1TJ3A

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 in a closed conformation
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sucrose-Phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Hydrolase
total genus 89
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1tj3A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1tj3A02
2Q4RA 4OD0A 3KBBA 1KYTA 3NIWA 5AKYA 4I9GA 1S8OA 3U7EB 4UM7A 5AKEA 2FI1A 2HEGA 3L5KA 4KX5A 3EWIA 3KC2A 3HYCA 5AKXA 3E84A 2YMLA 4NABA 5AKKA 2JGAA 4EX7A 5AKLA 3ED5A 3OCXA 1RKVA 2Q5EA 3QUBA 4ZEXA 1YMQA 3I28A 3E8MA 1QH9A 4UAUA 3AR3A 2WFAA 2WF8A 4YH1A 2BDEA 3B9BA 1YS9A 2G06A 1ZS9A 3ONNA 5AIAA 3NUQA 5AW8A 1WR8A 1QQ5A 4AP9A 4NAVA 4BX2A 1QQ7A 4Y2TA 3OCZA 5AM1A 5AI0A 1RMYA 4UU1A 2FPUA 3WKBA 1RC8A 4DWOA 5AVQA 2OM6A 3QU9A 4OFZA 2YMQA 4XPZA 1VJ5A 4F71A 4RESA 5ALSA 3DDHA 1YJ5A 1Q91A 4C4SA 5AI8A 3QGMA 1Z4JA 2R8YA 2FUEA 3FVVA 4JB3A 2EATA 1Z4MA 3R09A 1TJ3A 4HGOA 3QUTA 2FEAA 2O2XA 2YMMA 1N9KA 3AR8A 3NALA 5ALDA 2HSZA 3VAYA 5ALWA 1XP5A 3ZW7A 4AS3A 5AM3A 4GXTA 1NNLA 3ZUPA 5AK3A 1Z88A 2I33A 3L8HA 4KYTA 5AVRA 1ZJJA 4EELA 4NFLA 3WK9A 3QLEA 3M1YA 4Y2QA 1Z4LA 4UASA 1ZOLA 2GHTA 3E58A 3D6JA 3OTQA 2B0CA 3UM9A 3WKDA 3MMZA 2JAUA 5AI5A 2ZBGA 2GHQA 1Y8AA 3WK4A 2P11A 3OCWA 2P9JA 1L8LA 3W5CA 5AW3A 1CR6A 2YN4A 4BEVA 3DAOA 2JAWA 3L0CA 5ALEA 2C8LA 1RKQA 3QXGA 4Y2XA 1QQ6A 3KDPA 2C88A 2B1RA 4YIHA 5ALUA 5ALIA 3U13A 4ZEVA 3EPRA 2EAUA 5ALMA 3QUQA 3PGLA 2IOFK 4YIKA 1J8DA 2HX1A 2I54A 2GFHA 2CN1A 5AK6A 4IFTA 5AHXA 3QU4A 2GMWA 2RAVA 2ODAA 2BDUA 1Z4PX 3W5DA 1O08A 2AH5A 1NRWA 3IJ5A 1RDFA 4HGQA 1L7OA 1AQ6A 5AK5A 1L7NA 4UAVA 1RQLA 2CFTA 3N07A 4G9BA 3E81A 4J03A 4KN8A 4EX6A 2G0AA 1Q92A 1YV9A 2MSNA 1TJ4A 2IYEA 3N5KA 2G1AA 5ALYA 2YFYA 2C8KA 3KD3A 5ALQA 5ALOA 4G63A 5ALVA 3DNPA 3NASA 3AR2A 1RKUA 5JJBA 1X42A 1Z5UA 2PQ0A 5ALKA 3GYGA 5ALXA 3S6JA 1WZCA 4YCNA 1Z4IA 2G80A 4XQ0A 4YCMA 3SD7A 2JAOA 2BY4A 3PGVA 4XOUA 5AVXA 4IG4A 1RMTA 2B8EA 2I6XA 3AR5A 3ET5A 5ALRA 5IT4A 3ESQA 3ZWKA 2ZBFA 5AKIA 3MPOA 1RRCA 3FPBA 4H1WA 2PKEA 1U2SA 2HF2A 4I9FA 3A1CA 4FE3A 1SU4A 1YDFA 5AVSA 5AW9A 2WHEA 4YGYA 1NF2A 5AESA 4DW8A 5IT0A 5AI6A 4QJBA 2WF7A 5ALJA 2YJ3A 4AS2A 5AM0A 1L7MA 2G08A 4BNDA 1U2TA 5AKHA 3R9KA 3QU5A 1ZRNA 2AUTA 3FM9A 1EK2A 1VFPA 4Y2UA 1F5SA 2W4MA 3BA6A 3J7TA 3UMBA 2G09A 4CF5A 1TA0A 4UMEA 3A1EA 1LTQA 1XPJA 5AW6A 2I34A 4FYPA 2FUCA 1T5TA 3MC1A 4UMFA 2WF5A 2FPRA 3IB6A 2RB5A 3SKXA 3PDWA 2HCFA 2ZBEA 3M9LA 3SKYA 5ALNA 3AR6A 4CF3A 5AKJA 4EEKA 1ZD3A 3MN1A 3UMCA 4Y2YA 4CF4A 5AW1A 5AKZA 4O8CA 3WKEA 4UMDA 1YNSA 4Y2VA 1ZRMA 2ZBDA 4UATA 3U7HB 5A3SA 3QUCA 2IA5A 5E0OA 1EK1A 3FGOA 2FPWA 3N8GA 2OYCA 3ZX4A 4BEWA 1WPGA 2B8JA 5A3RA 3OPXA 4C4TA 1RPZA 2O9JA 3KZXA 2YMPA 5AW5A 5ALTA 2GO7A 4PNHA 5AI4A 5AVYA 3QX7A 3HLTA 5AW2A 2ZG6A 3OCYA 3L1UA 4NV0A 3WK8A 3WGUA 1JUDA 4DFDA 3RF6A 1WVIA 5AK4A 5AM5A 1O03A 3AR7A 3W5AA 2WM8A 4UMVA 4GIBA 4BKMA 3DV9A 2W43A 2CFRA 3P96A 3TLMA 1Z5GA 5FP0A 3SF0A 3WK6A 2CFSA 1L7PA 3CZ4A 3L8EA 2D2VA 2X4DA 3KOOA 1U7PA 2NO5A 4ZEWA 1J97A 5AW0A 2ZOSA 2P27A 2B1QA 2B30A 2OBBA 4C4RA 2FDRA 3FZQA 1VJRA 1Z4OA 4EENA 1RQNA 4OCZA 4UU0A 2HO4A 2R8EA 5ALHA 3ET4A 3L1VA 5ALZA 2HF7A 2YJ4A 3ZI4A 3AR4A 3ZVLA 1LVHA 2G07A 3QU7A 3WK5A 3L0YA 4OHFA 3RFUA 4L57A 3AR9A 3ZTYA 4KX3A 2YJ5A 3QU2A 3W5BA 2OA0A 3ZTWA 4JDPA 4HAIA 1SWVA 3L8GA 5AICA 2Q4TA 3N28A 2HDOA 2P69A 2FPXA 1ZD4A 3NANA 4EZEA 3EF1A 2DQSA 3FPSA 2HHLA 4YCLA 4BNDB 1Z4KA 4BYGA 2PR7A 1T5SA 1TE2A 5AW7A 4Y2PA 2NYVA 1MH9A 3L0BA 3WGVA 5AVTA 1IWOA 1T9ZA 2EARA 2VKQA 3U7FB 4DCCA 1PW5A 4J2TA 1U02A 2IOFA 2MU1A 1QYIA 3A3YA 3B8EA 4Y2RA 3B9RA 3WKCA 2W11A 3CNHA 3NRJA 2I7DA 5ALFA 4HGPA 4B6JA 4BBJA 3N1UA 3SLRA 2QLTA 2WF6A 1RMQA 3SHQA 3ZWDA 2C9MA 2IOHA 2RARA 3I6BA 2JARA 4FFDA 5ALPA 3I76A 1SWWA 1TJ5A 2NO4A 5AKGA 4CNQA 1XVIA 2AGVA 1L6RA 3BWVA 3K1ZA 4MUMA 4BX0A 4HGNA 5A3QA 3OCUA 4NWIA 3L7YA 3I1YA 2QYHA 3SMVA 3L8FA 1CQZA 4BX3A 4F72A 3PCTA 2C4NA 1S2OA 5AI9A 1Z4NA 4KNVA 5AM4A 2HOQA 4L6AA 4QQFA 3U19A 3IRUA 3ZVMA 1RLMA 4HYTA 2R8XA 5AVVA 4CE6A 3QNMA 3ESRA 1K1EA 5AIBA 1ZD2P 3UMGA 3U7GA 1ZD5A 3EF0A 2WF9A 3NAMA 4KNWA 4L6CA 3F9RA 4E88A 4UW9A 3U26A 3R4CA 4RETA 5AM2A 1N8NA 1RLTA 5ALGA 5AVWA 1L8OA 2YY6A 2AMYA 3ZU6A 1U7OA 3WK7A 4XE5A 4Y2JA 4Y2SA 1RLOA 2B82A 2FPSA 5T41A 2R8ZA 5ALLA 5AVZA 3ZX5A 4UM5A 3A1DA 2YBDA 5IS2A 2HI0A 3WKAA 5AVUA 3ZVNA 1Z4QA 1FEZA 2YJ6A 2ZXEA 4HGRA 4Y3UA 3QYPA 2RBKA 5AW4A 3OCVA 4UARA 4MWOA 2I55A
chains in the Genus database with same CATH superfamily
