1TJFA

The crystal structure of the n-terminal domain of cap indicates variable oligomerisation
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
185
structure length
185
Chain Sequence
GAAGPSSASVKEFQNLVDQHITPFVALSKKLAPEVGNQVEQLVKAIDAEKALINTASQSKKPSQETLLELIKPLNNFAAEVGKIRDSNRSSKFFNNLSAISESIGFLSWVVVEPTPGPHVAEMRGSAEFYTNRILKEFKGVNQDQVDWVSNYVNFLKDLEKYIKQYHTTGLTWNPKGGDAKSATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyl cyclase-associated protein
publication title Structural evidence for variable oligomerization of the N-terminal domain of cyclase-associated protein (CAP).
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Membrane protein, protein binding
total genus 70
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.330 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1tjfA01
1S0PA 1TJFA
chains in the Genus database with same CATH superfamily
5A23A 2JABA 5BT1A 4ATGA 3U64A 4IULA 2R02A 4HVBA 3BUAA 2DZNA 3URZA 4AVXA 3SO8A 4G24A 3C3RA 3CK8A 2P9PG 3UT4A 1KT0A 1IXVA 3UINC 1E8XA 4GTPA 4I6JA 3ZIMA 5D0OD 4LNBA 2XGMA 3CHMA 2DYSE 4EBAA 2I9CA 3CVWA 1V54E 2Y69E 5CECB 3G2WA 5CERB 2CFZA 3V2XA 5KWDA 3ZHEB 5AJDA 3OXLA 3PE3A 1SW6A 4GZ3A 5C2YA 1UN9A 1GW6A 3PH0C 3FH7A 2PQRA 3LKUA 4CEMA 4HQDA 1JCSA 2XPZA 3UI2A 4F3VA 1MJ0A 1FT2A 3ASNE 4FJYA 2J4DA 1YMPA 4OAUC 1RW2A 5JJ6A 3FU5A 1TNBA 2OEWA 1A5EA 4XKCA 3T5XA 2FULA 3TG4A 3O4ZA 4U0ZA 4CZ2D 4DRXE 3FUKA 1UN8A 3UUXA 5CMWA 3L54A 1MQSA 4M3OA 4ZFHA 2AWIA 4BERA 4HOQA 3QC1A 4IN3B 5AIJA 3FU3A 2NXPA 4YDWA 5CBOA 5EIDA 3AU5A 4HLLA 1HF8A 2PQNA 3ONKA 4NQ0A 4HB5A 3ISMC 4FJZA 2P9IG 2J07A 2HR2A 1N4RA 3MGBA 3FUMA 4XI0A 1H2VC 3PS6A 2VTBA 1LD7A 3LPZA 3CVUA 2PZIA 3MV2B 2ILRA 4HRMB 4I1AA 4J7WA 3ESLA 4GTMA 3HXCA 2UY1B 4N3CA 4GU5A 3KEZA 5J08A 3CVNA 5BXUA 2AXUA 4JZYA 3MCXA 2LSUA 4XZ4A 1V55E 4GAAA 3DSXA 5KNGA 4D10C 2QZAA 1BD8A 1FPPA 4FC8A 4J8SA 3DPYA 1K3ZD 5FIOA 3J5QB 3CHRA 4TUUA 4U96D 2QY7A 3IBEA 3B95A 4JA7A 1H2TC 1YYHA 2R5SA 2WQ6A 1WDYA 1ZBPA 2V0PA 1G3NB 1NZNA 4IRUA 1QZ2A 2VSYA 2WXRA 4HXIA 3TL5A 3LYAA 3B7TA 5CRUA 5AYWD 4WWOA 2GRQB 3C5RA 1QNFA 4N5QA 2P9SG 3ULEG 3OXFA 4OYSA 2J4BA 4EBAG 2XENA 3EHMA 4J0UA 3D9LA 2DWZA 1U3DA 3CHQA 1EPUA 4F53A 3QK0A 2IONA 1O5MA 1QQEA 4J8YA 2V5QC 4A3VA 3JUIA 4G23A 4FA6A 2AVPA 2ZIRA 3UXGA 4JHJA 4UI9K 2XS8A 5FWQA 3FFLA 3EIJA 2CG3A 3EJNA 4HOUA 4BETA 2ZGGA 4R7LA 4KBQA 2WXNA 3L9TA 5AN8A 4EZJA 1Q2ZA 3OTNA 3T5VA 4WNEA 2CHWA 2AJAA 1E8WA 2VGXB 4G25A 5AENA 4NRHB 2XRZA 4ANWA 2X38A 3PRZA 5CBNA 1K1AA 5FQ8A 3S7BA 2XGOA 5CEDB 4F1SA 3AJIA 4Q94A 5G04C 4UQXA 3PZ3A 3DSWA 3C3OA 5J90A 2XZTG 3LXUX 4ABNA 5A7DB 3ZNGA 2P58C 1IKND 4FP7A 3HXEA 4YDYA 1IHGA 1KZPA 2EQXA 4ILGA 4A3TA 3D9KA 3VLEA 4CDMA 3ULQA 2FI7A 1S70B 4WWNA 3QNKA 3TJPA 2IOSA 4GYOA 4CGWA 4RVBA 3EHRA 3CSTA 5JJ7A 5G04J 2IY0C 1H6PA 4AY5A 3NB2A 5BV0A 3Q49B 2IU1A 3E34A 3ZYKA 4C48B 3HVEA 1PC2A 2LNIA 1TN7A 1SQMA 1BLXB 1SZAA 1N4SA 3JYSA 1PAQA 3ENEA 1N94A 1DC2A 3RRMB 2X6KA 1X5BA 2CG2A 3F6QA 4WNDA 2C0LA 2WB2A 3CIAA 2RKKA 4MLPA 4U95D 5ENRD 4I2WA 4HOSA 3JXJA 4CCAA 4KXKB 4AIFA 4AP2A 3Q73A 2X6FA 1NA3A 3JQ1A 5H7PA 2WXJA 3E33A 4N5CA 3FH8A 1E7VA 2IQCA 3DRAA 5B1AE 3FY4A 2UWJG 3P2BA 3V2OA 2OCCE 4GTVA 2PM7A 3B7BA 4HI8A 5EIBE 4BTBA 4BX9A 3NZUA 3UIOC 5AARA 4JW1A 1NI1A 3V30A 1HXIA 1OCCE 3V31A 3CGHA 3DXKG 5LOZA 2J08A 5CEAA 4BY6A 2KCKA 4XX5A 4ANUA 4A63B 1H0AA 2J49A 1N9AA 3ZUVB 4I6EA 1U3CA 3MV3B 3TWQA 5AAOA 2PNNA 3CVYA 3UT8A 2GROB 4LERA 1OWOA 1OWMA 1OY3D 3HG0D 3Q15A 5KBAA 2IFUA 3DXMG 3RSEG 5CRVA 1HZ4A 2FO7A 3I3NA 2CFUA 2L9BA 4K0RA 1O1TA 5FZRA 1ELRA 4H7YA 3D9HA 3ZW3A 4PUCA 1IHBA 3UM0A 4K5CA 3UX4A 3U66A 4L2LA 3FU0A 4I43A 2R05A 1S64A 3RRUA 4I9CA 3S7FA 4G1TA 3SHFA 5HKPA 4O1PA 1EF1C 3B7UX 2EILE 3IKOB 3UQ3A 4GYYA 1K1BA 4ATZD 4LG6A 4WNFA 5ENTD 3EUVA 2KZTA 3FU6A 2BTDA 2KXPC 1BU9A 3UM3A 4K5AB 5EKQD 3UKUG 4DLQA 3MYVA 3FTVA 1S63A 4TXRA 3ESKA 3BU8A 3ZYLA 3W9FA 2XEEA 4F6RD 4NURA 3MX3A 3ASFA 5JA4D 4AEZC 3CKCA 3AS5A 3GYZA 5BV1A 3ZU7B 4BESA 3LCAA 5HRYA 3E4BA 2XQ0A 2XPYA 4O60A 4XI9A 5JJTA 5FT9A 2GGFA 4DX6D 3QWPA 4DX1A 4FHKA 1Z6TA 3VTYA 1N95A 3ZVVA 5BXOA 5G2NA 3DWLG 3NAWA 1HU3A 4RG6A 1Y6IA 1HX8A 3ZXSA 4A1GA 1RZ4A 4GZ5A 4FU3A 3TWWA 4EHMA 2VSOE 2NC9A 1MZCA 2ETBA 2GW1A 3C72A 2V4LA 3TWSA 3I5PA 4WWPA 4XKBA 3EHNA 1AP7A 3JQ0A 2BEDA 3GZ1A 2ZU6B 5ENOD 3D9PA 5ENNA 1OUVA 5D66A 1H6OA 2KATA 3PE4A 3UPVA 5D0QD 5AQBA 2NSZA 2C2LA 4U8VD 4TXPA 3AG3E 2FEZA 3IHVA 4HBDA 3SBSA 3D9JA 2ETCA 4HLEA 2VGEA 4AXHA 4FHJA 3AU4A 3JCKC 3Q9NC 5JMND 2ONDA 3L17A 2I6HA 3WG7E 3LVQE 2ZXWE 3HXFA 4G11A 2BF0X 5HI7A 5G05C 3TAXA 4G8LA 4DUIA 1U2VG 3CVLA 1VDYA 3CVPA 2H6FA 3LDZA 4ACLA 4U0UA 