1TJ3A

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 in a closed conformation
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sucrose-Phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Hydrolase
total genus 89
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1tj3A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1tj3A02
5AK4A 1K1EA 2ZXEA 4ZEXA 3EF1A 3BWVA 3N1UA 1Z5GA 4UM7A 2IOFA 4BNDB 5AI8A 1YV9A 1QQ7A 3AR4A 1RQLA 3ZWDA 3U7FB 4BX3A 3FVVA 4KX3A 3QXGA 3QU2A 5ALFA 2G08A 3AR8A 4HGQA 1NF2A 1ZD4A 4RETA 4KNWA 3ZX4A 2QYHA 2B82A 3OCZA 3N8GA 5E0OA 2FPSA 3QU7A 3U26A 4Y2UA 1TA0A 3L8EA 2HSZA 3OCYA 5AI4A 3QU5A 4JB3A 4YIHA 5AW6A 3W5DA 4NABA 3WKEA 4OFZA 1U7PA 3M1YA 3SD7A 4EEKA 1AQ6A 3P96A 4Y2PA 3UMCA 2WFAA 5AW9A 2HOQA 3R9KA 5AKYA 1FEZA 2MU1A 4O8CA 5AVVA 5AW2A 3F9RA 5AKZA 2B1RA 1CR6A 3KOOA 1ZOLA 4EELA 2G0AA 4EENA 3I76A 3HLTA 4L6AA 3L7YA 2HF7A 3KC2A 3QUCA 4KX5A 1LTQA 3AR7A 2HO4A 3FGOA 5A3QA 1Y8AA 2FPXA 2GHTA 5ALWA 4DWOA 3A1DA 4ZEWA 2C9MA 3E58A 4Y2JA 3WGVA 4UW9A 3RFUA 3QNMA 3WK6A 5ALLA 3WK4A 4UM5A 3KZXA 5AW7A 3QU4A 3L0BA 2FUCA 4AS3A 5AESA 4BEWA 4YCMA 4YGYA 3OCUA 1T5TA 2ZBFA 4YCNA 1PW5A 2RBKA 3N5KA 3KD3A 5AW0A 2C4NA 5ALPA 5IT0A 5AKGA 2OYCA 3FM9A 5A3RA 2B30A 3MPOA 3ONNA 3WKCA 2IOFK 3ZI4A 1TJ3A 2IYEA 4NFLA 1L7PA 1N8NA 3AR5A 4Y2XA 4L57A 2JAUA 4UMDA 1RQNA 1F5SA 1WVIA 5AHXA 3CNHA 3BA6A 3ZTYA 5AM0A 1ZS9A 3WK5A 5ALIA 3GYGA 2HDOA 3MC1A 2NO5A 3AR2A 4GXTA 5FP0A 1WPGA 4NV0A 3PGVA 4EX7A 1U7OA 5ALNA 3SMVA 4HGPA 4OD0A 1RMTA 3PGLA 2BY4A 1Z4LA 2HX1A 3L8GA 5AIBA 2YMQA 3U13A 1VJRA 1YS9A 3L0CA 3WK8A 1VJ5A 3L1VA 3HYCA 5ALUA 3NANA 1N9KA 2RAVA 3WK7A 4OHFA 4KNVA 3EF0A 2PKEA 1Z4QA 5ALZA 3ZUPA 1Z4KA 3OPXA 2NO4A 4L6CA 5AM3A 3N07A 1TE2A 1Z4PX 1RPZA 2R8YA 3IJ5A 5AK3A 2WF5A 2BDUA 2MSNA 2B1QA 3S6JA 4UATA 4IG4A 4BX2A 3I1YA 3J7TA 3NRJA 2I6XA 1L7MA 4KYTA 1TJ4A 3QYPA 1ZD2P 5AM5A 4UARA 5AKLA 4J2TA 4C4TA 3L0YA 5AK6A 3UMGA 1EK2A 3WGUA 3W5BA 3W5AA 4CF5A 1WR8A 2HF2A 1RLOA 3AR9A 5ALOA 3I6BA 1U2TA 2HEGA 1TJ5A 5AM4A 1NNLA 2YBDA 2FPRA 2YN4A 5ALMA 2AH5A 4Y2SA 2RARA 1KYTA 4B6JA 2W4MA 5IT4A 1Z4OA 3UMBA 2NYVA 3EPRA 1S2OA 2JAOA 5AVZA 3A1CA 1Q92A 4YCLA 5AKHA 3IRUA 1JUDA 3ZWKA 4BEVA 2I34A 1MH9A 5AW8A 3DNPA 2W43A 1YNSA 2B8JA 4BYGA 4G63A 1RLTA 2ZBGA 1YDFA 5AKKA 5ALYA 4KN8A 3QX7A 2IA5A 2JGAA 2WF9A 5ALDA 2YMPA 1SWVA 3NIWA 1CQZA 3I28A 4E88A 4FYPA 4BNDA 3K1ZA 5AM1A 4BKMA 3SLRA 2CFRA 2YJ4A 3QUQA 2OBBA 3ESQA 4HYTA 2HHLA 3WKDA 3NASA 4Y3UA 2EATA 5AKXA 4YH1A 1QYIA 3NUQA 1RMYA 2I7DA 3B8EA 5T41A 4Y2TA 4MWOA 1WZCA 4XQ0A 2QLTA 4RESA 1S8OA 4Y2YA 2HI0A 4UAVA 3AR3A 5ALVA 5AW4A 5AKEA 1ZD5A 2CFSA 4XOUA 3OCVA 1RMQA 2O9JA 2HCFA 2JAWA 4DCCA 2G06A 2B0CA 1J8DA 3MN1A 2FDRA 2DQSA 3FPSA 4AS2A 3NAMA 3ZU6A 4CF3A 5AW1A 5AI9A 5AW5A 5AVQA 3OCXA 2X4DA 1ZRMA 3CZ4A 4F72A 3DDHA 1LVHA 3ZVLA 2I55A 2CN1A 4MUMA 3W5CA 3WK9A 4IFTA 5AI5A 3ESRA 2EARA 2GFHA 3U7HB 1O03A 4QQFA 5JJBA 2P11A 3PCTA 4HGNA 2YMMA 1T9ZA 2P27A 1J97A 2I54A 3PDWA 4HGRA 3OCWA 5ALHA 4H1WA 2VKQA 5AIAA 1SWWA 1X42A 3TLMA 1RLMA 5ALXA 5AVUA 1QH9A 1QQ6A 1Z4JA 2G07A 4G9BA 4J03A 5ALJA 3U19A 4Y2RA 3KDPA 3WKBA 5AKIA 3EWIA 4EZEA 2R8ZA 3NALA 2JARA 4EX6A 4DFDA 3U7EB 1L8LA 3ZVNA 1ZRNA 1VFPA 1XVIA 2ODAA 3QLEA 4C4SA 1RKVA 3ZTWA 3ET4A 5A3SA 4UMVA 5AVYA 2IOHA 4Y2VA 3ZW7A 2WF8A 1L6RA 2I33A 3B9BA 5AVTA 2G1AA 4UU1A 1RKUA 2Q4TA 4UU0A 1IWOA 2AUTA 3QUBA 2WF7A 2BDEA 1Z4NA 1YJ5A 2PR7A 3QGMA 3FPBA 2C88A 3R4CA 3WKAA 2P69A 3SKYA 1T5SA 4NAVA 2FI1A 1RKQA 5AVRA 4XE5A 3N28A 1EK1A 3D6JA 3E81A 1XPJA 5ALSA 4NWIA 3E84A 3L1UA 2YY6A 1O08A 5ALQA 2D2VA 4Y2QA 3ZX5A 4CE6A 4PNHA 4I9GA 3SF0A 5AW3A 4ZEVA 4YIKA 1Z5UA 5AVWA 4UASA 4F71A 3L5KA 2P9JA 2R8XA 1NRWA 2W11A 5AM2A 5ALGA 2YMLA 3FZQA 1SU4A 3E8MA 2YJ6A 3QU9A 5AVXA 5ALRA 5AKJA 2AGVA 2C8LA 1U2SA 3UM9A 2GHQA 2ZBDA 2YJ3A 4UAUA 2ZG6A 5AVSA 1Z4MA 2R8EA 2G09A 5IS2A 3SKXA 5AI6A 1XP5A 3ED5A 4I9FA 1RC8A 4UMFA 3DV9A 1Z4IA 2B8EA 5ALTA 3KBBA 4GIBA 2Q5EA 4HAIA 2YJ5A 4OCZA 4BX0A 3R09A 4AP9A 2WHEA 2Q4RA 1ZJJA 1RRCA 3VAYA 3B9RA 4HGOA 2EAUA 5AI0A 2GO7A 1YMQA 2WF6A 3L8FA 3MMZA 1Q91A 3AR6A 3M9LA 2OA0A 5AK5A 2ZOSA 1ZD3A 2C8KA 3L8HA 2G80A 2GMWA 4CNQA 3QUTA 3ZVMA 2ZBEA 2FPUA 4BBJA 1L7OA 3A1EA 5ALKA 4DW8A 2O2XA 3OTQA 3RF6A 2FPWA 5AICA 1L7NA 3SHQA 4C4RA 2YFYA 3ET5A 1RDFA 3IB6A 1Z88A 4JDPA 2FUEA 4FFDA 2PQ0A 2AMYA 2WM8A 4UMEA 2FEAA 3U7GA 2OM6A 3DAOA 2CFTA 2RB5A 1L8OA 1QQ5A 5ALEA 4CF4A 4XPZA 3A3YA 4FE3A 4QJBA 1U02A
chains in the Genus database with same CATH superfamily
