1TJ5A

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 in complex with sucrose and phosphate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sucrose-Phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Hydrolase
total genus 92
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1tj5A01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1tj5A02
5FP0A 2HO4A 4NABA 4DCCA 2FPWA 3OTQA 4J03A 2G07A 2I34A 4RETA 4Y2UA 5AICA 5ALFA 2OM6A 5ALRA 3FZQA 3U7FB 3EWIA 4UASA 2HEGA 3OCUA 3S6JA 5AKIA 3WK7A 3KZXA 5AW6A 3QU5A 5AM2A 1F5SA 3QU4A 4AS3A 3B9BA 1TJ4A 4FFDA 2ZBEA 2B1RA 3SLRA 2PQ0A 1U7OA 1ZD3A 3R4CA 4ZEXA 3QU7A 3W5BA 2HOQA 3UM9A 3OCVA 4UAUA 2HX1A 3FGOA 4QQFA 5AW1A 4UW9A 1ZOLA 2I55A 4EELA 1QQ7A 2D2VA 2B8EA 3AR3A 4Y2RA 3HYCA 3GYGA 3MPOA 4BBJA 3L8FA 3PGVA 1YV9A 4GIBA 4KYTA 5ALNA 5ALYA 4AP9A 4OHFA 4GXTA 1Y8AA 2MU1A 2WF5A 4BYGA 4UATA 1RLTA 4NFLA 5AVXA 3SKXA 2WHEA 3L8GA 1T5SA 2R8YA 2FPUA 5AI9A 1XP5A 4BX2A 4BX3A 5AM1A 3W5CA 5ALPA 5AKZA 4UM7A 4BX0A 3U7EB 5AW7A 4UAVA 3BA6A 1L7PA 1NF2A 2W11A 2WF6A 4I9FA 2R8XA 3FVVA 1L7NA 2YJ6A 3OCXA 5AESA 1RC8A 1QYIA 4KX3A 1N8NA 1S8OA 3ET5A 1O08A 4BNDA 1MH9A 4YIKA 5AK6A 2I33A 4AS2A 1Z4JA 1Z4NA 2W4MA 3FPSA 2ODAA 2IOHA 5AVSA 2Q5EA 3A1DA 2PR7A 4DWOA 1S2OA 2BDEA 1L7OA 5AVVA 3L1VA 3HLTA 3ZVNA 5AVYA 3ZW7A 2YJ3A 3BWVA 3RF6A 3WKBA 3QYPA 2YBDA 4UARA 1YNSA 2WM8A 3NIWA 4EX7A 5AW9A 4NWIA 3WGVA 3WK8A 2YMMA 5AKEA 3ZUPA 1L7MA 4DW8A 2FUEA 3WKDA 3U7HB 2I6XA 1Q92A 4Y3UA 3QU2A 3U26A 2Q4RA 3ZI4A 4FYPA 2B82A 2AUTA 3QUQA 4QJBA 5AK3A 5ALWA 1QQ5A 5ALSA 1EK2A 3L7YA 4RESA 3UMCA 5AW8A 2P11A 5AW2A 5AIAA 3ZVLA 2B1QA 4XPZA 4XE5A 5AI5A 1Z4MA 4OCZA 2G08A 1ZS9A 3EPRA 3U19A 2MSNA 1RLMA 4IG4A 3DNPA 3QUCA 3AR6A 2GHQA 3I6BA 2BY4A 1L8OA 2ZOSA 2X4DA 5AW3A 4Y2JA 2WF9A 4Y2YA 4C4TA 2FDRA 3AR5A 2QYHA 3QX7A 3VAYA 2YMPA 2EARA 2C8LA 2HCFA 5ALIA 1Z5UA 3D6JA 4I9GA 3MMZA 3WK4A 1L8LA 3PGLA 2GO7A 2DQSA 3E81A 3KD3A 4HAIA 3WK5A 3KDPA 1LVHA 5ALOA 1ZD2P 3NALA 3ZWKA 4L6AA 2ZXEA 1ZD5A 2G0AA 3B9RA 4HGPA 2YFYA 2JAUA 2WF8A 2JGAA 4HGOA 2GHTA 2G80A 1VJRA 4ZEVA 3QUBA 4YCLA 2CN1A 4EX6A 3QU9A 2IA5A 3NASA 4L57A 1QQ6A 1U7PA 3NANA 4CF4A 2R8ZA 1RMTA 5AI0A 5AW4A 1Q91A 3ZVMA 3UMGA 4PNHA 2O9JA 4Y2VA 3KOOA 2HI0A 3B8EA 3WKAA 3OCZA 3SD7A 5AVQA 3L1UA 1RKQA 3AR8A 3L0BA 4JB3A 5IT4A 1CQZA 1ZJJA 1Z4OA 3PCTA 1LTQA 1RMYA 1Z4LA 4Y2XA 1SWVA 4YCMA 3CZ4A 4L6CA 4KNVA 5ALEA 4F71A 4UMVA 2C9MA 1JUDA 1WVIA 4EEKA 1TA0A 3RFUA 4JDPA 4G9BA 5ALKA 3E84A 5T41A 3ZTYA 4FE3A 1RRCA 3WKEA 3AR7A 2OBBA 5AKKA 5ALUA 2QLTA 4B6JA 3MN1A 2BDUA 3N1UA 4YCNA 1YDFA 2PKEA 2HF2A 1YMQA 1Z4PX 1Z4IA 4BEVA 1SU4A 2IOFA 4KNWA 1X42A 1NRWA 5AHXA 2YJ5A 3PDWA 3QNMA 4HGRA 2FI1A 3ZWDA 2B8JA 5AM4A 2JAWA 5AKYA 5AW0A 2YMLA 5AVWA 2YN4A 5ALLA 3OCWA 1FEZA 1U2SA 3DV9A 4UMDA 3W5DA 3K1ZA 5AKXA 1Z5GA 3A1EA 3AR9A 3FM9A 2HF7A 4CF5A 4HYTA 3L5KA 4MUMA 4HGQA 3OPXA 5ALXA 2ZBFA 4O8CA 3DDHA 3QXGA 5ALQA 2G1AA 3L0CA 1QH9A 3R09A 2CFRA 2O2XA 2YMQA 4BEWA 3N28A 3ONNA 5AVTA 2WF7A 5A3QA 4F72A 1T5TA 2NO4A 3A1CA 4YH1A 1RQLA 5ALVA 5AKLA 2HSZA 4YGYA 1Z4KA 5ALZA 3NUQA 5AVRA 3WKCA 2G06A 5AM0A 1XPJA 4G63A 1J97A 2HHLA 4J2TA 5AM3A 3EF0A 4HGNA 2NO5A 5AW5A 5E0OA 1TJ5A 1T9ZA 4CF3A 4Y2QA 1L6RA 5ALDA 1YS9A 4Y2SA 4Y2TA 3MC1A 3R9KA 1YJ5A 4Y2PA 2C88A 4KN8A 2EAUA 4E88A 3IRUA 1ZRNA 1XVIA 3DAOA 4CNQA 5AVZA 2GMWA 1SWWA 3AR2A 3I1YA 2P9JA 3U13A 4MWOA 2I54A 2C4NA 4C4SA 1WZCA 3L8HA 5AI6A 5A3RA 2ZBGA 2RB5A 2IYEA 3ET4A 1EK1A 5AIBA 1J8DA 2YJ4A 5ALGA 3N8GA 4BNDB 5IS2A 3WK9A 2CFTA 3J7TA 3N5KA 3QUTA 2G09A 3EF1A 2VKQA 2JARA 2C8KA 4UU0A 2CFSA 3WGUA 2AMYA 3OCYA 2FPXA 5JJBA 2RARA 3E58A 2IOFK 3N07A 3F9RA 4BKMA 3ESQA 3KBBA 4CE6A 4UMEA 2GFHA 3I76A 5A3SA 3E8MA 3ZU6A 2AH5A 1U02A 4UU1A 1KYTA 1U2TA 4XQ0A 1TJ3A 4XOUA 3AR4A 5ALJA 3W5AA 3ED5A 2ZBDA 3L0YA 3QLEA 1VFPA 5ALMA 3SKYA 3I28A 2RBKA 2FPRA 3ZTWA 1IWOA 4NAVA 5AK4A 4DFDA 4IFTA 2B30A 5AK5A 2Q4TA 5AI8A 3IB6A 2NYVA 1RPZA 4ZEWA 4H1WA 4OD0A 5AI4A 2ZG6A 5ALTA 3ZX4A 4C4RA 1WR8A 1ZRMA 4UM5A 5IT0A 2R8EA 1RQNA 2JAOA 5ALHA 1PW5A 5AKHA 1O03A 5AM5A 1ZD4A 1VJ5A 2WFAA 1WPGA 5AKGA 5AVUA 2FEAA 2EATA 1RKUA 3SHQA 3SMVA 5AKJA 1K1EA 4EZEA 1RKVA 1RDFA 3UMBA 1RMQA 4KX5A 4NV0A 4YIHA 1N9KA 1NNLA 3NAMA 2AGVA 2P69A 2P27A 3FPBA 3ZX5A 3P96A 2HDOA 2B0CA 3SF0A 1Z88A 2I7DA 1AQ6A 1Z4QA 2FPSA 3U7GA 3ESRA 3M1YA 1RLOA 3NRJA 3TLMA 4OFZA 1CR6A 3CNHA 4EENA 4UMFA 1TE2A 2OYCA 2RAVA 3L8EA 3WK6A 2YY6A 2OA0A 3QGMA 3KC2A 3IJ5A 3M9LA 3A3YA 2W43A 2FUCA
chains in the Genus database with same CATH superfamily