3NBNB 5BW8C 1O1SA 3FDHA 3FTWA 4TRQA 4LCTA 5EN5D 3ZRHA 3E32A 3IHYA 3SBTB 3CK7A 3DEPA 4E6HA 3AG1E 1OCOE 1DCQA 3L16A 5IY5E 2DIWA 2L0TB 3CEQA 1N0RA 4FADA 1WG0A 4Q69A 2HO1A 4UWKA 2VGYA 3TG5A 1SA5A 5HQ8A 4J8FA 3RAUA 4PDXA 3W9GA 4ANXA 3ABME 5ENQD 1LF8A 4BT9A 3AS8A 3G2SA 3Q78A 5LCWC 1JUQA 4BSXA 2A4ZA 1H19A 1Z5SC 2Y0BG 3D3MA 4PS8A 1N11A 4JA9A 3MEKA 4F7AA 4MRUA 4GCOA 2J9QA 4JL0A 1XGWA 4X8QA 2OV8A 4GZCA 1YA0A 2AW6A 4HFGA 2A5UA 4CRWA 4NIKA 3RJVA 4CT0A 1HG2A 1MHQA 3Q5MA 3FTYA 4N39A 3FEXA 3CLJA 4B0ZA 3OAWA 5CHEE 2CHXA 3D9MA 4HI9A 3AG4E 3FUDA 3QWVA 3LY8A 3VLDA 1NL4A 3R9MA 4DX7D 1E8YA 1MX4A 4GMRA 4BEPA 1KT1A 3RIBA 4JEUA 4YDOA 4DX2A 2RD0A 3SFXA 3ZYMA 2R2LA 3APCA 3DSTA 3L82A 2F37A 2ETAA 3S7JA 2ZGDA 4GA1A 4O1OA 1FVFA 2WXFA 4RSYA 5EYLA 2V5FA 4F1PA 5T3RA 3LVRE 1TYQG 4I1OB 3QDNA 1E96B 3U9WA 1YCSB 1ZU2A 5LX8A 4DJAA 2CHZA 1Y8MA 4Q96A 2P9UG 2JEKA 3ZHEA 2F8YA 3QKYA 2M63A 2OEVA 1Z3XA 1ELWA 4FLBA 4BX8A 4ILHB 3DSUA 3SZ7A 1SVXA 3MKQA 4K5BA 4ZHBA 2L6BA 2DBAA 5EDSA 5LP0A 5HS0A 4ACKA 2QYUA 2QC9A 3R9AB 4GA0A 3UT7A 1TN6A 2HE0A 4GYWA 4MKTA 2WQHA 4UWFA 4HS2A 2WXQA 4APOA 3PVLA 1TJCA 1H6KA 3CR3A 1N4QA 1FT1A 3TGOA 3GZ2A 4JD2G 4M7CA 3IXEA 4L23A 3MZLB 3FP3A 1HG5A 3FTXA 4HRNA 3SI5A 3CKBA 3FWVA 4I1MA 1HH8A 1TNYA 4V3IA 1WY6A 3ZN3A 3ML8A 2GRRB 3KEAA 4JXTA 3FUJA 1N0QA 2X6HA 3ZPJA 2Y3AA 3FH5A 4B93B 2YHEA 2B0OE 2P2CP 5JHBA 5KCMA 3S2AA 2KC7A 5EYPF 4JPSA 3K9IA 4EZKA 1N52A 3FUEA 3FUNA 2AXZA 3AS4A 4GA2A 2LAHA 1EYHA 1KLXA 4GPMA 3PZ1A 2QYJA 2FBNA 1D8EA 3AG2E 4MS6A 4XEIG 3HYMB 1UW4B 4WAFA 4JVSA 1N54A 4W9RA 5B1BE 5FQ4A 4YVOA 3ASHA 3SF4A 2A5EA 5DIZA 1OT8A 3ASDA 3FTUA 5DBKA 4U63A 1X81A 2XGSA 1MX2A 4PS7A 5KJLA 5AQ7A 4G8KA 4G2VA 3U3WA 1LD8A 4KMOA 2F8XK 2WM9A 3PDNA 2Y4TA 4UWGA 4A1SA 3ASGA 4L1BA 3FUFA 3MJWA 4A55A 4H7XA 3LJ3A 2AXVA 4UWLA 2WXPA 4LSZE 2XCBA 2DVWA 5FQ7A 5BPPA 4XE0A 2XCCA 1TR4A 2OOEA 3UMVA 3G2UA 5JHAA 2VTBB 3UIPC 1JWFA 2IO3C 2OVBA 1NA0A 3ONLA 1W3BA 3SFZA 4ANVA 2QFCA 5FZSA 4I17A 3HXDA 4AJWA 2GRPB 1TEZA 3UKRG 3BEEA 3KSLA 4JHRA 3PNTB 4EECA 2WXLA 5KNHD 5KJNA 4LRZA 3QB2A 2WMOA 4AY6A 3KD7A 1BI7B 3ML9A 4DI4A 2B6CA 4C0MA 3RO3A 2RFMA 5ARGA 4FULA 3RO2A 2VGXA 2X6IA 3HDXA 3DBSA 2XEVA 5M72A 5ANRA 2XRYA 3L6AA 4UI9C 2KCVA 1UOHA 2BUGA 3QAQA 1E8ZA 3SNXA 3LJNA 4JEHA 3V79K 2FF4A 3CV0A 3I4GA 2MRIA 4KYOB 4TUMA 2DZOA 3LY7A 3P1UA 3NOCD 3NQPA 2FO1E 1HS6A 2IJGX 4J6IA 4B89A 4UI9J 2LAIA 3FTSA 3T8KA 1SZ9A 4CT4A 2H6IA 2WXHA 2WPVA 2V8SE 5ENSD 2VSNA 4Y6CA 3D9OA 4EPZA 3BG0B 4GZDA 2KBXA 2L0IA 1KPSB 2I1JA 2EIJE 2OVFA 3CVXA 3I4RB 2I2OA 2KM4A 3QOUA 1B89A 4PS3A 4TV3A 1Z3YA 4U04A 3TWVA 4YVQC 5LFAA 4KZ0A 3DPDA 3LY9A 2J09A 2DCPA 2KCLA 5D2MC 3LEWA 4YNDA 2E0IA 2Q7FA 3PEUB 5FQ6A 2BKGA 4JC8A 4Y6WA 2YNQA 3DSVA 3UM1A 3GZSA 5T8IA 3KS2A 3MKQB 3PNLB 4HRLA 4B8AA 4LEUA 3BG1B 3VLFA 4GTSA 2WMNA 1A17A 1MYOA 1L5JA 5E75A 5AQAA 3MKRA 1QYMA 4L7TA 5BUZA 1MX6A 1D9SA 2LXLA 4ILIA 3TWRA 1INZA 3FUHA 4HNAD 3R7QA 1OWPA 4BFRA 4JB8P 3C3QA 3PREA 1ZB1A 4KT6B 2F0YA 5FINA 2P9NG 3FTZA 4YDEA 3HIZA 1OCRE 5ANLA 2PL2A 5C1DA 4IYPA 3CHOA 3E30A 2IEJA 4U07A 4GTRA 3O48A 4GMJA 4N2SA 2X3MA 1OCZE 5ENPD 3HVEB 1HE8A 3DEOA 3T9KA 4APFA 2YQ8A 4K03A 3IV0A 1NP7A 4RG9A 1KZOA 5G05J 3MA5A 2RFAA 5EILA 2PM6A 1OXJA 4OAVB 3SFYA 2VQ2A 2HM8A 4O6FA 2WXIA 3Q75A 2R59A 4U8YD 3UM2A 2I1KA 4J8DA 3TWTA 1TNZA 3Q7AA 4BTAA 4N2QA 3TWUA 3B13A 2YINA 3ZXPA 3Q4AB 1SA4A 3HHMA 2JLBA 2WXKA 4CDNA 3S7DA 3ULYA 2MYOA 1JCQA 3E37A 1IYGA 3B7RL 1TNUA 3Q7FA 3D9IA 5LCWJ 4JHKA 2XHEA 4XIFA 4I6GA 2V4HC 1JCRA 4AOFA 1H2UA 5KJMA 4DX5D 1E7UA 3WXXA 1OWNA 1HFAA 2R03A 1S0PA 3APFA 2MOWA 4DPRA 2Y4UA 4EQFA 5FZQA 3FEYA 1UJKA 1BPOA 3SD5A 4KVOA 3KSQA 4U7EB 1E90A 3ASOE 4HORA 4URKA 5EX0A 4UQZA 4WUYA 4OVUA 4C0EA 2GRNB 4BWRA 3PUKA 5CCMA 2H6HA 3TXMA 2R17C 5G55A 3Q79A 2XEHA 4KVMA 3N71A 3FULA 4GTTA 4NACA 4BT8A 4GZ6A 3IEGA 3CQCB 1PY1A 4KZCA 3VTXA 4RLYA 3PZDA 3CVQA 2XZDG 4DI3A 2VSXE 3TXNA 3LS8A 1N4PA 3Q47B 3CK9A 3CHSA 3EU9A 3SY2A 2KZTB 3FUIA 4GTQA 4TXQA 4UWHA 4BSZB 1UJJA 1DVPA 1DNPA 2LO6A 3CHPA 4PH4B 5B3SE 2P9LG 5T4YA 4MBGA 1K8KG 4AM9A 4I9EA 3OXGA 4OVVA 3X2QE 3EHQA 5FJYA 1QBQA 4DLOA 3FHEA 2BKKB 2WXOA 3R7RA 3J5PA 3ABKE 3B7SA 2WQ7A 1FCHA 1D8DA 5EX3A 4HOTA 3ZKJA 3Q9UC 3CQGB 3EDTB 5ITZF 4GB9A 4LUNU 3SGHA 4Z68A 3CVVA 2WVIA 4WNGA 5AQ9A 4FLHA 1O1RA 4RQIA 1TN8A 4LNUD 4CYMD 3APDA 1NFIE 4N3AA 2VYIA 4U8HA 3JXIA 5E76A 2XS1A 3ZGQA 4B8CB 2UY1A 4J8EA 3G2TA 3RK6A 4L9PA 2L6JA 3RRNB 4I2ZA 1FVHA 3NOGD 3T8MA 2DYRE 1BI8B 2LXMA 3U4TA 4GTOA 2IF4A 3PZ2A 2GRLA 4LNGA 4UUCA 2EIME 1ELKA 3PEVB 1UG3A 5BNWA 3HRAA 3L22A 3BQOA 3C98A 2NYJA 3GW4A 3KAEA 3ZFWA 3ABLE 3NZSA 1P5QA 1DCEA 2RG8A 5FTPA 2HYZA 3SQVA 2GRMA 1HO8A 1EDUA 3HXBA 1TJFA 4UQYA 4ME2A 3ZYQA 3PUJA 5CCLA 2WXGA 2EINE 5A6CA 3UTMA 1AWCB 4U0SA 4CGVA 2E2EA 2H6GA 2VJ8A 4AV7A 3NF1A 2LSVA 2ZISA 4B94A 3DSSA 5AJLA 3CSFA 3PZ4A 1TNOA 1OWLA 3RKVA 4E85A 4QQIA 4C9BB 3RU0A 3AAAC 4EZLA 4CDRA 2YHCA 1WM5A 3ZEFA 2P9KG 3EU5A 2MHKA 3QARA 2Y1LE 4GCNA 3JUEA 2C0MA 3TWXA 4DK5A 3QJZA 1IQUA 1XNFA 1JPLA 3EIQC 1IQRA 5ARFA 4G26A 3QWWA 5CMYA 4L2YA 3G2VA 4GPKA 3L08A 1WAO1 4N3BA 2WXMA 2LUHA 2X6JA 3D9NA 2J8SD 5KJKA 3L13A 2XPIA 4QFVA 4P29A 4GMLA 2IOLA 1LTXA 2EIKE 2IO2C 1JWGA