3HB7A 2E87A 2ANCA 3KBBA 4DPMA 3HGQA 2ZB7A 5FWYB 4CKXA 2QPAA 1HF3A 3B1ZA 5AKEA 3KKEA 1E89A 4XGQA 3QVGA 2AZDA 2XE8A 4RDHA 1AKNA 4MQMA 4CVNA 3GTOB 1PZNA 1SXJB 3IAM6 4QFMA 3VTKA 1FYWA 4DEYA 2WLTA 5EHQA 3KCQA 3RVKA 4EX7A 2EX0A 3G1TA 3Q2KA 1GEEA 2H16A 2XWBF 1X8XA 2OV4A 4QE3A 1J00A 1V5GA 2C82A 4DMRA 2MYPA 3AR3A 1KWKA 1BOFA 3MT9A 4MKIA 4TQUS 3Q2IA 4CV3A 3TH5A 1YL6A 2PVSA 1WUYA 3RUFA 2X40A 1T9DA 4MH0R 3MQ2A 4HRAA 1ETUA 3HDVA 5EQDA 3TE6A 2R68A 4I4TB 5EWLA 5JCOC 3CWCA 1ZLYA 3DEYX 4A8JA 3AUUA 1FLDA 1YUBA 4MB6A 5EKXA 2HA4A 3VDRA 4WBNF 4DQDA 3K16A 3U48A 4ZEMA 2BEWA 5CYPA 2PL3A 1P2BA 3AUKA 1E6WA 5L3SA 4G6ZA 4XOIA 3AI3A 3HM9A 2D7DA 1YKFA 1YS6A 4GKKB 1R9TB 2NZYA 3QWAA 3EEQA 5LDHA 2BFDB 1YRLA 3GZJA 2OM6A 3L06A 4ZVNA 4OFZA 1JB9A 2PVPA 3NYQA 4XPZA 4J0HA 1M2KA 3RS2A 2A9FA 2AZ4A 1H2RS 2FUG1 2LBPA 3DSRA 4IV5A 4IXMA 2JJMA 4EF5A 1P0MA 2MWMA 1XEXA 2QJTA 1XA4A 3MQ4A 4MWDA 2HV9A 4QDKA 2F3PA 3SFTA 1GQ2A 1ZI9A 1QK4A 4S0XA 1F6WA 2JBAA 1LXCA 2B21A 4NVRA 2VC2B 2VXOA 4EMTA 5EIOA 4UEQA 1KMHA 3MGCA 4EQ6A 3UGQA 4V02A 2ON6A 1R15A 1EQAA 2HA5A 2IDZA 4C07A 1ZK0A 1XF9A 3ZR4B 3EVGA 2B0JA 3EY9A 1C3VA 1AG9A 1XAGA 2J5BA 3B5IA 3NBUA 1D2AA 4IDDA 3VBEA 2NU6A 3WLNA 4LI0A 3T1YB 3GEIA 5T7BA 4RVOA 1Z2CA 1IRIA 1OX4B 1Q12A 2I8LA 5KBYA 4EYKA 4GXTA 4HDMB 1HKHA 3ZUPA 5ELLA 1G1MA 5AK3A 3FUUA 4BATA 2IH4A 4MGYR 2YR0A 3O3MB 1JZSA 4N54A 1HZZA 2HXGA 3KKZA 4YONB 3T4XA 1WCIB 4Y2QA 4EG6A 3RKRA 1ODJA 3WSTA 2PX4A 1AO0A 1EX7A 1X1BA 2F1KA 3NBFA 4PGHA 3IMEA 3T7SA 2HA6A 3BGSA 1UPCA 2B3DA 3ZDFA 4RVGA 5E6UA 3VJMA 3AV3A 1ZLXA 4Z51A 4P83A 4MHTA 1SQ6A 4UDYX 1CDZA 3MMZA 1BROA 3VR5A 1ORIA 1T24A 2GHQA 3LBAA 3PGKA 3ZBUA 4P4SA 2B4QA 3UTDA 4EBFA 4OI4A 2OSVA 4LZLA 4QUBA 3X43A 1ID8A 3H42B 4NYJR 1FQJA 4UULA 2B7BA 4GT1A 1D1SA 3IV7A 4TQGA 3U3KA 4B87A 5ICEA 1E2PA 3JWHA 5CBPB 1SBTA 3DT9A 4QYSA 3JYLA 3L0CA 4WASA 1IB6A 4JL5A 3PDHA 2O8CA 4EEZA 3Q7IA 2VATA 1ZMRA 4U2FA 3SIWA 3ZDRA 4EQZA 4KXYA 1NNUA 3D54D 1BD3A 2GN2A 3G88A 3NR2A 3PRHA 4Q0MA 4ZEVA 5C8ZA 1ILEA 3MIZA 2FG6C 4I8XA 4KQWA 3R1IA 3PUKA 4US1R 4RFLA 2HQRA 4Q1DA 1UIMA 3ZE7A 1YZFA 1TYDE 4LGCA 2CYAA 2JK1A 5DLEA 3KBOA 5B12A 1RNLA 4JI7B 4QASA 1SXJC 5TT1A 1EXWA 2JRLA 3ER9A 3MCUA 2FPPA 2NYUA 3KQSA 2QAIA 3EPHA 2CSUA 1WQ1R 2X41A 2HRDA 2GEBA 5AK6A 3DTTA 3PWSA 4M7WA 4WJKB 1QH0A 4ZD6A 3BM5A 3MHTA 1Q77A 2BYTA 3LX8A 4K26A 4IJWA 4PBTA 1N6OA 1YRYE 2WILA 1RDFA 4KJZA 1XQ6A 2VXYA 1XZGA 2P4SA 4O02B 2VDOB 2B4TO 3MAGA 3NVKI 3GMSA 2ZYSA 3P9XA 1H65A 4ZI7B 3OQHA 2FPIB 4V2UA 2X0FA 1FDSA 5L4NA 4CLRA 3EGXA 4F97A 3IULA 1NPYA 2QNIA 2FZCA 1UIRA 2O3SA 4XQ9A 5A9SA 2OECA 3I4CA 3N5KA 4EJFA 2HLHA 4CM9A 3TIXB 4ZI3A 3JD2A 3Q6MA 1M2GA 2HLNA 2PMKA 1ZY2A 4B6PA 2Q8PA 2GZRA 4K9DA 1VL1A 4BZWA 3KB6A 1YB4A 1NFFA 1FYXA 4IHJA 1BXRB 4ETWA 1BX1A 3JR7A 2QPLA 2AHRA 1GL3A 3O47A 4I2NA 4K28A 4FXOA 4DLLA 1WW3A 3ESAA 2IPNA 1LPMA 2HHJA 3LUAA 4GM1A 3TLGA 4ATNA 1GUZA 1K86A 3Q9UA 1CJMA 2VA8A 5AO9A 5FOUA 3N2GB 4OYHA 1BQ3A 1HDEA 3KWFA 3SD7A 1HORA 3CONA 5IKMA 5FBLB 1F4PA 4F8YA 5MFPA 4BX8A 2GYUA 1KEKA 2HPAA 2V65A 5FHQA 1N9GB 5TR9A 4URVR 2E2WA 1MAVA 4Q3CA 3VZDA 1XGKA 4DF3A 5B3LA 3INRA 1THZA 3K6JA 2BSQA 2AE2A 4UC0A 3RUEA 2AKAB 2OFOA 2Q2WA 4KGDA 2ZBFA 3JYOA 1ZO8A 2AC2A 2Z57A 5G0TA 1G8SA 3ERCA 1MEEA 2EEPA 2IHNA 2QYSA 3IPXA 2VIIA 4JOBA 2IF2A 2YTZA 3VU9B 2UXBB 4F21A 4IILA 1T9KA 1ISFA 1MG0A 1JIXA 3OZTA 4U39A 2HA3A 2HV8A 2X22A 3I2GA 4F2WA 3K70C 1GPNA 4W7IA 2DTEA 1JG3A 2QF7A 2XBLA 3ICPA 4KQEA 3IEPA 4AB1A 1E1YA 3R5JA 5AESA 2C2GA 3CCBA 1P7ZA 1NBHA 1WXHA 5H0IA 2XF8A 5ALJA 1E5XA 3HP4A 1K66A 5JYCA 3UPDA 2QLBA 1I7NA 2PWPA 3KZVA 3TSWA 3OQMA 3PG5A 1T3TA 4ZI5A 1ZU4A 4QBIA 2W4MA 4II7A 5EEHA 1CJSA 1FTNA 4V1CI 1Z6AA 4BLPA 3ZXYA 4BMDA 4L27A 1L5ZA 4BMOB 3FDIA 4G5SA 4LJ8A 4P4TA 1PRYA 5B1YA 1ZQ1A 1W4CA 2ZSHA 4C1NA 2VYVA 4ZMSA 2ES4A 3KR0A 1K08A 1USIA 1OWOA 4LF4B 4KV7A 4YV1A 1F2UA 1Q50A 3D64A 5FA8A 3LYHA 3F8SA 3R5TA 3PEVA 3X1KA 2YWGA 1AQJA 3LHIA 2AMVA 2HCFA 2V7VA 5JVDF 5IPFA 1AXRA 4BKUA 1II8B 1AS3A 2XWPA 5IDYA 4B46A 3QPUA 3GOHA 1RU3A 1QG6A 3H97A 5HKKA 2NP7A 4V0QA 1J8VA 1WLYA 2BP7B 1ZESA 2N1MA 3SZUA 4B3JA 3AY3A 4OLJA 4C5AA 4ZQFA 4Y2YA 1NNI1 1Z13A 2G77B 4GICA 1OIWA 5EJ6A 3PHJA 1Q83A 4WOBA 1SKUA 2B5WA 3DXFA 3GHHA 1DG3A 3GLHB 2B4RO 1KVUA 1D07A 4FOTA 1JT2A 2J3QA 2K2QB 4PYOA 3CUKA 4I5IA 1YFJA 1H9BA 4DREA 2PY6A 3E5RA 1WLSA 3I4MB 1BEZA 2PRZA 3DVSX 2OG1A 4GYJA 3QKIA 2ZSIA 1QRSA 3ETJA 2AOVA 3I4LA 3ITEA 3FOZA 1CZNA 3M1IA 4TRNA 5K0FA 1VMAA 1A5AB 2EBWA 1EK1A 5E0OA 5KTMA 2Y1XA 3QY9A 1T35A 1TKAA 1FYVA 4MVCA 5IZCC 2JAQA 3GR6A 1WB4A 4ZV7A 1OVMA 1HMPA 5IASA 1M73E 3EVNA 1XDGA 1XTVA 2ECPA 5D86A 4I36A 1Z3IX 2OFFA 5CDGA 4MR9A 2O7VA 2JLQA 3WHLA 5DX8A 4WA7A 2E89A 2H54A 4BNLA 3ACCA 1H4VB 3PQ5A 1GVHA 2PFKA 1OLXA 3ZG6A 1LRLA 1T2CA 3HLTA 3LDFA 3M6UA 2ZJFA 1ZOOA 3RE1A 3T5GA 4HDQB 5AW2A 5LYJF 4JGGA 2C4UA 3WGHA 3S1SA 4V24A 1MF7A 4PFQA 3S1NB 3GG9A 4MV7A 3V8QA 5BWLA 1V6SA 2FWJA 2YVQA 3KE9A 3LHSA 3R44A 2O8FB 1ESZA 3CHYA 2WZDA 2A14A 1D2NA 1XD8A 1TQ2A 2FHPA 2JS7A 2QMHA 2HPVA 1RPAA 2VAXA 3R3ZA 1U98A 1RQRA 1ZWLA 2QD5A 3EDYA 1ACMA 3OM1A 5GV7A 5JWHA 1IBRA 2VH2A 3BZBA 3GB9A 3OLZA 2X0NA 5EPUA 1LDMA 1B3RA 4NJOA 2PO7A 1BDMA 2OLKA 2P1RA 3DFFA 1PUXA 1XYVA 2ACEA 4G4SO 4P2BA 3RG2A 5KEIA 4UEOA 3M6WA 3A9WA 3WGQA 2G4VA 4G5XA 1SIWA 4Y2GA 1VDMA 3WK6A 4E4YA 3LLCA 1GN8A 4C0AC 1C3LA 3LFUA 4CU5A 1UDXA 3DE3X 3K73O 3AESA 4NEQA 1ESEA 1ZRHA 1FUEA 1XRMA 4C2BA 4C0WA 4OLBA 1HE2A 1QF9A 1TKBA 2GCGA 2Q3LA 2ZYTX 3IQWA 3ZV4A 2WPDD 4R0VA 1V4NA 3EWNA 2Q9AA 2MSCB 2W2VA 1BTOA 1ZAKA 1S3IA 4WADA 2XDQB 3DZCA 2QTVA 1NUQA 3N2IA 3QLTA 4CT4B 4R9SA 5JJ5A 2O5CA 4AKIA 3BXGA 4F60A 4LVCA 2B8WA 3ZHYA 4ID9A 2EW8A 3PNLA 4HT3B 2YJ4A 3QE4A 1SUSA 2CDAA 3GDFA 2OUKA 2V7UA 4WT7A 3ZVLA 3AHJA 1RWMA 