1B7GO 4CJXA 4D4MA 4B47A 4A3MB 1V47A 4YVFA 1N2GA 1EFCA 4OAOA 1YZQA 2MT9A 4JGBA 4WFIA 2DSTA 1XD2B 3DZCA 4NNPA 1JPJA 2D2FA 3VTAA 4AWAA 2VK1A 3SQNA 4KXFB 3KALA 3NT4A 2H52A 2XWBF 4OSOA 5A1TA 4V2IA 3K35A 1EX7A 3R5KA 4K05A 1PJ2A 1GPUA 3NJRA 4S04A 1LW7A 2Q3HA 3ZI0A 1QH1A 1QIIA 5PGMA 1SJ9A 3AK4A 4ZO6A 3S6JA 1HWYA 4D81A 3BD7A 4C88A 1Y7HA 5GP1A 4XD7A 4N3AA 4BO8A 1ZGAA 1QGED 5IKOA 2C4MA 2VJCA 3RFXA 3UH1A 3RVQA 1AA9A 4L6IA 3K16A 3IURA 5EAIA 3R7DA 4WTOA 3M6LA 3OOYA 5EIHA 4C6HA 2JFHA 4M0LA 4FN5A 1TEZA 4UBIA 4J0EA 3EVTA 3I2IA 5HRAA 2WMYA 1KEUA 3I9KA 2FSIA 1QG0A 4G09A 4QASA 1XJQA 2Q4OA 3ZWOA 4WBNF 4CEHA 1GFIA 1WXDA 2FQYA 4XTRA 3F4BA 4QWWA 1U65A 2NNLD 1V16A 4A3GB 4MAFA 1R74A 4AJIA 4P5EA 3ETLA 3SE7A 2IGTA 5BY2A 4MVJM 1KI6A 3EWNA 2HADA 2HNAA 4O4HB 4CV0A 1GZSA 1M5UA 1DWPA 1BEZA 3GEHA 3KB6A 4ZKDA 4Z3OA 3P2MA 1A2QA 1N2ZA 3OY2A 1D2AA 4HWGA 1E1YA 4DM7A 1EFDN 5JAIA 3I05A 4BX2A 5KTPA 3OLWA 4CTMA 4DR7B 1M75A 3AI2A 1MAUA 2ZTVA 3DJYA 1TW2A 3N53A 4TXMA 1BQ4A 2LV8A 2V45A 4EYKA 2O1EA 1L3CA 4KFRA 1DKQA 4GZMA 1VC2A 3A31A 1J8YF 4NZNA 1GKKA 3GTOB 1L9XA 2F43B 2AXEA 3G2HA 1TU4A 1EGMB 1L7XA 3DTYA 4AN1A 3BQMB 3ZE0B 5DYNA 4TYWA 3LUDA 4PBSA 1AH2A 5DTJA 5I47A 4L4RA 2AB0A 1B1CA 4GF5A 4MRVA 2HJHA 1KSGA 5FWYA 3ON5A 1UOQA 3IS3A 5TNXA 2E6UX 3LTEA 3DGFC 2G82A 1GHTA 3KTOA 1VYHA 3AF3A 4ND4A 4PANA 4RPLA 1VRCA 2V65A 4U2FA 4AP5A 1Z7EA 1XI2A 1XQVA 1YU9A 2QN8A 1TYCA 2VJYA 1GA6A 1ZH8A 3DE7X 5CH3A 3HZRA 1YJ8A 2NNWB 2OQRA 2XSZA 3QOFA 4IX1A 3W04A 1OH6A 2R0QC 1AKVA 2ACKA 3QFCA 1ZM7A 4YUAA 3ZJ5A 2NP7A 1KEVA 3C6XA 1THMA 1KO8A 2W90A 2VBFA 3AFIA 2W2LD 3FNRA 4KSCA 1E9SA 1J23A 4ZU6X 5D3ZA 2JA7B 4J0HA 3QSGA 4G5RA 4N1AA 1KI7A 3GVPA 1U5AA 3ELWA 4I0WB 4QSHA 2MCFA 4X64B 5D7NA 5KMGB 1ODTC 2WTNA 1R16A 2XMSA 2Y8EA 3FTDA 1GNPA 4QUEA 1OQAA 2R00C 3L79A 5LZ7A 1IDN1 3MAJA 3HOZB 3B1WA 4OGGA 3TNJA 3TS1A 2Y9MB 1IXKA 5HQTA 2ZU0C 3FHJA 4UFNA 1OWMA 2ZDQA 4FYYA 3DDZX 4HX9A 4LXUA 1HI9A 1WVMA 3NNDA 1FMTA 1SCJA 4BNFA 4DNXA 5C3MA 1QQ5A 1F1BA 2BSXA 4C78A 1PZHA 4GW3A 1XTIA 4K87A 4ZVRA 2P9CA 2AFHE 4RQBA 2NXNA 4XYBA 2QR3A 4QHSA 2VDWA 5LMNB 4XPZA 2JB9A 2AG8A 4B3MB 3KT3A 3CVUA 2WICA 2F2TA 2ZYRA 3GA7A 5DNAA 4AMBA 1H1LB 2W0MA 2BGJA 2WYWA 3EPRA 5B5SA 4B3CA 1U7DA 2ZAIA 4XUEA 3I1IA 3WHIA 5CFQA 1CQXA 4I4TA 1KYVA 4BP3A 1P73A 3DAFA 4M0UA 3WL6A 3RBXA 1Z8HA 3WMFA 4OIFA 2XUDA 3ANXA 3KLBA 1Y4SA 5G0TA 3ZUGA 1R5BA 4YAFA 4B82A 2OCGA 1W2GA 3QBJA 5JALA 3OPYA 1SIUA 1J0EA 4NCJA 4E30A 5F78A 4M36A 1V1RB 4MVJA 1J49A 1XZCA 3OA2A 4AKEA 5LQNA 3I0ZA 2TS1A 4JUAA 2JA2A 2H54A 2UUPA 3CSSA 3KLNA 4GEGA 3VAYA 1Z9BA 4ZAFA 4E4RA 2ZRIA 3M3PA 4LFAB 4Q3EA 4KN6A 4R9VA 3SGLA 2HMYB 1I6LA 2PWYA 4CDGA 3OH8A 3WGHA 4HQRA 1KI9A 1PFKA 1WCWA 4FHDA 5EE0A 3B12A 3IRVA 4Z4CA 1V4BA 3D8UA 1KZ6A 4KWHA 3O4VA 1T1IA 2CXOA 2PA0A 3QFRA 2R6HA 1EFTA 5I9TA 2RGWA 4YTEA 4ZC1A 5ESRA 2UV8A 4L6AA 2QVLA 2SBTA 3TTTA 4DIUA 3QXCA 4DR5B 2FGJA 1G42A 2P9TA 2VNHA 1HK7A 2NT4A 3ZZUA 4P3OA 1WHSA 4NG5A 4ZTBA 4L9RA 5DM60 3K1AA 5AXBA 4YRNA 3H3XA 3EZGA 3G23A 3VM6A 3THWB 1EWKA 3L7KA 1ZL2A 5TEWA 2XF8A 4PZPA 4QBTA 4E5NA 1AX9A 2HGZA 4QT4A 3UF0A 4L57A 5B3JA 1QQ6A 3J81k 1PFQA 2WJVA 4OKIA 1A69A 3NXSA 1SBZA 1U9ZA 5EKSA 2AFVA 1O5OA 4CV2A 2LIPA 3G49A 1KK0A 3SE0A 4FYHA 1FTWA 2QLLA 2C9BA 2VF2A 1NHWA 1N2EA 2JHAA 1EE9A 1G9TA 1XAJA 2OC4A 2PYIA 3CG4A 2L2QA 2JCSA 3K32A 4R8LA 4UC0A 4YQZA 1E59A 3KT6A 4N03A 1X38A 2FR8C 2JHPA 1I32A 1NVEA 2QAIA 3CUSA 3OZUA 5EHXA 4RTNA 2VRCA 1Z83A 3CW8X 3DLAA 4U9IS 4DV7B 1G8YA 1G98A 1X1EA 2JLSA 1OGJA 1ZU4A 2OXRA 1ZCAA 1ND6A 3OOJA 3DTVA 4GLBA 4I4NA 1XZGA 4MHOA 3VMMA 3AEUA 3LRTA 3VJKA 1EXNA 1KQFA 2CNKA 3JQCA 2C9MA 4DG9A 1QQBA 1DELA 4RTPA 2R86A 4O3FA 1HE8B 3ZQ6A 1MQ9A 2W5UA 1ZIYA 1V3VA 4LXYA 5ALKA 3C14C 4EA6A 1E69A 2ONYA 4RF2A 2DC1A 2ZRJA 3PUYA 1U1CA 1CHDA 3HN7A 5LXTB 3OD1A 1UIMA 1EIWA 1UJ6A 5J5CA 2XE7A 3JQAD 3AIMA 2QX4A 2WTEA 3KDAA 3SIPA 2P9YA 3AB8A 2NZ8A 2YZKA 3TW0A 4BXOA 4DLUA 1BTOA 1O0BA 3E7FA 4ZK2A 1KAGA 1P7VA 1Q0UA 2HRDA 2AS0A 2WUVA 4FILA 2RBEA 2VZ9A 3RBZA 3MWLA 1II9A 2I3DA 4NATA 4URVR 3QWHA 3IE2A 5I7WA 1K6JA 2GJ8A 1JKJB 4I36A 2GEFA 1X86B 4G5HA 5BXYA 5L4LA 5CIWA 5AKYA 4TS4A 4LCEA 5LBTA 4AN0A 1J2RA 1D2HA 3KSRA 4FM9A 4RMIA 4EBFA 1W25A 1G7TA 3MFQA 3VC3A 4Q9DA 4ZCPA 1DKLA 1FLDA 2I1WA 5G4KA 4O63O 2GQ0A 4Y1FA 4A8HA 1A76A 5EJ9A 1CR2A 1TMGE 2TMYA 3GP5A 1NUQA 3MS2A 3P1JA 3SY8A 4YJ2A 1FYVA 2PX2A 3IPCA 3OOEA 1R10A 2Z5VA 5C0OE 2JVKA 2JFBA 1XKQA 1P8AA 3F97A 3TO5A 3WB2A 2FE1A 4CF5A 1CG6A 5ICSA 4TTTS 3QKSB 4IIUA 4TUYA 4GMDA 3FCAA 1GPLA 4F85A 1LKZA 2OGUA 4A8TA 1VB3A 5ALQA 2Q5HA 4YBRA 1QH9A 3G7UA 5IVPA 4DOMA 3FDJA 1H94A 2YMQA 5KOYA 1XMIA 421PA 2WF7A 1LX6A 4Q34A 1DKNA 1L8QA 8MHTA 1ORIA 4HX2A 4OA5A 2B98A 4GX2A 4HX5A 4R2WA 2Q2VA 4ZHQB 1I4OA 1B14A 1W4CA 1YR1A 4WN9B 2PGNA 2FZCA 3A6JA 3NIDB 2FSVC 2ESRA 5B53A 3WZMA 1PX0A 3D6MA 1OZHA 1Q0PA 3TKAA 3ZXYA 3DPIA 3LWNA 3LCJA 3DOOA 3M7IA 1WKCA 4R2MA 4UAJA 3WLSA 4TL8A 5AVRA 1V3QE 3OP1A 3F0TA 1WKVA 4MI1A 1KOLA 4AZ0B 1IHUA 1M2FA 3NDPA 1L7BA 1H2AS 1Q0HA 4GGPA 4JEHA 4YDHB 3NBXX 2PS3A 1RZVA 3W79A 1X1RA 2OSBA 4TVSA 2CF5A 1WUTA 2XBLA 5DGIA 5IAJA 5FHQA 3LTNC 2DUMA 1ENOA 1LBHA 1Z0FA 4ENVA 2IU4A 3FYUC 3BBPA 1DG3A 1JQDA 2XRZA 1DKOA 3NLLA 1KK1A 5A5FA 5K0TA 5L7TA 2C5HA 3Q8WA 2XUQA 4BFWA 2QVZX 3QVTA 4QDXA 1P72A 2C2BA 4JSRA 4N41A 5CM9C 1XVIA 4EJ0A 3JAWA 2V7BA 1IG3A 4E2XA 3WP1B 4WZAE 2AF4C 5KBYA 2WJGA 4LJ9A 2Y4OA 1JKMA 1J1IA 1K08A 3LCVB 4LHZA 2G0NA 4MWOA 3LL7A 4OP1A 4WNCA 5HE9A 3EASA 3CIFA 3UJNA 1KO7A 1VL0A 1QR6A 2YR0A 3EJ6A 3KYIB 4UUOA 5ED4A 9MHTA 1KGSA 1YB1A 4H59A 1KFKB 2ZBGA 3VHQA 3E8XA 1W94A 4YJGB 1H85A 1N6HA 2I8CA 4UBLA 4F60A 2ENWA 1OIXA 2HD4A 2WSSD 4PYKA 5JYDA 5KC8A 2YJ4A 2B2CA 4K9RA 3I01M 1T6YA 4NZZA 4P0TA 3UOAB 1U28C 