chains in the Genus database with same CATH topology
4Q96A 4N2SA 5A23A 2X6FA 2X3MA 1NA3A 2JEKA 3ZHEA 3QKYA 3HVEB 2M63A 3JQ1A 5BT1A 1HE8A 4ATGA 2WXJA 3U64A 4IULA 4APFA 1Z3XA 4N5CA 3FH8A 1E7VA 2YQ8A 1ELWA 4K03A 4HVBA 3IV0A 1NP7A 2IQCA 4FLBA 3FY4A 2UWJG 3P2BA 4RG9A 5G05J 3URZA 4BX8A 4AVXA 3MA5A 4ILHB 2PM6A 4G24A 3SZ7A 2PM7A 3CK8A 3MKQA 3UT4A 1KT0A 1E8XA 4BTBA 2VQ2A 4I6JA 4BX9A 3ZIMA 3NZUA 5D0OD 2DBAA 2HM8A 5EDSA 4O6FA 5LP0A 2XGMA 4JW1A 2WXIA 4ACKA 3CHMA 2R59A 4EBAA 3R9AB 2I1KA 1HXIA 4GA0A 4J8DA 2I9CA 3CGHA 3UT7A 3CVWA 5LOZA 2J08A 4GYWA 4BY6A 4BTAA 4N2QA 3G2WA 2KCKA 2CFZA 3B13A 4XX5A 4MKTA 2YINA 2WQHA 4UWFA 3ZHEB 3Q4AB 4ANUA 1H0AA 2J49A 4HS2A 2WXQA 4APOA 3HHMA 5AJDA 2JLBA 2WXKA 4I6EA 3PVLA 1TJCA 4CDNA 3OXLA 1H6KA 3CR3A 3S7DA 1U3CA 3MV3B 3PE3A 3TGOA 4GZ3A 5C2YA 3GZ2A 1UN9A 3CVYA 1GW6A 3UT8A 1IYGA 3B7RL 3PH0C 3FH7A 4LERA 2PQRA 3D9IA 1OWOA 5LCWJ 1OWMA 4L23A 3MZLB 2XHEA 3FP3A 4JHKA 4XIFA 1HG5A 3FTXA 3LKUA 4I6GA 3SI5A 3CKBA 4CEMA 3Q15A 3FWVA 2XPZA 4AOFA 2IFUA 4I1MA 4F3VA 1HH8A 1H2UA 1HZ4A 4FJYA 2J4DA 5KJMA 4V3IA 2FO7A 1WY6A 3I3NA 1E7UA 3ZN3A 2CFUA 2L9BA 3ML8A 1OWNA 5JJ6A 3FU5A 4K0RA 3WXXA 4JXTA 5FZRA 1ELRA 1HFAA 3FUJA 4H7YA 2X6HA 3ZW3A 4XKCA 3T5XA 4PUCA 3ZPJA 1S0PA 2FULA 3APFA 2Y3AA 3TG4A 3FH5A 2MOWA 3UX4A 3O4ZA 2YHEA 4U0ZA 2Y4UA 4DPRA 4EQFA 3U66A 4L2LA 3FU0A 5FZQA 5JHBA 4I43A 3FUKA 3FEYA 1UJKA 1BPOA 1UN8A 3SD5A 3UUXA 3RRUA 5CMWA 4I9CA 3S7FA 5KCMA 4KVOA 3L54A 1MQSA 2KC7A 4G1TA 3S2AA 3SHFA 4M3OA 2AWIA 4JPSA 1E90A 4HOQA 3K9IA 3QC1A 4EZKA 4IN3B 5AIJA 1N52A 3FU3A 2NXPA 1EF1C 3B7UX 3FUNA 3FUEA 4HORA 2AXZA 3IKOB 3AS4A 4GA2A 3UQ3A 2LAHA 3AU5A 4GYYA 4URKA 1EYHA 1HF8A 5EX0A 2PQNA 4UQZA 3ONKA 1KLXA 4WNFA 4NQ0A 4WUYA 2KZTA 2FBNA 4OVUA 4C0EA 4BWRA 4FJZA 3FU6A 3PUKA 5CCMA 4MS6A 2BTDA 3HYMB 1UW4B 2J07A 2HR2A 4WAFA 4JVSA 5EKQD 3TXMA 1N54A 3MGBA 4W9RA 4DLQA 3MYVA 3FTVA 3FUMA 2R17C 3ESKA 5FQ4A 4YVOA 3ASHA 3SF4A 4XI0A 5DIZA 5G55A 1H2VC 3ASDA 3ZYLA 3PS6A 4KVMA 3FTUA 3N71A 3FULA 5DBKA 2VTBA 4NURA 4U63A 3LPZA 3MX3A 4NACA 4BT8A 2XGSA 3ASFA 4GZ6A 3CVUA 2PZIA 3IEGA 3CQCB 3MV2B 4AEZC 1PY1A 4KZCA 3VTXA 4PS7A 2ILRA 5KJLA 3PZDA 3CKCA 3AS5A 4G2VA 4I1AA 3U3WA 4KMOA 3GYZA 3CVQA 3ESLA 5BV1A 4DI3A 2VSXE 2UY1B 3TXNA 2WM9A 3PDNA 3LS8A 3LCAA 3Q47B 4N3CA 4GU5A 3CK9A 3CHSA 2XQ0A 3E4BA 2XPYA 2Y4TA 3KEZA 4XI9A 5J08A 5JJTA 4UWGA 2KZTB 5FT9A 2GGFA 4A1SA 3ASGA 3QWPA 3FUFA 3CVNA 3MJWA 4FHKA 4L1BA 4H7XA 3LJ3A 2AXVA 3FUIA 4A55A 1Z6TA 4UWLA 2AXUA 4JZYA 3VTYA 4UWHA 2WXPA 3MCXA 3ZVVA 1UJJA 2LSUA 4XZ4A 1DVPA 1DNPA 2XCBA 5G2NA 4GAAA 2LO6A 3CHPA 1HU3A 4PH4B 5FQ7A 4RG6A 4D10C 1Y6IA 5BPPA 5T4YA 4XE0A 1HX8A 4FC8A 3ZXSA 2XCCA 4A1GA 4J8SA 2OOEA 4GZ5A 3UMVA 4AM9A 3G2UA 5JHAA 3CHRA 4FU3A 2VTBB 4I9EA 4TUUA 2QY7A 3OXGA 2VSOE 2NC9A 3IBEA 1JWFA 2OVBA 4OVVA 1NA0A 3ONLA 1W3BA 3SFZA 4ANVA 2GW1A 2QFCA 5FJYA 5FZSA 2V4LA 4I17A 3I5PA 4DLOA 4WWPA 3FHEA 4JA7A 1H2TC 4XKBA 2WXOA 2R5SA 3EHNA 3R7RA 2WQ6A 4AJWA 3JQ0A 1ZBPA 3GZ1A 2ZU6B 3B7SA 1TEZA 2WQ7A 1FCHA 2V0PA 3D9PA 5EX3A 1NZNA 4IRUA 4HOTA 1QZ2A 2VSYA 2WXRA 4HXIA 1OUVA 3BEEA 3LYAA 4JHRA 5ENNA 3B7TA 3TL5A 3PNTB 5AYWD 4EECA 2WXLA 4WWOA 3CQGB 3EDTB 5KJNA 4GB9A 1QNFA 4LRZA 2KATA 3PE4A 3QB2A 3UPVA 2WMOA 5D0QD 4LUNU 3SGHA 4AY6A 3KD7A 3ML9A 2NSZA 4DI4A 3OXFA 3CVVA 4OYSA 2C2LA 2WVIA 2J4BA 4EBAG 4C0MA 4WNGA 3RO3A 3EHMA 2FEZA 3IHVA 4FLHA 4FULA 5ARGA 4J0UA 3SBSA 3D9LA 3APDA 3D9JA 1U3DA 3RO2A 2VGXA 2X6IA 2VYIA 3HDXA 3CHQA 4N3AA 1EPUA 4U8HA 4HLEA 5E76A 3QK0A 4F53A 3DBSA 2XEVA 2IONA 5M72A 5ANRA 3ZGQA 1QQEA 4AXHA 4FHJA 4B8CB 3AU4A 2XRYA 4A3VA 3JCKC 3JUIA 3L6AA 4G23A 4UI9C 2AVPA 2ONDA 2KCVA 2UY1A 4FA6A 3L17A 2BUGA 4J8EA 3QAQA 3G2TA 4JHJA 4UI9K 2I6HA 3RK6A 1E8ZA 2L6JA 3LVQE 5FWQA 3FFLA 4G11A 3EIJA 3SNXA 2CG3A 2BF0X 4JEHA 5HI7A 5G05C 3RRNB 3EJNA 4HOUA 3TAXA 3CVLA 4I2ZA 1VDYA 1FVHA 4R7LA 4KBQA 3T8MA 2WXNA 2FF4A 3CVPA 4EZJA 3U4TA 2IF4A 3CV0A 3LDZA 3OTNA 2GRLA 3I4GA 4U0UA 4ACLA 3T5VA 5BW8C 2MRIA 4KYOB 3FDHA 3LY7A 4WNEA 3FTWA 3P1UA 1ELKA 4TRQA 4LCTA 3PEVB 1UG3A 5BNWA 2CHWA 3ZRHA 3IHYA 3SBTB 3CK7A 3L22A 3NQPA 4E6HA 1HS6A 2IJGX 3C98A 3L16A 2DIWA 