1J33A 2PKWA 3W2EA 2OD9A 1Q1AA 3WYNA 2R1TB 2GWHA 2WHXA 3QTBA 5DYIA 1Y3DE 4KXMA 3C6XA 3GJZA 3SZLA 4L57A 2PH3A 2YJTD 4KN6A 3IAM1 2RI1A 2KBFA 4HDRB 4YLEA 4YO7A 4Y6RA 2WD7B 4ND6A 4DLVA 1C9KA 1PJLA 3KL2A 1SKQA 1OBCA 2ZREA 3C5CA 1UWVA 1P9LA 4ND1A 1FNDA 2FEMA 2RJNA 3FGPA 1PK7A 1I6HB 3U6KA 4NK5A 1IBSA 3CR8A 1KZGB 4HDNA 5LSAA 1J42A 4QUAA 1FW8A 1E18A 3IE0A 2OFXA 3QX8A 3WLLA 1U5AA 2FPXA 4EJ2A 2ZT8A 3LPCA 3EF1A 4PZZA 2VI5A 2C0QA 3P0EA 3VI4B 1FJHA 5DN6D 3TLYA 1PFVA 4HJXA 1TIPA 5CH3A 3PQCA 4W8HA 4DG8A 1EYZA 2BN4A 2FSVC 1KH3A 2IYPA 2V1XA 4INPA 3WQRA 4MVJD 4JQZA 2ESRA 2B36A 3X1YA 1SQ5A 4TWZA 3D6MA 2QN2A 3P9RA 1UM9B 3QMMA 1W36B 1IJBA 4J1TA 2N46A 4UE3S 4D9JA 4FYXA 4J94A 5K2MA 3ASZA 4HQOA 1DC5A 1O95D 1TT5B 2V6BA 3M2TA 1O5OA 3ZKAA 4J3JA 3GLQA 2EFCB 1EVEA 3ESXA 1I10A 4NX2A 2LW7A 3FKSD 2CK3A 1HC7A 1KYWA 2YYAA 2Z8XA 1ML4A 2WU3A 4XR9A 5C3UA 2BI8A 4DC1A 3OQVA 1CVRA 2OHXA 2PWYA 3BICA 3C1UA 1P7YA 2B4AA 3I6BA 1EJ6A 3OPMA 4RCYA 4TPKA 2EKDA 4U0KA 3PK0A 4UXHA 1N3LA 2FMHA 2D4HA 2WG2A 3GVCA 3RTCA 4QPJC 4D4KA 1EDDA 4MUIA 2V9CA 2NO4A 4MVJM 5B7PA 1QU2A 2I1LA 5EQFA 1RWBA 4YUAA 3WWOA 4FSHA 1KQNA 4MP8A 1YZTA 2IKQA 1NJ8A 1PZXA 3G8CA 4GG1A 3SNKA 1TM5E 3AUTA 1EUCA 1WEHA 1JSXA 5E7MA 1KH1A 3ROXA 1YE5A 4PS0A 1X1AA 1JSCA 1SY7A 2ZGVA 4JBYA 4M9QA 1QQBA 3FWPA 2WM2A 2XQJA 2C4NA 3GLFB 1V3QE 5L7YA 2FSFA 1SIOA 3JQ9C 3EUEA 2XZTA 2OP1A 2P6MA 3AIOA 3IH5A 4FGUA 4IFBA 4L15A 4CQMD 2XAAA 3VDNB 3FOFC 3F73A 3QBTA 3AF0A 1FDOA 4FQ8A 5DB4A 3TW4A 3N8IA 3IR7A 2AVNA 4YAJA 1WXFA 1G291 1GWNA 5HKLA 3IRUA 1R4MB 1XQXA 1U7TA 1EVZA 3AX6A 3Q87B 2INGX 2IYNA 4HYTA 1R8SA 2VDQB 3GEMA 4YR7A 5LQNA 3MWKA 3UMGA 1VCMA 1I2AA 4CLXA 1N6HA 1P2SA 3K6KA 4JFAA 4M0PA 3NAMA 4MKXA 4C30A 1E3DA 2XKKA 3ZS8A 1M7HA 3R4CA 4MKZA 4ITRC 4QNNA 5DWQA 1N8NA 1KZ4A 1L8OA 1VL6A 3T3GA 1XCLA 3TQRA 4Z53A 1VHDA 2G82A 4XE5A 4QDUA 3KVRA 1GQSA 1M33A 2H4HA 2VHWA 3ETNA 1E9DA 3OZXA 3ROEA 3T94A 2NV6A 2J7PD 4PLWA 4KRXA 1B6RA 1SVKA 3QVJA 1JSRA 2PX5A 1Y5MA 1GNVA 1Z08A 4FBMA 1QGAA 2QSUA 1F3OA 1E8NA 3CEMA 2QXYA 5TF4A 1PP4A 1SNYA 2FZ5A 3IVCA 1AKWA 3OFNA 4LYJA 2BJHA 4OBXA 4W8OA 3VZSA 1S4MA 3LI2A 1SHUX 5FPTA 3DCNA 3GX1A 3OPQA 3RSOA 4QQRA 3NHFA 2DT5A 2A92A 4GQAA 1EESA 3HOWB 3NHPA 4REQB 3UPUA 4UM7A 3GEDA 3Q9SA 5GY7A 1FB5A 2DBZA 2AUMA 2FI1A 3BHJA 2ST1A 4CQLB 2RCNA 1G6Q1 3GLUA 3ZHXA 2DUMA 3IP5A 1OH5A 3GTPB 5KO2A 1KK3A 2Z9DA 3VKFA 4UQLA 2P2NA 3QUBA 5KB3A 5AXAA 1JFLA 2J5KA 3H9JA 4BUJA 1M6YA 2D1RA 5FAKA 3PE3A 3R9IA 3OJLA 3V4SA 3NIFB 2WUGA 2VTEA 3OZVA 3TIGA 3Q15C 1GTZA 1UWKA 1EP9A 3D2CA 4WINA 2JVIA 3IMCA 2PMEA 2V55B 1FS6A 3ONNA 4IXDA 1W36C 1H3EA 4G8JA 3AM1A 1DEXA 4B4UA 1BEEA 1OA0A 3W2IA 1DC3A 4R1LA 1BMDA 2OAP1 1Z18A 2H2DA 3TZBA 3JATB 2JD2A 5K8VA 3ZH9B 1E3WB 4I50A 2FQ1A 2XYQA 1ZGBA 3CYFA 1XZFA 5GTDA 3R0VA 3AZOA 1EFLA 4WL0A 3JD1A 4WOPA 2LR0A 3LA8A 2JA8B 1RM0A 2JK0A 3BJIC 5JDCC 1IMOA 2R751 3C3DA 2XWSA 3BKXA 4ARVA 4KSBA 4AP6A 2QRPA 4UJ3A 3SJUA 4LQ4A 4YAUA 1KTIA 4MI3A 3ZW8A 1T6ZA 3N59A 3DDHA 2IYXA 2NU7B 3DE4X 3MTBA 4EJSA 5DI3B 3F7TA 4JL6A 3BK2A 2ENUA 4OMFG 4C2TA 4BGEA 1T9CA 2QN8A 4C2UA 3G23A 1RHJA 4KFUA 2WFZA 4CM3A 2XUAA 1K6MA 3GIDA 4LE1A 4M99A 3TSZA 2FEAA 3P4UA 2JA1A 4OY3A 1X1DA 3WISA 4NHEA 3IDOA 1RM4A 2QM8A 3KHTA 4BJ1A 1H4QA 4P8RA 1G4HA 5BR8B 1ADFA 1T6NA 1CQXA 3TTSA 4A4DA 4EPYA 1G5HA 3VAYA 2AOUA 4TM7A 2CMHA 1VSQA 2C95A 4WZAA 1IXSB 2CLSA 1KP9A 2ZCUA 3K0EA 4P5EA 4OXXA 5C1BA 2WU4A 3VSCA 1WMBA 1AV7A 4HR7A 3GN1A 2WT8A 1OXBB 1EXDA 1JAXA 3O6VA 2YXPX 5HUJA 4D0RA 3WJ2A 3FCEA 4Q9LA 4CTNA 4ZREA 2V54A 3OCJA 1LBSA 4BBZA 5F4ZA 2J3LA 3OTQA 2DB3A 3EAGA 1Q0RA 2E4ZA 3P1JA 3OE7A 3QFCA 3ZU4A 5L3ZA 5AJYA 4FMCF 2A1UB 1FFAA 1WBJB 3U9SA 4Q3KA 2QG4A 5LB2A 4W9MC 1A4RA 1C3OA 3AL2A 2XQFA 4TTIA 2QDKA 4BQSA 4IHJF 4PR0A 3IMKA 1KE1A 4ARIA 1SFOB 1PN3A 1U80A 2JIPA 3HMKA 4MV8A 3G8AA 2EHJA 4BAGA 1QV7A 2OAGA 5CT5A 1QQ6A 1ZPDA 5BN3A 3VPSA 4XJXA 3KDPA 1RCTE 2AD1A 3ZWWA 4DLZA 3DTVA 3I2FA 5CB6A 2FFJA 1JLLA 2N9UA 4MRMB 4LXQA 2VHJA 3L2OB 3LVQE 4DWJA 1B8NA 2A88A 3FRHA 5JI2E 1KDRA 3SHTA 5M2QA 1U8XX 4Q9NA 3MRSA 4GZ3A 5BOSB 2C9OA 2DH5A 2OEPA 3K2QA 3P8ZA 1RKBA 4QHTA 4AJLA 2QL9A 4R81A 1T5BA 3F1KA 4PCLA 1UP7A 4RF3A 5FF9A 2BMWA 2PUEA 1I5RA 2FFAA 5KVQA 3PYMA 3T0GA 1Z75A 3ZIAD 3K1YA 3GWZA 2BGKA 4IFTA 3IPAA 3R6DA 4TMFA 5EOVA 4MRAA 1VPLA 4D81A 1N5JA 3JYNA 3M9WA 3K1AA 2IC5A 1MORA 4CQMB 4BC0A 4GOJA 3CVOA 1A50B 2M6SA 3H7AA 1M7GA 4CBVA 1ND6A 3H2IA 2Z6UA 4AN1A 3CWZA 4LV5B 3EVBA 5HCUA 3LH5A 3OT4A 1OD6A 4HXGA 1DRKA 1ZNZA 1GTL1 4GXNA 1L3IA 3LW8A 4PZLA 5BSEA 2D3TA 2L17A 4GI3A 4AZ0A 1MB0A 4DWVA 3HB0A 2JJ1A 1VJCA 2QD4A 4ZQIA 1R74A 3HYNA 5CDFA 2VK4A 2CV2A 1HYBA 2P3QA 1N6KA 2R48A 3DVLA 5ALQA 4N12A 4J2HA 5EN4A 4KN5A 1V6CA 5LMCA 3U0VA 4UZSA 4AMVA 4RY9A 3H99A 1LLCA 2PS1A 4RM2A 3WWPA 4POOA 5JXHA 5MN5A 1E8DA 5H80A 2WJWA 3U3OA 1NJ1A 2B78A 5K1ZA 2ZTLA 1YZQA 2I65A 4OQPA 4DYHA 1WD5A 3P2JA 3RYIA 4DNPA 5E6RA 4LF9B 1ONBA 4NAUA 3TGPA 1BXKA 4D4IA 1JFRA 2OQ2A 4ER3A 2V74B 4PANA 3Q3IA 2OSBA 3E1SA 3FWZA 3EH1A 3RTEA 1UKYA 2Q41A 3TLXA 4FIDA 3BJZA 3CLTD 4CMEC 1H66A 3I01M 3CXRA 3L8MA 2DT8A 4GR4A 3ET5A 5IT9A 2A8YA 2E21A 4Z8XA 