1ZHOA 3B13B 3EISA 1E5VA 2ZUDA 4MGYR 2I6SA 2NVUB 3SF8B 3VKUA 4R68A 3R0IA 1NMYA 3BXGA 3Q40A 1N4DA 2NLOA 2FUG1 2I4RA 4DJDC 3BMOA 1AHPA 1FQWA 1W5TA 1C9YA 2XUAA 4ZVSA 3P0EA 5CT9A 2GJAA 2ZJ3A 3P2IA 1TKAA 1IVYA 2NQ2C 3UJCA 3G89A 1T9DA 5DK6A 1NATA 3IO3A 2B6NA 2OK7A 1BHJA 3X1KA 4KXMA 2EX1A 5HCIA 4UHHA 3QVGA 3DEIA 2BM9A 2V7TA 2R66A 1GXSA 1XRRA 3AERA 2J6BA 3KBBA 4R7ZA 3FVQA 1SG0A 3H4VA 1ODLA 3KKNA 3NHUA 5IVDA 2Q6KA 2PH3A 3C3MA 4F5WA 3MMPA 2I6GA 4M98A 1IQRA 3SSOA 4GYKA 1QHHA 1EMDA 4YRFA 3GMTA 2YV2A 3COZA 4EI9A 1V4VA 1B6GA 4U2CA 1E2JA 4J75A 4B83A 1D4ZA 4LZZA 4RJ2A 2EJUA 1MVLA 1QIGA 1KR2A 3DUFA 2QRVB 3UKDA 1N77A 2CXQA 2WJWA 4PYNA 3IIMA 4QTXA 1EM8B 4RPIA 3UOWA 3IIKA 4EFMA 1JEQA 3AZOA 1PR0A 3SNKA 2FPRA 2YWGA 4UNIA 2G88A 3FA2A 3HP1A 3RM3A 2YS7A 5KNDH 3FZGA 3MAAC 2XTAA 2CVOA 5COBA 2R96A 3R0ZA 3VZRA 1Y6ZA 3ABZA 3FF4A 3WRVA 1PFGA 5AH0A 4C21A 1H6CA 4EIWA 2YNMA 4TZTA 4IKOA 2RGAA 3EDCA 4LZWA 2I4TA 3UMYA 1JIIA 3KUXA 3RT7A 4DPMA 2YU9B 3WQHA 3IH5A 1CZOA 4XW2A 4RD0A 4C4RA 4FR2A 4JQSA 3V00A 1BAPA 4AKTA 1BCSB 4B7ZA 3DFFA 4J4BA 4D02A 3EFBA 1A7AA 4AMVA 5FBHA 10MHA 4LI0A 1W75A 2H06A 4KW7A 4KRFA 5IHPA 3FKIB 1K83B 4DY6A 3OZEA 1UUFA 1ZMTA 3BB3A 2H8KA 4IHJB 2BHTA 3ZJYA 4X85A 4ZDIA 1YKGA 2NTJA 5FI5A 2WWRA 4XVRA 4ARZB 2VS1A 1I2AA 5FQOA 4IEFB 2VPTA 1Z0IA 3RAEC 1DHRA 3OHPA 3WLNA 4KODA 1H2RS 1X19A 1XG5A 4B2PA 3LKDA 4L08A 2ZPTX 4ISCA 4P5PA 3RS0A 4YXWA 2O54A 1BW9A 1BMQA 1O9GA 3FPBA 1KAEA 3DEJA 4QUIA 1OI2A 3FHCB 3BE6A 5KSWB 1Z07A 1TM4E 2QD1A 2AEJA 2QORA 1C1DA 3D3NA 2I7DA 3U6BA 4ICIA 4UHKA 1DC3A 2OUIA 4CW7A 3FZYA 4DT1B 1DSSG 1E32A 4HR7A 4JBLA 2ATEA 4WIAA 2E6KA 3QFSA 4C22A 4OFZA 5EXXA 4OHOA 2YWXA 3OCCA 4K46A 4URYR 3UQZA 2Q0QA 3PXUA 2I6UA 4H7KA 2BOVA 3NTXA 3VR4H 1M54A 3AMVA 5BXQC 4DNFA 2P5UA 4RCVA 3KC2A 2AOUA 4H27A 5A4FS 6ABPA 2WV7A 3LQ4A 5T8KA 5H4GA 1HEYA 2AE2A 3NM6B 4XASA 1C50A 1NXPA 3N2GB 3OZGA 3T54A 1WMBA 1ZKDA 4PSDA 2HO4A 1SUEA 4WUTA 4NY1A 4O0MA 4IOKA 2OFFA 1EHIA 1RPJA 4DE5A 1A2BA 3G0OA 3M81A 3H7IA 1QONA 4MI3A 3RKSA 3ACBA 3U4QB 3OZFA 1LBTA 1P9RA 3W3ZB 1B2LA 2QIOA 1BYIA 1RRGA 2VP0A 2YDXA 3A2MA 2G07A 2ZT6A 3GELA 3KZ1E 3LGAA 2VVTA 3EQ9A 3IPLA 3R6DA 5AHWA 2FQQA 4GZ6A 3SOPA 5BQFA 2QMHA 2HLDD 3FH0A 3JSXA 1QVWA 4ZV7A 4TSKA 4CDMA 3FTPA 4BO9A 4ZI7F 4HAXA 2ECFA 3VH1A 1NXOA 1X2EA 1W9HA 1WE2A 3L05A 3QU5A 4PO3X 5I7SA 4FFLA 2RAFA 3KVRA 3TE7A 2QW1A 2QRJA 1ZD3A 2BHRA 4RDXA 5I7UA 2HOQA 4DMMA 3CPEA 3K20A 3OCVA 4W9NC 2CXXA 2JJ1A 2YV3A 2YXLA 1DKPA 4D3YA 5JD6A 2MSCB 3LBYA 3QLJA 1N6LA 3DUWA 4P3NA 1JFVA 3CWQA 1M6VB 3GOQA 4MUGA 4ZAWA 5CH5A 1D2EA 4BX8A 1QTIA 3Q7PA 5EZYB 1TWGB 2BLNA 1EG2A 3IQEA 2O19A 2I3AA 2A57A 3PQ3A 3ND8A 4WD3A 2PLFA 1VMEA 3E0QA 2ZEJA 3Q2IA 1C0IA 2VPZA 2FG6C 3CBGA 3IP3A 1J70A 3JZAA 4OHFA 5ALYA 5K3FB 2IEBA 3RARA 3O7WA 3RIGA 2KPOA 2ODBA 1J56A 1ZGGA 5DRYA 5GJBA 3CO0S 3HBJA 4C4ZA 4M1MA 5KO2A 4AO7A 4GUAA 2QTAA 4EUSA 1OH7A 1ETHA 4WESA 4XVQA 5JCZA 3BBLA 4L73A 1IN4A 4YWHA 2XGJA 2J3DA 2NW6A 3LF2A 4M3NA 4F86A 1NI5A 2HM7A 1NLMA 4N3BA 1QP7A 3U62A 4C7VA 1GFWA 1KR5A 4LECA 5EIFA 5GVRA 5LZ5A 5P8WA 1KZGB 3I9NA 1F7VA 1HDEA 3PJRA 5ALPA 4I1OA 3GG2A 1KMQA 3GRUA 1O57A 3N6RA 3FNQA 3LQ2A 4KDEA 4RD3A 5JOQA 5JS8A 1I3KA 1LVGA 4L95C 3WRYC 2YWEA 2WWHA 1V11B 1GT91 4GRAA 4M7PA 3FVVA 2O2DA 4LPSA 2I2XB 1C3EA 3IVGA 5NLLA 1KP3A 2DB3A 1ZVQA 3TDMA 2NO0A 2ORED 4IIYA 2VYVA 1LWOA 4KX3A 4GXQA 5IAKA 4GE3A 1U1FA 2J9FA 4F8JA 1G4HA 4ER6A 1VE7A 5A1JA 2R87A 5A9TA 1TYBE 2REOA 4BKOA 1DAFA 3O31A 4X65B 9LDTA 2VP3A 4NU5A 1J06A 3KXKA 4P2GA 2UUCB 2XXAB 1F3LA 2XQFA 1YRBA 1ND5A 4RIFA 1NXTA 4K9OA 2NYAA 4BBZA 2BAGA 4F9FA 2DQKA 5I9LA 3AOGA 5KIAA 3PIDA 2BGGA 2PGIA 1WB4A 3BPSA 5A4IS 2Z2KA 2V7XA 3G6WA 1EFVB 4NX2A 5JANA 2IS4A 3OQIB 4KXVA 1X9GA 5DBGA 3VBCA 1Q7CA 2DFPA 2P91A 1ZIPA 2C98A 2IYPA 1GSAA 2L17A 1JEEA 3IJPA 3KZVA 1FIUA 3O1HB 4PAGA 4R7GA 1THGA 5P21A 4B7AA 1HY3A 2H2GA 3LHDA 3ZWAA 3N2EA 4P80A 5LWHA 3W6NA 4B3TB 3F74A 3OQPA 3SR3A 2WFLA 3ZGLA 5GOZA 1T0UA 3G82C 3ZU3A 4UBNA 3RRZA 1DTWB 4FMCB 4MHTA 2FE4A 5TGDA 1T4CB 1JLKA 1SEVA 4QBFA 4TN5A 1EVQA 3S2ZA 4YBZA 3RRMA 1KHTA 2MHCA 3BS4A 3PQEA 4TTIA 3HOUB 3V6MA 5JBNA 3C4VA 1SBYA 2HO5A 2OG2A 4B33A 4CMCA 4HLUA 2XVXA 1PT6A 2XF2A 2Q2OA 5KQLA 1OILA 4O2RA 1QJCA 4O59O 3ISVA 3KIPA 3VPAA 1LPOA 1F6DA 1RIIA 1ULSA 5FX2A 2XB6A 2BELA 2TRSB 3RJ9A 1Y63A 1QC5A 3GMSA 3UHPA 1PLKA 2ET6A 2XOXA 1JTVA 1YACA 4K6MA 4QAJA 3OEWA 4GI2A 4N0QA 4XSVA 3WFIA 1UDCA 3OJOA 4PYJA 5K3DA 1SA0B 3DVAA 4BBPA 5THKA 4NSNA 3B5IA 2ZT5A 2HWXA 3SXUA 3Q5EA 5CLGA 4D3SA 2HHHB 1VSBA 3PL1A 1YBMA 3UUGA 1A9SA 1DMSA 1K8RA 1TECE 4MRMB 4HBGA 4Y2JA 1CQIB 2VF5X 3FYSA 3D3EA 3DNMA 2QT0A 3OJEA 4O4HF 4KNYA 2P90A 5ESDA 1KY2A 2QYSA 3JRWA 3PT9A 3BL5A 3BWBA 3FPEA 3AINA 2FZEA 3U44B 1PVDA 2GKOA 1UOEA 4CMBA 2WZCA 1IUNA 1ORDA 1XVAA 2OYRA 3F4LA 5JNLA 3B82A 4AKGA 4FFSA 1KDOA 1NVVQ 1BOFA 1V8PA 2DCMA 2VJPA 1H2HA 4H9GA 4DC1A 1DC4A 3E8SA 4ZVOA 4O4LA 3SHOA 3TPZA 2YYAA 4FC6A 4J7AA 3BERA 3KD3A 4W8OA 3L84A 2QE7D 4IDBA 4GICA 3FSGA 4HNQA 2D3TA 1WXQA 1AQJA 2H4JA 1TF5A 5H3CA 1T2FA 2Z09A 1ZD5A 3A1WA 4L5CA 5C5EA 1LLQA 2XKJE 4HGOA 4X8MA 3PUJA 1OAOA 2GZDA 4UUQA 