3GW4A 1E8WA 3KAEA 2L0TB 4J6IA 2VGXB 3CEQA 4G25A 4FADA 3ZFWA 4Q69A 2HO1A 4UWKA 3NZSA 5AENA 4B89A 2VGYA 3TG5A 4NRHB 1P5QA 3O48A 5HQ8A 4UI9J 2LAIA 4J8FA 2RG8A 5FTPA 3FTSA 4ANWA 2XRZA 2X38A 4PDXA 1SZ9A 4CT4A 3PRZA 2WXHA 4ANXA 2HYZA 2WPVA 2V8SE 2GRMA 2VSNA 5FQ8A 4Y6CA 3D9OA 1LF8A 3S7BA 1HO8A 1EDUA 4EPZA 4BT9A 3AS8A 3G2SA 5LCWC 1TJFA 3BG0B 4UQYA 4GZDA 2XGOA 2L0IA 1JUQA 4BSXA 4ME2A 2A4ZA 4F1SA 1H19A 2I1JA 3ZYQA 2OVFA 3PUJA 4Q94A 5G04C 2WXGA 5CCLA 3CVXA 3I4RB 3D3MA 4UQXA 4PS8A 5A6CA 4JA9A 3MEKA 2I2OA 4F7AA 5J90A 4U0SA 4MRUA 2KM4A 3LXUX 3QOUA 4ABNA 4GCOA 1B89A 4PS3A 2P58C 5A7DB 2J9QA 4CGVA 2E2EA 4TV3A 2VJ8A 1Z3YA 4JL0A 4AV7A 3NF1A 4U04A 2LSVA 4YVQC 4FP7A 5LFAA 1XGWA 1IHGA 4KZ0A 2EQXA 4ILGA 2OV8A 4GZCA 1YA0A 4A3TA 3DPDA 3LY9A 2AW6A 3D9KA 4HFGA 2A5UA 3VLEA 4B94A 4CDMA 4CRWA 2J09A 5AJLA 2DCPA 2KCLA 3ULQA 3CSFA 2FI7A 3LEWA 3RJVA 4CT0A 4YNDA 1HG2A 2E0IA 2Q7FA 3PEUB 4WWNA 1MHQA 3QNKA 1OWLA 5FQ6A 3RKVA 3Q5MA 3FTYA 4N39A 4JC8A 4Y6WA 2YNQA 3FEXA 3TJPA 4E85A 2IOSA 3RU0A 4C9BB 3CLJA 4B0ZA 3OAWA 3GZSA 4GYOA 4CGWA 5T8IA 4RVBA 4EZLA 3KS2A 3MKQB 5CHEE 4CDRA 2CHXA 3CSTA 3D9MA 3PNLB 5JJ7A 4B8AA 5G04J 2YHCA 4LEUA 3BG1B 3FUDA 3VLFA 3QWVA 4AY5A 5BV0A 3LY8A 1WM5A 3Q49B 2IU1A 3ZEFA 3ZYKA 3VLDA 2WMNA 1A17A 1L5JA 5E75A 2MHKA 3MKRA 1E8YA 3QARA 4L7TA 5BUZA 1KT1A 3HVEA 3RIBA 4JEUA 4GCNA 1PC2A 2LNIA 4ILIA 1INZA 2C0MA 1SQMA 2RD0A 4DK5A 3QJZA 3FUHA 1IQUA 1XNFA 3R7QA 3ZYMA 1OWPA 1SZAA 3APCA 3JYSA 1JPLA 1PAQA 3ENEA 4BFRA 3EIQC 1IQRA 5ARFA 4G26A 3QWWA 5CMYA 3PREA 3S7JA 3RRMB 4KT6B 4L2YA 3G2VA 4GPKA 3FTZA 3L08A 1WAO1 4N3BA 4GA1A 2WXMA 3HIZA 2X6KA 1X5BA 1FVFA 2X6JA 2WXFA 3D9NA 2CG2A 3L13A 4RSYA 5KJKA 2XPIA 5ANLA 2PL2A 4WNDA 2C0LA 2V5FA 5C1DA 4QFVA 4IYPA 2WB2A 3CIAA 5T3RA 3CHOA 4MLPA 3LVRE 4P29A 4I1OB 4GMLA 3QDNA 2IOLA 1E96B 4I2WA 3U9WA 4HOSA 4CCAA 4KXKB 1ZU2A 4U07A 4AIFA 5LX8A 4DJAA 1JWGA 2CHZA 1Y8MA 4GMJA 4AP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0P A;  1TJF A; 
#chains in the Genus database with same CATH topology
 5A23 A;  2JAB A;  5BT1 A;  4ATG A;  3U64 A;  4IUL A;  2R02 A;  4HVB A;  3BUA A;  2DZN A;  3URZ A;  4AVX A;  3SO8 A;  4G24 A;  3C3R A;  3CK8 A;  2P9P G;  3UT4 A;  1KT0 A;  1IXV A;  3UIN C;  1E8X A;  4GTP A;  4I6J A;  3ZIM A;  5D0O D;  4LNB A;  2XGM A;  3CHM A;  2DYS E;  4EBA A;  2I9C A;  3CVW A;  1V54 E;  2Y69 E;  5CEC B;  3G2W A;  5CER B;  2CFZ A;  3V2X A;  5KWD A;  3ZHE B;  5AJD A;  3OXL A;  3PE3 A;  1SW6 A;  4GZ3 A;  5C2Y A;  1UN9 A;  1GW6 A;  3PH0 C;  3FH7 A;  2PQR A;  3LKU A;  4CEM A;  4HQD A;  1JCS A;  2XPZ A;  3UI2 A;  4F3V A;  1MJ0 A;  1FT2 A;  3ASN E;  4FJY A;  2J4D A;  1YMP A;  4OAU C;  1RW2 A;  5JJ6 A;  3FU5 A;  1TNB A;  2OEW A;  1A5E A;  4XKC A;  3T5X A;  2FUL A;  3TG4 A;  3O4Z A;  4U0Z A;  4CZ2 D;  4DRX E;  3FUK A;  1UN8 A;  3UUX A;  5CMW A;  3L54 A;  1MQS A;  4M3O A;  4ZFH A;  2AWI A;  4BER A;  4HOQ A;  3QC1 A;  4IN3 B;  5AIJ A;  3FU3 A;  2NXP A;  4YDW A;  5CBO A;  5EID A;  3AU5 A;  4HLL A;  1HF8 A;  2PQN A;  3ONK A;  4NQ0 A;  4HB5 A;  3ISM C;  4FJZ A;  2P9I G;  2J07 A;  2HR2 A;  1N4R A;  3MGB A;  3FUM A;  4XI0 A;  1H2V C;  3PS6 A;  2VTB A;  1LD7 A;  3LPZ A;  3CVU A;  2PZI A;  3MV2 B;  2ILR A;  4HRM B;  4I1A A;  4J7W A;  3ESL A;  4GTM A;  3HXC A;  2UY1 B;  4N3C A;  4GU5 A;  3KEZ A;  5J08 A;  3CVN A;  5BXU A;  2AXU A;  4JZY A;  3MCX A;  2LSU A;  4XZ4 A;  1V55 E;  4GAA A;  3DSX A;  5KNG A;  4D10 C;  2QZA A;  1BD8 A;  1FPP A;  4FC8 A;  4J8S A;  3DPY A;  1K3Z D;  5FIO A;  3J5Q B;  3CHR A;  4TUU A;  4U96 D;  2QY7 A;  3IBE A;  3B95 A;  4JA7 A;  1H2T C;  1YYH A;  2R5S A;  2WQ6 A;  1WDY A;  1ZBP A;  2V0P A;  1G3N B;  1NZN A;  4IRU A;  1QZ2 A;  2VSY A;  2WXR A;  4HXI A;  3TL5 A;  3LYA A;  3B7T A;  5CRU A;  5AYW D;  4WWO A;  2GRQ B;  3C5R A;  1QNF A;  4N5Q A;  2P9S G;  3ULE G;  3OXF A;  4OYS A;  2J4B A;  4EBA G;  2XEN A;  3EHM A;  4J0U A;  3D9L A;  2DWZ A;  1U3D A;  3CHQ A;  1EPU A;  4F53 A;  3QK0 A;  2ION A;  1O5M A;  1QQE A;  4J8Y A;  2V5Q C;  4A3V A;  3JUI A;  4G23 A;  4FA6 A;  2AVP A;  2ZIR A;  3UXG A;  4JHJ A;  4UI9 K;  2XS8 A;  5FWQ A;  3FFL A;  3EIJ A;  2CG3 A;  3EJN A;  4HOU A;  4BET A;  2ZGG A;  4R7L A;  4KBQ A;  2WXN A;  3L9T A;  5AN8 A;  4EZJ A;  1Q2Z A;  3OTN A;  3T5V A;  4WNE A;  2CHW A;  2AJA A;  1E8W A;  2VGX B;  4G25 A;  5AEN A;  4NRH B;  2XRZ A;  4ANW A;  2X38 A;  3PRZ A;  5CBN A;  1K1A A;  5FQ8 A;  3S7B A;  2XGO A;  5CED B;  4F1S A;  3AJI A;  4Q94 A;  5G04 C;  4UQX A;  3PZ3 A;  3DSW A;  3C3O A;  5J90 A;  2XZT G;  3LXU X;  4ABN A;  5A7D B;  3ZNG A;  2P58 C;  1IKN D;  4FP7 