1HEUA 4BY1B 2BONA 4BO1A 2ODPA 4AMUA 2G1UA 2OD7A 4U8HA 4PFKA 3BE5A 3VOAA 3RBZA 3QYAA 1CY4A 3RUPA 1GPLA 1NMEA 3C3KA 2GEVA 3PNVA 3N39C 4HBGA 3E53A 3TNJA 1F4VA 2H1CA 3I9KA 4YP1A 1IZZA 5LJLA 5AVSA 4J0IA 2VBCA 3CEAA 2ATVA 3HOXB 2JFVA 2X9NA 2G5CA 3ISJA 5E7QA 1V9CA 3BDIA 4O0MA 2R5WA 3OZUA 4JP2A 4X5OA 3U4HA 2EBFX 1QHIA 2GS9A 4CIXA 3B3FA 5AOCA 3K6SB 4I55A 3UVEA 3MS7A 2OO5C 2J08A 1TKRA 5G1OA 2R87A 3DV2A 4B7XA 3B6JA 3K8OE 4C1BA 3VR6D 4DRYA 4GVXA 3RASA 1QRDA 3L6EA 1I32A 4WNCA 2BFEA 1XRQA 4OQEA 2R6R1 3KUXA 1TA0A 3FNBA 4NP6A 2AFIE 1Q20A 3A1EA 3H0GB 4PXSA 3UAWA 4BNGA 3L7DA 3LY7A 1N2OA 1UFKA 4TMYA 1U28C 3RAJA 3VV2A 1U5BA 1A69A 4Z9AA 1GPWB 5FAXA 2WF5A 4F92B 4H17A 1HA3A 4FT4A 1T4MA 3UXYA 4FGLA 4MR7A 1T10A 1P0FA 2A5GA 3E9EA 3PDWA 4IZHA 3MWEB 1GAWA 3T61A 1ZM4A 1YQEA 4RQTA 3HKDB 4BNVA 1NBOA 4CM8A 1IUOA 2VP3A 4B6QA 4G0UA 1Z29A 1S01A 4OXKA 4M1MA 1ZVMA 2EJBA 4R8KA 3KQUA 4LFBB 4M1ZA 4OKIA 3DNMA 1T4BA 1IQPA 3GT7A 1GR1A 2EW2A 4YUVA 2X4LA 5FWNA 2HXSA 1IXZA 2R7ZB 2H07A 4N5MA 2XLBA 1T1RA 1WXXA 4R5HA 2VL7A 2ZRIA 1X7YB 4Q4JB 1ZCZA 3USES 4A3DB 3SVLA 4Q3OA 1SXJE 2CNWA 2HUNA 3WBBA 3ZV5A 1RW4A 4HVCA 2ATCA 3LKZA 5LP6C 2O8BA 4IGFA 4OXQA 1KI2A 3TK1A 3WNVA 3ELYA 5HNKA 1RHQA 2JEZA 2V6GA 1U2DA 4R40A 5HIKA 1T5HX 3HV0A 2VJAA 1D4AA 1Z6TA 3EBOA 1JS1X 3L4BC 3RODA 4C7MA 4PYKA 1KMMA 1WHTB 3E03A 4X44A 4EG5A 1FUKA 4HS4A 4UOEA 4DJFC 3IOEA 1QVRA 3KB8A 4N0PA 1R9GA 3V3TA 1H6AA 1NSYA 1PF7E 2DPYA 2ZE6A 4UPEA 3CPJB 5I4KA 5EYPB 1G8KA 4QEDA 1J2EA 4V0RA 1EM8A 3B9PA 1O5IA 4NBNA 2FN3A 2CXNA 3DEIA 3GEHA 1OQAA 2BMJA 3ULKA 3N8KA 1NV8A 5J4HA 1BDBA 4ZT6A 3K53A 1NVKA 2HK6A 4DMCA 4YRSA 1KSHA 2BELA 2WTXA 3ANNA 4NOKA 5DP2A 4W7SA 1EX1A 3GELA 1U1CA 4US0R 2LP4Y 1TMGE 3IS3A 3K32A 1JUDA 2CCJA 3IUBA 4RD6A 2AVDA 4PSVA 1P62B 5CDTA 1AQNA 3RYCB 5J1SB 1B73A 5BYJA 3QE3A 2IEAA 1N5DA 4F2GA 1ZUNB 4HGYA 2YHUA 1GZ6A 1J09A 5EXXA 1Z0AA 2JFFA 3JARB 2Y93A 1KBZA 2K2WA 5TPWA 4X8MA 2JFBA 3R7LA 3D6NB 1TA9A 4ZYTA 4ENQA 3GUZA 3CUVA 1IVSA 1L4EA 1RHUA 4IHAA 5BNIA 2D0DA 1Z5GA 3KSAC 3R7DA 1KY3A 1NASA 2FKNA 2X2OA 4CQJA 4KBYA 5BUCA 3D0OA 2C7OA 1NXOA 2C2KA 2WT4A 4RBNA 2HGSA 3OUTA 4M60A 2IPAB 3CN7A 1JAHA 1UXGA 4NJEA 4P54A 1ZZGA 4I9HA 4EKNB 5JMPA 5IZCA 1X2BA 2O2HA 4GMHA 4E5MA 1PL8A 2LIPA 1X3SA 2BGWA 4I8DA 3MAAC 1U4OA 4B48A 2H7VA 2R79A 5DP1A 3RF7A 1F2VA 4LDZA 4B9EA 1DQZA 5DJ5A 1SB9A 4RVSA 2I7XA 1D0SA 3EZNA 3LM8A 2ZRCA 4Q24A 2QY9A 3D8RA 3EZGA 4PC3A 5AJWA 2ZSDA 3BTUA 5JZVA 4LSZA 2C9YA 2LNDA 1M3SA 4I66A 3LGSA 3AB8A 4LMBA 2X4IA 3E7DA 2RHGB 3LO8A 4GO1A 4P92A 1L4KA 4FS3A 4PLFA 4ZVVA 3THWB 4ZJZA 1VHTA 2HKIA 1JR3D 2XB8A 4G65A 2AOTA 3P52A 1K0FA 1XU7A 4LMRA 1U3DA 2VT6A 4IJVA 4RVHA 2GF9A 3QPCA 1P9RA 4AZWA 1ZUD1 2FY8A 1H2XA 2VNAA 1FX0A 3FTCA 3PNYA 3G59A 1AXGA 1II9A 4KX3A 1F14A 2QJRA 2YW2A 1D1TA 2H31A 4DCOA 3HKBA 2FN9A 3V9PA 5DNWA 2R4QA 2B4KA 3DZJA 4R3WA 4XVQA 3NBAA 1U7WA 2QTAA 1BE1A 3T12A 1NKVA 1GARA 1QIKA 5E8RA 4XQCA 5HFAA 4DRXB 3UKJA 3ZE2B 2FEPA 1RC0A 3EVDA 3L0ZA 4HVTA 1ZINA 4X92A 3GY0A 3UAXA 3UG6A 4IQ4A 1RXVA 4KRGA 4DLBA 4M76B 5F64A 3S1AA 1GRVA 4OQLA 4YWJA 1NT2A 2Q5QA 3GRPA 3L0OA 1W4BA 1SULA 1E7WA 3ZWQA 1FMLA 3E8SA 1Z15A 2QE6A 4QLOA 3L0BA 5HJ5A 3S16B 4IEEA 2X8JB 2F2TA 5CNJA 1Q0HA 1ZEMA 4AKHA 2VKQA 1EEXB 3BGDA 1RI3A 4DAOA 1OIXA 1BFKA 2PZMA 2MINA 3TQOA 2XT0A 5I45A 1H9CA 1KU0A 3E15A 2PCLA 1X9IA 1CUUA 3OOHA 5ANRB 1ECLA 4XYBA 4D2IA 3HCFA 1GN9A 3LVFO 4D4GA 5E4TA 2JGDA 3DWFA 3O8LA 2ZJ6A 1YTLA 1L5WA 1JA1A 1QZUA 2P77A 2P8JA 3A1WA 3NM4A 3OY7A 5D3MB 4EKEA 1CYEA 3QLVA 3U7QB 2WF6A 5LMNB 2ZSAA 4ER6A 2OXFA 1HFKA 3E82A 4OHVA 3C7CB 4DA9A 1FVXA 4CUZA 3Q3EA 3JZDA 3T1NA 5JLJA 4YRQA 1C80A 2JARA 1PZGA 1G19A 4QWMA 3U4QB 1W9HA 2PE5A 1G20A 3RZDB 4CMIB 2OO3A 3VISA 4IQGA 3K7AB 3NXKA 5KKCA 1YBAA 4CKBA 3BJMA 2FDXA 2WR8A 1G7TA 4NOJA 3TXYA 3A9RA 4QARA 3UJAA 2VLIA 5A3QA 1FMCA 2J3EA 3WLHA 4H7PA 4ETIA 1PV1A 3PUYA 2O4UX 2LRHA 2WTAA 4IIHA 3M3HA 3QV2A 4MKFA 1H4SA 4YJDA 1IJKA 1CDDA 4EZBA 2ZJ3A 5F3RA 1G5QA 1UXOA 4JYMA 1FS5A 3IHLA 4WECA 3G85A 4DG5A 2EYQA 2JH8A 3P9CA 3OQIA 4W5HA 1J9EA 2HOQA 1U7XA 3AGPA 4E5UA 2NU8B 2DJ5A 3DONA 1CTQA 3I3SR 1UDAA 4E08A 1LF0A 2GJ9A 4EY3A 2BRUC 2HSGA 1P0IA 2CDCA 2F9FA 2GPAA 2OC4A 3FYCA 1ZD2P 1KVSA 4V0LA 5HKOA 3LV8A 3MTEA 4E88A 3R7WB 4B33A 3J81k 1EA7A 2YINC 4P98A 5CB0A 4I50F 1FQKA 2O2IA 1VZ2A 5DNEA 1D3AA 1KDPA 4KJXA 4QQ8A 1MGPA 1A9ZA 2YY6A 1JG1A 2ZU0C 1XJCA 2GN4A 5F76A 1L5HA 2DH6A 1RLOA 3BULA 4TTQA 2H4XA 4KQXA 4Y2SA 5AR1A 3MZ0A 4ITUA 1Z7WA 1KY2A 3U56A 4J1QA 4UM5A 3AEUA 1HLGA 1XZHA 1PJAA 4B74A 1POWA 3C5VA 2FG7C 4HB4A 3WIVA 1HTWA 3HVUA 4XFKA 4B7AA 3UAOA 4M8KA 1T13A 1EUYA 3NVAA 4QHYA 4UBJA 4EP1A 3AF1A 3LKVA 4PLTA 2H1SA 2DZDA 4DQLA 5D87A 4YJ2A 2VUMB 3RROA 4G25A 2YHIB 1ODTC 4W1PA 3PWZA 1U4SA 4URUR 4ZHQB 1GYPA 1DAMA 4TROA 1QE5A 1WW2A 2VF8A 1P7PA 2XRMA 5C5DA 2UYHA 3BCUA 3CZCA 1GQFA 1Q2XA 4RKWA 2DQ4A 3MD9A 5BSTA 3P9KA 4A0GA 1J39A 2ZANA 1ULSA 4B3FX 2W58A 3TNYA 3NWBA 2Q0HA 3E84A 3PGMA 4FFBA 4N82A 3CMCO 3DZKA 4A26A 1KQOA 3A0RB 1PJ4A 2I4NA 4MYRA 4ARAA 1UKVY 1VJGA 1Z45A 2FOXA 4ZEXA 1QLHA 2BEUA 4JFRA 4YUYA 5KTYA 5L53A 1YMQA 3LO5A 3WS7A 1G8PA 1EWRA 