2WAXA 1UC4B 3I83A 2G80A 4LXTA 4N6OA 1O6GA 1L7RA 1R18A 4TMFA 4YPVA 4PPGA 2WSYB 1G63A 1T1SA 1VA4A 2DJ5A 3OT1A 4UFPA 4B76A 1TQ6A 2ZSEA 4IUYA 4XM2A 2GPYA 1Z8NA 3PFFA 4CQMD 3FPLA 4NOKA 5AI0A 3H5WA 5EXEA 3TDNA 3L0PA 4CIDA 2SICE 1R1DA 3FNFA 5FEMA 4MKHA 4WHMA 3ORHA 4ND8B 4YNBA 1CQWA 1BEEA 2AWNA 3HJGA 5DYTA 3T9FA 3R3VA 4JHLA 3TLKA 2AQKA 3BK1A 3L0BA 2A33A 3ZHZA 1NG9A 1S9DA 2H5JA 5HP4A 3H2BA 2OPBA 3HR7A 2FB9A 3BK2A 1Z4LA 2H4XA 4Y2XA 3SX2A 3SVZA 4XLTA 1YS6A 3S2HB 2P75A 2CUKA 4TM7A 4KNVA 1V5FA 2EXXA 2JLCA 3KEFA 3CJRA 5FOTA 1OIWA 5CURA 1QLWA 4B3BA 4CKBA 2Q4DA 3GT4A 1MRZA 4JIGA 4WOJA 3VVBA 4E3ZA 2Y2UA 3V8QA 3DT6A 4BBRB 5EG5A 4EK9A 4JIMA 4BTLA 1G4AE 1XA0A 1EUCA 3I4FA 2IYRA 3B1JA 5CVEA 4NHOA 3TXAA 1UC9A 4LRQA 2W6MA 3UJPA 1PNTA 3DTNA 2N46A 3SC2B 5HUHA 3ROFA 5DNUA 3DFMA 3B1FA 2W0SA 3UJBA 1G2OA 1XJ5A 2JI8A 5JMTA 3JZFA 1Z4PX 4MYRA 4NENA 1ZK3A 3ZG6A 1SU4A 1P2BA 1WZNA 3RNLA 4Z1OA 2P9QA 1WMEA 1U8TA 3RC8A 2O7VA 4DQ0A 2R8PA 4LUCA 4ZAZA 2ZZKA 1WJGA 2IYVA 4YS6A 5LNK6 1G59A 3GAZA 2GWRA 4DMUB 3RQIA 1VKRA 4AJ4A 2DHDA 4Q19A 3F6YA 3TYXA 4DPLA 1EHCA 5K8VA 1XZEA 1N5DA 4JMPA 4PZ9A 4LOHA 4C7KA 4DR4B 1BQEA 2QRZA 1NJGA 2HC9A 2VKTA 3QE0A 4HGYA 4RWZA 5AUQA 1JH8A 1TWAB 5KOJB 3ZR4B 1IHXA 2DMRA 3I34X 4HXGA 2WA1A 3RHSA 1QK5A 3V7FA 4JLKA 4XCVA 4ENWA 5CDSA 4LHXA 5CT4A 1PJ4A 3DHWC 1YS1X 5C8ZA 5AKXA 1K7XB 3CX4A 4MVYA 5JPDA 3MQ4A 1ID8A 3T12A 2BR5A 2F67A 4O4JA 4OKSA 3AP2A 1VG9B 1YR8A 4FOTA 5FUYA 2GJ9A 3RC3A 3OKFA 1CQPA 1KPGA 5KJEA 4L5BA 4DS3A 4ESOA 3IEPA 1ZP6A 2E4UA 4YGXB 2E4YA 2VCYA 2HJVA 2JI6A 4EPVA 4MQBA 1C2TA 2SNIE 3D4PA 4JT8A 3S99A 1E3DA 1EJ0A 3NBAA 3TSAA 2IZ0A 2Q1TA 1HV8A 2FHSA 3MA0A 3NC0C 3ONNA 3ORYA 2IKSA 4FWIB 1G66A 5TQVA 1FMCA 4I6JA 4CMEA 5T67A 3WLLA 2FW6A 3KYCB 2ZJ7A 4Q4HA 2FNAA 3PVCA 5JCOC 2CNDA 2ZRDA 4CU5A 3KJFA 4YMGA 1IEVA 1Q5PA 2RB4A 3D8NA 1L5HB 5IUKC 1DAGA 4DANA 5E8JA 3AI1A 4J7CA 4LRXA 3KFXA 2B61A 3M6MD 5DLYA 4UTXA 4LYDA 5D5QA 1RXEA 3CU5A 3PG5A 4NJEA 4QD3A 1PT8A 4KWCA 1ZM3A 4OHRA 5ITZA 4D6XA 4EHLA 1YVEI 2X9LA 5DX0A 4TXNA 1E3IA 5JNRA 3QSYA 2I78A 2QV0A 3V8PA 1DPFA 1D09A 1C0KA 4J2TA 4ZJPA 2OTCA 1ZWLA 3PCRB 4ZYWA 1N2CB 4C7BA 1TJ5A 5F3DA 4MP3A 4CBVA 3QI7A 1PYGA 4UNSA 3WY9A 1Q7EA 1Z36A 1C7RA 2VQ3A 4H60A 4MA5A 2IEAA 3GNTA 2Y1FA 3OTIA 4ROTA 1KKLA 4IXMA 5DJ5A 5B12A 4W5JA 2IBMA 1FBTA 2UUBB 4LOIA 1KEWA 1FDTA 4DAOA 1GSIA 5ICEA 2C8JA 1XZJA 4L8VA 5D3MB 2BI7A 3DO5A 2GA9A 2WP8J 2W6JA 4NH0A 1N0VC 5T6BA 1U7HA 1TCCA 4RGVA 4UNQA 1OXXK 5AJUA 3W7BA 1G8GA 5A4JA 5JDIA 1QTQA 5IUNC 1RP7A 3IEXA 4I5EA 1GNTA 2E7ZA 5DEIA 1A2KC 1H2EA 4QUHA 1PKEA 3I73A 1MOPA 5E6SA 2ZR8A 1UK9A 1T6ZA 3PHHA 4EKIA 2P6RA 1WZCA 3AUUA 4G56A 4LMPA 1GTRA 1YB5A 5LXTF 1LJ8A 2IYEA 4A2QA 2GCPA 4L9WA 4C0QC 3CRW1 5F1KA 4L4UA 2GZ1A 1VLHA 3K70D 1P0PA 3IUJA 1C8VB 4W8GA 4J91A 4JLOA 1GPDG 4Q47A 2B7CA 1NBMA 3ENVA 5REQB 4BNDB 3U4AA 1UOPA 1PKXA 1TI7A 3ZLUA 3NWPA 3J7TA 3EAFA 2VKQA 2JARA 3GLIB 1FUUA 4MWZA 2I22A 2QZJA 3KU1A 1EK6A 2P68A 1M8FA 3LO8A 3QY9A 2AF3C 2WKWA 4E15A 1N0WA 1ZNZA 4ARIA 2AJLI 4KYVA 5BMOA 2EVWX 1XZBA 1HSZA 3GDGA 3V48A 4C3OB 1ABFA 3QVKA 3PFKA 4A16A 1C0LA 1QUFA 4XEHA 5EZQA 3IUMA 2R6ZA 1NC1A 4TTPA 5FOVA 3FSRA 4XDYA 4YAUA 3JALB 5BQ5A 2B0JA 2JW5A 3GQBA 4Y98A 5F9FA 5JAHA 2EDAA 3DL7A 1U0EA 3E8MA 1E63A 1HE2A 1KMHB 3EZ6A 3I9V6 4IOJA 5ELMA 2ZZNA 4ZDKA 4KTTE 4N4AA 5J2TB 1KY4A 4FINA 1CYEA 3GCGA 4CKCB 5HFAA 2HIMA 3CA8A 1HDCA 3RUHA 1JLLB 1EBFA 1Q21A 3W8FA 4UDXX 1DEAA 3DTTA 2WQ6A 3A2KA 2PZFA 1QHSA 1NXXA 1H23A 3VNVA 3C5HA 2ZB2A 5TRTA 3OTWA 1UBJS 4E3WA 2HREA 2WSIA 3NAQA 2CE2X 4HFNA 1X1CA 2GXSA 2I4NA 4K0RA 1VLQA 4MQFB 3IE1A 1UKEA 4I55A 1E89A 4TWIA 4ZHQF 3IAUA 2CB0A 2CMGA 3KB2A 2OV3A 4ZJYA 1OFGA 3DFKA 3UMVA 2I4IA 2K6GA 1TT5B 1C1YA 3I6QA 2GD1O 2CBZA 3BJZA 3EULA 4RHFA 1DCMA 2WKQA 5LMUB 2JDID 4JQOA 4IQ8A 4ZZ3A 1OCEA 4YRIA 4LDPA 4LK3A 4JH0A 3G2MA 2JGKA 3FUUA 4Q4DA 4Z0HO 3PPYA 2EATA 3IVXA 4PZYA 2RGUA 3T7EA 5HDBB 1YB2A 3HSKA 2C5BA 1KXJA 2JEYA 4NFSA 3WGJA 4B4UA 3KL2A 4MB6A 4EZEA 4EPYA 1NU6A 3AHJA 1M5TA 2RMKA 4WXYB 4K2HA 3ZIAD 1L5NA 3VYTB 2F1JA 2ONZA 2PSSA 4NAUA 2JLAA 5CXXA 4OP3A 3UG7A 5AO9A 5BVHA 5D01A 1TVEA 4K3VA 3MRXA 3P9PA 1ZQ1A 2YRFA 2V7WA 3M5WA 5FO0A 3W2IA 3WJ7A 5IXJA 1L0BA 2J7PA 1ZZEA 4HQOA 1RAAA 4N65A 1AMNA 4PU0A 5EP3A 1ZIOA 4QODA 3DNFA 1UJ4A 2Z2XA 2WYOA 4L8FA 4CIXA 1QGAA 3QMVA 4QLOA 1SD1A 3T3NA 3CJTA 2QXUA 5FO1A 1NE7A 1YR6A 1W52X 3C16C 4FYVA 2QN9A 4J16A 1PUJA 4P4SB 3NW9A 2OYCA 2NU8B 3X44A 4E12A 1MRNA 3WK6A 4BN5A 5DBEX 3I9JA 3U3OA 5E2IA 3LKVA 4HLQB 3KJZA 3LFTA 1M7GA 3CV3A 4L3VA 3L8YA 1HSOA 4YUVA 1RYBA 1F6BA 4P22A 4JUBA 3TRFA 4EI2A 3ABRB 1A7JA 4EO4A 3N3AC 1ADBA 3A9CA 1TGYA 3HVJA 4WN3A 5H81A 1TKBA 1X7ZA 4WOPA 2Z2IA 4CMIA 2P4QA 4FK8A 3R8FA 1C3LA 1VXRA 3CLTD 4TLMB 4PC1A 5ETJA 3ACDA 3LLSA 4RK5A 5DW0A 3HUDA 5AICA 3ZCTA 1BSVA 1NE2A 2W6IA 4IDQA 1VGQA 4KFUA 3T3HA 1PDVA 2RDMA 4LY6A 2PRZA 3UCXA 2HH9A 1PL6A 1F4LA 3LOQA 3LQKA 1OFUA 4BNJA 4EG1A 2BEUB 4PHGA 1E60A 4X8OA 2GF9A 1WCIB 1NASA 2C4UA 2VJDA 3X1JA 2VDJA 2ZUSA 2HDWA 1E3EA 4Q02A 3TM5A 3C8HA 2PKYX 4YUXA 3MINB 1WBDA 1Z6QA 2RIPA 3W5BA 3K72B 3EWSA 1ULBA 2J87A 4FHFA 3EY9A 