A;  3HXE A;  4YDY A;  1IHG A;  1KZP A;  2EQX A;  4ILG A;  4A3T A;  3D9K A;  3VLE A;  4CDM A;  3ULQ A;  2FI7 A;  1S70 B;  4WWN A;  3QNK A;  3TJP A;  2IOS A;  4GYO A;  4CGW A;  4RVB A;  3EHR A;  3CST A;  5JJ7 A;  5G04 J;  2IY0 C;  1H6P A;  4AY5 A;  3NB2 A;  5BV0 A;  3Q49 B;  2IU1 A;  3E34 A;  3ZYK A;  4C48 B;  3HVE A;  1PC2 A;  2LNI A;  1TN7 A;  1SQM A;  1BLX B;  1SZA A;  1N4S A;  3JYS A;  1PAQ A;  3ENE A;  1N94 A;  1DC2 A;  3RRM B;  2X6K A;  1X5B A;  2CG2 A;  3F6Q A;  4WND A;  2C0L A;  2WB2 A;  3CIA A;  2RKK A;  4MLP A;  4U95 D;  5ENR D;  4I2W A;  4HOS A;  3JXJ A;  4CCA A;  4KXK B;  4AIF A;  4AP2 A;  3Q73 A;  2X6F A;  1NA3 A;  3JQ1 A;  5H7P A;  2WXJ A;  3E33 A;  4N5C A;  3FH8 A;  1E7V A;  2IQC A;  3DRA A;  5B1A E;  3FY4 A;  2UWJ G;  3P2B A;  3V2O A;  2OCC E;  4GTV A;  2PM7 A;  3B7B A;  4HI8 A;  5EIB E;  4BTB A;  4BX9 A;  3NZU A;  3UIO C;  5AAR A;  4JW1 A;  1NI1 A;  3V30 A;  1HXI A;  1OCC E;  3V31 A;  3CGH A;  3DXK G;  5LOZ A;  2J08 A;  5CEA A;  4BY6 A;  2KCK A;  4XX5 A;  4ANU A;  4A63 B;  1H0A A;  2J49 A;  1N9A A;  3ZUV B;  4I6E A;  1U3C A;  3MV3 B;  3TWQ A;  5AAO A;  2PNN A;  3CVY A;  3UT8 A;  2GRO B;  4LER A;  1OWO A;  1OWM A;  1OY3 D;  3HG0 D;  3Q15 A;  5KBA A;  2IFU A;  3DXM G;  3RSE G;  5CRV A;  1HZ4 A;  2FO7 A;  3I3N A;  2CFU A;  2L9B A;  4K0R A;  1O1T A;  5FZR A;  1ELR A;  4H7Y A;  3D9H A;  3ZW3 A;  4PUC A;  1IHB A;  3UM0 A;  4K5C A;  3UX4 A;  3U66 A;  4L2L A;  3FU0 A;  4I43 A;  2R05 A;  1S64 A;  3RRU A;  4I9C A;  3S7F A;  4G1T A;  3SHF A;  5HKP A;  4O1P A;  1EF1 C;  3B7U X;  2EIL E;  3IKO B;  3UQ3 A;  4GYY A;  1K1B A;  4ATZ D;  4LG6 A;  4WNF A;  5ENT D;  3EUV A;  2KZT A;  3FU6 A;  2BTD A;  2KXP C;  1BU9 A;  3UM3 A;  4K5A B;  5EKQ D;  3UKU G;  4DLQ A;  3MYV A;  3FTV A;  1S63 A;  4TXR A;  3ESK A;  3BU8 A;  3ZYL A;  3W9F A;  2XEE A;  4F6R D;  4NUR A;  3MX3 A;  3ASF A;  5JA4 D;  4AEZ C;  3CKC A;  3AS5 A;  3GYZ A;  5BV1 A;  3ZU7 B;  4BES A;  3LCA A;  5HRY A;  3E4B A;  2XQ0 A;  2XPY A;  4O60 A;  4XI9 A;  5JJT A;  5FT9 A;  2GGF A;  4DX6 D;  3QWP A;  4DX1 A;  4FHK A;  1Z6T A;  3VTY A;  1N95 A;  3ZVV A;  5BXO A;  5G2N A;  3DWL G;  3NAW A;  1HU3 A;  4RG6 A;  1Y6I A;  1HX8 A;  3ZXS A;  4A1G A;  1RZ4 A;  4GZ5 A;  4FU3 A;  3TWW A;  4EHM A;  2VSO E;  2NC9 A;  1MZC A;  2ETB A;  2GW1 A;  3C72 A;  2V4L A;  3TWS A;  3I5P A;  4WWP A;  4XKB A;  3EHN A;  1AP7 A;  3JQ0 A;  2BED A;  3GZ1 A;  2ZU6 B;  5ENO D;  3D9P A;  5ENN A;  1OUV A;  5D66 A;  1H6O A;  2KAT A;  3PE4 A;  3UPV A;  5D0Q D;  5AQB A;  2NSZ A;  2C2L A;  4U8V D;  4TXP A;  3AG3 E;  2FEZ A;  3IHV A;  4HBD A;  3SBS A;  3D9J A;  2ETC A;  4HLE A;  2VGE A;  4AXH A;  4FHJ A;  3AU4 A;  3JCK C;  3Q9N C;  5JMN D;  2OND A;  3L17 A;  2I6H A;  3WG7 E;  3LVQ E;  2ZXW E;  3HXF A;  4G11 A;  2BF0 X;  5HI7 A;  5G05 C;  3TAX A;  4G8L A;  4DUI A;  1U2V G;  3CVL A;  1VDY A;  3CVP A;  2H6F A;  3LDZ A;  4ACL A;  4U0U A;  3NBN B;  5BW8 C;  1O1S A;  3FDH A;  3FTW A;  4TRQ A;  4LCT A;  5EN5 D;  3ZRH A;  3E32 A;  3IHY A;  3SBT B;  3CK7 A;  3DEP A;  4E6H A;  3AG1 E;  1OCO E;  1DCQ A;  3L16 A;  5IY5 E;  2DIW A;  2L0T B;  3CEQ A;  1N0R A;  4FAD A;  1WG0 A;  4Q69 A;  2HO1 A;  4UWK A;  2VGY A;  3TG5 A;  1SA5 A;  5HQ8 A;  4J8F A;  3RAU A;  4PDX A;  3W9G A;  4ANX A;  3ABM E;  5ENQ D;  1LF8 A;  4BT9 A;  3AS8 A;  3G2S A;  3Q78 A;  5LCW C;  1JUQ A;  4BSX A;  2A4Z A;  1H19 A;  1Z5S C;  2Y0B G;  3D3M A;  4PS8 A;  1N11 A;  4JA9 A;  3MEK A;  4F7A A;  4MRU A;  4GCO A;  2J9Q A;  4JL0 A;  1XGW A;  4X8Q A;  2OV8 A;  4GZC A;  1YA0 A;  2AW6 A;  4HFG A;  2A5U A;  4CRW A;  4NIK A;  3RJV A;  4CT0 A;  1HG2 A;  1MHQ A;  3Q5M A;  3FTY A;  4N39 A;  3FEX A;  3CLJ A;  4B0Z A;  3OAW A;  5CHE E;  2CHX A;  3D9M A;  4HI9 A;  3AG4 E;  3FUD A;  3QWV A;  3LY8 A;  3VLD A;  1NL4 A;  3R9M A;  4DX7 D;  1E8Y A;  1MX4 A;  4GMR A;  4BEP A;  1KT1 A;  3RIB A;  4JEU A;  4YDO A;  4DX2 A;  2RD0 A;  3SFX A;  3ZYM A;  2R2L A;  3APC A;  3DST A;  3L82 A;  2F37 A;  2ETA A;  3S7J A;  2ZGD A;  4GA1 A;  4O1O A;  1FVF A;  2WXF A;  4RSY A;  5EYL A;  2V5F A;  4F1P A;  5T3R A;  3LVR E;  1TYQ G;  4I1O B;  3QDN A;  1E96 B;  3U9W A;  1YCS B;  1ZU2 A;  5LX8 A;  4DJA A;  2CHZ A;  1Y8M A;  4Q96 A;  2P9U G;  2JEK A;  3ZHE A;  2F8Y A;  3QKY A;  2M63 A;  2OEV A;  1Z3X A;  1ELW A;  4FLB A;  4BX8 A;  4ILH B;  3DSU A;  3SZ7 A;  1SVX A;  3MKQ A;  4K5B A;  4ZHB A;  2L6B A;  2DBA A;  5EDS A;  5LP0 A;  5HS0 A;  4ACK A;  2QYU A;  2QC9 A;  3R9A B;  4GA0 A;  3UT7 A;  1TN6 A;  2HE0 A;  4GYW A;  4MKT A;  2WQH A;  4UWF A;  4HS2 A;  2WXQ A;  