2VSXA 4PGGA 1PJCA 4IIJB 5BXYA 4I81A 3S2UA 3OIVA 2JH3A 2NQTA 3K0FB 3R8CA 621PA 3K0CC 1U3TA 4S12A 4A0FA 5ESRA 1ZS9A 1P91A 3U81A 1KRWA 1DCKA 5JYBA 5JISA 3QWBA 5FL7A 1CZLA 4P84A 3P2OA 3OD5A 1R1DA 2RG1A 2YRWA 3E9MA 3IR6A 4V03A 5EJAA 4BP1A 3GLHE 3T4EA 1GGFA 2WICA 2BFAA 3W4IA 4ABTA 4WK2B 2H2FA 1XTKA 3KKKA 4Z3DA 5A5VA 3IEMA 1M1NA 4Z49A 1N3IA 1TWCB 3N75A 5FR2A 2G40A 3P97A 2Y4OA 3M6AA 3TIFA 3CB2A 3OHMA 3UG7A 2DPXA 4JCCA 4WIAA 1I6LA 1P4AA 3QXSA 3A7EA 1PZEA 2WTMA 4NBLA 4YECA 3KAJA 4AJOA 1C7JA 2ZRGA 3GRUA 1CWUA 4P3OA 5BYAA 1Q91A 4JXZA 1IJEA 3MCVA 6LDHA 5FTLA 3QGMA 3ZCPA 1WMFA 1FBTA 4M89A 3STUA 1UXJA 2FNAA 3O3OB 4PX2A 4B3RB 2FZGA 1J0BA 1EDZA 1KYYA 4BLUA 1CS0B 1XZ8A 1X39A 2C4MA 1P18A 1K89A 2IGBA 3QMVA 3LQFA 5JZBA 1E69A 1T8WA 3COYA 1NI5A 1XYYA 2JD0A 4B7UA 1CY2A 4AZVA 1S6YA 1SUIA 1CY7A 1ORVA 2N1BA 3PKZA 1CFZA 1FIUA 3A04A 1K68A 3HN6A 1E2JA 1IULA 5AVRA 1HT3A 3FLMA 2IX3A 1I2MA 1WJGA 4UE2A 2DR0A 2WYVA 1X94A 3OOEA 1JQAA 2X0IA 1JTFA 1Z4LA 2GJ4A 5CDYA 4NU0A 2FJUA 3CEPB 2I29A 3JVEA 5REQA 3UM9A 3DMHA 1GCAA 1C7RA 2AN3A 3R6LA 4LRUA 3E7FA 1S0UA 3TDKA 3AKDA 2E2JB 2ZDQA 2QX4A 2V4MA 1N5LA 1QNLA 5JDCA 2PUFA 3WK4A 3LHFA 4MKGA 1Y3FE 1QX3A 1YRBA 4KWEA 1M72A 3QVSA 3QEMB 3OM0A 1W1WA 3KOXA 3HVIA 4YREA 2DBQA 4JA2A 5DCLA 4BB0A 1H0HA 1FRVA 3C1TA 5HZGA 1TQ6A 3U7RA 5K45A 3C8HA 4Q3BA 4QJIA 2P7IA 4PLYA 3I8XA 2X19A 4JNCA 3OKCA 7GPBA 1YJQA 3ILVA 4L4RA 1ECPA 1E0DA 3G7SA 2YOFA 4I7EA 2PMFA 5TS2A 3EXHC 4PTLA 1VYHA 1OX5A 1D2CA 1ZK3A 3HDYA 2QW0X 4KUEA 5AHWA 5KTPA 2C5AA 3UOWA 4IMPA 5LN1A 4F8EA 1YZYA 2X2FA 3NDJA 1C9JA 3M83A 2WP8J 4PINA 1NQ5A 2J0VA 4IJKA 4FYVA 3QU4A 1KH2A 2IHZA 1CJVC 3RQIA 1ZMXA 4G8DA 1SCNE 4Q3NA 1CU1A 3OMLA 4ZCQA 4C6RA 4F11A 4UNPA 3SFZA 1YU6A 2F3SA 1E1CB 2BGTA 2PT9A 4DLAA 5KYUB 4Q1BA 1LPBB 3LD9A 4Q7KA 3VSDA 4A8TA 1W35A 5ES3A 4UAVA 5DKFA 1C1HA 4UBKA 2R84A 4F4UA 1W0JA 4BIIA 3B1XA 1V7PC 3O4IA 4P22A 1TB4A 4I55F 3FMVA 5K3BA 1LTKA 2F59A 4AZTA 2NPOA 3IE1A 1P4SA 1YV9A 4OAQA 1CIVA 1RYHA 4CEIA 2IYEA 5BSGA 3IQIX 5DBGA 5CH5A 4G41A 1TU3A 4WLNA 3LPAA 3GBVA 1CW2B 3OUZA 2XZLA 4JJAA 2VZ9A 3G5UA 1E9BA 4WXMA 3NTLA 3DNPA 3GGJA 4WVLA 3CH5A 5FEUA 3TFQA 3PGXA 1TYCA 1GSOA 4IEIA 2AI3A 4OKSA 4U7JA 5DBFA 2SBTA 2Q6VA 1QUFA 3PDCA 3L8CA 4AYBB 3KOWA 1MZVA 2C04A 1AHHA 2CZQA 4FYIA 4IDOA 2B4YA 4YCMA 3R9WA 5CVTA 1G8GA 3JASB 1MXHA 2KLHA 4DIFA 4E70A 1YZKA 3QFRA 1DB3A 5CFPA 1YR3A 4N01A 3UOGA 1MPTA 1SC4A 2LD4A 3FZEA 4FMPA 3IVMA 3LOUA 1J5EB 1TGYA 2ZYAA 5DNUA 2P1ZA 3IC5A 4JUCA 5JJKA 5IJ9A 1P7VA 1RTTA 2QT1A 4IIVA 4PAMA 1KE2A 2Q1YA 1P19A 1QFJA 1XZMA 2OCYC 3GLFE 3DLBA 3D3NA 3L6RA 4WKGA 1GUYA 5I9IA 3PFCA 2IPLA 4I9FA 2PLWA 2X13A 1KVRA 4X7BA 1MTOA 1VRVA 3NAZA 4IMRA 3L1IA 4ZAFA 2MJLA 1DX9A 1JKFA 1N34B 4B2PA 1DLJA 5CM2Z 1O96B 5AI6A 1E2BA 5K05A 2YOHA 4H0NA 2C92A 1KXJA 1NJGA 1SXGA 3ENWA 4BNDA 5BV1A 4IVQA 4O08A 3MRVA 2E6KA 1AKVA 3EUWA 4AP5A 1U6IA 3QU5A 3BGOS 3HQ4O 1DAIA 3CEJA 3KKPA 3IBSA 1GZVA 3KQMA 3UMBA 3JWEA 2SECE 4QDXA 4ZO8A 1QPZA 2WJVA 3DPIA 1F7VA 4XGKA 4URWR 3PNOA 1WL8A 3S2FA 1XQVA 1W2WB 1SB8A 1NXXA 4N7RA 4XEUA 3TZCA 1M9NA 2PX3A 2XSZA 3GTMB 5CVEA 4WKBA 1B7GO 1GPH1 1RYYA 1W2HA 2BGNA 2OZLB 5G4LA 3M9LA 1RRMA 3MLBA 4QG3A 4CIWA 2ZJ8A 2QM0A 5T3UA 4DA4A 1M54A 4MA4A 3ZGVA 3DXZA 4P3XA 2Y1FA 1UQRA 5F5XA 4B3BA 1Y1QA 2XTZA 5L8VA 2GZDA 1E6KA 2EG5A 4HWGA 4KMMA 2JI6A 2PBZA 2W98A 4DMLA 1M0EA 3GLIE 3ZVNA 5K0JA 2IYAA 3THXB 4DUGA 2CBZA 3OFJA 3FTFA 1XEAA 3OEEA 4CM4B 2QZ9A 3ZCXA 2PBLA 3TSCA 3Q9NA 1AOXA 3G2KA 2OK7A 5KYGA 1SD5A 5G4KA 5C1OA 3C6YA 1AN9A 3JVIA 5DN9A 3U1BA 1RWQA 1H2AS 1SOVA 1WA5A 4LJ9A 1R0LA 4CN9A 2FPWA 4G5OA 1VKJA 1GG5A 2JIBA 3SQDA 4MV1A 3ZX4A 1A88A 1WPGA 3C74A 3H0KA 3ONDA 2XZDA 4X1OA 2YWEA 4JI3B 3AFOA 3OPXA 1U7HA 1NBIA 4PHGA 3L4SO 4DVGA 3UJ6A 2HYDA 4EGSA 8ATCA 3GUCA 4BNXA 4B75A 1I4WA 4ARCA 4E15A 1GCGA 5KYKA 5AW5A 3RFTA 1TAHA 2RGEA 2Z4SA 4WA8A 2YZ2A 3TRHA 4CEJB 4EY5A 4V0OA 4OUDA 3JRNA 1A04A 3NVMB 1SVMA 1U0TA 2D59A 2FZLA 3QI2A 5EGSA 1DEHA 3H4MA 3EXIA 2RGCA 3G17A 3M1AA 4YAOA 2F9MA 3D8BA 2X9LA 1MXFA 3B1JA 3VMMA 4XWTA 4IUBS 4TV8B 3UO8B 2C3UA 1DRJA 4Q7EA 3AR7A 5TNXA 1NT4A 4G5QA 4CETA 4U5XA 3PF9A 3R3JA 3WWCA 1M2OA 8LDHA 3IQGX 3D8TA 3KX2A 1YCDA 4AIRA 4BV2A 1L8AA 2OUIA 3PKJA 4LYAA 3O9ZA 5HOQA 3P2IA 3LQ2A 4DNFA 3M3YB 5TQ0B 4OHOA 2JFHA 1SC9A 1FUUA 3LKDA 4JITA 4UTOA 5BQFA 2D1QA 5LP6A 3N58A 3U3RA 2DCMA 2NO7A 2PT5A 5IAOA 1XPUA 2ZZMA 2O5EA 4C7JA 1ZVQA 2XB2A 2Y92A 1OWMA 3SYMA 5AW0A 3PO3B 3RR2A 5KOYA 3FFXA 4Q47A 4RGQA 3K15A 4DCGA 1SVUA 1M0WA 4DLXA 4ENRA 5ARCA 1JV2B 4D6XA 5CA0F 5TRTA 4EENA 2HADA 1XNGA 3O3CA 5ADUS 4OJKA 3U3JA 1UKEA 3SM9A 2X1MA 4ZIRA 2BFBB 2BHLA 4G4GA 4D41A 5LZ8A 3MJ4A 4I1UA 2CXUA 4H4EA 2REQA 4GI2A 5EZYB 3RSSA 3WQBA 1D5CA 1FY2A 4LJSA 1QO0D 1S7CA 4G0PA 1P5RA 4NEGA 1I0IA 1W59A 4EG0A 3CGWA 4QPCA 4MVJE 1ADBA 1DIRA 4WY8A 4R1MA 1I30A 2IZOA 3Q7RA 4XASA 4F1WA 1NKSA 5EP4A 3NT4A 3RH0A 1AHIA 4MKRA 2C7GA 3PVZA 4L9SA 1E5LA 2PWAA 3UCXA 1J8YF 3I1JA 3W5BA 5COQA 1XN4A 1KOGA 4IG9A 3UFXB 3CZRA 4M6WA 2C9DA 1W5SA 3LZDA 4PNPA 4MIYA 2EL7A 2HSWA 3FXAA 1T15A 5LQRA 1GL7A 1PQUA 1UZMA 2ZE7A 4AWBA 3D7MA 4C3ZA 1N1DA 1ESMA 