3RVSA 3OIVA 1Q15A 2ZKIA 2ZXEA 3SQDA 4AZ0A 3H83A 3NOQA 2QUZA 3WMGA 1W4BA 2XOEA 4OMFG 5IPFA 2V7TA 3VHLB 3R4VA 4YMWA 5G0SA 5SY4A 3CLKA 5K03A 2ZULA 5DYGA 1CEYA 3AEXA 3AR4A 4RD1A 4US2R 4F96A 2IS1A 1UMBB 5KYTA 3HB7A 1OXUA 2E4XA 2EV9A 4HGQA 5JJKA 1BE0A 4KK3A 1RYNA 3LQYA 4HNSA 2I2CA 3WLTA 1O94D 1RWWA 3IURA 1T36A 4JN6B 5G0VA 5KAMA 1H66A 1SY7A 1NZDA 3ZX4A 2LKDA 4W8GA 3DSRA 2BI8A 1VDMA 1H3FA 5C3EB 2H5LA 1M7BA 2H2IA 4X54A 1NQOA 3MK31 5E38A 3O9VA 3OU6A 3W7BA 4RE5A 1K5DA 4ZYTA 2J5QA 2OFWA 4DTCA 3KLOA 1J39A 3TQCA 3UUEA 4KKXB 3DOCA 1HDCA 2M1XA 3RZOB 3S14B 5J2TF 3NM4A 2HK8A 3D4OA 1K86A 4FFMA 4P98A 1J2JA 4ZXPA 3KNZA 3Q10A 1I36A 5C9ZA 3QKWA 3SICE 3SC6A 3ZYCA 4X7BA 1A77A 1HNNA 4KJXA 4C05A 3KU1A 1XMVA 5ILOA 4N8EA 1ICIA 5LDGA 2WHXA 2VSOA 3AY7A 4O2BF 5AKYA 2Q8QA 1LX7A 3DBIA 5AXCA 2D8MA 5KCMA 1KR5A 4KVFA 4IRUB 2QXYA 2NIPA 4EGJA 4HC4A 4EMSA 2RBGA 1JU3A 5EUBA 1NR5A 1Z6ZA 1YA8A 1T6XA 3RK1A 4NDZA 1NA5A 2FN4A 1HTTA 1AF4A 2ZIXA 4YYEA 3EWAA 1T2UA 1ZNXA 3EVBA 2OM2A 3J81k 2UUAB 4MLCA 3VNVA 2VCHA 2B5WA 1XRLA 3IYLW 4OFBA 5H9VA 2AMLA 2IF0A 4MRNA 3UN1A 1F14A 3DBHB 1EDOA 2I7TA 4C7BA 2CLCX 1DXHA 2A5JA 4G4GA 1IZYA 2HBRA 2JAQA 2D7DA 1ONOA 1Q20A 1IBLB 1NUHA 1SCAA 3LY7A 3R9XA 4LDAA 1WZIA 1BS2A 1S1MA 1NL3A 3AUUA 4DQ0A 4UW9A 4RZHA 1X7WB 3HKCB 3KTFA 5FADA 4H1HA 5AVJA 1EUQA 4PLWA 1JWAB 1QCZA 4PFJA 4LY0A 2AZDA 1U0HC 1EH5A 3U1VA 1U8UA 5EWMA 1KDYA 4M22A 1F1BA 4L07A 4TXHA 1BXGA 2E9SA 3BWBA 4QXOA 13PKA 1CY2A 2NSLA 2DSTA 5TQ0A 5B4VA 2IPXA 3WIDA 1N1DA 5CVEA 3B12A 1PFWA 3IBTA 3OZRA 1OILA 4DL9A 1CR4A 2B4TO 3PC4A 5IJ0A 4M1YA 2J8ZA 2Q6VA 2B1IA 5CITA 2PX8A 4EMTA 1X15A 2GILA 2CHQA 2Q5QA 4P3PA 4YRGA 3K9FC 2G40A 3ER8A 3ZNNA 1MGPA 6REQB 3WFIA 3WBBA 3O4IA 4FW8A 5DT2A 1KO4A 1OAKA 2YCLA 1QP8A 2ZATA 3RRNA 3W1EA 2H2FA 3IEPA 4HYEA 3NXKA 2O8NA 1IMJA 1XEWX 1CQIA 1LUAA 1GSHA 1GGMA 2FFAA 1JDVA 3QKSB 4DZRA 4UMDA 3B1XA 3OY2A 2B99A 4Z86A 1XRNA 1KVRA 3TGWA 2J3QA 1NXPA 4EKNB 1KF0A 5KOHA 3VNAA 3JD3A 4B4KA 1YVEI 2GK6A 4LJKA 3NI2A 4EVRA 4CIAA 3C3MA 4OQEA 5BMVB 2XYGA 2H9YA 3F71A 3K9WA 1JEDA 4L02A 3K05A 3BFKA 5EESA 4O1MA 3IIMA 3K35A 4RCZA 1AMOA 3WAJA 4BWYA 2O8DA 3LXRA 4LDJA 3NTXA 3QHAA 1U7OA 1F8UA 3OKCA 1KTIA 3CJQA 4CCYA 2YCBA 3CEJA 3OTGA 4HADA 3WIOA 4E2FA 5K09A 4IMRA 2AKEA 4UXJA 5HCIA 1LDYA 4W5NA 1BQEA 3CR3C 4Q7LA 2YWCA 5AIBA 2YMQA 1E6MA 4B3DA 4ZAXA 4F4HA 5LKAA 3R9WA 3SHFA 3AEYA 3RK0A 4LWOA 1CB0A 5J4VA 1N5RA 3L1VA 2OMEA 5I48A 3LQ2A 3ACCA 1ID8A 1XK6A 2DMRA 2WM2A 4L74A 3SGLA 1U99A 3FNRA 2G72A 2Y2VA 3NOXA 3AUXA 4MPPA 5F73A 2HXGA 4FOPA 1IUOA 1Q95A 2WD7B 2GXSA 1ZPDA 4P9NA 5J4HA 3PHIA 4LYHA 3DWGA 2Z98A 3OZDA 5SYMA 1GTJ1 5LU9A 4IXDA 4UUPA 4GLOA 3IXLA 4PPGA 1GL3A 3PHBE 2IIVA 1XQVA 2AX4A 4QYXA 2NAPA 2RHRA 4O59O 3MYRA 1E1CA 4XX0B 5DYIA 3HKBB 1ZGJA 4WH0A 3KAPA 4QDZA 3KELA 4TQ9A 3SJBA 2Q2OA 3K16A 5BN4B 3ASZA 1NDQA 5FAXA 1MU0A 1L1EA 1G20A 4OI2A 5F51A 2H57A 3U7IA 5ILGA 4CQLB 1TTQB 4IZHA 2DERA 1L7MA 4M1MA 2QD1A 2O2EA 1HWYA 2WJYA 4OL9A 2AVDA 3OIWA 3RJZA 3KVOA 1MB4A 2I2DA 5H70A 1Z25A 2ANCA 3FMGA 1ORVA 1UBSB 5AKLA 3AF6A 2P2SA 4XVQA 1G38A 1VKZA 4RSHA 1XAIA 2P9FA 5E8JA 3WGIA 3U4QA 1F06A 2WV7A 4JV5B 1UODA 4BKPA 3FB4A 4G41A 1T3LA 1HLGA 3C2QA 4TVKA 4TT3A 5K3FB 2XV1A 2DBVO 1ABFA 1ZJYA 3L4EA 4UHBA 2C7BA 1R18A 1WP9A 5ER9A 1CUGA 1D2CA 3AM5A 3PJFA 5C4GB 5C44B 4OKIA 1CY1A 1C7FA 3U4CA 3AJRA 1VA4A 3O21A 4CI9A 4Z0PA 2AH5A 3FWPA 4AWBA 2Y76A 1R8SA 1X80B 2G36A 1NVWQ 4PLTA 4IO1A 2WDPA 1R2QA 2QXUA 1LTKA 3DMNA 4I81A 5EJ6A 3ZLBA 3V7WA 4BVHA 4H0NA 1EUCB 1CU1A 2X3YA 4HR7A 2P3LA 1M34E 1N1MA 3MQ4A 4LQ4A 4QNNA 1XTTA 1MH9A 1F4VA 1U65A 1OYYA 2BEJA 2XB4A 4QASA 2FZEA 4OB6A 4EJ6A 2HLNA 5C1OA 1F3OA 1U0LA 1PZFA 1D2RA 4C4PA 2DEUA 3HNPA 4CR7A 4ESVA 5ALYA 4KLCA 1W5TA 5J63A 5CLFA 2D0DA 3QX7A 4RMGA 4QXAA 1C7IA 3CF6R 1NW4A 4LNUB 2NVYB 2GD1O 5FWNA 3L7CA 4FDUA 2WHYA 2OQVA 4EBFA 1YZYA 2DTXA 1EZ1A 3IV7A 4Q3CA 5LA6A 3QI7A 4OV6B 4AJ1A 3KR1A 1TIPA 1JFRA 1K7YA 3RSFA 5KBYA 3MUOA 3KB8A 3Q9NA 3PXAA 4BVAA 1AQNA 2SBTA 2FNAA 1RE1A 1WE2A 1XYGA 4KFTA 4D3YA 2NUPB 3KE9A 5I6DA 7MHTA 2YU9B 4L7VA 4OBWA 3JWIA 4TMFA 4HRYA 2PDAA 3GJ7A 1ZN7A 4YH1A 4NL4H 3KM0A 1NI4A 1RMYA 2I7DA 4HF7A 4JVLA 5K3EA 5JQGA 1UWKA 1P5ZB 2FX2A 2VP3A 2YHSA 3DT6A 1VE1A 3FNGA 4N8SA 3NETA 1Q1ZA 1YOBA 2A4MA 4RVDA 4F4IA 1FP2A 2K87A 4RA6A 1A4XA 4Y0AA 3U9TA 3WZ2A 3FNHA 2CNNA 3QBTA 1N9ZA 1YR3A 4KPGA 5C2JB 4TRMA 1KEKA 3AZQA 4FN4A 1II0A 5LZ5A 4OO3A 2J5XA 1WX1A 3EASA 1CIPA 4UFPA 3OE7D 5LIPA 3V33A 2VJMA 2WWIA 1G8HA 1NN3A 1QNFA 1J7JA 2IUYA 2VHUA 2G06A 4I99A 1YD7A 3SM9A 3UANA 4DCCA 4DM4A 3PQ2A 4OXXA 5LZ9A 3SYMA 4F5EA 1I5EA 4K9LA 5C32A 1ODLA 3WA6A 2A9PA 3Q41A 1W36D 5FA6A 2BIFA 2MIIA 2MSEB 1UJ5A 2W6QA 3JD2A 4H1VA 5B1YA 4MWEA 1G5RA 1DQYA 3T5MA 1J7KA 2GJKA 2ZVQX 4Y8VA 4XM1A 4EO7A 4JXZA 2JI7A 1J0BA 1GPH1 1ORDA 4F72A 1HNXB 4IIGA 3ZVLA 3W5CA 4C7OB 3Q0TA 4C0JA 4YBRA 3PXUA 2WNIA 1Q6YA 1W85A 5AI5A 2DP4E 4P4SA 4AWXA 4JT4A 2Z2ZA 3L49A 1B8UA 3A4TA 5LQAA 4ARUA 1TNDA 3G0DA 1RZVA 4CMCA 2HWKA 3RI3A 2J7KA 2P11A 3RK4A 2YWRA 1FX1A 3ILSA 4H3SA 3E2PA 2AG8A 3LY5A 4TVBA 3TCKA 1HV8A 4DV6B 2EL9A 1AH2A 3ZS8A 2CWDA 1JLLB 5F78A 3TLMA 3FYCA 2INGX 2WJJA 4ALLA 4F85A 5A4KA 5B7PA 4DIEA 1K4YA 3T7SA 3LI2A 1AN9A 4AT1A 1FXWF 2F3TA 3T3GA 1X1EA 2I4LA 1XKQA 5A0TA 1DC5A 2M1ZA 3K8QA 3RGGA 1YS4A 4QXPA 3ZEAA 1AUVA 1MTZA 4RFVA 2WT8A 1QHHB 5I01A 1GD1O 3OEYA 4NY1A 3U7EB 3EOZA 2XD9A 2XGGA 5EGNA 4MR7B 3BXPA 1LI5A 4MEJA 3EZ2A 4UHEA 1Z7WA 2P3OA 3BA1A 2P91A 1SCIA 3E5RA 3W9UA 1AUXA 5HZGA 2XMGA 3BZBA 4RY8A 4JLNA 4C0XA 4EG7A 3ZW7A 2Y67A 4KH1A 3GX1A 1L6RA 4KQ1A 2I33A 3PA8A 2FSFA 2VQ6A 2NN3C 1QRSA 2ETXA 3AF0A 2X2OA 4U5QA 4QLBA 3GCWA 3IXMA 2DJ5A 3K92A 4BE4A 1D2MA 1E7MA 1WF6A 2A14A 4XQEA 3TN7A 1FTYA 1MC4A 4FDAA 2KMLA 2PR7A 4MIYA 1BGVA 