2ZK7A 5G1PA 5BUZA 4TS3A 4ZZ0A 2OGWA 2ZB4A 5I5EA 4MSUA 4QLAA 1YS4A 1PGPA 3LUFA 2JA6B 4JS0A 2DVMA 4MYDA 3QKWA 1VL8A 2EX0A 3UAVA 4QUDA 4OVKA 4QU8A 3BXEA 1V5GA 4PWZA 4BBJA 3L8FA 2AFIE 4OYYA 5ALNA 1KAQA 3RVSA 4QYIA 3MLEA 2R48A 2OORC 3FVTA 4DVGA 5GTDA 2B63B 4ARVA 4YAGA 2DE0X 3AY0A 4CIBA 3MTQA 2O20A 3CKLA 3AUAA 4NYMQ 1UPCA 2IDZA 2ZETA 4GFDA 3QI2A 1J22A 1XVUA 4JEMA 5C1DA 3MLBA 1XD2A 4EB6B 1WM1A 1T9GR 4PQYA 3T5TA 5BYAA 3KOXA 1KAMA 3MFYA 3FYUB 3DKKA 3NIBA 2Y0BA 3A6ZA 4WNIA 5J1TB 1E0SA 1VM6A 3F1KA 3HJCA 3UXEA 4C76A 4BX3A 2EKPA 3IP6A 2OV8A 4HQLA 4UM7A 1GQFA 1S1CA 2FN9A 3EFEA 1FJ2A 2R2AA 4BUJA 4X44A 3MTEA 3TZQA 5JS7A 5L53A 4IHJF 5LZ2A 2A5GA 4JBHA 2R8XA 3VDQA 5A5GA 2YJ6A 5K0NA 1JTEA 3G2QA 5JSZB 4U8GA 3D5EA 3QUAA 4FZ3A 4TV8B 4OG2A 4R3UC 2A9FA 3ROEA 3Q5DA 5IAAA 4V2UA 3NV9A 1T24A 3AJAA 5HIAA 2ZJ4A 5IF3A 2J0EA 3QOXA 4RKFA 1EVEA 5DSZA 3N7TA 3OPNA 2X5NA 3K6KA 3INGA 4E2WA 2GDJA 2Z2YA 3PA6A 2LVBA 4LWQA 1TL7C 2PM8A 1JA1A 3I58A 2CLHB 2EFHB 1VECA 2XRFA 1N57A 5AVYA 2XTNA 4O4HA 3CNOA 3STUA 3L7AA 1AKMA 1CUJA 2YQZA 3CXUA 1E4EB 2GCNA 4PN7A 5BSWA 1ADYA 4NWIA 5KTMA 4EEZA 2HEIA 3ZUPA 3BHIA 4IEEA 2EFEB 3E2IA 3RRXA 1NQUA 2FMHA 2NX2A 3I12A 3L93A 3O2NA 2G63A 4HWSA 4PLFA 3HJBA 5KAPA 4YRGA 3DM5A 4ZZIA 2DPHA 5FL7D 2KMLA 3EQZA 1N7HA 1NVAA 4FW8A 4YV0A 1QGUB 4PLWA 6CHYA 3A9WA 2F8SA 5FBWB 3GAMA 4AULA 2V96A 3RTEA 1JDBC 3IHKA 4K9KA 3HCBA 4H77A 4UHFA 2F43A 4HXYA 1DBWA 3OMLA 3P20A 3RCBA 3VH4A 1V8BA 1FFYA 2F7SA 3DP9A 3GLRA 1Y4ZA 3KPVA 2RI1A 2UYHA 5A0VA 3I8OA 2HCTA 1WPXA 3NOQA 2J0SA 3M4JA 3OZVA 1LFDB 3NEJA 4UZEA 4HZGA 5DZSA 2GDZA 4B73A 4QSMA 3O73A 1ZO8A 1FF9A 1OASA 3TLEA 5HF5A 2JLYA 3W6PA 4B5LA 1SVKA 2JIZD 3CE9A 4KUEA 3TN7A 4F21A 1UFVA 1D0SA 5IDWA 1AN0A 1GGFA 1MC1A 4QWMA 4WZBA 3ZQJA 4ETMA 2BGLA 2Q2QA 4RTKA 5EZYF 4FJ0A 1DV2A 4J0JA 1UZNA 1Y7LA 2DU8A 2FXIA 5M3MB 2BHLA 1FA9A 1KZYC 3A6LA 3D0OA 3BB1A 1C41A 3G8CA 4IHKA 5IJWA 1JAXA 4B6EA 1YT5A 4MUBA 2C5GA 4KJZA 3F96A 5CFLA 4YASA 1HDIA 3BIWA 1T4GA 5BW6B 2EJTA 5TQ0B 1NT4A 1SULA 3RGGA 3HKDB 5IAGA 3EQ7A 3LK6A 4DM4A 5KMGA 2WTBA 2ZWOA 2QROA 3TG2A 1JHZA 2HA4A 4EG7A 4KE6A 4P3XA 5EJ5A 1UK7A 3RUIA 4X54A 4CMAA 4IZOA 1JEAA 3TSZA 3SJBA 4ND1A 3UK1A 1XJCA 2PMBA 3O0TA 3HV2A 4BN0A 2ZR0A 3HXKA 4QEDA 4KL8S 4MNTA 1OX4B 1XZ8A 2O2CA 4UULA 4J0CA 1EA7A 4F7WA 2ZE5A 3FDZA 721PA 4HEJA 4PCVA 1DDOA 2IIBA 2K2WA 3Q3VA 1H2YA 4I1IA 2V5UA 4TSRA 4X3PA 3FIJA 2IYNA 4QECA 1NW8A 3FUWA 4LK2A 1RQ2A 3ZK7A 4I6EA 3CISA 1JWLA 3L7OA 1VXOA 3STWA 2FVXA 3QXHA 3DVQX 5A4AA 2JA1A 2JZCA 5THQA 2KE5A 4MS4B 4K5QA 2R65A 1S2LA 2YZMA 3DZGA 4L22A 1P2TA 5AUOB 1RKQA 2Z30A 1E4OA 1JR3A 3QFHA 4DJAA 1VB5A 5H80A 2JK1A 5D3QA 4PX9A 5DNDA 4Q24A 3R4VA 4JL5A 3B7GA 2IF2A 2LDBA 3S15B 4PLPA 2FMIA 4B4KA 2HMVA 5HNKA 2D1YA 4IL5A 3RVMA 2GN1A 4GXNA 2WD8A 3JQFA 4EJFA 2C5FA 3TEJA 1WRBA 2BWJA 4BLVA 3AZPA 3JAKB 1WSBA 3BCSA 1MNAA 1U6IA 2LUOA 1MKYA 1ZGBA 1J24A 2V55B 5EUMA 3NV7A 3MUOA 5IVIA 4J49A 3LDUA 3LF1A 3ZKWB 1GKIA 1ACMA 1FS5A 4UOQA 5E4JA 2JLUA 9ATCA 2BF7A 4FMCF 2AOTA 2Q0HA 3KK0A 5IDVA 3NGMA 1NU8A 3NM5A 3K8YA 4FNOA 3GN1A 3ADDA 1IC6A 3TLJA 1MO3A 3THWA 4OOFA 1YZNA 4AC9A 3GTQB 3GUYA 4OJYA 4ROSA 4UHBA 1GPJA 1L5OA 4BMSA 1RXSA 3GA0A 4HJXA 5FAKA 1IU9A 1EWTA 4UCXA 3NEYA 5CMLA 5JHGB 4MW9A 1Y4DE 3I5AA 4PXSA 1AY0A 2W71A 3HUEA 1SZJG 4DCUA 5K6TA 1BO6A 3CSUA 2QNIA 1E79D 5KVAA 3JZIA 2ZGVA 4C1BA 5AW0A 2QGNA 2JAWA 3BH7A 1PZEA 3LSTA 1WUJS 4MEBA 1GPNA 3I2YX 4BQOA 1P75A 1W85B 3BZUA 1AS3A 4R8MA 3TLGB 5B4TA 2Q6OA 2F4NA 5TE9A 3WP0A 3HXMA 1AJEA 1YJCA 1FDRA 3R44A 2RHGB 1UZLA 2QZ4A 3FUTA 1UK6A 3VU9B 2ZJYA 1YOVB 1NW6A 1KTIA 1PWHA 1FXWF 4YDSA 2PUAA 3DHNA 4IH4A 4HYEA 3S1SA 4HAVA 1NXSA 1R3DA 1B00A 1SKYB 1PN3A 3LE8A 4HYTA 4Z9AA 3WRXC 3WFZA 2WNIA 3NYQA 3ANLA 2IYYA 3GCDA 1FJGB 1WMDA 5IARA 3OQNA 3GEIA 4A6DA 2BBOA 5HG0A 3RANA 4ZVNA 2QD4A 2I2BA 2OQIA 3IMCA 2DUUA 5CB4F 5LXTA 3R3SA 4PO8A 4ZFNA 5A3QA 3SCZA 3MBIA 3F3YA 4A8PA 2R7KA 3B9QA 2C7GA 4FFBB 3RH0A 2A5YB 2CLIB 3Q3CA 5I6DA 1POWA 5F7OA 1OXSC 4RQUA 4U39A 1T0JB 3Q5GA 4WK6A 3NUGA 3WGOA 5KWVA 2JFGA 3T9CA 2IYOA 5AKLA 4YUZA 2I7CA 3AH8A 1CY0A 2FR1A 3AFNA 1OGYA 1V48A 1E5XA 3C6ZA 4FX2A 3BK7A 4MEJA 3EGIA 3IR7A 1Z4KA 1JBQA 2W8BB 3TQCA 3MUNA 2VDKB 4IDPA 5IDYA 3SLKA 4D8VA 5ADWA 1WEHA 3ETGA 1GD1O 3H16A 4JB0A 1JKJA 3ST7A 1FW6A 5FADA 4YQEA 1UMBA 5SV2A 1V95A 4YRMA 3IV7A 3TXYA 2XYHA 1UBSB 4ZCIA 1F4VA 3RYHB 1YS9A 4GMHA 1YS2X 4TV9B 2VSNA 1C8LA 2PMDA 3DL2A 4NYJQ 4X0EA 4UE3S 5SYAA 1T5OA 4B9AA 3CMCO 3HVUA 3QY0A 3ZE7A 4CM8A 4IHQA 1E58A 2XNHA 4W1SA 4DXHA 4BVEA 1I24A 1GQ2A 2O7NA 4PZEA 4KJXA 1H8HD 5FNZA 2QAGC 2ID9A 1I4DD 1RWOA 2XUKA 1PJCA 3QKSA 4WADA 2D62A 1FBNA 2JATA 3IBGA 2WVHA 4YYEA 1NONA 2GPNA 3QJYA 4MR9B 4CM5A 3L77A 4DBLC 3VR6A 3JQGB 2R9VA 3OIYA 3UPDA 3IB3A 1P9WA 2MSWA 2O7SA 4YJFB 1EI9A 3U13A 3OFND 4K40A 4DCTA 1KH1A 4OU4A 4H2DA 3AHCA 3MUEA 3QKRB 4IXWA 3MQ2A 3M3HA 2HFJA 4ZHQA 1LK0A 4LJ5A 4WN9A 3AFMA 5HE8A 1IATA 3CUEF 5AQEA 2OLKA 3LVFO 4OHCA 3C45A 4JU9A 1RHRA 2V9PA 1LFAA 3OWOA 5JI2E 3AUJB 4BVKA 1YE8A 4Z1MD 2QB5A 4XJTA 1MHTA 2I6TA 2YYZA 4AZ0A 1UF9A 4G9GA 1J0BA 2PLAA 4LAFA 3HPRA 2Y0CA 2I66A 3E2MA 1W5AA 