5JAHA 2VSNA 3Q3CA 5FOXA 1KYVA 1VKHA 4IEFB 4KXNA 1E1KA 1B3BA 3LUDA 4B73A 1HDCA 1JFFA 1K63A 1QVWA 2IEGA 4G1VA 4PR3A 5IYZB 3PDIB 1OZGA 2VDNB 5JATA 3S3TA 5J5VA 5L7TA 4MUGA 1T5SA 2JLRA 1N2JA 4UHBA 1CVLA 1S9HA 3WRYC 3WGVA 3L9XA 3WNDA 5EA2A 4ME6A 4Q16A 5CX1B 4AXBA 5TGTA 3QPDA 4PLCA 4WWHA 4EG4A 1U31A 2QUHA 1LC3A 1SQSA 4A2CA 3GXBA 5IG2A 1PW5A 5KSZA 1M2WA 1CEXA 3LRXA 3O4VA 4UD6A 1U02A 2IQ5A 4L5BA 4PWYA 1VKRA 1P77A 2Z3VA 3DQPA 3TZLA 4ER5A 1P29A 2J0UA 1POXA 3WX0A 3H3XA 1TK2A 3TCXB 1E5QA 3KKOA 3PD0A 4M88A 3OX1A 1NA5A 3A6HA 3NBKA 4O1MA 4WFKA 5G41A 4YPFA 4QOFA 2UZ1A 1MABB 1Z5PA 4C2MB 1QONA 5HDBB 4FFDA 5ALPA 4N03A 1IC6A 3AH8A 2QSZA 4WD3A 4PLZA 3RO7A 1YUMA 4YJ2F 4PCUA 4DIEA 1RPJA 4FKBA 4TS4A 5JNWA 1W75A 5FNZA 1YDEA 4NOMA 3TQSA 2IUYA 2HJRA 3KEFA 2GDJA 3BWVA 3CJTA 1SVNA 3VUFA 4URXR 4CW7A 2F67A 2W6NA 4LDAA 2Q0XA 4KXVA 1IDOA 4IYRA 4BCBA 3JSXA 3U4GA 4YP9A 3I1IA 1EKXA 3V2HA 4PSKA 3TD9A 1AURA 2PS3A 3ZQJA 4YPOA 3SMQA 1FNBA 2GARA 1O89A 3E22B 3HA5A 3NTQA 3WHKA 4TMVA 4GQIA 4XA8A 3RDPA 3KG2A 4D7AA 4U0JA 2AK2A 2QS9A 2VSYA 2W2TA 3V7YA 2XAUA 3JALB 5FWDA 4J0GA 2QDXA 4L6AA 4D9FA 4EHAA 3IVXA 4F5ZA 5DHQA 3E3MA 4JNKA 1ZC3A 4PGAA 3WIOA 4AUNA 3U19A 3KUUA 3GQVA 4QU8A 3ZVMA 1UK7A 4L08A 2B63B 2XDAA 4OHXA 1YOVB 4OGGA 2O14A 2GRJA 5DM0A 1JXQA 5LLDA 2BGIA 2YNMD 1JE1A 1ICEA 4L6CA 4NBWA 1JWLA 3U26A 3GEGA 3H18A 5A4AA 1AV6A 3BZWA 5K0CA 5UKDA 3PR3A 3WGMA 2W2KB 5KQGA 1ECFA 2HK8A 2BTEA 5M3MB 3CZQA 1ZIYA 2JFZA 3HR4A 2ZUFA 3UV3A 1K06A 3TOSA 1Y1SA 1M8PA 1QKKA 2XQGA 2ZSFA 2GUWA 4HX2A 2FPSA 5ERYA 3UF0A 4Z7JA 1DADA 1RD4A 3DGFC 3ZX5A 4DOMA 5H3HA 1UC4B 3WV4A 4CV1A 1ZJ6A 4NMHA 6ADHA 3WAJA 3KR1A 1WUKS 2HZBA 2O8NA 4BFZA 2ZE8A 1Z5ZA 2ORWA 3AHCA 4D3SA 1NHWA 5CFLA 2GA9A 1FDRA 1XT6A 2I7CA 3WICA 4B3IA 3IPYA 4KAFA 3MIIA 5BSMA 1PTKA 4OGWA 4X3OA 4XUEA 4AKEA 3ZCUA 3DMRA 1HG0A 5ILQA 2AIRA 4YJKA 1PFQA 1QVVA 2XKAA 5KJCA 3GIWA 3H5RA 2I55A 3KEMA 2XOEA 4GOXA 6PFKA 3GG2A 1GRRA 1U04A 2CHUA 2ISQA 4HQNA 4UBLA 4X63A 1M5TA 3FPEA 5G0UA 2ZJ5A 3HJHA 5AJXA 5FADA 2X9QA 1HQCA 1HZJA 1XTBA 4ZAYA 4X0EA 4WKOA 1DKNA 4JLSA 4ZU1X 2AZXA 1VLQA 3FFBA 4NABA 4AJNA 1TVMA 4YRRA 4FDAA 1B16A 2BWJA 2G9RA 3B3QA 3PUVA 5K3FB 4BLSA 1YL7A 1HDYA 2EZUA 5CJPA 1DI0A 2W6OA 4CFYA 1QLWA 2CHVA 2JFXA 1JKMA 2ATIA 2ZE5A 3H9BA 1K8XB 3OJXA 3RRMA 3TPCA 3WB1A 3R3SA 3B1KA 3B9BA 4JKYA 3KHKA 2G06A 4AYTA 4L8YA 3ZEIA 1P17A 3C4VA 4G56A 4LJ5A 4MJXA 3CE9A 4EW1A 4ZCTA 1CR1A 3EIQA 1J70A 3SHOA 2X0RA 1PNQA 1PR4A 3LUKA 5DNDA 4XQEA 3QVKA 4X62B 1QQ7A 3DPSA 1KP3A 1WTAA 3NEJA 3OCZA 4Y2TA 3S1LA 3TL2A 1O97D 3PQ7A 4AL4A 2ZP1A 3CPHA 4M83A 4NKRA 2HMYB 5KWIA 2OAQ1 3UXEA 1E2GA 1Y3IA 1BSVA 3FZYA 4CMGA 2Y0DA 4JUBA 1PX0A 1R27A 4OJYA 4KU4A 4MVWA 1NMSA 3EYAA 1F8GA 5THQA 2GILA 2WVJA 4AMGA 3BWCA 4ZVPA 5MHTA 2XUJA 3CRRA 3GUUA 3JRWA 4CKEA 4HQKA 4LHWA 4C4XA 1JHXA 3KT8A 3QUAA 1GNQA 4JJEA 1CR4A 1E4VA 4LDNA 1HH4A 3TRDA 1I94B 1VPEA 2B1IA 1MFZA 2GJ8A 2JLAA 2QVCA 2BFCA 3IR5A 3HEBA 1VCNA 4A7PA 4R3UC 3OZ7A 3MUFA 3QE2A 5DM4A 3FVQA 4RZXA 3F96A 2Z1DA 1FX1A 1GUDA 4QOJA 1QGUA 2O2XA 2WK1A 4WDRA 5DNAA 3GA5A 3EG9A 2FW8A 2MYNA 4J07A 4QPPA 5BYKA 3C14C 2H11A 1KWGA 1ORWA 4Q7MB 3EIUA 5A4IS 1F4LA 3FNEA 4LOJA 2CJWA 2CVFA 4OYYA 3VNVA 3S2DB 2O1WA 4UCFA 2A0KA 1NNLA 1EBFA 2LXNA 3CNQS 4NMLA 5DK6A 3RFCA 3WI7A 5CTAA 3UMJA 1EG2A 1T2VA 4B8ZA 4WDQA 4ZWNA 2OGUA 1LK0A 3EQ6A 1W25A 4BMNA 3P0RA 5H8WA 5IM4A 1TTHA 3LQKA 2FU5C 2O1EA 1YZLA 1LPOA 4O6VA 1Q11A 3JQAA 5M3BA 4ACAA 5EIXA 4A73A 4Y6PA 1IMJA 1MO5A 1GZ3A 3BS4A 3IPCA 3WLSA 1U63A 3MGBA 2XEDA 3ETEA 4BNFA 1P3JA 3FNIA 3N8DA 4TSFD 5F1KA 3TIIA 5JW6A 2FLWA 2ZBGA 1BHJA 4GMKA 4IDFA 3HI6A 4TKUA 3THOA 3I73A 1Y8AA 1J2JA 3H4IA 1EK5A 1RJGA 1CUJA 4D42A 4DSZA 4FC6A 4G0XA 4BNNA 2FV8A 2Q1XA 4BLTA 1Z7EA 4YMHA 3GRYA 4CGZA 1C9YA 2X5JO 1VYTA 2FTKE 3Q8WA 4JY7A 1HNZB 1QSGA 2QQEA 3AETA 3PFHA 1PBTA 2A84A 3PU6A 4G67A 4QTXA 1YVEI 5JFGA 3NX4A 5E6SB 3O9MA 3KZCA 5FFNA 1JDBB 5GQSA 1GFZA 3AP1A 5K01A 1G38A 4J0EA 3RIYA 4ZN6A 3CNOA 1OXSC 1XG5A 3QG5A 1E0JA 2JVJA 4ZOBA 4BQPA 5KWSA 3FWYA 4RKEA 1JEEA 2WYIA 3LP5A 2NQ8A 2G7ZA 2XMPA 5EJIA 1JJVA 4MQ6A 4FI3F 5EI5A 4KO4S 1Z9BA 1ZOSA 1RXEA 3QXHA 4GX1A 3KD2A 1Z22A 3GJYA 3SX4A 3UA4A 3AUSA 1JEYB 4NXMB 2WJZB 5I4CA 1U7DA 1V2HE 1G8JA 3TQTA 3KQVA 1QRRA 3M3PA 3UWOA 4A10A 2XTAA 4NULA 3HJTA 3EEBA 1PR9A 2GXUA 3I9V6 2VAPA 1RJWA 4P33A 1VMEA 2ZB8A 3GP3A 1KBOA 5DLDA 3WE7A 2OCDA 4P4UA 5AHXA 3V1NA 2BKXA 1BW9B 3F4LA 4IIFA 4WCFC 2LUOA 5M5WB 4QU0A 4MR8A 1IFXA 3PC3A 4OU5A 2CVQA 2BDUA 3OICA 2QR3A 4TT3A 5FFFA 2PBRA 1C8LA 2GZ1A 3DXXA 1CHNA 3RIEA 5FUYA 4BFYA 1F9AA 4D9HA 1NBEA 1Y3CE 2Q5JA 4QQKA 4YGXB 4DV3B 3NBQA 3P9PA 2QK4A 4BJ3A 4RZIA 1BVYF 1FSFA 4O2AA 1IK6A 2AJTA 3EODA 4FUTA 1KF0A 1K7SN 2XV1A 3O83A 2PU5A 1LDEA 3A1SA 2PS9A 1MJFA 1H5UA 2REXB 3A7DA 1XLUA 1XIVA 1ZN9A 4DJTA 3JQRA 4MMYB 4ZALA 2Q3EA 2QQGA 1PWEA 3UYLA 1EDEA 4G63A 4A27A 5JSZB 4O4HB 3SXUA 3FBGA 4LG1A 3NASA 4OQMA 5KAPA 5E8JA 5LQSA 5J4LA 1SPXA 3W7BA 1RZRA 2VUUA 4BCDA 1CLEA 3ZWPA 1T0JB 3EXHA 2D4AA 3L8YA 2YS6A 3M8KA 3VPCA 5AJVB 3B51X 6CHYA 4O2LA 2QQFA 1B0AA 1QC5B 1N2SA 4MA0A 2NUAB 1PR3A 4DLNA 2VQEB 3DOCA 3AZQA 1YJAA 