3QPWA 1Z74A 1SUEA 1LQ2A 3LPAA 3PGA1 4FYKA 5TEWA 3GVIA 1YJAA 4H1UA 2RD2A 2PCJA 1SKUA 2IVZA 5CT8A 1XF9A 4BNDB 2MYPA 4MLPA 4B3SB 1KFKB 2XWBF 1NUUA 3HCAA 4YUXA 1BS1A 1HQDA 4NWIA 3L1UA 2ATXA 1VCIA 2A33A 2GEFA 2L69A 2WZBA 2X2PA 2XYHA 3KZKA 3MJHA 3DKKA 2D2VA 4OLBA 3IDZA 1POWA 1K7CA 1UJBA 4GFDA 4TPKA 5DDIP 4ZREA 5H7XA 2CF5A 3BEDA 1OXXK 2VNSA 4L2IB 4GLLA 1T8YA 2O2YA 3QENA 2NAFA 4XVRA 5FNVB 1UWCA 4UD2A 3ORHA 4QZVA 4K05A 1SMKA 2CBZA 1W76A 1U3DA 3LE8A 4K9DA 4OIMA 4JJ6A 4DGSA 1T9DA 3PYXA 4D97A 5A4AA 3OUZA 1TUIA 3ZWAA 3LMKA 2QZZA 5DM2A 3I05A 4DN6A 1H42A 2QL5A 1WWKA 1RC1A 4PSAA 3CR7A 1PYOA 3VR5H 2YWJA 5AKJA 1T0HB 4JP2A 1U2SA 1VJ1A 4EIWA 2CWWA 3BILA 3F6BX 5F2EA 3LIIA 4EAQA 1L5QA 1I33A 2Z04A 3F7NA 2G28A 5L9AA 2H0RA 3KZVA 4MUFA 1PZMA 1YIDA 1TZBA 5F1PA 4YRIA 821PA 1U2RA 1SOMA 5JZSA 3KALA 2L82A 3LBHA 4N39A 3U6BA 1YS2X 1D7AA 2JANA 2YHAA 5L3QA 2BL4A 3BRSA 4P3NA 5JWHA 4R01A 1ZGHA 1R9JA 1QYVA 4X91A 4F3KA 1EFPB 2PMCA 2B8EA 2CEKA 3SIWA 1EFDN 4EY5A 5DCYA 2E3JA 4XLTA 3QWIA 3IHLA 3GFVA 3W2TA 4BX0A 1ISIA 2C4TA 3EXG1 4UE2A 3NVMB 3GDFA 2IYLD 4UHFA 1E79D 2COUA 2YNMC 1SBHA 3CGWA 4YAUA 2QIPA 4F12A 1IBRA 2QMQA 3QSYA 4HQRA 1A0OA 1QIMA 4MUNA 3TTTA 4B74A 4HEHA 1EFTA 1Q3HA 3UQYS 2GO7A 4KC0A 2GRUA 2WF6A 3MCVA 2TS1A 5JS2A 4M87A 2V7QD 4B5KA 3RS5A 3U48A 3HXQA 1J49A 3G7NA 5A4IS 3K53A 3ADPA 1DC8A 2P4UA 1ZD3A 4WEQA 2W6JD 4O0LA 4Z9BA 4F86A 3IXQA 1OFTA 4RWEA 4L85A 4ZGWA 2X2EA 3LK7A 3DB1A 2XB2A 1VJTA 4W7IA 2YH2A 1S2MA 2OAP1 5AJVB 3A1EA 1P74A 4NK5A 4ACAA 1A3CA 1KRXA 3OTQA 5FA8A 3KSAC 5HQ3A 3GNTA 1FDRA 4FYJA 1UMCB 4LXQA 3G7SA 4U7TB 4BKRA 2XB9A 2A9OA 1MD9A 3F7MA 4FFDA 2JGKA 1AD2A 1QIEA 1BEZA 2FEXA 2FQ1A 2ZWOA 1F2VA 4MR9B 5IN5A 3LFUA 5I7HA 3B38A 4YAJA 4KPUA 2GN8A 3QKIA 5FTNA 5I7AA 3T1VA 5CVTA 2OM6A 3MM4A 1YZ3A 4Y2HA 1POXA 1W5AA 2YXNA 4G5FA 2Q4OA 3QUSA 4I5FA 4WA7A 5EWJB 4UQLA 3T3OA 3L05A 5FH9A 2V5UA 1Z0AA 5GWXA 1XKXA 3IFSA 4UTXA 1PGNA 2WKQA 5F7ZA 5J40A 4JX9A 5CPFA 5JPIA 2O2IA 4G26A 4G07A 1T5OA 1KO8A 1ZMRA 4CV3A 4LE0A 4EI9A 1E58A 2UZIR 1VG1A 1E3MA 1QWOA 1V4VA 4RW0A 5AI8A 4TQGA 5JVDB 4MVWA 4LXUA 1RXEA 1NVMB 4TTVA 1K63A 1RP1A 2G88A 1KH2A 5JBQA 4BX3A 4U2CA 2GM4A 5CXXA 2OG2A 4R98A 1DRVA 2G0NA 3QLUC 5AJZA 4PYIA 4AQDA 1QYDA 2DHRA 2L42A 1ZD4A 1XYYA 3CIOA 2RH8A 6PFKA 1BTOA 1U3UA 4WNIA 4BNHA 2Q45A 2P67A 4IF4A 4AMGA 4Q15A 3K7EA 3QU7A 5FB3A 1PX0A 2DM6A 4IVRA 4YRLA 2J85A 4L8VA 5DBIA 1XDSA 2Q2VA 4P5DA 1DKPA 4HYYA 4JI1B 2G9ZA 3K9LA 3PC8A 3PRKE 5TQVA 4BMVA 4BBZA 1FMLA 2IYVA 5BVHB 1FNCA 1W4RA 4R81A 1WY5A 3ZKAA 4W5OA 3DS8A 3K2BA 3K72B 3SSOA 3WKEA 4ZK6A 5ADWA 1OXTA 5ITZA 1PQ4A 1BZYA 1UKVY 2QORA 3RODA 4P4GA 3SQOA 3K6RA 3P9NA 4JQSA 4DQDA 2ZM5A 1A5AB 1ZNYA 2DBYA 3G0HA 3RVPA 3IP6A 3YASA 4M1WA 2I3DA 1JA9A 4I50F 1V96A 4HLQB 4XDZA 4EKDA 2YXDA 1YVUA 3LF2A 4DIBA 2NZJA 1JYEA 2J45A 4EITA 1K0FA 5L7WA 2QBYA 1Y5RA 4P93A 4HAZA 3RHZA 1IBSA 3HJGA 4E51A 1WXQA 1IFXA 2QUAA 3W4IA 5IKEA 4UVHA 2X6QA 2HHJA 3ECAA 2DPYA 2IW1A 3G2JA 1WUTA 3AG5A 2VQ3A 5DIZA 1KBQA 3TSOA 3ZWWA 4EW3A 5C80A 4BLVA 5BSMA 1WTAA 2XBLA 3KC2A 3GEHA 3IMEA 2HYDA 4IQFA 3N87A 4B4OA 2B9VA 3TW0A 1EFAA 3LFTA 1W59A 3O2SB 4RNDB 1ARZA 2HA2A 2H8GA 3MUNA 2IF2A 2GASA 5FT9A 4IZOA 5SY6A 3VR1A 3WMXA 3ZWXA 3TRHA 4JYAB 5BNTA 4ZC1A 2TRSB 3AZPA 2CMKA 4LF8B 4AP6A 2H52A 4Z7OB 1EFCA 1ZRHA 3FUXA 3KEOA 3WV4A 5DEIA 3THRA 1DDOA 2D5AA 1PX2A 4AXXA 2QE6A 4D0LB 1S89A 1WXWA 1AKQA 2F90A 4KLNA 4UFNA 4YQFA 3IUQA 4KP7A 3I09A 1GZDA 4WIAA 1PWHA 3IHWA 5KVQA 3H2SA 2I2FA 1T5TA 2ZEJA 2FAXA 1KZYC 4FZJA 2WWVD 3HV0A 4B2PA 2Q0QA 4Q1BA 2V65A 3TVYA 4H4CA 1CUYA 2WFMA 2QSZA 3HVUA 4KGDA 5F23A 4J0JA 1ZITA 3F0TA 3JYQA 3QYJA 4TTQA 4FZ3A 1Y63A 2VPWA 5FR2A 3WQHA 4JY7A 4BWGA 1NJ8A 1O9GA 1NLFA 4U7FA 2AUMA 2PL9A 5JG7A 4KQFA 1PT6A 3V1KA 3GPIA 4R05A 5B2ZA 2P1ZA 3IQXA 4YP1A 3T06B 3QIVA 1VG9B 1FNBA 2G7ZA 1QRRA 2XTJA 3G3EA 5DRYA 3HY6A 3OQHA 2Y1CA 1YZFA 5BUSA 4JR1A 1XHFA 3T9EA 5CB6A 2C59A 3BMOA 2Q1XA 4Q1CA 3T12A 4HVLA 4CETA 5H81A 4DLPA 4MS1B 4ZCIA 2AD5A 2F17A 3EC2A 2G5TA 3DV0A 5TF0A 3RHSA 1DIGA 3BTOA 5AHXA 1PNRA 4B17A 2ZT8A 1SOWA 4WOCA 3KOMA 2WPNA 1HURA 2V6JA 3OIYA 2QL6A 3KJEA 4FKZA 3DO5A 1Z0UA 3DDWA 4C4OA 3OLXA 5G0TA 3AHEA 5DTRA 3IP3A 1U5CA 3KJNA 4RHEA 3A10A 1WPGA 1E2LA 1XPOA 2VG8A 5HS4A 1BA3A 5ALNA 1CSEE 1KQOA 4HMQA 3AOEA 5LUBA 2C4HA 2QL9A 4GBJA 3R23A 3KAKA 3TW8B 3UWDA 4DDTA 2ZSAA 3U13A 1COWD 4EMBA 1E9RA 4RIFA 3T4EA 4K3UA 1REQB 5KJCA 1I14A 1Q84A 1W2WB 4RHFA 4CLRA 5E1BA 3WB2A 3ZHZA 1NUTA 4FZRA 4E0BA 1ZX1A 4YMVA 3NH6A 3SVTA 2QX9A 4ZEOA 4J1QA 5FBZA 4Z7QB 2YW9A 5INTA 1HE5A 1U3TA 2OHFA 4CEIB 3BHIA 1AXRA 1C9KA 3FTDA 3AIOA 3N6RA 3STUA 1GUFA 1Z47A 4ER7A 1IL0A 2MSKA 1CR2A 4EG3A 3BGOS 4IMJB 1TE2A 1Y4SA 4NOJA 1MVOA 2P1RA 1SBTA 1U98A 2XWJI 5T8KA 5KX5B 4AG5A 3IJ5A 3FCSB 5AK3A 3SJZA 3K1AB 2RHCA 3GEMA 3LZ6A 4BQFA 3DF7A 5JSQA 1U04A 2B1QA 1CUZA 1LQTA 2A92A 3DONA 2EWVA 4IDHA 3S6JA 3WDMA 4RO0A 5FOVA 3PFCA 3WAGA 4HWRA 4QRIA 5DLYA 1RHJA 5I4BA 3VPHA 4IEFB 5KYKA 3DBRB 1U0TA 3OQBA 1ACJA 4LPKA 5ADUS 1E3TA 4M88A 2HSEA 1YR2A 4BLQA 1NLUA 4BLWA 2O0MA 3L0YA 3LCCA 1O8CA 3O84A 3OLQA 1M1ZA 4LJ5A 2GAAA 3QE9Y 2C7OA 3WYDA 4PQEA 3RYHB 2HF2A 3LPLA 5IZCA 5FTKA 3JQFA 2ZGVA 3HQ4O 2FR8C 3FFAA 3BMNA 3UKJA 1EGMB 3QKUA 2ZE7A 3LC0A 3LPCA 1K8RA 2DR0A 3AEZA 2VF4X 3DKPA 4KITB 3NU1A 4BLPA 5IJWA 1EIWA 1U5AA 4NSNA 4REQA 1XVLA 3QEBZ 2YN4A 1DBSA 1WOYA 1CVIA 2GSWA 4Y2SA 1FVXA 5K6AA 3AETB 1AUOA 1ZOPA 2A7QA 3F78A 3JALA 2EZTA 2QRQA 3KEGA 1QE3A 4FOSA 5A2QA 3OQ6A 1B16A 3QITA 2WG2A 4KQJA 4A27A 4EUKA 3GK3A 2DR3A 2ONKA 3MQFA 5GZ1A 3SEFA 4B32A 4Q4JA 3PE3A 3RC9A 2WTUA 4M7WA 4XGQA 3M4JA 2C2HA 1NYTA 2HMTA 2IUTA 2OORA 4QDKA 3HGQA 2Q8PA 3IVGA 3PHLA 2VSFA 2ZBGA 2DQZA 4FEGA 1WZ2A 5JNWA 2O5VA 4QOEA 4Y9TA 1FBNA 3EXHB 3UGQA 5HR5A 4NCAA 3ENVA 1SQGA 2CD7A 3LL4A 3TVTA 4E5YA 2O3RA 4QUJA 4Y7CA 3WB9A 1A2QA 5DM70 1SWVA 1YRHA 1Z34A 3K9CA 4IUDS 1ZMBA 1JAHA 3NIWA 1FY2A 1Z5ZA 4G0MA 4Y9DA 5JATA 4HSGA 1Y1VB 4C0SA 2V54A 3BXXA 3SR3A 1QV9A 1CF9A 1ULAA 2IZ6A 2OZPA 4HNAB 2R62A 3CVOA 5BR8B 4ZGBA 2DH5A 3EDRA 4U2FA 5EJ7A 4D56A 3MSCA 1ZC4A 4XW2A 4CMHA 1CS0A 2BFAA 3GOQA 2H11A 1G1AA 2BZSA 1D4FA 1WMFA 1XQ1A 2V3WA 1CUXA 4CFZA 5CB4B 1YZQA 1QH1A 1P8AA 3GGCA 3GMTA 3GY0A 5B53A 1O97C 3UJ9A 2G63A 4FGWA 1EBBA 3TQRA 2CW5A 2QR2A 4R8KA 4RESA 3W8NA 1CERA 1NULA 4GZMA 3QPCA 4RGQA 2HI0A 3KT6A 5JSKA 1IUKA 3W6OA 3I8OA 3B20A 1MLDA 4N5NA 3WL7A 1RC0A 2QF7A 4LRSB 1Q2XA 2AG0A 3LX6A 4PPFA 2QD2A 2BH2A 1U7DA 1VYVA 2I3GA 2OGTA 2IV2X 1KR2A 5LC1A 4AN1A 3FHJA 4XUCA 4KE7A 3TBFA 4BO3A 2PUWA 4EVSA 3BDAA 1NN0A 3FPSA 4RDCA 1KERA 3LO5A 3CVYA 4ZTZB 3NAMA 3RFVA 2ZRGA 4ID9A 1ZWKA 3VR6D 1IU9A 1H9AA 2WSSA 3HU3A 1CLUA 1E1RD 2QGFA 2R1TB 2QGNA 3HCDA 4M0MA 3AEUA 3H8WA 3MHPA 3OM8A 1MT3A 1LVHA 4H27A 3TNDA 4DSUA 3O3OB 3GZJA 1UEXC 1YKGA 4MA4A 4L73A 3HU1A 1JZTA 4M4SA 2Q1WA 3F6EX 3SHOA 5D2CA 4PRKA 3CN7A 3ZE9A 1GLGA 5IBCA 5B57C 4URVR 3ZJYA 2Q4DA 2POQX 3EC1A 3EW9A 3MRXA 1Z08A 4PYOA 3V00A 3UZUA 3VX3A 1NBAA 2Z3WA 4NJEA 3ROFA 3OP4A 1JGTA 3VHXB 2CLOB 3H5LA 4D99A 2Y6UA 3C85A 2NP6A 4UE3S 5KCZA 2H00A 2PRYA 1CUHA 1V3TA 3ZCUA 4ZKDA 3K8ZA 1GCUA 2A57A 1PT9A 1GDHA 4DUGD 3TD9A 2AHRA 1PGJA 3DLCA 1YZGA 4Y2RA 5F52A 2LBPA 4BFUA 4YRJA 3ZD8A 2QGZA 5GONA 3VZSA 4BRWA 5KNDD 5L4LA 2X5NA 4WCVA 2ODEA 3NALA 4AX4A 4HL6A 2ZRQA 3VH2A 2YUIA 5JOQA 3MMXA 1SXPA 1ISRA 2WKPA 1KZ1A 3NV9A 1G7RA 1R0YA 3AOGA 3UICA 4YT4A 3C8DA 4R5HA 3JZAA 3BICA 4RENA 3QMWA 3JCZA 3KJGA 1NFQA 4JBNA 4LBVA 2NUBA 2PUTA 4TUYF 2VHCA 3R7NA 1QVRA 2ZAGA 5C1IA 4CEHB 1DNPA 2R4QA 3LX5A 3NTRA 4PHHA 1NP3A 3CWQA 521PA 1FRVA 3R7FA 4AO7A 2RGRA 2JLBA 2FN3A 4ONEA 1NWCA 2Z5FA 3H7IA 2UUBB 3E7WA 3LKZA 5CIQA 4X95A 1SHLA 3GGDA 2BDEA 4XWAA 1P1KA 1A9ZA 2CFIA 2HFKA 4GI7A 4P32A 1IVYA 3H2IA 1VA5A 2G67A 1JDBB 1ZY2A 2ZIFA 4Q7KA 3HP4A 5KREA 1ACMA 3CVWA 2P69A 4ODIA 1UINA 2OE2A 2WKRA 4KYVA 1DWUA 1SXJE 3GGGA 3EHEA 5HXAA 4JOQA 4LC1A 2WWFA 1T4CB 4TMXA 3UAYA 1XPJA 1F6DA 3H18A 1UIRA 4W1SA 4KXLA 3E82A 2WJ6A 1FFHA 2I99A 1JPNA 3DZKA 4PTLA 4XSGA 3QBVA 1PG5A 1GPUA 1ADCA 1M2OA 1VC2A 1Y8RB 1NRIA 2HA6A 3TFWA 2C7QA 2Q0HA 2EW2A 5GJCA 1CX9B 5C37A 3DOIA 5TS2A 2F4VB 1YDHA 2JCGA 1QB7A 1Q83A 2QRUA 2N47A 4M0PA 4ZZ3A 2Y0SB 4F71A 5E2IA 1V9LA 5FUXA 5CIYA 2P9JA 4DGQA 3C6ZA 4F3CA 3GLRA 1IZ8A 3HCWA 1H2HA 1KXJA 1QDLB 1N5JA 3D3JA 1JG3A 3H9GA 4ISBA 4JBHA 1N2BA 3W3AD 2WDZA 2V4ZA 4U0JA 1M6NA 2BGUA 2F64A 3A3PA 1FFXA 4OYLA 4RZUA 4ZQBA 5EIOA 4RTKA 1Z6GA 1BKSB 2ZAIA 4PZUA 3KPUA 1KK0A 3QJGA 2WWHA 3DEAA 3H11A 4KIUA 4N82A 4HQLA 5ICSA 1S2NA 1K9VF 1PJSA 2GN6A 4TL7A 1E6WA 3ZCSA 1SHKA 1TVKA 4HWGA 5HJEA 4YP9A 1VJ0A 3MFYA 3TL6A 3FUWA 4DMLA 1RJWA 3RJ9A 4X1KA 4MKIA 3DLAA 3CE6A 3I9NA 4UVDA 1HDRA 2VJQA 2X4LA 4BB5A 1OROA 2NZ8A 2PH5A 4BMDA 2BE7A 1I94B 2XKAA 3H1AA 1Y7PA 1GKUB 2OESA 2ZI9A 4L0MA 4QOFA 4JL8A 4IPTA 3ZNPA 4JB8A 5FDFA 1Y8ZA 3BS4A 2AG1A 2X6TA 4HAIA 4DB4A 5DBHX 4DBVO 1P2VA 2MHCA 3TEMA 3HXTA 4EKGA 4DSTA 3H65A 3ZZNA 2BHTA 2C7VA 1N1GA 4C6RA 1AO3A 3HKDB 5I7OA 2QTLA 5HS6A 2XIJA 1X14A 5SYNA 3AGQA 1ZHOA 3THWA 2H7XA 2FRDC 2P9YA 3NWJA 2X0FA 2J6HA 1XVVA 4HN9A 1C9EA 1I3CA 4CEJB 2NLOA 4PX9A 2JAXA 1C14A 5DPMA 5ICFA 1UPXA 3F3KA 4FB4A 5J1SB 1JEYB 2GXAA 3PNSA 3TKYA 4EG8A 2C5GA 2WU8A 4LY9A 3FDZA 1O94C 3NC0C 4UBIA 1H65A 3QUTA 2J3JA 1CDOA 2VRBA 1YASA 3JQQA 1P0IA 4OQZA 1D04A 3FFTA 3QLJA 3JSAA 3S55A 3THXA 4DW8A 2R6CA 4Y6QA 5JMOA 5K0TA 3CEHA 4J16C 4AULA 5AICA 2PXHA 5AJHA 4C4RA 2QP9X 5K51A 3EGXB 1IXZA 3GFTA 1FDVA 1D2GA 3KYDB 4JDPA 3GEEA 1ABEA 1V95A 5GPBA 4BE7B 1GFSA 4XDYA 4P4NA 2AMVA 2ADMA 2QV0A 2WG0A 2VSNA 4CM4A 3G0GA 2O5CA 2H18A 5AOAA 1T35A 5JAPA 2OORC 3QVXA 4EHFA 3O90A 4BIIA 5I8ZA 3IVXA 5LOVF 4HZUB 5KSYA 5LMZA 2XE8A 1U02A 4RQUA 5D3MB 2A1UB 4A6XA 2VPIA 1L4UA 1O6BA 2CNOA 2OBFA 1KMQA 1T1GA 4ZI7B 3C6YA 2G9UA 3UGTA 3HJUA 1T2NA 1BW9A 4EB6A 1QS0A 2JCXA 1LLFA 4IDEA 1T43A 3PQ5A 4W1RA 1NJ2A 4DCUA 1T2AA 2OFPA 5B37A 3PNVA 3PVSA 1VMAA 1W6RA 1SPXA 1QZXA 1E2HA 2X5OA 3L79A 5IJAA 4QSMA 2SHKA 5KTKA 1L7RA 3CRZA 1M3SA 3BULA 4A6EA 1CW2B 5TE9A 3VZBA 2UDPA 2VT2A 1SBCA 3A4LA 4D92A 3EQ8A 2PNJA 4P4UA 1J21A 3N7AA 1GPWB 2JEYA 4DQKA 3RT9A 1V1JA 2PZBA 2QRZA 4Y1EA 5CW2A 2IV3A 5B7NA 3NYIA 5T6BA 2ABWA 4G01B 3ZWOA 4URUR 2ZT5A 4ZCTA 3ZNOA 1FFSA 2GPYA 3BYZA 3BG5A 3BL5A 2GEKA 4U2BA 5BT9A 1UOQA 3AI2A 1DIOB 1W94A 1OAOC 2V1XA 