3ODPA 4HFRA 4BZQA 1WTCA 4TKZA 5BV8A 3WO0A 3SQLA 1GPWB 2XITA 2VDOB 4BY7B 3O03A 1UPXA 2AL7A 2C4TA 4D4KA 3DE0X 3NGXA 2FK7A 4I8XA 2FK8A 5F21A 2YIVX 4NZYA 4DNQA 2RG1A 2Z3WA 3N07A 3UTDA 4KP7A 4J0FA 5CT5A 1S8FA 5CEJA 4KPEC 1RU3A 1RRVA 1KGDA 1O3YA 2M1XA 5CFOA 4TMXA 1VYVA 3W3AH 1IN5A 1AK1A 2KW5A 1MCZA 1TJYA 4NICA 4C0JA 2QX6A 4KSBA 2CHEA 2P5TB 4IV0A 1U2TA 3AF2A 1SXJC 1Y1QA 4QNRA 4B34A 2A88A 3GTJB 4UVHA 1I2CA 1XXHE 4QQRA 4WUVA 3ED5A 3EBPA 3ASZA 2W2KB 2ZIAA 3FPCA 2YZGA 3M4NA 4U7DA 1CVIA 1ZW6A 3D7SA 2JGEA 3L4EA 3N8NA 4D9HA 1YBVA 1YFZA 1IWOA 2XNSA 3ZY6A 1HO3A 4Y6GB 2FJ0A 4YJGA 4U02A 3A32A 4PQGA 2EKBA 2NZYA 4KO4S 1G7CA 5LD2C 5DTEA 5AI8A 4LRWA 5LLDA 3MGBA 1W88B 1OHHD 2BKLA 3K0CA 2KI5A 4MITA 4O25A 221PA 2JJQA 4UDNA 3V2HA 1NPDA 1CZHA 1KK2A 2NYRA 3SF8A 3ZX4A 3P27A 4DJ5X 1HC7A 3WWDA 4AF6A 5B6PA 1EUQA 5IT0A 2QU8A 3HOYB 1STOA 1UPUA 4K9DA 3FUVA 1UH5A 2FRDA 4HSEA 4P93A 4AZVA 2I4LA 1ZGHA 2J5KA 1S96A 3QEOA 4PLCA 2FUKA 1KVQA 4UDOA 2QL5A 4YJHB 3OE4A 4DDKA 2JAQA 1B41A 1K1EA 4PO1A 3HO1A 5BV7A 1IBSA 4CT5A 2ZWVA 5B30A 2AZMA 2GUGA 3BWMA 4JX9A 1GGVA 1NVXQ 1DJLA 4F12A 3LX4A 1K3FA 2DFNA 4HF7A 1G16A 5EJ2A 2AGVA 2VZ0A 4CIVA 2GAAA 2TMDA 1SC3A 1SD5A 1I94B 3EOBI 1N3LA 2HCRA 3KYBA 3QPCA 1T26A 4N7RA 1QCDA 2B0CA 2QRVA 2IV7A 3TVDA 4AZWA 4C6RA 1SUSA 2WVGA 4C4YA 4PR0A 5HGXA 2XAAA 1Z4QA 4FDUA 4Q1FA 3DW1X 3K5IA 1M8KA 4R54A 2O5VA 1YL5A 2IPLA 2OHGA 5KVQA 4KIFA 2O7RA 3S1RB 4P53A 1UBTS 3B6EA 1NF8A 1DBSA 2F9MA 4C29A 1O8CA 5CLQA 1UWCA 2GZRA 3I6IA 4Q7MB 3MUFA 3CNHA 4EENA 2WK1A 4B3SB 1UPFA 2FW8A 4BKRA 1M34E 2GCIA 5K20A 2JEOA 3A8TA 1BCSA 1XL0A 4XQEA 4C7JA 2M6RA 3F1LA 5EWMB 4CLHA 5JI3E 1YCHA 4QKQA 2F90A 2JBHA 3PP8A 4WY8A 3NS7A 2NSYA 1E9BA 5DT2A 2GARA 3VX4A 3BT7A 4KH0A 2RKOA 2LW7A 2VF8A 2HK6A 3OTQA 4RTSA 1OYWA 1OC4A 1YQWA 4IHJA 1O95C 3W1EA 4O2LA 1O97D 3HWSA 5BSMA 4ARZA 1QWOA 2E4ZA 1PWZA 3HACA 3N7AA 4LY3A 1HT2E 3WAKA 4D92A 3VR5A 2WIAA 1A96A 1G8PA 4NLLA 2AMLA 3JU3A 1YASA 4M7WA 1NDHA 5MFPA 1I3QB 2OP0A 3E9YA 5E3HA 1DMRA 1U0TA 1Y3IA 2PHZA 2EERA 2V7VA 1UKAA 2J0QA 5J2TF 1N2JA 5KQPA 1UXJA 4HYYA 1G2QA 3E61A 4DT1A 1JHPA 2WPNA 4QOJA 2C9CA 2IYFA 4M0FA 3FVRA 3HWWA 3PLRA 4UU7A 1HZZA 4Q39A 4G4SP 2VJLA 1ZHHA 5FTKA 2I6QA 1P1HA 1M67A 1EJ6A 1KKMA 4IMPA 3K8ZA 5LIPA 2E4XA 4Q48A 3N2GA 1OXTA 2DM6A 3AOEA 5E7MA 1LSJA 1FYWA 1QIDA 2P4EA 3KOWA 5H1YA 1J20A 4N8EA 1R12A 3DMDA 1D2MA 4N0MA 4RANA 4RKRA 2QM8A 3PXAA 4WFJA 4MARA 4URZR 3U4QA 1FTYA 1JT9A 1JI0A 3C3YA 1JJIA 1F0PA 2XUGA 3S40A 2V6MA 4HDQB 3TQRA 2PGAA 5AM1A 1RVDA 2JLWA 3RJZA 2FLWA 5G53C 2CV0A 1SZDA 3BFPA 2LE0A 1RI5A 2RKWA 4S1VA 4EO9A 4C2AA 1GAWA 1QF6A 2F1RA 3X43A 3O2QB 1GGKA 3OE7A 1YTUA 4L07A 2CBGA 2PEZA 3DZBA 3M0EA 4RZHA 1VG1A 2YN0A 3CF6R 4W5HA 5B6JA 5EJAA 3E9QA 3MJ4A 1M7HA 3KFLA 1QV6A 4XGQA 4BV3A 4OQQA 3T3PB 4A3JB 5T3UA 5L7YA 1XMSA 1PYOA 4CKZA 2HU5A 1M6VA 3KR2A 2QN6A 5EZYA 2V6IA 4LWPA 2HA0A 5G0SA 5DHRA 3RFFA 2OQVA 2R7NA 4GWKA 2IYWA 2R25B 4MVJH 1JW9B 3L1VA 2QBYA 1X7WA 4O1MA 4AW9A 1XHEA 3ZVNA 3MXOA 2G4VA 4J9UE 1XTJA 5HA5A 4N8DA 1A8UA 4E22A 4PSKA 3VSBA 5BORA 5JATA 4GSKA 4JENA 5H82A 3BULA 3HJFA 1WXFA 4TN1A 3IA7A 2EKZA 1IZ9A 2XYPA 4OTZA 3F5MA 5H3LA 3IQGX 1HYQA 2NUTB 3GV0A 1BDBA 2HYDA 3OP4A 5HIJA 2INGX 5KPJA 2ORIA 2P1RA 3WKDA 8ATCA 2OFPA 1I4LD 1LI7A 4J0IA 2PMZB 1VIVA 1HFEL 1YRAA 1KI8A 2IP1A 2BM0A 2V6FA 4ER7A 4F4CA 4OK3A 1WQ1R 3WNDA 1NF9A 4WPGA 2FCRA 5EIEA 1ECPA 2X0KA 2PT6A 2WWGA 1YGPA 3M1LA 3ZI4A 1ZXBA 4M1TA 3THRA 3R7AA 4BTVA 1V11A 4OBEA 4HEHA 2GHIA 1V8OA 5FTWA 4LHYA 4TLLB 1KNQA 4JR1A 3OZXA 1OXUA 3AJEA 5IJXA 1Y5RA 3EEYA 4XB2A 2VDUE 2PMWB 1WO8A 4TLBA 4M99A 3OWHA 5GJWC 3D3QA 4Q05A 5LP6A 5IVKA 4MDEA 2P9GA 4RC9A 4C43A 3RTCA 4YCDA 4JCOA 3RHTA 1JQ3A 1JU9A 1SQ6A 1UDBA 4CTJA 4LE2A 5F9HA 1W0JA 3RVBA 3RV3A 4FIZA 2EW8A 2X8BA 2C54A 3RV4A 2XXAA 2C2OA 1QF7A 4BO2A 2GYWA 1K3TA 1YQTA 4G5OA 5AJWA 5I7VA 2Y1KA 2OZVA 3HJRA 4IJWA 5K3SA 1DEKA 2PO5A 3IQZA 5I8ZA 5KVSA 3O8RA 4F6RB 1CZKA 1XSEA 4BWYA 2C4HA 1V25A 1EH5A 2DFLA 2DPGA 5IT5A 1TZ2A 2Y1CA 3IKLA 3OQIA 5EGNA 3TLBA 1OD6A 1YQEA 1G6OA 1P1KA 1ZCFA 1OBOA 4DAEA 2BY4A 1HX7A 1AUXA 4FKMA 3TB4A 3L7MA 3S5UA 3G0DA 4GNRA 1D1SA 3W9SA 2GRJA 2Q5IA 4MWTA 3EARA 1AKWA 3W5SA 3G1UA 1OLUB 4RVDA 2ZUBA 2Y6VA 1L7QA 2HCFA 1AM4D 3GYBA 3LQYA 1IBKB 5DM70 2R93B 4A2PA 2DLNA 4JELA 1XAHA 1TQ4A 2IZOA 3DKIA 3GCXA 5I4BA 1CEYA 3IC5A 1K6XA 1VE5A 2F48A 5EGSA 1PEKE 2VJOA 4F0JA 4BDTA 1NVVR 1QR2A 1T4CA 2HWUA 9GPBA 2W2XA 1XHFA 4LOLA 5F2OA 4DLZA 3A26A 4A3SA 1GTL1 3MILA 2J3MA 2JLZA 3U5ZB 5E9QA 3CRNA 5H4HA 4EGFA 2X6QA 1DINA 1FSSA 3RRJA 4XRGA 1L5MA 4MUHA 3DYIA 2C2XA 5BW8A 4OYRA 1WPQA 4TWRA 2GI4A 1YA6A 2X4LA 2P4HX 3B1VA 2J5BA 4TV8F 5LWQA 4EX6A 3EZNA 4U7FA 3I6YA 3M3DA 3SS7X 1NJSA 1L7AA 2KYRA 4GX0A 5G02A 1YUBA 3NJ8A 1AQUA 1SA0A 1XV5A 2VT7A 3IKJA 2HHAA 2LXNA 1N7IA 3I9FA 2DUJA 5IBQA 2GZ3A 1PD1A 2FFBA 5THXA 2FUG6 3UMGA 1U0SY 3WKAA 3N8HA 5HMLA 1GN8A 2CUZA 3ABQB 3F90A 5F1OA 3CRQA 2DCUA 1MTZA 1FXWA 1YMUA 1OR8A 4I81A 4RSHA 1QFSA 1CQIA 2BEVB 2QJRA 1F7UA 4X45A 3LZDA 3ICVA 4RD4A 3OQVA 4RMNA 3A4TA 3ZC3A 2F8MA 3U44A 1WUKS 1NUTA 3K0SA 4QX6A 1TWCB 1QHFA 2C7BA 2D5AA 4K6FA 3U0VA 