4APO A;  3PVL A;  1TJC A;  1H6K A;  3CR3 A;  1N4Q A;  1FT1 A;  3TGO A;  3GZ2 A;  4JD2 G;  4M7C A;  3IXE A;  4L23 A;  3MZL B;  3FP3 A;  1HG5 A;  3FTX A;  4HRN A;  3SI5 A;  3CKB A;  3FWV A;  4I1M A;  1HH8 A;  1TNY A;  4V3I A;  1WY6 A;  3ZN3 A;  3ML8 A;  2GRR B;  3KEA A;  4JXT A;  3FUJ A;  1N0Q A;  2X6H A;  3ZPJ A;  2Y3A A;  3FH5 A;  4B93 B;  2YHE A;  2B0O E;  2P2C P;  5JHB A;  5KCM A;  3S2A A;  2KC7 A;  5EYP F;  4JPS A;  3K9I A;  4EZK A;  1N52 A;  3FUE A;  3FUN A;  2AXZ A;  3AS4 A;  4GA2 A;  2LAH A;  1EYH A;  1KLX A;  4GPM A;  3PZ1 A;  2QYJ A;  2FBN A;  1D8E A;  3AG2 E;  4MS6 A;  4XEI G;  3HYM B;  1UW4 B;  4WAF A;  4JVS A;  1N54 A;  4W9R A;  5B1B E;  5FQ4 A;  4YVO A;  3ASH A;  3SF4 A;  2A5E A;  5DIZ A;  1OT8 A;  3ASD A;  3FTU A;  5DBK A;  4U63 A;  1X81 A;  2XGS A;  1MX2 A;  4PS7 A;  5KJL A;  5AQ7 A;  4G8K A;  4G2V A;  3U3W A;  1LD8 A;  4KMO A;  2F8X K;  2WM9 A;  3PDN A;  2Y4T A;  4UWG A;  4A1S A;  3ASG A;  4L1B A;  3FUF A;  3MJW A;  4A55 A;  4H7X A;  3LJ3 A;  2AXV A;  4UWL A;  2WXP A;  4LSZ E;  2XCB A;  2DVW A;  5FQ7 A;  5BPP A;  4XE0 A;  2XCC A;  1TR4 A;  2OOE A;  3UMV A;  3G2U A;  5JHA A;  2VTB B;  3UIP C;  1JWF A;  2IO3 C;  2OVB A;  1NA0 A;  3ONL A;  1W3B A;  3SFZ A;  4ANV A;  2QFC A;  5FZS A;  4I17 A;  3HXD A;  4AJW A;  2GRP B;  1TEZ A;  3UKR G;  3BEE A;  3KSL A;  4JHR A;  3PNT B;  4EEC A;  2WXL A;  5KNH D;  5KJN A;  4LRZ A;  3QB2 A;  2WMO A;  4AY6 A;  3KD7 A;  1BI7 B;  3ML9 A;  4DI4 A;  2B6C A;  4C0M A;  3RO3 A;  2RFM A;  5ARG A;  4FUL A;  3RO2 A;  2VGX A;  2X6I A;  3HDX A;  3DBS A;  2XEV A;  5M72 A;  5ANR A;  2XRY A;  3L6A A;  4UI9 C;  2KCV A;  1UOH A;  2BUG A;  3QAQ A;  1E8Z A;  3SNX A;  3LJN A;  4JEH A;  3V79 K;  2FF4 A;  3CV0 A;  3I4G A;  2MRI A;  4KYO B;  4TUM A;  2DZO A;  3LY7 A;  3P1U A;  3NOC D;  3NQP A;  2FO1 E;  1HS6 A;  2IJG X;  4J6I A;  4B89 A;  4UI9 J;  2LAI A;  3FTS A;  3T8K A;  1SZ9 A;  4CT4 A;  2H6I A;  2WXH A;  2WPV A;  2V8S E;  5ENS D;  2VSN A;  4Y6C A;  3D9O A;  4EPZ A;  3BG0 B;  4GZD A;  2KBX A;  2L0I A;  1KPS B;  2I1J A;  2EIJ E;  2OVF A;  3CVX A;  3I4R B;  2I2O A;  2KM4 A;  3QOU A;  1B89 A;  4PS3 A;  4TV3 A;  1Z3Y A;  4U04 A;  3TWV A;  4YVQ C;  5LFA A;  4KZ0 A;  3DPD A;  3LY9 A;  2J09 A;  2DCP A;  2KCL A;  5D2M C;  3LEW A;  4YND A;  2E0I A;  2Q7F A;  3PEU B;  5FQ6 A;  2BKG A;  4JC8 A;  4Y6W A;  2YNQ A;  3DSV A;  3UM1 A;  3GZS A;  5T8I A;  3KS2 A;  3MKQ B;  3PNL B;  4HRL A;  4B8A A;  4LEU A;  3BG1 B;  3VLF A;  4GTS A;  2WMN A;  1A17 A;  1MYO A;  1L5J A;  5E75 A;  5AQA A;  3MKR A;  1QYM A;  4L7T A;  5BUZ A;  1MX6 A;  1D9S A;  2LXL A;  4ILI A;  3TWR A;  1INZ A;  3FUH A;  4HNA D;  3R7Q A;  1OWP A;  4BFR A;  4JB8 P;  3C3Q A;  3PRE A;  1ZB1 A;  4KT6 B;  2F0Y A;  5FIN A;  2P9N G;  3FTZ A;  4YDE A;  3HIZ A;  1OCR E;  5ANL A;  2PL2 A;  5C1D A;  4IYP A;  3CHO A;  3E30 A;  2IEJ A;  4U07 A;  4GTR A;  3O48 A;  4GMJ A;  4N2S A;  2X3M A;  1OCZ E;  5ENP D;  3HVE B;  1HE8 A;  3DEO A;  3T9K A;  4APF A;  2YQ8 A;  4K03 A;  3IV0 A;  1NP7 A;  4RG9 A;  1KZO A;  5G05 J;  3MA5 A;  2RFA A;  5EIL A;  2PM6 A;  1OXJ A;  4OAV B;  3SFY A;  2VQ2 A;  2HM8 A;  4O6F A;  2WXI A;  3Q75 A;  2R59 A;  4U8Y D;  3UM2 A;  2I1K A;  4J8D A;  3TWT A;  1TNZ A;  3Q7A A;  4BTA A;  4N2Q A;  3TWU A;  3B13 A;  2YIN A;  3ZXP A;  3Q4A B;  1SA4 A;  3HHM A;  2JLB A;  2WXK A;  4CDN A;  3S7D A;  3ULY A;  2MYO A;  1JCQ A;  3E37 A;  1IYG A;  3B7R L;  1TNU A;  3Q7F A;  3D9I A;  5LCW J;  4JHK A;  2XHE A;  4XIF A;  4I6G A;  2V4H C;  1JCR A;  4AOF A;  1H2U A;  5KJM A;  4DX5 D;  1E7U A;  3WXX A;  1OWN A;  1HFA A;  2R03 A;  1S0P A;  3APF A;  2MOW A;  4DPR A;  2Y4U A;  4EQF A;  5FZQ A;  3FEY A;  1UJK A;  1BPO A;  3SD5 A;  4KVO A;  3KSQ A;  4U7E B;  1E90 A;  3ASO E;  4HOR A;  4URK A;  5EX0 A;  4UQZ A;  4WUY A;  4OVU A;  4C0E A;  2GRN B;  4BWR A;  3PUK A;  5CCM A;  2H6H A;  3TXM A;  2R17 C;  5G55 A;  3Q79 A;  2XEH A;  4KVM A;  3N71 A;  3FUL A;  4GTT A;  4NAC A;  4BT8 A;  4GZ6 A;  3IEG A;  3CQC B;  1PY1 A;  4KZC A;  3VTX A;  4RLY A;  3PZD A;  3CVQ A;  2XZD G;  4DI3 A;  2VSX E;  3TXN A;  3LS8 A;  1N4P A;  3Q47 B;  3CK9 A;  3CHS A;  3EU9 A;  3SY2 A;  2KZT B;  3FUI A;  4GTQ A;  4TXQ A;  4UWH A;  4BSZ B;  1UJJ A;  1DVP A;  1DNP A;  2LO6 A;  3CHP A;  4PH4 B;  5B3S E;  2P9L G;  5T4Y A;  4MBG A;  1K8K G;  4AM9 A;  4I9E A;  3OXG A;  4OVV A;  3X2Q E;  3EHQ A;  5FJY A;  1QBQ A;  4DLO A;  3FHE A;  2BKK B;  2WXO A;  3R7R A;  3J5P A;  3ABK E;  3B7S A;  2WQ7 A;  1FCH A;  1D8D A;  5EX3 A;  4HOT A;  3ZKJ A;  3Q9U C;  3CQG B;  3EDT B;  5ITZ F;  4GB9 A;  4LUN U;  3SGH A;  4Z68 A;  3CVV A;  2WVI A;  4WNG A;  5AQ9 A;  4FLH A;  1O1R A;  4RQI A;  1TN8 A;  4LNU D;  4CYM D;  3APD A;  1NFI E;  4N3A A;  2VYI A;  4U8H A;  3JXI A;  5E76 A;  2XS1 A;  3ZGQ A;  4B8C B;  2UY1 A;  4J8E A;  3G2T A;  3RK6 A;  4L9P A;  2L6J A;  3RRN B;  4I2Z A;  1FVH A;  3NOG D;  3T8M A;  2DYR E;  1BI8 B;  2LXM A;  3U4T A;  4GTO A;  2IF4 A;  3PZ2 A;  2GRL A;  4LNG A;  4UUC A;  2EIM E;  1ELK A;  3PEV B;  1UG3 A;  5BNW A;  3HRA A;  3L22 A;  3BQO A;  3C98 A;  2NYJ A;  3GW4 A;  3KAE A;  3ZFW A;  3ABL E;  3NZS A;  1P5Q A;  1DCE A;  2RG8 A;  5FTP A;  2HYZ A;  3SQV A;  2GRM A;  1HO8 A;  1EDU A;  3HXB A;  1TJF A;  4UQY A;  4ME2 A;  3ZYQ A;  3PUJ A;  5CCL A;  2WXG A;  2EIN E;  5A6C A;  3UTM A;  1AWC B;  4U0S A;  4CGV A;  2E2E A;  2H6G A;  2VJ8 A;  4AV7 A;  3NF1 A;  2LSV A;  2ZIS A;  4B94 A;  3DSS A;  5AJL A;  3CSF A;  3PZ4 A;  1TNO A;  1OWL A;  3RKV A;  4E85 A;  4QQI A;  4C9B B;  3RU0 A;  3AAA C;  4EZL A;  4CDR A;  2YHC A;  1WM5 A;  3ZEF A;  2P9K G;  3EU5 A;  2MHK A;  3QAR A;  2Y1L E;  4GCN A;  3JUE A;  2C0M A;  3TWX A;  4DK5 A;  3QJZ A;  1IQU A;  1XNF A;  1JPL A;  3EIQ C;  1IQR A;  5ARF A;  4G26 A;  3QWW A;  5CMY A;  4L2Y A;  3G2V A;  4GPK A;  3L08 A;  1WAO 1;  4N3B A;  2WXM A;  2LUH A;  2X6J A;  3D9N A;  2J8S D;  5KJK A;  3L13 A;  2XPI A;  4QFV A;  4P29 A;  4GML A;  2IOL A;  1LTX A;  2EIK E;  2IO2 C;  1JWG A; 
#chains in the Genus database with same CATH homology
 4Q96 A;  4N2S A;  5A23 A;  2X6F A;  2X3M A;  1NA3 A;  2JEK A;  3ZHE A;  3QKY A;  3HVE B;  2M63 A;  3JQ1 A;  5BT1 A;  1HE8 A;  4ATG A;  2WXJ A;  3U64 A;  4IUL A;  4APF A;  1Z3X A;  4N5C A;  3FH8 A;  1E7V A;  2YQ8 A;  1ELW A;  4K03 A;  4HVB A;  3IV0 A;  1NP7 A;  2IQC A;  4FLB A;  3FY4 A;  2UWJ G;  3P2B A;  4RG9 A;  5G05 J;  3URZ A;  4BX8 A;  4AVX A;  3MA5 A;  4ILH B;  2PM6 A;  4G24 A;  3SZ7 A;  2PM7 A;  3CK8 A;  3MKQ A;  3UT4 A;  1KT0 A;  1E8X A;  4BTB A;  2VQ2 A;  4I6J A;  4BX9 A;  3ZIM A;  3NZU A;  5D0O D;  2DBA A;  2HM8 A;  5EDS A;  4O6F A;  5LP0 A;  2XGM A;  4JW1 A;  2WXI A;  4ACK A;  3CHM A;  2R59 A;  4EBA A;  3R9A B;  2I1K A;  1HXI A;  4GA0 A;  4J8D A;  2I9C A;  3CGH A;  3UT7 A;  3CVW A;  5LOZ A;  2J08 A;  4GYW A;  4BY6 A;  4BTA A;  4N2Q A;  3G2W A;  2KCK A;  2CFZ A;  3B13 A;  4XX5 A;  4MKT A;  2YIN A;  2WQH A;  4UWF A;  3ZHE B;  3Q4A B;  4ANU A;  1H0A A;  2J49 A;  4HS2 A;  2WXQ A;  4APO A;  3HHM A;  5AJD A;  2JLB A;  2WXK A;  4I6E A;  3PVL A;  1TJC A;  4CDN A;  3OXL A;  1H6K A;  3CR3 A;  3S7D A;  1U3C A;  3MV3 B;  3PE3 A;  3TGO A;  4GZ3 A;  5C2Y A;  3GZ2 A;  1UN9 A;  3CVY A;  1GW6 A;  3UT8 A;  1IYG A;  3B7R L;  3PH0 C;  3FH7 A;  4LER A;  2PQR A;  3D9I A;  1OWO A;  5LCW J;  1OWM A;  4L23 A;  3MZL B;  2XHE A;  3FP3 A;  4JHK A;  4XIF A;  1HG5 A;  3FTX A;  3LKU A;  4I6G A;  3SI5 A;  3CKB A;  4CEM A;  3Q15 A;  3FWV A;  2XPZ A;  4AOF A;  2IFU A;  4I1M A;  4F3V A;  1HH8 A;  1H2U A;  1HZ4 A;  4FJY A;  2J4D A;  5KJM A;  4V3I A;  2FO7 A;  1WY6 A;  3I3N A;  1E7U A;  3ZN3 A;  2CFU A;  2L9B A;  3ML8 A;  1OWN A;  5JJ6 A;  3FU5 A;  4K0R A;  3WXX A;  4JXT A;  5FZR A;  1ELR A;  1HFA A;  3FUJ A;  4H7Y A;  2X6H A;  3ZW3 A;  4XKC A;  3T5X A;  4PUC A;  3ZPJ A;  1S0P A;  2FUL A;  3APF A;  2Y3A A;  3TG4 A;  3FH5 A;  2MOW A;  3UX4 A;  3O4Z A;  2YHE A;  4U0Z A;  2Y4U A;  4DPR A;  4EQF A;  3U66 A;  4L2L A;  3FU0 A;  5FZQ A;  5JHB A;  4I43 A;  3FUK A;  3FEY A;  1UJK A;  1BPO A;  1UN8 A;  3SD5 A;  3UUX A;  3RRU A;  5CMW A;  4I9C A;  3S7F A;  5KCM A;  4KVO A;  3L54 A;  1MQS A;  2KC7 A;  4G1T A;  3S2A A;  3SHF A;  4M3O A;  2AWI A;  4JPS A;  1E90 A;  4HOQ A;  3K9I A;  3QC1 A;  4EZK A;  4IN3 B;  5AIJ A;  1N52 A;  3FU3 A;  2NXP A;  1EF1 C;  3B7U X;  3FUN A;  3FUE A;  4HOR A;  2AXZ A;  3IKO B;  3AS4 A;  4GA2 A;  3UQ3 A;  2LAH A;  3AU5 A;  4GYY A;  4URK A;  1EYH A;  1HF8 A;  5EX0 A;  2PQN A;  4UQZ A;  3ONK A;  1KLX A;  4WNF A;  4NQ0 A;  4WUY A;  2KZT A;  2FBN A;  4OVU A;  4C0E A;  4BWR A;  4FJZ A;  3FU6 A;  3PUK A;  5CCM A;  4MS6 A;  2BTD A;  3HYM B;  1UW4 B;  2J07 A;  2HR2 A;  4WAF A;  4JVS A;  5EKQ D;  3TXM A;  1N54 A;  3MGB A;  4W9R A;  4DLQ A;  3MYV A;  3FTV A;  3FUM A;  2R17 C;  3ESK A;  5FQ4 A;  4YVO A;  3ASH A;  3SF4 A;  4XI0 A;  5DIZ A;  5G55 A;  1H2V C;  3ASD A;  3ZYL A;  3PS6 A;  4KVM A;  3FTU A;  3N71 A;  3FUL A;  5DBK A;  2VTB A;  4NUR A;  4U63 A;  3LPZ A;  3MX3 A;  4NAC A;  4BT8 A;  2XGS A;  3ASF A;  4GZ6 A;  3CVU A;  2PZI A;  3IEG A;  3CQC B;  3MV2 B;  4AEZ C;  1PY1 A;  4KZC A;  3VTX A;  4PS7 A;  2ILR A;  5KJL