2W8ZA 4GI3A 1W0KD 3Q2OA 3TOSA 3WLQA 5BXYA 4CCWA 1BS9A 3FFXA 3E05A 2QI9C 2WJGA 5MFPA 2ETVA 3OJ0A 3F1LA 1TVEA 1QR6A 3SJ7A 4K46A 2TMYA 1E0AA 5DHFA 1D9ZA 1LD3A 1FF9A 1QYRA 4JFAA 5JROA 1V11B 4ZQFA 2C9OA 3VC3A 2GX6A 2WVJA 1ONNA 3O4RA 5HIJA 1NXXA 4ND8A 1M5TA 1SUPA 3KKEA 2FN9A 5EYPA 4FNGA 1SC1A 1P7WA 3DVLA 4C3VA 4CHTA 3K6KA 5IVKA 1NF3A 3ZZ1A 4QGSA 5JYCA 1AA6A 4BQEA 3I4NB 3JZMA 2QN1A 3NHPA 2O8FA 4II7A 5KWJA 4O8ZA 3DE2X 3VYUB 3I2KA 3EULA 4JELA 1K5PA 1Q12A 4ZK2A 4CPDA 2OHIA 4ERXA 2Z2KA 4OHYA 1UK9A 3E9NA 4EABA 2WQ7A 4BNWA 5DNEA 5L53A 1EB9A 1FXUA 1DO8A 3ROKA 3SJAA 3GLSA 4M37A 1P0MA 2YJTD 1W19A 4INPA 2JH9A 4PZPA 4A8HA 2FR1A 1K4KA 3EGVA 2PXXA 3VH1A 4ZT7A 3OSUA 2YASA 2B3DA 3NWOA 5ALLA 5T4BA 2F1KA 3WK4A 5BR7A 3TW6A 5IDWA 1M6VA 4PG4A 3O92A 3ZXSA 5I7VA 5ALDA 4RS3A 4EGCB 3A4YA 1TZ2A 4IMPA 4PZYA 4TWBA 1M2WA 3S2UA 4BEWA 1I3QB 4LTMA 3FWHA 1XTZA 4O2BA 1I7NA 3DGFC 5E4YA 4YCNA 1TEZA 4HI0E 2ONJA 1AK1A 1IEXA 4NJMB 1NJ5A 4R1PA 5IC6A 4FILA 3EG5A 1QQTA 2IZ1A 3FDJA 3RG2A 2X8AA 3WXBA 3UGJA 1GY8A 2EL7A 3U4IA 2GPAA 3GT0A 2WWXA 4DDWA 3WTBA 2CVOA 1NUAA 1WRBA 4KUHA 1CC1S 2O07A 4YJ2F 4RDXA 3IPYA 1BDIA 1YQQA 3KVRA 1T15A 4U2EA 1FC0A 3I8XA 4Y2GA 3WYNA 5ITWA 4CTKA 3N3BC 1NFRA 4M8KA 3PNPA 5JQWA 1Z56C 3OQOA 1B0PA 3B1KA 1G2QA 1S4MA 1OI7A 1SHZA 2JAUA 2XNCA 3KXIA 1TA9A 1U8TA 1HZZC 2CJWB 4FCTA 4IBOA 5F2KA 1S02A 5EZYA 3TR6A 2PKYX 2QUIA 2VLIA 4PXYA 3V3KA 1DE0A 4AJHA 1I6KA 2CCKA 3ETNA 2ZR0A 3RYCA 1G17A 1DG3A 5JY1A 4JBWA 4ARZA 2W8BB 2XUDA 3W5UA 3HA2A 2QAIA 5TGZA 3KR2A 4EFLA 5CLJA 5LMUB 1AS2A 4MK4A 3ERCA 3W9YA 1EFLA 4MO2A 3LVFO 3THYB 1M1YA 3L06A 4B83A 1NI5A 4RVOA 1GYQA 4BNNA 5B5SA 2W2KA 2XBUA 4ZDJA 5F5NA 2ONZA 4HX2A 3WMFA 2FHPA 1L5OA 4JT2A 4W9NA 3QNUA 1A72A 2ZJ1A 3VKGA 3TLKA 1M10A 3AUJB 1YS9A 4YASA 1KJQA 2FN7A 2IPNA 3TZEA 3RM3A 5A7HA 2F3QA 5FTWA 4DWOA 2IYWA 3BCHA 3L8MA 3CW9A 2R5WA 4KVZA 4O4IB 4JLJA 3SZOA 3KQUA 5TPWA 3G2QA 2UYQA 2UVQA 3I9OA 3CX3A 3G2IA 2FQYA 2O4UX 2PUBA 3L1HA 2HNBA 1XKTA 2UZAA 3FTQA 4WPGA 1OC2A 4O63O 4E33A 5LIRA 3K6SB 5ERGB 4JKOA 1M54A 3DTVB 1GJRA 4RD0A 3JQ7A 2WIBA 2DC1A 1KY2A 1OKKD 1QIHA 3N07A 5LN1A 3SF8A 3UAGA 3NNDA 1L7EA 1SZJG 1A8PA 1SEPA 2OKCA 4US0R 4ND6A 1MX3A 3UJCA 3ZU4A 3VFDA 5M3FB 5EJGA 4KPYA 3I1YA 3SR4A 2JRLA 5AHWA 3T9FA 3A9WA 4PR3A 5L40A 2I91A 2G9NA 1KY4A 3RRBA 2X5XA 4LRUA 1X8XA 3U16A 3BM5A 5LZ4A 3ZDBA 3T4XA 1PCXA 3KZCA 2QVGA 5ELLA 3VX4A 3LJKA 3WMEA 2D2IA 4I5IA 5CAEB 4JS0A 3QX3A 2X0IA 3T7AA 1I6HB 3RCBA 4GUDA 4X63A 5BQFA 1DTSA 1G21B 3CV3A 4R54A 4CKBB 3OJEA 3W5AA 2I1VB 3V3TA 4WCDA 2A9QA 1WCIA 2BUCA 1P39A 5SV2A 4AF6A 4FR2A 2GAIA 1PDOA 3I6BA 1H4QA 1BQ3A 1Q0HA 2EKQA 2P4QA 2HEGA 1NV9A 3LH5A 3IEVA 1DFHA 2J9ZB 1I10A 2MMCA 2ODPA 3LYLA 2ARKA 2PS1A 2VZLA 2YBDA 4TTJA 3TK1A 3SFZA 4WECA 1AQUA 4E70A 1KYTA 4URWR 1I4WA 3RIYA 1T3SA 4HNQA 4W6ZA 3RU7A 4NH4A 3TM4A 3TTXA 1GT91 4B6JA 2HCRA 4Q18A 4EY3A 1AKVA 2XUGA 3AY3A 1JQEA 1R0XA 3K5IA 3NBXX 3OPYI 4KV9A 5DSTA 4AJKA 3LC7O 2B7CA 4H15A 4QTUB 5IKOA 4OLHA 1KP3A 3F74A 3GLVA 4F8EA 5AW8A 2VUMB 2BMWA 1WMEA 1QXSA 4NDNE 3FYTA 2QDXA 3MB5A 4ZEMA 2B8JA 3PUJA 5JT1A 2ZT7A 2V3CC 4GPZA 5F33A 1RJEA 1KHHA 1A96A 2JBAB 1P7PA 1Z07A 4O2RA 1W36C 3I12A 2WHQA 3T7CA 2AOTB 3DMRA 3PWSA 4A8JC 3GLGE 4JSYA 1OH7A 1UFRA 4GBGA 1XLTC 1Y6FA 2CSUA 2C99A 4C7KA 1L4MA 2XMRA 3CBGA 4OJQA 4D8TA 1OVGA 5EP4A 2M6LA 3RUCA 5CLQA 3BWXA 4GE0A 4GPIB 4D2IA 1S3IA 3BMQA 2YJ4A 5D7NA 4D4MA 2ZBRA 3O8QB 4YR9A 5DSXA 4N18A 1KQNA 2DHCA 5IC5A 1PR3A 2VTDA 5HM6A 2Q5LA 4A73A 5LNK6 3F5QA 1A98A 1QAOA 1ZK4A 4FOLA 1JBQA 2MWMA 2C42A 4NRDA 1VI5A 1JF8A 2N0SA 5BN3B 1VI6A 1ZAKA 2FN8A 3CNLA 4H7IA 4J3NA 3TJRA 2QA5A 3GAMA 3KOUA 4MWOA 3ADDA 4A3BB 1S2IA 4OBXA 2L17A 3GJ8A 4YT5A 5DGHA 4HDRA 4XLZA 2G9VA 3REQA 4IXWA 2FFHA 2GCEA 1FYXA 3M1LA 3SK0A 1P2GA 2PS9A 4BP1A 3QPAA 4OJNA 3MQ2A 2MR6A 2Y4NA 2OAGA 4RSMA 3VKHA 3BE5A 4TLEA 3ON5A 3R5SA 5DCUA 3UOWA 2O3TA 1J8DA 3K9GA 5JSZA 1SCKA 1J23A 4E13A 3N2IA 1GPKA 1ZEMA 3HFRA 3RROA 1PZEA 5IH7A 3A1VA 1GL9B 4CMEA 1NX9A 4KXWA 1EWQA 1KVUA 2WU4A 3L7NA 5D87A 5BP7A 1R4MB 3DDUA 4DHWA 5MGNA 5A4FS 4Z4CA 5F4BA 1RCUA 3GCDA 1YGYA 3EXAA 3P1JA 4JD5A 2VI5A 4NX2A 2HJSA 2I2AA 3I4MB 1JDUA 5DOVA 1GA1A 3H9UA 3IV6A 4BEJA 3K73O 3J80A 1UT8A 2QP3A 3FBGA 1KKLA 1ZOIA 1XAGA 1GZUA 3O95A 3P9SA 4LYFA 4LXHA 4QEZA 4X62B 1I6MA 4JI8B 4JITA 1BVUA 2GLXA 4P1ZA 2R7AA 5TRTA 1QX3A 2NU8A 2VRWA 2BFCA 3FVQA 4FFBB 3L82B 4W9MC 4RJ2A 1U2EA 3M3DA 1E0SA 1P1IA 1GQFA 4LF7B 3I0ZA 5BWBA 4Y7DA 1G5QA 1WW8A 1R8XA 2FUNB 1U81A 1XMJA 2OXFA 3GRFA 1H93A 1VBFA 4KQGA 4G4IA 3WKBA 3SJUA 1XMQB 1IATA 4D8YA 3P52A 4X24A 3ZNQA 3MT0A 1GYPA 3L92A 4DR4B 3CTMA 2H59A 3QSGA 1FYEA 2EYQA 3AZOA 5IASA 4ZZ1A 5KNLA 4P82A 2VSYA 5CTAA 4UBLA 3U3JA 5IK2D 1IZ9A 5DBFA 4HEJA 3UMYA 3PZBA 2IOHA 4KE9A 4D3XA 1JJBA 4E2ZA 5AJWA 5JUWA 1RQRA 1DAEA 2IY7A 2VDLB 3ECCA 4EQ6A 2QM3A 4NMLA 4YHBA 1Y9DA 1MQAA 4WLEA 1GQYA 2W00A 4ZANA 3FKIB 4GC5A 4GOJA 4J1TA 4D79A 4EHIA 2RMKA 1ACLA 2GXUA 4KU4A 3IQGX 3ORSA 3OOWA 1XXLA 2PLAA 3O82A 3A32A 2JJYA 3SX2A 2R66A 1N8TA 3O1IC 3OHSX 3U6KA 1KJYA 2ZRDA 5DCLA 4CKYA 2PX2A 3SVLA 1E9CA 1JVNA 1U2ZA 5CYOA 2RK6A 4OSPA 1MPTA 