1UM8A 3QTTA 1AGXA 4I3HA 4L50A 4BLPA 1RXIA 3AYZB 1X9IA 1SO8A 5CB4A 2X76A 4Z4QA 2DHRA 2VYND 4EBBA 1MH1A 1RJWA 4Z4HA 1XK6A 3DVLA 3BH0A 4LDJA 3S2SA 3HHEA 3Q41A 5FWNA 4KGZA 3J80A 3QEBZ 4W7HA 2IS1A 3NDRA 3TR0A 3Q8LA 3QHAA 1GKUB 2QUBA 5ALUA 3HB0A 1GWNA 4YK7A 9ABPA 3PDHA 4BTEA 1I1HA 3MN1A 4P5DA 2VDQB 1NV8A 2CDNA 1E8MA 1BX3A 2WLSA 1ZM9A 2Z08A 2ZWPA 1KVUA 2IIQA 4QVGA 1YI8A 1PS9A 2CVQA 1PEYA 4FGSA 2AFRA 3IEUA 5F3RA 4RM3A 4ZCLA 4LJSA 4RH3A 5JNUA 1URPA 4A36A 1NRWA 1O94D 3E27A 1IMOA 2COEA 1TF2A 2HWWA 3TNFA 3UT0A 5C5DA 1XCLA 1CUWA 2C97A 1QANA 4N9WA 2NO7A 3WSTA 2O3UA 4V0QA 1XTTA 3N05A 2CMDA 1DXOA 2J3EA 5LDGA 4ND8A 1K7YA 2Q1WA 3ICQB 2ORWA 3KAPA 1GP2A 1EFAA 1W2HA 1JSZA 2NO6A 3MTIA 3D64A 3HJNA 3JYPA 3AG6A 1FNDA 3K2IA 4RFLA 3AI7A 5H16A 3C41J 4F7DA 4DMGA 2B3DA 1QBKC 1GAJA 2WWXA 3GLFB 1Z12A 3G2PA 3M6VA 1R9GA 3EHDA 2B5VA 3FMOB 3I62A 4BNUA 1TYAE 3T5AA 2ZBPA 3GBSA 5C4XB 1UBLS 1PLJA 4R1SA 1H4SA 2M6KA 1P5JA 3VJLA 4B31A 4FCCA 4MUMA 3DMNA 1BCRA 1RLUA 2B69A 1LPAB 4O8CA 1CKEA 2V7PA 3UJ7A 4BN4A 1FW8A 4HMQA 2IPNA 1NUAA 4FBGA 4NCKA 3ZH2A 3ZVRA 4B0OA 4D80A 3JQ7B 5CBKA 1JH9A 4ODIA 1HKHA 3IHTA 1ZH4A 3GNQA 4A26A 4D56A 5BSRA 5LU9A 3WA7A 4QOFA 1EVZA 1T5TA 4OL0A 1FVOA 4XSGA 3FMIA 1MNQA 4FDTA 5C4MA 3M83A 3O75A 2V6JA 5TQ2B 1PQUA 3W5IA 2Y0SB 5JCXA 4DLRA 5E6UB 3C0KA 4XDGA 3ZZNA 3L1HA 3EGXA 2FQ1A 3P0IA 3U9SA 3IAAA 3H0CA 4KLNA 3SS9X 4N12A 3P9RA 1D04A 1YKSA 1VLLA 2WHQA 4OP2A 5ICFA 3UKJA 3MJCA 4OB6A 5BOSB 5JDIC 3EZ9A 1D5CA 2Q3DA 4R41A 1YQUA 4QPNA 5C3EB 1JB1A 3NGLA 1XDGA 2RG7A 4QBIA 1J97A 2P0AA 3M4ZA 3MRTA 4PG8A 2DETA 3RYCB 4M8SA 1WD7A 3TNYA 1JAYA 4NXMB 1H2ZA 4D6PA 1LTKA 4BGUA 5KOJA 1OLXB 2YL2A 2ZSKA 4NCNA 1B0PA 2PG3A 2C2HA 1G8JA 3NBZC 2IZ1A 4EHKA 1D3AA 4MPJA 3ADKA 2HRBA 1DS6A 2R79A 2IXDA 1RBMA 1VJ0A 3HCRA 2LDXA 3TJZA 5FPTA 1LDMA 1V2GA 5ERXA 4R7TA 3BD9A 5IJAA 1JDBB 3NBQA 4K6CA 3GVXA 1Y80A 2JIOA 1HMPA 2YFKA 4LQ4A 5I9IA 4F5ZA 2H5LA 4MQ4A 2BGTA 3QVOA 3C8ZA 5H9VA 3ZHVA 4PTYA 4EP1A 1NBWB 3Q8XB 5LQMA 4FX5A 5KWIA 3KYCA 2C7VA 3DD1A 1OXBB 1WF3A 5IBCA 2OHOA 1ISGA 1P2UA 3RIYA 3S7ZA 4PYRA 2ORYA 2C2MA 1M73E 3G02A 2RB5A 3OX3A 3AW8A 5SICE 1L5HA 1SUBA 2ZS8A 3S3TA 2C5EA 3SM3A 2MSDB 2G9QA 4B6RA 1Q3TA 3P9IA 4F2GA 3AJ8A 3NM4A 1RNLA 5G0WA 1SD2A 2XPCA 2G09A 3GUZA 1A04A 1FQOA 4I46A 4QGGA 4R1OA 3AG5A 4IX9A 3MJRA 4I50B 2I4MA 1YA4A 2P78A 3ICWA 4KUHA 4DIOA 1ADCA 4Q3LA 1N2CA 3GUHA 2J0UB 3OSUA 2RE8A 1DDIA 2QLFA 1TF7A 4OI1A 1Z2EA 1C8BA 3HCFA 3P4UA 3COWA 3LJKA 3IJRA 2G8NA 1P1BA 1LLUA 4BKMA 3HUFA 1ZN7A 3TLYA 2R00A 3L8ZA 3DC2A 4RYLA 4G2NA 3ZCPA 1AGNA 5HK9A 1CNFA 3ADPA 1NW5A 1Y0BA 1CJTC 2AWOA 4XUGB 3KJEA 2Z04A 1EVKA 1TJ3A 1Z0SA 3B3JA 4CLOB 3THYB 1HXHA 3AR4A 4YDRA 3G13A 3VU1A 1NWHA 2DBVO 3E9MA 3HB4X 4XRRA 1B8PA 3RAGA 3L0OA 4J6EA 1IAVA 2PX6A 1SVMA 4HNAB 4ZO8A 4OX9Y 2GGSA 1FX0B 4XWYA 4U7PB 1DWUA 1LSSA 2QRQA 5AK4A 4POAA 3SJ7A 3VDMA 4QXPA 1MTOA 3TQIA 2EV9A 2R1VA 5REQA 3F8TA 3GVHA 3HBNA 2GHRA 4QUJA 1FY2A 5EHGA 2C2KA 4B6SA 5LB4A 3ITNA 5CNMA 3ZZTA 3DULA 2BKUA 2OAP1 4JVOA 4N7MA 1F8FA 1MLDA 5M7EA 2GJ4A 3BG5A 1U2PA 3RKRA 3W4JA 3GLIA 5JFOA 2NO9A 4FEEA 3S70A 1Z5PA 3EVBA 2FMFA 1N8TA 4HQKA 3S0JA 2Y71A 3EC7A 4C4XA 2VDRB 3KRTA 4HAZA 4L2IB 4EL0A 1R0YA 3MB8A 4PGAA 4BY9E 1A9RA 1GPKA 5BYKA 2FEAA 4GOLD 4G36A 2YJNA 1HLDA 2VQEB 2WKPA 3K9WA 2ASEA 5G1OA 4DSUA 1UXGA 4F8YA 3TUZC 2DPMA 1RKVA 2NTVA 2YUTA 1P2GA 1PLLA 5K3BA 3QELB 2O1WA 1U9YA 1XCMA 2B6HA 2X77A 4TV9F 2G1PA 1LPBB 5JH7A 4W5OA 5B36A 1KMHA 4YECA 4DUGA 2POQX 1IZ8A 5J2TA 5A03A 5IFLA 3FLBA 4CKCA 4WLUA 5AUPB 3B36A 3PQ2A 1B0UA 3NXKA 2HDOA 5HS6A 3KU4A 2NPFA 3RRFA 2G7MC 2H63A 4FMDB 3WDMA 1EEHA 2LIVA 1DEOA 2FFRA 1OWNA 3ZQKA 3WC4A 1DHTA 3D6TB 2D0OB 2A9OA 5FB3A 5FUVA 5KSYA 1G20B 2OEPA 2M9MA 1CWUA 5CTJA 5BT8A 4KRXA 2C3OA 5FTMA 2C7OA 3OIWA 4MQFA 4CLEA 3IX7A 4XGNA 2JGNA 1P1FA 1M76A 4LDZA 4UTRA 1M1NB 2PDAA 4HN4B 3RQSA 4MA4A 4LRYA 1RZ3A 1TT5A 1M2WA 3WXBA 2RK3A 5ESWA 4GKKB 1P1JA 4LQDA 1Y1KE 3JVUA 3GEEA 4IIJB 4KQ9A 4KQCA 1DG1G 1V7PC 1T6XA 3ZY2A 5K8TA 3IP1A 2HWYA 2FR8A 1N25A 4H0CA 4KXWA 2Q3LA 1PK7A 1S2DA 2EG5A 3VZQA 3ZDBA 1ISIA 1M6YA 2JJ2A 3EGVA 4UAGA 4H0NA 4CKWB 4DQXA 5M34A 5L3RA 3ADOA 1P6XA 1QYRA 2IVZA 3E18A 4RV5A 3T0FA 2BBSA 4J03A 2BTEA 2HV9A 2Q9AA 4MIYA 4PTLA 1L5ZA 5EKUA 1XZQA 3KOMA 1M74A 1K0FA 1DC7A 4Z2AA 2JGIA 1X80B 4G0MA 2PQ6A 1N1DA 1SC6A 1DIGA 2OT3B 3T4PA 1JP7A 4P84A 1YFKA 1CY1A 3KZXA 1SMKA 1LV8A 2C96A 4YRRA 4AS3A 4WZZA 2BMEA 3VR2A 1XWFA 1GQYA 1VHLA 2QP9X 1TJ4A 1EFRD 3CZMA 2UZAA 3PHCA 4OHPA 4BGVA 3E3LA 2KX7A 4ZEXA 1CJCA 4P7GA 5DBIA 3SAJA 3VOBA 5T5QA 1ESCA 1A98A 4FSDA 2BFAA 4KCGA 2RH9B 5KNBA 5LM3A 4OEHA 4NRDA 5IT9A 3EAGA 4IRUB 3SHTA 3PQ4A 2K7FA 4RK6A 1XZDA 2CLMB 3Q9UA 4NFHA 1TMYA 2BFDA 3AR3A 2J8ZA 4HUJA 4WBSA 5BMVB 4OI4A 1WQ3A 3USES 4P82A 1YV9A 3FX2A 1CP2A 4P4SA 1QGZA 4IAOA 2NU8A 2HRQA 3WLJA 2BH2A 5JZ9A 1Y8AA 4JC0A 1H66A 2WF5A 3V46A 2NSLA 1NW7A 4Z9YA 1BXGB 1U4OA 2QTVB 3QVVA 1N8SA 5IEBA 1Z5WA 1XCGB 2RAUA 3SKXA 3Q6NA 4ZYLA 4NYMR 4O5OA 1W76A 2WHEA 2XTMA 3L8GA 4AYBB 4MUNA 4W1RA 1ESDA 4JBNA 2FPUA 3FOAA 1J0DA 1J5XA 2JGDB 5F4BA 2PGOA 5AUNB 1P3JA 5AVOA 4HQ0A 1BNCA 1XDBA 