1CJCA 1EJBA 3K2EA 4BMPB 2IU3A 5EPOA 1DL5A 1OPRA 3OHPA 5IVKA 4R7ZA 1U3FA 3C3BA 4XOUA 3A2MA 3CVVA 4L8GA 5HIMA 3TQQA 4ZYUA 3D7SA 2HM7A 3CWQA 3CX4A 4BVFA 2GF0A 1NJ5A 1ZJZA 2HK9A 4WKCA 4GZ5A 1W581 2AJBA 4YRTA 1ISGA 1RRCA 2PKQP 1GT6A 4F1JA 5FCDA 4J0KA 4CIYA 5TDHA 4AF6A 2OHVA 1BS1A 5EVJA 3SC2A 1FDIA 3BIOA 4X8OA 5IW8A 1R9MA 2PBFA 3Q10A 3JQGB 5U4QA 4C9BA 1Y34E 5C5EA 1D5WA 5TGZA 1J6UA 5HTOA 4U7WA 3H04A 4Q05A 3BAZA 5LQAA 5E1MA 1JHZA 3RIHA 3UWKA 1JSLA 3R5KA 3W9SA 4D0NA 2W2LD 4FE7A 4W1QA 1XFDA 1PL7A 3BHNA 3EDQA 1U6JA 1JX6A 4X95A 5IAKA 2JLVA 1ZXXA 4YRBA 1IOLA 1VFPA 2RGNA 4Y2UA 3TSOA 3O92A 4J16A 2VPYA 3I2YX 4J76A 2VCEA 5F23A 4Q4HA 4AF7A 2RGAA 3LX6A 1JDBC 4G85A 3VZQA 4R6WA 2W8BA 2OCAA 1GD1O 1B00A 2FN7A 5CLQA 4IF4A 4F5WA 4A5OA 1MC4A 2IDJA 4H4CA 3KHUA 2FPRA 3IB6A 4NV3A 3OZIA 3TVDA 1YACA 3I34X 3HBLA 4HNGA 5KOJA 3HCCA 4FHZA 4JJKA 3I04A 3E23A 4QTUB 2R60A 1FP4A 4N5LA 4RY0A 5D8DA 4HG2A 3W5SA 3MGAA 3R0JA 1FU8A 1L6IA 3W9BA 4FVTA 3I64A 4EPWA 3FSGA 2VSFA 1VG0B 2NZXA 1HT2E 2ISSD 4I4CA 4EEKA 4LFAB 1I80A 2HWYA 1QDUA 2W37A 4GUAA 2BKUA 5TXGA 3S8YA 3C6MA 3WTCA 4JI8B 4RQUA 1P3Y1 1QS0A 1I01A 3OLYA 3SC6A 3WP0A 4IDQA 1MO3A 1R9JA 4MQFB 3TAXA 1NQWA 1ZFNA 2IVFA 3RUAA 2O50A 3EQ2A 3P19A 2B35A 1HV8A 1VSBA 1JDNA 3FUCA 1EFRD 1NVVR 3F3SA 4Z0PA 1W73A 4QBKA 1S4QA 3KS9A 1M8FA 4QJ5A 3JYQA 4CKWB 2IA5A 3OTOB 3KFVA 4U6SA 5A4KA 2QROA 3NOVA 2DM6A 1J56A 3RU3A 4R8RA 2DUUA 4CDRA 2HQSA 4X6LA 5CFNA 1DRUA 2P2GA 5EE0A 4OK6A 1ZISA 1FSPA 2F3RA 1GILA 2J32A 4R8LA 1GGJA 3P0FA 5A4JA 2F8LA 2J30A 2Y9PB 4LYYA 4Z0TA 4KFTA 1Y3AA 2C83A 5EUMA 5J2UB 1CRPA 1JXOA 1WBDA 3PHCA 3O95A 4N39A 4S1OA 1CV2A 4X71A 1OR8A 1A9XB 2AJLI 3EISA 3HK2A 3QWFA 1B6SA 5TMDA 4A3BB 2D8AA 2QENA 5F98A 4DR4B 5CT4A 2FZWA 3ICCA 3G0GA 1BRTA 3FIUA 2ORVA 1GG8A 2IYLD 2VDWA 1SK8A 4C0KA 4C78A 4XGRA 2D6FA 3KT3A 1VG1A 2X58A 4UNRA 1ODFA 3BMCA 1Q0QA 1RJ9B 2QORA 1KQPA 4IOMA 3ZLUA 3PC7A 3QW2A 4WK6A 5C3EB 2FZKA 5EGNA 3ZU5A 3NTVA 2Q27A 1LY1A 2FJ0A 4RPHA 2XB4A 1FF9A 1JLMA 2JLCA 2ZSUA 5EIAA 2E5FA 1P8JA 1KO4A 4ZI2A 3OSUA 1NYLA 4FGSA 1NE2A 4H15A 4CG3A 2YV3A 1JR3E 1W88A 2Z2IA 1KERA 4Q34A 2I6SA 2HU7A 4ZDWA 1XEFA 3UYKA 3OH8A 1DXOA 5E3JA 1M34B 4NICA 1O77A 2JZCA 2NVXB 4PTZA 3LHKA 4XD7A 1U7PA 4B9AA 3RAGA 2QBYA 2B1QA 4YLYA 1X7ZA 3B7WA 2AJCA 3PL1A 3TXXA 3W8FA 1R66A 1DXHA 5CM8B 2H17A 3HDGA 2EG9A 4XM2A 2RDMA 3K5HA 4MP3A 2RGUA 5DV9A 2R8EA 3CVWA 5KKAA 2P2CA 1B8OA 4U6NA 3EDRA 1P45A 2YFQA 3OA0A 3FCAA 4KLCA 3PEUA 1T8SA 4L4XA 2HF7A 5LD2C 4BFXA 3HCNA 4LJ7A 3ONFA 2OYRA 3HYRA 5D6OA 4BQEA 1XTQA 3A6FA 4PONA 3LWDA 2OKCA 4J0QA 3WAKA 1QQTA 2J1LA 5KC8A 3B6KA 2PX6A 3HXQA 5JSUA 1O97C 3SEQA 3MT7A 2IP2A 4WXYB 4TYMA 1U1FA 1BAPA 4HCJA 2CL0X 2PKCA 2M32A 3L05A 4RUKA 3PQ4A 3QKSB 1HUQA 2GK7A 4N3NA 3LL4A 4OUKX 1EWKA 4XPIB 4ZOEA 1IN7A 2E85A 2YWRA 4PLHA 2Q4TA 2RONA 7YASA 3H1PA 2Y0CA 1K92A 4Q1CA 2B8NA 3UHPA 2Q29A 1KKUA 1ZOPA 3U4IA 1FTQA 3CVYA 4ZARA 3EDMA 1OE0A 4U9IS 3QVTA 4ABYA 3HP7A 4C88A 3DLIA 5BUSA 2DOKA 3E05A 4O4JA 1TE2A 4RC9A 4XB2A 4OHMA 1XAIA 5KDLA 1K5DA 1YI1A 5DNYB 3OJ0A 3OLVA 4QUJA 2ZROA 3SSMA 4B17A 5E1DA 2DF8A 2WUWE 5IN4A 2IT1A 1PJ3A 1KPHA 3HXTA 1DO8A 2IZ6A 3VPFA 1VYUA 4YLGA 1QH8A 1MO6A 3QHAA 1B6GA 1R4NA 4E13A 2EW1A 2AWNA 2QTTA 3LL7A 1QYIA 4YRKA 3AKYA 1SUBA 4RIIA 2O8EA 4JI6B 2M9MA 2Q4EA 3WKCA 4OXYA 2V8BA 3GHYA 3QWIA 3BD7A 1OLUB 1JAZA 2OMKA 4IH9A 4MS1A 5FYDA 4IXTA 4LDQA 4BO0A 3EVZA 4GMFA 4INZA 3KQLA 3SHQA 3ZWDA 2FOIA 1EUDB 3IQEA 4B6FA 4EW6A 1ONOA 1BKDR 5T8KC 1TW3A 5B53A 2JI8A 4WVFA 4ZZ2A 1I51A 1RP7A 4QYXA 5EZSA 4H6WA 5IULC 3VU8A 1Z8NA 1F8XA 1VXRA 3KOZA 4HDKA 5GMOA 5KSWB 2AYXA 5A5FA 1RAFA 4PQGA 4BZPA 3V5NA 4N9QA 2X6RA 2RHRA 1GG9A 3AIKA 3CRW1 3PV0A 4I19A 5NULA 3WYFA 3L4EA 1WO8A 4L6IA 5LA6F 3UN1A 4NBVA 3SFVA 2QYHA 1KQGA 2GD6A 3L8FA 1BVUA 4A3MB 2CNOA 2D1SA 3ZGXA 2HK7A 1KFBB 4YY3B 1XV5A 2Y3IA 5IC6A 1NLZA 3EAFA 3LLUA 4C3IB 1HI9A 4NECA 5AM4A 3R6TA 3LVBA 3TI9A 5ITZA 1JL3A 5FPKA 5JPCA 4A15A 1V1MB 4DQKA 4G5GA 3RYHB 4QWWA 2IW3A 2B8TA 1Q0LA 1U1DA 1W0CA 1K7CA 1MD9A 3FWKA 4U63A 3HU1A 3L46A 1SVLA 1DS6A 3DYBA 3EF0A 1V7CA 2H06A 3Q40A 4YROA 5DEOA 1Y8QA 2F8MA 4NMWA 3UGTA 3VO2A 3WO1A 5EJFA 4GI7A 1DSSG 3I9FA 2X15A 4ZKEA 4LV8B 4TMKA 2H29A 1DC7A 2CF5A 4DV7B 1F1JA 2GZMA 3D1JA 3NDPA 2AFIA 3VR3A 1W8DA 3D6AA 3ZU6A 1K6XA 3IKLA 4E3ZA 4BV8A 4LYHA 2CFCA 4FZRA 4B3HA 3UJHA 3ZYZA 1V45E 4R8SA 1L0BA 1Z07A 4EI9A 4L3VA 1YQ9A 4ZHSA 4RTQA 4DR3B 3NOXA 1FFDA 1IWBB 4P86A 1RBZA 3B78A 4L22A 5IKOA 5J2TB 1WOMA 1R50A 4RF5A 4HDAA 2GN8A 2A7XA 4J49A 1KEWA 4JA0A 2HTFA 4I2VA 2ZXEA 2FH5B 4M9SA 4QGFA 3I9V1 2W42A 3GJ4A 1T3HA 1E9SA 2C3YA 3QF4B 4GPZA 1B0UA 1QTQA 3M81A 4IGAA 1P33A 4JGBA 5DHFA 3UJDA 2HAEA 4BLQA 3U61B 2GK6A 5CW2A 3SZGA 4C20A 5BNFA 3NHKA 5C18A 3QQPA 1AIPA 2J41A 1L7AA 2VDPB 1RZVA 2CKDA 4ZPXA 1PZFA 4Y6QA 3RJTA 4G0OA 3WLMA 2H1WA 3MT8A 4H7DA 1EHYA 4CEHB 2EF1A 3F5DA 3N7UA 1EVYA 4IOKA 4X9XA 1FPMA 4OMDA 4LZZA 2P4EA 4KXFB 2JLSA 2Z9CA 4MW7A 3T5CA 5GGXA 1FMTA 3RVLA 1ZDMA 1FSGA 2WHPA 2J9RA 3TTTA 2C5BA 2RH9B 1YBVA 4UJ5A 5TVKA 2Q5IA 4ZJPA 2E3JA 5H3CA 2BMEA 5BVGA 2OQVA 2BFFA 2A4KA 2PMBA 3OG9A 2PU7A 3KL4A 5A7GA 