1R4NB 3DR3A 1I30A 3FWYA 4HNRA 2LUOA 4PNPA 4KO4S 3RJ5A 5FULA 3GJSA 3S1RB 1G8KA 2HWUA 4FX5A 3DCJA 4LE1A 1F0NA 4GSKA 4K9NA 3L4JA 3WLEA 1B7GO 4RH1A 5F21A 3R5HA 2Q0XA 1MC8A 4U8GA 5H1YA 4MW1A 2PKQO 1JE1A 2QT9A 2O1EA 2B34A 4MSUA 2EC5A 1H0HA 3GXBA 4ZEVA 1PS8A 1SVNA 1P8JA 3P2MA 3N76A 4WLNA 3LXUX 1B6RA 5IM5A 3R7DA 1QFYA 5DOZA 3ROGA 2O05A 4QUEA 3ZKWA 4DQVA 3M7IA 5IDYA 4HV4A 1JG6A 3E8MA 2YJ6A 3GVXA 4I0WB 1NY6A 4OXYA 4R8VA 3TUZC 2HSGA 4W8OA 3L46A 4H3HB 2WMDA 4IWXA 1GKLA 3HVKA 1DAPA 3TI9A 1IM2A 4EUEA 3HJFA 2DPMA 3GTJB 3TD2A 3NJ4A 1PWXA 3ZDDA 1C29B 4GSYA 4I1SA 1N0UA 2H4XA 3AP2A 2OB2A 3BK7A 1OOEA 4QPJC 3WB1A 3R6WA 4FGKA 4BV8A 1VM6A 2FW9A 1EG7A 1GTVA 4CM8B 2FPPB 1P1BA 1D2AA 2DRIA 2HQRA 2Q3DA 3HSKA 3ZY4A 4QUIA 3WJ1A 1KI3A 3R3HA 3SYKA 1B6TA 1J00A 3D4NA 2J33A 4PCVA 2V59A 1M34A 4ZMBA 1HYQA 3LF1A 2QRMA 4Q16A 2QS9A 1HTBA 4E2XA 4EFKA 3Q2IA 2HXYA 3KBBA 4PIVA 3CCCA 5FA5A 4IJ5A 1KMHA 4IZ6A 2GFQA 2IYFA 3RIXA 2CV0A 3TUIC 5AOCA 4CIVA 1Z0JA 3QELA 4MXDA 3AYZB 3U1TA 1XGKA 4L0DA 1I13A 4LJLA 1ZJJA 4DLBA 2PA3A 3MLEA 2WSBA 3GUVA 3LXXA 3L7JA 2XUFA 1DOZA 2EBUA 4DDMA 1Q57A 1E2PA 1B6GA 2Y66A 2BONA 4OJTA 3DWFA 4TROA 5I9BA 4ZI2A 2P2YA 4UVIA 1OLUA 5C18A 3D0KA 4ZAZA 2GCGA 1RZRA 4LC9A 3JS5A 3NHZA 3LP5A 1X7XB 1PL6A 2LKCA 4HWKA 5CDTA 4GI2A 4GLBA 4A93B 3AW8A 2ZB7A 1T1RA 4JVSB 1EUDA 4YEDA 1L7OA 3R77A 5E9WA 2QMHA 5A6VA 2QRVB 3Q5GA 2EZ8A 3LPMA 3RF6A 4KHPB 5GIPE 1EFRA 5DT9A 1NVEA 4CG3A 2YV1A 3EODA 5B58C 5KNCD 1OZ0A 4DR1B 4BWVA 1M1NA 3CNEA 4EG6A 1NYQA 1YDWA 2R7NA 1GXSB 3RSSA 5FOQA 4BQIA 2VRCD 1FLNA 3BHNA 3C3PA 4PWYA 1BX1A 1QQ5A 5DGDA 1L5NA 2NNLD 4L9WA 1MA0A 3RFFA 1WB9A 3OCCA 3GJQA 3L3BA 1YS1X 4PWZA 1VPDA 1ZNZA 2MMGA 3DZFA 4IZIA 1SQ0A 4I1OA 3AVVA 1A1SA 2GSDA 4BLUA 4D9NA 2BTQA 2J9GA 4ZEXA 1QIDA 4EO9A 4AZVA 4N9WA 3W0LB 1C1DB 3KTAA 4DILA 3O93A 1BX3A 5EJ4A 2P6RA 3KXKA 4IIVA 4MUEA 2CZGA 3IALA 3QTBA 1FBTA 1MKYA 3IVMA 4E5PA 3AINA 3JD0A 1NWHA 2ZP1A 2Y71A 2RC5A 1TECE 3UJPA 3H4MA 3P2IA 4G0UA 3RAEC 4H77A 1QAQA 3NJRA 2X86A 4QBFA 5C4JB 1YKSA 1WD5A 2FPIB 2X8LA 4QPZA 3L4BC 4WNCA 3SYNA 4WKCA 1B73A 3DYIA 2FLWA 2J31A 5E9JA 3SYLA 1ZESA 2EJUA 3OF3A 3HBLA 1D6SA 1OBHA 2QTTA 4JXJA 3S27A 1DKRA 2C2XA 3L8EA 4JC8A 4KMRA 3E9DA 1PEDA 4PX2A 3CGGA 2BZ1A 2EP8A 3PNYA 4IW3B 4DV2B 2PMZB 3MLAA 4BU1A 4WFIA 1YACA 3VVCA 1UKAA 2BGWA 4I4LA 3AHFA 4KPEC 3T5PA 1RWKA 3PE6A 2W2QA 4QUDA 3TINA 4PAMA 1N2CE 3C5HA 5U4QA 2JI6A 2NACA 2YDYA 4R8LA 4YRDA 3WGHA 4YC7A 3ZDEA 5K3DA 1WUJS 2F6RA 1XQXA 1C1XA 4D96A 3JQ8A 3BHJA 2RHJA 2BMVA 4K9SA 2W5UA 3QG5A 4GWGA 5IYZA 1RI2A 1HQKA 4PO3X 5JASA 4ZI3A 2GAFA 1TPZA 2MU1A 3CZRA 3LBAA 5CFQA 3V4RA 4ME6A 1QO0D 4DLSA 4PICA 2NVXB 4PX3A 3TXAA 5KJFA 4LXXA 2R0QC 4XIGS 1BCRA 2X14A 4B47A 3A0UA 1EI9A 1KP2A 2AWOA 3FJYA 1ISHA 5D84A 1EVZA 2Z8ZA 5J23A 4COKA 1O7JA 4L6AA 4B6RA 1E1LA 4RYLA 4PAGA 5AYVA 4DSZA 4V0SA 4HB2A 4ZQCB 2HF7A 1GIAA 1YBVA 1ZLYA 1NJSA 2V7PA 2XLBA 2JFVA 2AFRA 3A1TA 1YMVA 4MGHA 5DX0A 5AUPB 5THKA 5ICCA 3O83A 2ZSKA 2HB6A 3T5BA 3O03A 1IYZA 4ZC8A 4YLGA 2XF2A 3DBLA 1VGVA 2ICAA 2PL5A 3ITDA 1DFIA 4GBED 3D1LA 2C9MA 4M36A 4XUGB 4R3UC 5FFFA 4AN0A 1PNQA 3C1UA 1K7EB 2OHHA 1OXBB 1NNUA 1NVTA 3PZRA 3V1YA 3WLRA 1IBMB 4KRYA 4M54A 3RW9A 1MQ9A 1ECBA 4JA2A 4BPRA 5CR9A 2Z9CA 2X58A 3ZZUA 2YW2A 3ZDYB 2AN4A 1I3MA 2I6SA 4LSGA 3ZU5A 1LX6A 2I22A 4LHWA 4OIFA 1FLAA 4IGAA 4GKJB 3GLUA 1Q0RA 2HK7A 4JJAA 1TLFA 4NBNA 4BB6A 1UJNA 4DIMA 1Q0ZA 4EDHA 4PQGA 1RAGA 2FPLA 5F7OA 5AUNB 3C3JA 2ZDHA 2GB4A 3O8CA 5F3DA 3DD5A 2AJTA 2VYCA 4P08A 2K7FA 1H3NA 4NEHB 5GV7A 5ALPA 2EZUA 4N5HX 2B0JA 1SCBA 5ESDA 1EMDA 2ERXA 4KOEC 5ITSA 3AFGA 2XZLA 1M2KA 2XHEA 5A03A 3F7OA 1NKVA 1XELA 2FGKA 3G7UA 4KIFA 4B3GA 2GJ4A 3TF5A 2JLXA 3PFWO 4JEIA 3A4NA 4F3RA 3PEWA 3VU9A 1MBZA 1XHLA 4JVNA 4W6QA 4IS3A 1Q1GA 4F5YA 5K4GA 2A67A 1ISFA 4B82A 4LFAB 4LJSA 2RH9B 3CUWA 5T4FA 3FHCB 2FSHA 2RG1A 3SM3A 3FOCA 3PR1A 4LRXA 5KNDH 2XNJA 4J6FA 3EXFB 2VPPA 2C57A 3L7IA 1QGUB 1U90A 3S70A 3UATA 4DIOA 1DS6A 5K3OA 2LDXA 1N6KA 4DCPA 4YXWD 3HFGA 4P3XA 2RHLA 4HN4B 3USES 3ZGLA 3GRUA 1EWTA 3FBTA 5EERA 2I8AA 2QD4A 4RK1A 1E2GA 1IN8A 1RQGA 1A8UA 3FG9A 3FRHA 5J1TB 4PNEA 2GNOA 3STXA 4P80A 1CYEA 1EG2A 4CQMB 2LR0A 4IINA 3U81A 1O0SA 2DBQA 3B7GA 2CK3D 2FY8A 2A86A 4P7KA 4UDNA 1RWBA 1WSBA 4FGLA 4B6SA 1Z6AA 4RJLA 4CJXA 5LNK1 4IIXA 4DLVA 3RREA 1PQPA 1G9XA 2ZJ0A 3PI7A 4OHUA 2OQ2A 3OLCX 3ETLA 3NONA 4QECA 4F4UA 4MINA 4WDQA 1Z5WA 2NV0A 4QTTB 1Q5PA 2B5OA 4OHMA 3HOUB 2P9TA 3SHTA 3QV1A 4MKZA 3JWHA 2W2XA 1BE8A 3P2OA 1P9NA 3BJIC 3D3EA 4Q5IA 5LR6A 4ZGGA 5ICGA 5IF3A 1ISSA 3AI7A 1YZHA 3EEIA 3D7KA 2VAVA 4D81A 4FLEA 3ZIUA 1Z0IA 2Z8YA 2OHJA 2D5BA 3IIEA 5FOWA 5SZHB 3RJMA 3C41J 1HT1E 2VSXA 4CTNA 1E3DA 2H1OA 1KEWA 5D6OA 3T3MB 3MTBA 4AYWA 5KYXA 4FUTA 3ZDRA 4BNGA 2IDMA 1B3BA 4K9QA 3TQTA 4QDJA 4O3MA 2PPLA 1PEKE 3WNQA 1HETA 1ZH0A 2WC1A 4H59A 3V2HA 3KHTA 3IV9A 3ZQ4A 2QD3A 4ARSA 3NRJA 3WGJA 2DFNA 2HU8A 3II6X 1ILWA 4D4GA 1IDN1 1U1IA 3QYPA 1X94A 1P4SA 2PIAA 1KAMA 2QRJA 2V9CA 3PDJA 4B6FA 4D44A 1W29A 4RZ2A 4YV0A 3TGLA 3MWEB 3PQ7A 4JZKA 3K0FA 3LLCA 1N6IA 4A2CA 2FUG1 3QZUA 3WGUA 2PX4A 4RE6A 3ZHOA 4ZCMA 1TAHA 1ZVMA 2YV3A 