3BTSA 1TMOA 3DDSA 3NT5A 4YRCA 4BRSA 4ZGGA 4QYXA 4D0SA 1G5FA 2BJVA 2O07A 2O3QA 3IYLW 2OUKA 1ZOIA 4RADA 5EPUA 5BV0A 1HORA 3T0GA 2BEUA 1R6AA 1R66A 3D7NA 4OXRA 4C03A 5ILOA 1L4UA 1X74A 5CIYA 2R92B 4X8HA 2O2YA 5LQAA 2X6TA 1AC5A 2PH5A 1SIWA 1O6CA 3ZDXB 2OCKA 1Q3KA 4LOJA 3MINA 5AESA 4D9IA 5HF9A 3IBCA 1NYQA 1DVRA 2CD7A 2XWJI 4ZPXA 5JNVA 2YOGA 5K51A 3VPXA 2FSVA 1VP9A 1IQ0A 1BE8A 2HB6A 4TQAA 1YFJA 3W8RA 4KBFA 4R0VA 1BD4A 1D03A 1QCZA 4GX1A 4RULA 4DG5A 4QU5A 5IMSA 3CF4A 1JU3A 2OHJA 1GO2A 2FY8A 3HVIA 3PF8A 5C3UA 3CW9A 3MTAA 5DN6D 4AJKA 1BWPA 4XWKA 1PS0A 2VBIA 3MTDA 3B6KA 1HYHA 2CY0A 4YN3A 3T3EA 3VO2A 4A0FA 5C35A 2PBZA 1VMAA 3UMSA 2XOKD 5IK2A 2A86A 2YBDA 3I2GA 4X91A 1OXMA 1T3GA 2WTMA 2XIQA 3C15C 3DBIA 3LXXA 3T95A 2VUTA 4RIEA 3BRCA 4EB6A 1S3SA 1AKQA 3QMPA 5TMEA 4DW8A 2Z4RA 2IXEA 2O8BB 3PNPA 3FYUA 5FFMA 3BUSA 3GD7A 1DJPA 5AJVB 4M89A 3JRXA 5LLTA 1C7EA 3FWZA 4ZQFA 2VNSA 4M1OA 4UEWA 5IN4A 3EC2A 1USUA 3L01A 1H6BA 1YOBA 2E48A 1SXJB 1SQ5A 3PPWA 3WSWA 1TIKA 1SRQA 2WD9A 3I61A 1RPTA 4P7FA 5TX7A 1NLFA 2HNKA 2NU7B 5KWEA 2XT6A 3IUBA 2QQ0A 1EK2A 1PIWA 4TL7A 4RESA 5JSZA 1I33A 3FCYA 4UBJA 4ED9A 1CCWA 1S3GA 4L0QA 4TV8A 1PG2A 3EEOA 3LCRA 1Q22A 2O2SA 1BE1A 1WW8A 3D2CA 2QKYA 1A9OA 2POCA 4BMPB 5ARBA 4OCZA 3C85A 4DBZA 3BIFA 5LD2B 1QQAA 1H0HA 4S1NA 3BGSA 3DEYX 2A9JA 4PV7A 1PYDA 4B35A 1TQHA 3DOUA 4RDCA 1WPRA 4QDTA 4FD3A 1JSRA 1U28A 1K7FB 2FH5B 2WSMA 3ESYA 3MGKA 3T3OA 4I4IA 4Q16A 2FWJA 2GTIA 4NK5A 2HXYA 4D5GA 3MWDA 5CB0A 4IDCA 3N8IA 2ECKA 3E9CA 1FZTA 1E4EA 1EA5A 4GLFA 4PYMA 4A0HA 3OF2A 3GXOA 4JOSA 2PE5A 4YI5A 4ARBA 2R6JA 3DDWA 3JATB 1QVVA 2WF9A 4MYTA 4OK5A 1ANKA 2Y66A 4C4PA 5HPYB 3SFZA 5BOVA 3A4MA 2JFVA 5AHKA 4KPUA 4RMJA 1YQDA 2RI0A 3TLXA 1JG4A 1XEAA 3OIFA 1RWWA 4JLSA 4Y8VA 2ODEA 1QQTA 4KMMA 2I2FA 1HQDA 1RWQA 3K2EA 3TTXA 2IHTA 2XEDA 1QGUA 2H11A 2H7YA 1Y5MA 3PEEA 4MW6A 4ESHA 5GINE 4S05A 1QDUA 4L8LA 4MZXA 2V3CC 2FW9A 1Y3AA 1BX1A 2QJTA 2VHEA 1PEAA 1VHQA 2UVQA 1W4RA 4H1VA 3EGWA 4AYTA 1TRHA 3E3MA 3W7VA 2Z6QA 1CF4A 2BMVA 1K8XB 3E48A 5KX5B 3KKMA 2RHRA 3CUTA 4RLHA 3V8EA 1ORWA 2ONCA 3KD2A 4INPA 5EZSA 3DOJA 1FVXA 2GHTA 4KLZA 2HBRA 4U2BA 4AJNA 3HEMA 3GZNB 2D06A 3EBOA 1ZITA 3PD1A 4HLUC 3PKIA 2H4ZA 4YB8A 4CL2A 4RZUA 4XI9A 2ZE7A 3UICA 2XNDA 4QO7A 4XVHA 3HU5A 2ZSFA 1C8KA 2PGJA 3ILHA 3FR7A 1Y9EA 4FYXA 1II0A 2PN1A 3X1XA 5KTRA 1LF5A 3JQPA 2FEMA 3LQFA 1XQ9A 4IVQA 4NDAA 4P4TA 2CCGA 3FKSA 4QEKA 1RZRD 1XTBA 4WT7A 5EWJA 1YZGA 2VA8A 3I4MB 1G8HA 3SD7A 1KI1A 3T35A 4FVTA 2ZQ5A 2GCOB 2DQZA 1WS6A 3FI9A 1SUPA 3SQOA 4XVUA 3SQDA 5DBHX 2O0KA 1K75A 3JQQA 3NYWA 1RMYA 1ONNA 2XD9A 1NOJA 1E66A 4G2TA 5TQ0A 4CL8A 5K05A 3K0KA 2PKWA 4ZHSA 4BPBA 3Q4GA 3AW9A 1SK9A 4MV8A 1CNMA 1U8CB 1UADA 2OFWA 2PH1A 3KYDB 5DI3A 5C51B 1BWRA 1CUCA 4RVFA 1SBNE 1SU6A 1EHYA 1GL6A 2WSLA 1OT5A 1RS0A 3D43A 1H8ED 3KR1A 4FHZA 3RFUA 4AT1A 4Z7JA 5JADA 1BU8A 4FE3A 1XYVA 2QRGA 3LY9A 2H07A 3IQDB 3AR7A 3HOWB 3K6SB 1K8YB 4CMKA 1RM0A 3PQFA 4JC5A 1TLFA 1CIVA 1ISMA 1WLYA 1WUHS 3CZQA 1JHQA 4PN3A 4JT9A 3GP8A 4YCSA 1OX4A 4XAQA 3T7RA 3R7WB 5CG2A 2F1KA 1Z4IA 4R2HA 3NHRA 1N6IA 3JWGA 3R1IA 4IVNA 3BTUA 3OTGA 4PSCA 2NUPB 2I65A 3RVKA 2RGBA 4B8YA 1A8IA 4MS3B 5JE8A 1SFOB 4LGYA 2QRHA 3LSYA 4W5QA 4PZDA 5F64A 5LC1A 3WOHA 1F8GA 4K9NA 4AX4A 2FZKA 3H17A 4K2AA 1Q1BA 4MRRA 4D3FA 1V71A 3ZWDA 4MS4A 2I7TA 3A25A 4NCIA 1Z37A 1QZ3A 1YB7A 2K7ZA 4WSOA 1XMOB 3NC4A 2VUSA 2ZIGA 2BGNA 2DZDA 3B3AA 1SVUA 3EMVA 3P2JA 4EQZA 3T99A 1WB9A 1RIFA 3LI2A 3LAWA 2YIJA 2IJGX 3NTRA 1EXWA 1U3DA 5GJVC 1MB4A 2G67A 4YX9A 2KLHA 2D8AA 3ANYB 4YPFA 3JAKA 1MB9A 1KMNA 2C2GA 2IP4A 3HI4A 3I37X 3MNFA 3UAWA 5H9WA 4OI0A 3WGYA 3VTZA 4C2MB 1HQYE 5ALXA 2JGFA 5CNIA 5HVNA 3QOYA 2XLCA 4WKOA 2QM7A 4MYCA 2FX5A 4DQDA 1L5SA 3ZKWA 2AJCA 3GRKA 1WXGA 1QH1B 3N28A 4HMOA 1HDRA 1IJEA 5KNCA 3ENNA 3SWWA 3S16B 2WKSA 3VYUB 4W9NA 1WL8A 2VH2A 4HAWA 2C42A 3DEFA 3U9LA 1U7UA 4M9RA 4JJ4A 3MF4A 3KELA 4EKGA 1KI4A 4RKEA 2BF4A 3OOWA 4H6PA 3GDOA 5IBRA 3ZHSA 1VSVA 1M8JA 2AKYA 4OU5A 3GH1A 5ALVA 4JBIA 2GH1A 3IR6A 1M6WA 1ZU5A 5BN3B 5TY0A 1KEEB 3NATA 4TYPA 3ZHCA 2OFXA 5KJ1A 3BB4A 3CWCA 1APBA 2C99A 2MTBA 1THTA 1UANA 1UMDB 1JAZA 1U0FA 3ESBA 4Q37A 4CEHB 3IUSA 3FE2A 1WXIA 2OBLA 2C57A 2BKEA 2O4UX 3F5QA 1W85A 1ZZGA 1T3SA 4UHCA 3TLGA 1NX9A 4TYNA 3DFZA 1Q17A 4GP7A 4W5RA 1XF9A 3MC1A 1QAOA 2VUHB 1PG5A 1LVUA 5IHXA 3WHPA 1D2GA 1JSCA 4NYJR 3VU9A 1IXZA 3U5TA 3TTYA 4LF7B 4QJ4A 3L07A 1L4HA 3O94A 3CPSA 2IV2X 4BMCA 1L1FA 2WU1A 2A0FA 5HCUA 3GW8A 1J99A 2G28A 3WRYA 4TTQA 2EL9A 3QJGA 2B1JA 2AJDA 1MP0A 2EX4A 2I62A 4CKYA 1JU4A 3RADC 2P2LA 4FNMA 4GP9A 4PS1A 3AKZA 1T9BA 3KKOA 4UTNA 1R6TA 2CVHA 4I66A 5D7BA 2O48X 2VH1A 2Y27A 1NL3A 3O2JA 4FFBA 4HRAA 3PE4A 3IPRA 4H3SA 4O6VA 5IH3A 3T94A 4CM1A 2C4NA 2R7AA 2PL1A 1LZKA 4LCBA 3L0ZA 1C9EA 3E5RA 1QYWA 2IVFA 2X7XA 4LVCA 1O5IA 1RQXA 1QB7A 2Y1OA 3KSBC 1AB6A 1AURA 1TTHA 4QXQA 4UZFA 1YTLA 1T2NA 4YCAA 5L45A 2W8BA 5EWLB 4AIIA 1T13A 1VCIA 4Q18A 4G25A 4RKWA 1P45A 1A77A 3FPAA 3F3MA 3EH1A 3WDSA 2AXQA 4B2LA 1DJOA 4KHPB 1G5HA 4PY2A 1XP8A 1XZKA 5EIBD 4DDUA 2QPLA 4AYXA 4P86A 3ZV6A 1UT6A 3I42A 8OHMA 4PFKA 1RQPA 3G5LA 2B4QA