4YH1A 3UA3A 4ED9A 2G9QA 1IWPB 3HUEA 4I4TA 1V8DA 4RF2A 3MJSA 4IVRA 1NVDA 1OI3A 2QAGB 3EBPA 4WI1A 3EA5A 3IT2A 4FXPA 3E35A 3MS2A 3AEYA 4MV9A 5EIFA 4D82A 5B3JC 3ZDAA 3WDMA 1TL7C 2P3LA 2JIDA 4KXUA 1C3JA 3HZZA 1I7PA 5EUCA 4JJZA 3IAHA 2FPUA 2FFRA 2XGGA 2ZWVA 4OVKA 2BW0A 6Q21A 1V8FA 3ENKA 1PWYE 3RVPA 1Z8DA 2WG0A 2PSDA 4LZPA 1M0TA 2Q21A 1XHFA 3SAJA 3SIRA 1C81A 1TWHB 3I0NA 4I6EA 1A2OA 5TQVA 1B2LA 4M3NA 1YK0A 3S15B 2D74A 3TKLA 3G2MA 5IF9A 5ECWA 1TYBE 1UT8A 2FSIA 4KR0A 1QE3A 1QKJA 2J45A 4AY4A 3KJHA 4EL0A 1DUVG 3VBCA 4BNHA 1C1XA 3MYRA 3RJ9A 1R3DA 1OOEA 1Z0UA 3H8VA 4RSRA 1WW8A 3A8TA 4BB9A 1BXGA 5HTKA 1XU9A 3NEYA 5DX1A 3GJRA 3F67A 5KX5B 1OMOA 1BJKA 5EP2A 4WLEA 3KYCB 1FTWA 1CQJB 1PEKE 3NJ8A 4BIMA 3KZNA 1QK5A 3F49S 3I09A 5FKJA 2XLCA 4CIVA 4OHRA 4OF4A 3WQHA 1EWVA 3CH4B 3HBMA 3MWDA 4IIUA 4J91A 5I9BA 2FWNA 1ZN7A 4UTVA 3AEXA 3ZLJA 3AVUA 1P1CA 3QKTA 2G04A 2QJOA 4F96A 1EJ2A 2JHCA 4R2LA 3JTEA 4BB5A 4XVCA 1Z2PX 5JCPA 3K8ZA 4RULA 2Q3DA 2CXXA 3BT7A 1C7ZA 3PC8A 2IXBA 3ER8A 3O03A 1V4BA 3IBCA 4XWAA 2ZRKA 4EATA 3DW1X 1ZA2A 4O2AF 4XDZA 1IH8A 2XNDA 4LCJA 5EP1A 4Y6GB 5K6RA 1CUAA 2I3AA 3TPZA 5LL6P 4Q9DA 4E0BA 4JLOA 4F6RA 1RYNA 4OI0A 2VEDA 1F0KA 1OTXA 1Y1TA 1D2MA 2FYTA 3DZBA 3MLEA 4PPGA 5JSKA 4X20A 3O8NA 2PSFA 4ND8B 4K05A 8OHMA 1LLFA 4XW2A 2BMAA 3LUFA 3DBVO 2FVXA 4X93A 4ZRNA 4J7AA 3KPUA 5ALEA 1YQDA 3L6BA 2CE2X 2I7VA 4HTAA 1G6KA 1SG9A 4ZQCB 3PI7A 3U4CA 3ZZUA 4AIIA 5KPDA 3FMOB 4QVIA 1XD2A 1L1FA 3REGA 2D5AA 1YKSA 1C0KA 5D2CA 5ALIA 4BX9A 4EYQA 1GRCA 5DFAA 4O4IB 3KU1A 4KDCA 3TE7A 4Z9YA 2IOFK 2CVOA 5DMHA 1YB7A 4N6GA 4DSAA 3NHBA 4DPLA 1B8PA 2K7ZA 3H5WA 2PMCA 1ADGA 4II3A 1JH9A 3FSEA 1L5OA 1I5OA 5EUBA 5KTSA 1KL7A 2I6TA 4MDYA 4C5CA 3CLUC 2CN1A 5EE1A 4KFRA 4BLVA 3L82B 1ZQ9A 3CF4G 1N2GA 1VI5A 2Q45A 2FOLA 5F3WB 1XCJA 1XTZA 3LGAA 3C4JA 1PQPA 3AP2A 3JU3A 5B1IA 3ZCVA 2II6A 1TDJA 5HIIA 1C14A 2VYFA 3WOHA 1YVPA 3AHHA 1SURA 4ZC8A 1GGNA 1EK6A 4AFNA 1Q17A 2P2YA 4JJ8A 2YZ7A 3SS7X 3W9YA 4LGYA 3ZUGA 3ZCTA 4CLDA 2PQ2A 3A2KA 1UZNA 2JCBA 4ZI7A 1R5NA 1RVDA 2Z95A 2FPIA 4O1IA 1HLFA 3L5OA 3UPTA 2NG1A 2LIVA 2F17A 2DMRA 3I53A 2AI2A 4WKNA 3O7WA 3JQ6A 5CU7A 1Y9AA 2QVGA 3BMXA 4M1WA 5ENVA 3ROPA 4D3ZA 4XRGA 2C1XA 4QTTB 1HDGO 2AR9A 4L5JA 3ESDA 4DIMA 1SXHA 1T0HB 2P3SA 5DZSA 2PPLA 3JD0A 4HNUA 1K75A 1HDOA 2PNJA 1MKYA 3AC0A 3AY6A 4KR7A 4HWTA 4Y1GA 1OC4A 5BOVA 5A0TA 3HUFA 1JFVA 1PVDA 5BSFA 2WUEA 1BDIA 4UVEA 3DV0B 1QYRA 1Z5UA 4PXYA 5B3KA 5ALKA 1G60A 1GUFA 4N7BA 3FH0A 3RB8A 1AC5A 1P6XA 1B2RA 3MA0A 4WZBB 3VH3A 3L40A 4DBZA 1KBQA 2C03A 4HX9A 1DFGA 1YR2A 3DAPA 1N0VC 2DFDA 3VH1A 1KAMA 3QVVA 4M1OA 4ZU3A 4ZJUA 1BHO1 3INNA 1YIOA 4KVZA 4M4SA 4E07A 5JRJA 4YI3A 1C7EA 2RCYA 2WIGA 1UKZA 2VF2A 4NCJA 2I6XA 1U9IC 4PVDA 4N41A 4UKDA 2ZIFA 5K4AA 3R9XB 5KNCH 2PLNA 4CMHA 3EC2A 3RPEA 1IBLB 5IU6A 3IO3A 3MPOA 1USVA 4M9RA 2CL6X 2IYZA 4S2UA 3STVA 2GD1O 1RHKA 1H2HA 4X7MA 4QNRA 3DKRA 3X0DA 5HUHA 3V46A 5AW9A 4RTMA 4QM7A 4YT5A 4JZKA 3FNFA 5IT0A 1R3UA 4H08A 3ESCA 1OCEA 4OJQA 1AF4A 4C08A 2P30A 2RGDA 1BE8A 3B20A 4YJGB 3B7PA 1LDGA 3CXUA 3I30X 3SQXA 2Y6VA 5AM0A 4B3XA 1Q7EA 3PQEA 4JKIA 3EOBI 1K9VF 5JSHA 5HHTA 4XZ3A 4BNMA 1KJ8A 2PUVA 4OA5A 1BWQA 1FRNA 2HA0A 2WWFA 3C8DA 4MRRA 2GKOA 4MYCA 5ER9A 3VR2D 3ZXSA 3ZWCA 5TMPA 5JS1A 4NF2A 1NVUQ 4DGQA 1JHDA 4NAHA 2FWBA 1G63A 1WXWA 5JY6A 1C30B 2ZEJA 4Q9AA 1WTCA 3ZY3A 1OY1A 2YWXA 3GH3A 3K20A 4HMQA 2FX2A 5AJHA 3VC1A 2EKQA 5LXTA 3WB9A 5KZMB 1MT3A 1QBKC 5LR6A 3FGZA 2H5LA 2I4IA 2RB5A 1RHMA 3UC5A 1B41A 1OT3A 3NHUA 4LZJA 3JZFA 4YAFA 1WAMA 3OOSA 2H3HA 5ALNA 1HDIA 5CBKA 5A4FS 1X70A 1Z6ZA 2XWQA 3HE3A 4JOQA 5KYYA 1JFTA 1QLJA 1S96A 3DFUA 3L6CA 3CKKA 2KPOA 5DSZA 1K7EB 3VO9A 2V3WA 4CF4A 3V8EA 2IV7A 5AW1A 1U4NA 2G5PA 4EFNA 1I50B 1QYVA 4JIGA 4MQEB 1VP9A 1GIAA 3NB0A 1YNSA 1RBYA 4LJKA 3N74A 2ZBDA 1I6KA 4RZHA 3OX3A 1H4TA 2JLBA 3WC4A 2SCUA 1PR1A 1XCOA 5A3SA 2AMJA 4HY3A 3PNBA 4D46A 4BZZA 3ACDA 1RZUA 1VE7A 4E12A 1W85A 3G79A 4HAOA 2PZLA 2MSEB 2J7KA 2ZULA 5COAA 1MOPA 2P0AA 4BXOA 3EEYA 3QG1A 1AGPA 4ZU6X 3ZI7A 5JARA 1T6YA 4JDUA 4UBOA 3IDQA 4TLAA 3NBXX 3U37A 4B4DA 5BNTA 1R8QA 1B8VA 3OWXA 2Q7DA 2Z3WA 1E0AA 3LC0A 4G1BA 3BGVA 1DT5A 3ZVRA 1TXGA 3DO6A 3GTJB 2NTJA 5JCJD 2AOXA 2QRQA 1VIMA 1Z74A 3QX7A 3KJQA 3MJRA 3BEOA 1ZKDA 1N7HA 1M1XB 2JGNA 4MCIA 4CYMA 5EKUA 4WFQA 2FF5A 3DMTC 1Z6PA 2ZVQX 5DNVA 5BN1A 1F0YA 1O94C 1J9ZA 1KNXA 1NV9A 2WSSA 3Q3HA 2O0LA 2RGWA 4JB2A 4JZYA 4FP9A 4D8XA 7AT1A 3CG0A 3E0XA 2NSHA 2QVXX 2C0PA 4OB6A 2NZVG 1UPUA 2FRXA 4DV5B 2V4UA 3DV9A 3SWWA 1DRWA 4BRZA 2IYRA 2QUZA 3K0AA 3K2IA 4O4JF 2X14A 3IT0A 2A4MA 4UXIA 5TC4A 5HRCA 1PV4A 3DCIA 1ECCA 4NS1A 4KGVA 2JLXA 3UCEA 8AT1A 2QN7A 2PO5A 2VP4A 3FI9A 1DDIA 4JLMA 2GN1A 4OSOA 3NVDA 4RZ2A 3L8EA 5C31A 3S2GA 4EVSA 4ZDJA 1I7SB 1G0OA 2D2VA 3I12A 1ZU5A 1VC2A 3KJFA 1RQXA 3KKQA 3NQ41 4MV5A 4RPIA 5JAQA 1ZICA 1KGSA 5H02A 2ACWA 3T3EA 5JH7B 1G7RA 3C4QA 3PX3A 5J1TB 5JAUA 2GVZC 3IUEA 4PZUA 4YBRA 2A5YB 2VOJA 4GPAA 4A1FA 4EG8A 3CLSD 3ZXXA 2PT7A 3N2KA 2XDQA 4WW0A 3IVGA 1QIIA 5EQTA 1HO3A 1LW6E 3GN2A 3ZKWB 2Z1MA 3OC6A 5T6MA 2J9ZB 4NZPA 2Y1WA 3GMIA 1P80A 4TS9A 1ZHFA 3I0ZA 4ZAVA 4EECA