3E5HA 3CMCO 2R1UA 4OMUA 4U0KA 3U4GA 4PLFA 1SBQA 2Q9UA 2JFUA 2ZS7A 4D3DA 1QGYA 3OY7A 2IITA 5ALOA 5CFLA 4QUKA 1Y8QA 3N2LA 1XAJA 2KYRA 5GP1A 3S1AB 4Y6SA 3KUXA 3T15A 5F9HA 3GTMB 2AUNA 5JLAA 3W9BA 4PRZA 3KDAA 5F7JA 4UTZA 2LNDA 5BV1A 1DQSA 2QOEA 2BBOA 3KP1A 4ZVKA 2WT9A 3G6KA 1XQ9A 2J07A 4D0SA 3JPWA 3QXHA 1WXHA 1DQRA 3UY4A 1O0CA 3ZJ5A 3OE4A 1V3VA 3IRUA 2NPIA 2R92B 3C6QA 2R8PA 2ZUUA 2BFBA 2GZ1A 5LYJB 3V1LA 2X7HA 1J5PA 4NATA 2FYTA 1FZTA 3P45A 3IPXA 2EHDA 4LRWA 1DX9A 1WXGA 2HN9A 1AGNA 1B74A 1E66A 1MFPA 3DAHA 1SBYA 5TDHA 5I9LA 4HD8A 5NULA 3W8FA 1M2VA 3DF9A 2VHWA 5LXTB 1V16B 2IA5A 1WKVA 1VL8A 1FOEB 1OX6A 2Q41A 2CE2X 1T1EA 3CZPA 1CQXA 3ZYZA 4D41A 4YONB 3FPJA 5ESXA 2IHVA 1YHYA 2RGNA 4QQKA 5JMPA 2F1IA 1VCHA 2GN0A 4XD7D 5DHPA 3R74A 2BR3A 3T99A 1ONSA 3HWRA 3EXIA 1UF9A 3QUQA 3NHWA 4HQ6A 1ND5A 1UMBA 1U9ZA 1CUDA 2JJ2A 3N0TA 4AY6A 1WETA 4Y3UA 4BJHB 3ANMA 1KAOA 1Y6GA 4X6LA 3TRIA 4WK4B 3Q5EA 4HQKA 1HE8B 1W0JA 2AYYA 4CR6A 3DE5X 4E12A 1ORRA 1PK8A 2IHKA 2KS6A 2WJAA 4S1WA 5AH0A 4AZTA 1ZINA 2PJUA 2V6GA 2GT1A 3QFCA 4A16A 1F2TB 4XQ0A 5CCEA 4L4XA 3T3EA 2GZ2A 3FVWA 4YCDA 3CPEA 3L1KA 1ZM2A 1QLHA 3JQ6A 1UJ4A 2OK7A 4MV6A 5I3CA 3I3SR 5T5QA 1II8B 3K0HA 2FX5A 1E64A 2D5IA 1XP8A 2XQFA 5A0VA 4R1OA 1V1RB 3CKKA 3CB4A 3K5HA 5GM1A 1P80A 2PFSA 2XE4A 3VDXA 4S1NA 5ENVA 1PZHA 3L7DA 2HRQA 3W5IA 4M9XA 3ACBA 4IGIA 2R4TA 1MAWA 2BCJQ 3TB6A 5K3SA 1N2GA 3BOSA 4ZODA 1WBBA 9MHTA 3VOAA 4MCAA 3NATA 5CDFE 3UJ8A 5AVQA 3EQ7A 5HTOA 4B3BA 1ZRMA 4M0UA 2HF9A 4NKRA 4PEVA 2GN9A 3NIDB 3WYBA 3AONB 1XA0A 4PBRA 3U31A 1OLXA 3E4CA 5IJZA 3JQGA 4IXNA 1DSSG 4BO9A 1NBIA 2C83A 2ZI6A 4MDEA 1KJ8A 1WPQA 3FGPA 1S3FA 4Z54A 3FIJA 2OILA 1QKKA 3DBHA 4DSAA 2EOAA 4JMPA 3Q3EA 1HI9A 3E2MA 5EOVA 2ATIA 4A7PA 1XCPA 2BHNA 1VKHA 1R5NA 1Z5VA 2PTHA 2XE7A 3EGDA 3ILYA 4FBMA 1KSFX 1RI3A 1RW4A 2Q3BA 3R5JA 1X70A 2A7XA 1D1PA 1Y3CE 4QRHA 2CLIB 2F1RA 4R2JA 2NW6A 3WRXC 1X7WA 1KMIY 4Q9IA 4CM9A 3FTFA 3I62A 5JAHA 1GQQA 3KB1A 5F3RA 2FKAA 1HDIA 2Z43A 1DIAA 4Z0HO 2ZVPX 2GK4A 1O89A 2J09A 4DVJA 5ALJA 3BQMB 1DLIA 4BNMA 1MJGM 1IM5A 3HOXB 2VDNB 2XWQA 5TVGA 2QP4A 3TRFA 1IHUA 2PSDA 3SP1A 2BYTA 1T4GA 4EX6A 4KODA 4YXFA 5G2OA 1Z45A 3UUWA 1KJWA 2V6IA 3MZ0A 5BSWA 5JH7F 1JIIA 1TEVA 1WHSB 1H1LA 2HA4A 3V34A 3QW2A 4JA0A 5CG2A 4LX0A 1THZA 1DO2A 1B42A 4HQOA 3ET4A 2DWPA 4QPPA 3ZY5A 4FWTA 1MIOA 4R84A 5JJCA 2P3QA 3NTLA 1HEYA 3K0AB 4Y2VA 2WF8A 3C5EA 1EWRA 3B6JA 3HS3A 3PIDA 4MMXB 4WQMA 5A1JA 6ADHA 3KQLA 1I0LA 5EJAA 4EHDA 3F46A 3GC6A 3MCZA 2G1AA 4FEAA 1F38A 2WUWE 4PQRA 2OD7A 3DV2A 3OBBA 3QKSA 4GZLA 1DWPA 4DXAA 4XVCA 3ANXA 4YCJA 2R6AA 1EM6A 3RU3A 1Z4NA 3DWEX 1SIBE 4D8VA 4K0KB 1H8EA 3B6MA 2YQ5A 1V43A 4MQEB 3C6KA 4G1FA 4IAOA 3M6MD 4AJ2A 5BMVA 1U9IC 1WUIS 1R27A 1LPBB 4P35A 4EB8A 4GPAA 4Q7MB 5CA0B 3DDOA 4N7RA 2K4MA 3A4MA 4JLKA 1LSJA 3R5KA 2OZLB 2IEIA 2PX3A 4PE5B 3GUUA 3T7RA 3TBHA 5ALSA 1CD5A 3BXEA 1TZMA 5EQTA 2BTEA 2PAAA 1PEYA 4RTQA 1WP4A 5EE0A 2W71A 3NX4A 5EMNA 2X8JB 2YQZA 3CINA 2I1LA 3WAKA 4GO1A 2QQGA 2RHTA 2V45A 2XHZA 1ECCA 3ER6A 1QB8A 4RSGA 4X3PA 3RVLA 5JNTA 2NU6B 2XTZA 3OX3A 4I9GA 1ZMOA 2GPTA 2WYVA 3HHPA 4URYR 4YB8A 2HRDA 3FYDA 4HUQB 4Q7EA 3LHKA 3NWBA 2QWXA 4WZAE 1Z5NA 1GPBA 4DB2A 2W0SA 4KXFB 1QLJA 2IDKA 1FUKA 5CX1A 3NTOA 5KO2A 3CIFA 2PFGA 3R8CA 1J2RA 3QU9A 4F45A 2PMFA 2EX1A 5CLLA 5DWQA 2RHWA 2H06A 4LDNA 3JPYA 4NC9A 5E3JA 2EDAA 2HT1A 2A1TS 2ZYVX 4H7EA 5FEUA 4F1KA 1P7CA 5CYPA 1JRLA 1RRPA 4DHEA 4CTJA 3HKBA 3PA6A 3U37A 2ZUWA 4HH0A 1CIVA 5DTMA 2V96A 4X64B 4IICA 4XCXA 4RVNA 4CV2A 3M3PA 3IMFA 5BPFA 4D46A 4FEYA 3SC4A 4E4YA 1EK0A 2BKVA 3V1UA 3WE7A 1YCDA 2XTNA 3ICOA 4CQLA 1VMIA 5FEMA 4RD2A 4TKUB 1VRCA 4NNOA 1RRFA 2BLLA 4HVTA 1IHYA 1OWLA 1LPSA 3R0JA 2W2LD 4QVKA 1F3LA 2DKNA 1DAMA 1RZ3A 1NX6A 2O3UA 4MRRA 2OXTA 5A4JA 3UWSA 1G6OA 2FE1A 4U3JB 2ZCJA 3HA7A 1BGWA 5K3FA 3HJTA 3LT1A 4R9SA 4YRZA 1NATA 3VAYA 5M04A 5M5WB 2HY7A 1XZEA 2JVKA 2PSFA 1VLZA 3I58A 2R1ZA 4M6WB 1EXNA 2OXIA 3VZPA 3W78A 4KQXA 2W6ID 1GV1A 4CIDA 1E6CA 2XVAA 3ZWYA 2PUVA 1P4GA 1K8QA 4MYTA 3M8KA 4OHPA 4FMCF 1E3SA 2Q5OA 3FTNA 4LDQA 2W58A 3LY9A 5LSAA 1K92A 2O2XA 2OSBA 4N12A 2GCPA 2JKVA 2Z6UA 2D0PB 4F2WA 2ASVA 3CZ5A 1JJ7A 1A8HA 3A14A 3F9IA 5BW5A 3GDGA 2QTZA 1JT2A 4U7WA 2YZ7A 6Q21A 1GEGA 2JHFA 1AQYA 3DMTA 3R3YA 4M0EA 2JHPA 1SOVA 1RWNA 2CMGA 1XU4A 1YIOA 3DEJA 4TTPA 4LNUA 3N74A 3AM3A 5DM4A 1EE9A 1EVKA 2ILTA 3U62A 1GGNA 4FE3A 3ZGZA 4P4LA 3EEFA 1QONA 4QJBA 5K1ZA 2A0XA 1S2GA 5DASA 1DUVG 2WPDD 4PLYA 2RKOA 1Y9JA 1XEFA 1JH8A 1DL5A 2F8MA 4Y30A 1EA5A 2WAQB 5A05A 3F73A 2O5RA 1A1VA 3S81A 3CEAA 1GUAA 2C2GA 2NUPA 3MBIA 1Q6ZA 1N6NA 5IM4A 2J0SA 4YRFA 3BB4A 2YHIB 5EXEA 3LLSA 3QU2A 4ZVTA 3UK0A 1C3LA 2W9XA 3DE1X 4G24A 4UM8B 4FDMA 5TPZD 4CUJA 5DGTA 5JTUA 3F3SA 3NM5A 3OOEA 1PJQA 2W2OA 5E7IA 3HP1A 4F6LA 2X8WA 2CHUA 2QYHA 4KXNA 1UXIA 4FJ1A 5EFOA 3OEHA 2D3TA 5C34B 3CTPA 4Z99A 2D13A 2H85A 3BWEA 3T41A 1Z16A 2RGXA 1MB9A 3GQVA 4OHZA 3ZQUA 5KS2A 3IUJA 1UJMA 4XB1A 2H5IA 4I6EA 3S29A 4YIHA 3Q8WA 3ZE6A 3D3QA 3NS7A 1ISMA 5DGCA 4AWAA 2MSWA 2Q3LA 4A4DA 1RYMA 3I52A 3RSLA 3S2GA 1JQJC 3P0FA 3UH1A 1KEEA 3REGA 4L3VA 4PGMA 3SD7A 2XNDA 2YFHA 2BV3A 1VL6A 5E7MA 4GVXA 3GDHA 2EJVA 2W98A 5AW9A 2WJIA 4BLRA 3HSYA 4QBTA 5HNKA 4O8CA 2EGHA 2KBEA 3PHCA 5DNVA 4QAQA 5FPTA 4N54A 4M0CA 3FZNA 3U0VA 2P9CA 3DO6A 1IK4A 2I2XB 3GCZA 4EELA 1CRZA 5IU6A 1D0VA 3LC2O 1MP0A 1G5FA 2I4TA 2CSXA 5JE8A 1TM7E 4TV8F 1U7XA 1U0EA 3OH8A 2YFQA 2Y0PA 2CNBA 2PH7A 1QK5A 3BQ9A 3MTEA 4LCJA 4ND7A 4GVPA 4MWBA 3GJYA 3TKLA 3CNOA 3VPAA 2O8CB 4EW2A 4R16A 3OKPA 1FNNA 5BSVA 3IEXA 1Y8AA 4E5UA 1JYFA 3T1OA 3VHRA 1MOQA 4D9IA 1M8FA 2VUUA 5E2AA 1XRRA 4MI9A 4NULA 2GBLC 1CFJA 2G82A 1D0SA 1B43A 1ZGAA 3DHNA 4DMFA 5D1NA 1AZLA 3GCGA 1UC9A 1Z8NA 2H7CA 3GROA 1QHHA 5JC8A 1K6XA 3HCPA 4DPKA 1YE5A 3FCEA 3IUYA 4QOSA 4AS3A 1SBZA 3DMHA 1YONA 1BWQA 2ZTVA 2G76A 3EFOA 2IDZA 1KRHA 2GK3A 2NNWB 1F60A 4MR7A 5C46F 1NUSA 1TU0A 4KIWA 4XIJA 3VU1A 2W70A 2JATA 4ENWA 3CSDA 3NHUA 4MA0A 3IAFA 2ORYA 3DAGA 1YJ8A 5EP2A 5C4IA 3G5TA 1VIVA 4MRAA 5BYKA 1U11A 3CUVA 4LYEA 4I9HA 2OYCA 1XZFA 2ODNA 3WHIA 1G8AA 3FM9A 3FZEA 1I4TD 4Q12A 1XDGA 2IYSA 4FT4A 4V02A 1K08A 3ZW8A 1NXQA 1X1DA 1PR6A 2IOFK 2L18A 2QAGB 3ACDA 3Q5DA 4URHA 3VR3A 1Z82A 2V7XA 1RTTA 5F5XA 2IYEA 3N75A 4WFJA 1D0IA 3BERA 4PSDA 4L57A 5CT6A 5HUHA 1BEEA 1FDUA 3JVDA 4ZQIA 3PT9A 2RSLA 3UXEA 2P4SA 3P0IA 4HDAA 1TQ6A 3T1NA 3NPAA 3TZHA 2PIDA 8ADHA 3AHGA 4FYYA 5C31A 1GSAA 3VSCA 4B40A 1PHPA 1KGSA 4CLXA 5AM0A 5ISMA 1AV7A 2P3SA 4H35A 2ZSEA 2C3MA 4MIOA 2VNKA 3LKVA 5AHRA 4LI0A 5CB8A 3HDJA 2BI7A 4QL3A 2V6BA 5IVPA 2C1EA 3GW8A 4F4JA 1NV8A 1FP4B 1XVTA 1PJLA 4I7EA 1MOZA 4WY5A 1M83A 4V0RA 5EA2A 5KTYA 1ZNQO 5F2OA 4EJSB 4NCJA 2IP4A 1QV6A 1Z28A 3CZAA 4L2IA 4TTTS 1VPWA 1Z4LA 1U9CA 1MQ8B 3M33A 1F51E 3AHDA 3LNCA 2JIOA 1RYDA 2PK3A 2VJCA 2A9FA 1NW9B 3UA3A 4C0WA 1NMSA 2UVPB 4YJ2A 4G36A 4OM7A 3A1WA 3ROEA 3HYCA 1PQUA 2YIVX 3A3KA 3L18A 1Q7CA 3LL7A 2ZWVA 4MI1A 5FUBA 3DQPA 2JGMA 5G4KB 5E3HA 1JG2A 1NN1A 2VJLA 1YKFA 3L43A 4YBZA 1BOFA 3C43A 2QN2A 4DLLA 1G8JA 1IN6A 1X1SA 4KLZA 4MHOA 4D9HA 4OFWA 3WGTA 2YZGA 2HSWA 4MVJF 5DBGA 1UM8A 4E08A 2Q1SA 2B1JA 3LVRE 3AKCA 2O8EB 2XTAA 4HWTA 2NO4A 2VBFA 1DO0A 2FEWB 1SQFA 4P5PA 1XZ8A 2PN1A 2HHAA 5DH9A 2EKPA 3HJHA 2ZK7A 3NFYA 1GAEO 1RT9A 4F97A 1ZJ6A 2PU7A 1N9GB 3NP7A 4IRMA 3V5NA 4AJ4A 1G8PA 4L8YA 3KUDA 1OLSB 3FSGD 4KQ9A 4KMMA 4G89A 2QJFA 1UKEA 5FPYA 3QEAZ 3QKTA 1W96A 3EIOA 1CHNA 1EFPA 3RUIA 4DXDA 1YB4A 3NCHA 4JSTA 3R20A 1Y5MA 2H3EA 3LG2A 1Y3FE 4LC0A 4OQXA 3WGMA 4LZWA 3WFZA 1PLKA 5FI3A 3TMAA 5JECA 4DADA 1PK7A 2F8LA 1COZA 2ZIZA 4U7HA 3SFTA 1XJQA 2FXIA 3G5LA 3TLJA 3KCNA 3K0CA 2XGSA 1QHXA 4XUEA 1P9LA 1N5IA 2H17A 3A1NA 3AVPA 3DEFA 3RYIB 5JCOC 1LLCA 2AEJA 2QVYX 4JR2A 4V2UA 4AKEA 4ZCPA 3IP8A 4RY0A 1BXRB 4UDXX 4P81A 1ZVKA 1WTCA 3BE8A 1U2TA 5C5EA 4V1CB 2IW3A 1FB5A 1KDZA 1R64A 3FROA 4OB8A 1SIWA 2WOJA 3MRSA 1Y6ZA 4QYIB 1NNLA 2V55B 1U2QA 3REFA 3T4UA 3W5HA 2QR3A 3W9SA 4LJ6A 1AQLA 3DNFA 4GX2A 1FIUA 4BO1A 2VF8A 3CRW1 1AIPA 1CJVC 1XTPA 3ZOZA 2EBWA 1Z4OA 2WI8A 3UMBA 1PL8A 1JFLA 1K2VN 4GX5A 4MUKA 4B0PA 3HDYA 1UMCA 2NYVA 3ESAA 4FIZA 4TS9A 3AM1A 3P5BA 1YDMA 3EC7A 1TQHA 1KYVA 3H1EA 4MUBA 1EQ2A 4MR9A 1JECA 3DTVD 4S35A 4F9FA 3LDUA 1XNHA 1ZI8A 1VP9A 1KARA 3OEWA 2IEYA 4NPAA 1LK7A 3ITEA 4HNUA 1CKEA 5JFTA 2VP0A 1P7YA 2ZANA 3FYUC 3FWNA 5EWJA 1U3WA 1VSUA 2NZWA 2PUEA 1N6OA 4K1LA 1XEXB 2FK7A 2P5UA 1GTSA 2H1WA 1SNYA 1G8MA 4GOKA 3KYBA 2CKMA 2YYSA 4EL0A 1X7ZA 5CVVA 2J1LA 5BUZA 4NOMA 4KLAA 2IE0A 3ZY6A 3UG7A 2GJ8A 2R96A 5C7OO 1EHCA 2LCIA 2W4QA 2AYXA 4MWZA 4P7JA 5LB2A 5JVDA 2AZMA 2HHLA 3C3DA 1T91A 1UMDB 3OP1A 1XAHA 5TLSA 1HG1A 5LJIA 1Y1LA 1RE0A 4CXMA 1E2JA 1ZN9A 2ECOA 2XQGA 1JN0A 3IX7A 3PJDA 4Q3EA 5F1KA 3D4PA 3SBOA 4L5AA 5KNCH 4NONA 3PGKA 4CMIB 1USWA 1NG9A 2DPGA 4JK3A 3GARA 4X1OA 1QRAA 3LLUA 3V2UA 3WIEA 2BMEA 1DIRA 1PG2A 1XNQB 1NASA 2MCFA 4V38A 1ZLXA 2ZYGA 4HAUA 1ZH8A 4MRSA 2FSPA 3OFJA 3Q3IA 2R7MA 4YAKA 5FQOA 3ZZMA 4MMZB 2BM1A 2JL1A 4N3CA 5BVHA 3Q9LA 4JU9A 3I73A 5TJ9A 1SCQA 3H3FA 1GL7A 4AK9A 4EHJA 2X9QA 3I0MA 3VYSB 1Z22A 3GQBA 2DQSA 2WUEA 4NCNA 4Z9XA 721PA 2CHFA 4F2HA 1HYGA 1Y7HA 4GEGA 4X93A 1ZQ9A 1JJFA 4X65B 1R9GA 2AOVA 4FWBA 3TH5A 5IWAB 2W7TA 4J9VA 2ZE8A 1W581 3BPSA 2AEFA 2UUOA 2GJSA 4RS4A 1NPDA 5LQMA 5AHOA 4QA9A 1GTRA 1CEXA 3MGKA 5CJ2A 2R9VA 4MYCA 1PJRA 1AKRA 3ZV6A 2HQBA 1UWLA 5HJ2A 4X3OA 1BAPA 2NMVA 1RACA 3O5AA 2AXPA 2X41A 1G55A 3OVMA 4IIJB 5LP6B 5T7BA 3DQZA 1IPFA 2BEVB 1E59A 3ZJUA 3IOYA 3FGZA 3IRVA 3GL9A 3UT0A 1PP4A 2O7SA 5ALHA 4QBGB 1S8AA 1X42A 1MCZA 1KKMA 5ALXA 2Y05A 3PXBA 4CWAA 2R8RA 2GBGA 5HFNA 5B1SA 1IEQA 4FI3F 5BQ3A 2JIZA 3D7SA 5JC1A 4J6EA 3RDPA 1WSAA 3FUVA 2FLKA 1NXSA 4QXQA 4D57A 1CUFA 2O59A 4RF3A 5DMHA 3BUSA 4BX9A 2EW1A 1N5OX 4MCJA 5K0NA 2B94A 2CNWD 4QYSA 4K28A 3FNBA 4L9SA 3Q11A 4QFBA 4QJIA 4DFDA 1O5IA 4FFLA 1CUIA 1Z6YA 5KKCA 2ODBA 4RU1A 1EP1B 1L7BA 2Y99A 4IJ6A 1SCUA 5TXGA 1EAYA 5B36A 1W4ZA 1CJTC 1ZUD1 1UK6A 3FUCA 4UCFA 3D4LA 3NDPA 1PJ8A 3L0PA 3V8BA 3NZEA 2NVOA 3MBKA 4AD8A 3PUIA 3S8YA 1XN1A 5AP9A 3IMKA 3WSTA 3OIFA 4GNKA 2BGKA 4KWIA 4TSFD 1FS4A 3LBYA 2LCFA 5AXBA 2VQEB 1XVUA 2WEKA 1JU9A 3NDJA 3QMVA 4MS1A 4OBEA 1ZGBA 1HR0B 1JHVA 3H6HA 1R16A 1E3LA 2F48A 3ZHTA 5BVGB 3U40A 5DN6A 3RTBA 3IA2A 3U9SA 4HXFB 1G63