A;  3PZD A;  3CKC A;  3AS5 A;  4G2V A;  4I1A A;  3U3W A;  4KMO A;  3GYZ A;  3CVQ A;  3ESL A;  5BV1 A;  4DI3 A;  2VSX E;  2UY1 B;  3TXN A;  2WM9 A;  3PDN A;  3LS8 A;  3LCA A;  3Q47 B;  4N3C A;  4GU5 A;  3CK9 A;  3CHS A;  2XQ0 A;  3E4B A;  2XPY A;  2Y4T A;  3KEZ A;  4XI9 A;  5J08 A;  5JJT A;  4UWG A;  2KZT B;  5FT9 A;  2GGF A;  4A1S A;  3ASG A;  3QWP A;  3FUF A;  3CVN A;  3MJW A;  4FHK A;  4L1B A;  4H7X A;  3LJ3 A;  2AXV A;  3FUI A;  4A55 A;  1Z6T A;  4UWL A;  2AXU A;  4JZY A;  3VTY A;  4UWH A;  2WXP A;  3MCX A;  3ZVV A;  1UJJ A;  2LSU A;  4XZ4 A;  1DVP A;  1DNP A;  2XCB A;  5G2N A;  4GAA A;  2LO6 A;  3CHP A;  1HU3 A;  4PH4 B;  5FQ7 A;  4RG6 A;  4D10 C;  1Y6I A;  5BPP A;  5T4Y A;  4XE0 A;  1HX8 A;  4FC8 A;  3ZXS A;  2XCC A;  4A1G A;  4J8S A;  2OOE A;  4GZ5 A;  3UMV A;  4AM9 A;  3G2U A;  5JHA A;  3CHR A;  4FU3 A;  2VTB B;  4I9E A;  4TUU A;  2QY7 A;  3OXG A;  2VSO E;  2NC9 A;  3IBE A;  1JWF A;  2OVB A;  4OVV A;  1NA0 A;  3ONL A;  1W3B A;  3SFZ A;  4ANV A;  2GW1 A;  2QFC A;  5FJY A;  5FZS A;  2V4L A;  4I17 A;  3I5P A;  4DLO A;  4WWP A;  3FHE A;  4JA7 A;  1H2T C;  4XKB A;  2WXO A;  2R5S A;  3EHN A;  3R7R A;  2WQ6 A;  4AJW A;  3JQ0 A;  1ZBP A;  3GZ1 A;  2ZU6 B;  3B7S A;  1TEZ A;  2WQ7 A;  1FCH A;  2V0P A;  3D9P A;  5EX3 A;  1NZN A;  4IRU A;  4HOT A;  1QZ2 A;  2VSY A;  2WXR A;  4HXI A;  1OUV A;  3BEE A;  3LYA A;  4JHR A;  5ENN A;  3B7T A;  3TL5 A;  3PNT B;  5AYW D;  4EEC A;  2WXL A;  4WWO A;  3CQG B;  3EDT B;  5KJN A;  4GB9 A;  1QNF A;  4LRZ A;  2KAT A;  3PE4 A;  3QB2 A;  3UPV A;  2WMO A;  5D0Q D;  4LUN U;  3SGH A;  4AY6 A;  3KD7 A;  3ML9 A;  2NSZ A;  4DI4 A;  3OXF A;  3CVV A;  4OYS A;  2C2L A;  2WVI A;  2J4B A;  4EBA G;  4C0M A;  4WNG A;  3RO3 A;  3EHM A;  2FEZ A;  3IHV A;  4FLH A;  4FUL A;  5ARG A;  4J0U A;  3SBS A;  3D9L A;  3APD A;  3D9J A;  1U3D A;  3RO2 A;  2VGX A;  2X6I A;  2VYI A;  3HDX A;  3CHQ A;  4N3A A;  1EPU A;  4U8H A;  4HLE A;  5E76 A;  3QK0 A;  4F53 A;  3DBS A;  2XEV A;  2ION A;  5M72 A;  5ANR A;  3ZGQ A;  1QQE A;  4AXH A;  4FHJ A;  4B8C B;  3AU4 A;  2XRY A;  4A3V A;  3JCK C;  3JUI A;  3L6A A;  4G23 A;  4UI9 C;  2AVP A;  2OND A;  2KCV A;  2UY1 A;  4FA6 A;  3L17 A;  2BUG A;  4J8E A;  3QAQ A;  3G2T A;  4JHJ A;  4UI9 K;  2I6H A;  3RK6 A;  1E8Z A;  2L6J A;  3LVQ E;  5FWQ A;  3FFL A;  4G11 A;  3EIJ A;  3SNX A;  2CG3 A;  2BF0 X;  4JEH A;  5HI7 A;  5G05 C;  3RRN B;  3EJN A;  4HOU A;  3TAX A;  3CVL A;  4I2Z A;  1VDY A;  1FVH A;  4R7L A;  4KBQ A;  3T8M A;  2WXN A;  2FF4 A;  3CVP A;  4EZJ A;  3U4T A;  2IF4 A;  3CV0 A;  3LDZ A;  3OTN A;  2GRL A;  3I4G A;  4U0U A;  4ACL A;  3T5V A;  5BW8 C;  2MRI A;  4KYO B;  3FDH A;  3LY7 A;  4WNE A;  3FTW A;  3P1U A;  1ELK A;  4TRQ A;  4LCT A;  3PEV B;  1UG3 A;  5BNW A;  2CHW A;  3ZRH A;  3IHY A;  3SBT B;  3CK7 A;  3L22 A;  3NQP A;  4E6H A;  1HS6 A;  2IJG X;  3C98 A;  3L16 A;  2DIW A;  3GW4 A;  1E8W A;  3KAE A;  2L0T B;  4J6I A;  2VGX B;  3CEQ A;  4G25 A;  4FAD A;  3ZFW A;  4Q69 A;  2HO1 A;  4UWK A;  3NZS A;  5AEN A;  4B89 A;  2VGY A;  3TG5 A;  4NRH B;  1P5Q A;  3O48 A;  5HQ8 A;  4UI9 J;  2LAI A;  4J8F A;  2RG8 A;  5FTP A;  3FTS A;  4ANW A;  2XRZ A;  2X38 A;  4PDX A;  1SZ9 A;  4CT4 A;  3PRZ A;  2WXH A;  4ANX A;  2HYZ A;  2WPV A;  2V8S E;  2GRM A;  2VSN A;  5FQ8 A;  4Y6C A;  3D9O A;  1LF8 A;  3S7B A;  1HO8 A;  1EDU A;  4EPZ A;  4BT9 A;  3AS8 A;  3G2S A;  5LCW C;  1TJF A;  3BG0 B;  4UQY A;  4GZD A;  2XGO A;  2L0I A;  1JUQ A;  4BSX A;  4ME2 A;  2A4Z A;  4F1S A;  1H19 A;  2I1J A;  3ZYQ A;  2OVF A;  3PUJ A;  4Q94 A;  5G04 C;  2WXG A;  5CCL A;  3CVX A;  3I4R B;  3D3M A;  4UQX A;  4PS8 A;  5A6C A;  4JA9 A;  3MEK A;  2I2O A;  4F7A A;  5J90 A;  4U0S A;  4MRU A;  2KM4 A;  3LXU X;  3QOU A;  4ABN A;  4GCO A;  1B89 A;  4PS3 A;  2P58 C;  5A7D B;  2J9Q A;  4CGV A;  2E2E A;  4TV3 A;  2VJ8 A;  1Z3Y A;  4JL0 A;  4AV7 A;  3NF1 A;  4U04 A;  2LSV A;  4YVQ C;  4FP7 A;  5LFA A;  1XGW A;  1IHG A;  4KZ0 A;  2EQX A;  4ILG A;  2OV8 A;  4GZC A;  1YA0 A;  4A3T A;  3DPD A;  3LY9 A;  2AW6 A;  3D9K A;  4HFG A;  2A5U A;  3VLE A;  4B94 A;  4CDM A;  4CRW A;  2J09 A;  5AJL A;  2DCP A;  2KCL A;  3ULQ A;  3CSF A;  2FI7 A;  3LEW A;  3RJV A;  4CT0 A;  4YND A;  1HG2 A;  2E0I A;  2Q7F A;  3PEU B;  4WWN A;  1MHQ A;  3QNK A;  1OWL A;  5FQ6 A;  3RKV A;  3Q5M A;  3FTY A;  4N39 A;  4JC8 A;  4Y6W A;  2YNQ A;  3FEX A;  3TJP A;  4E85 A;  2IOS A;  3RU0 A;  4C9B B;  3CLJ A;  4B0Z A;  3OAW A;  3GZS A;  4GYO A;  4CGW A;  5T8I A;  4RVB A;  4EZL A;  3KS2 A;  3MKQ B;  5CHE E;  4CDR A;  2CHX A;  3CST A;  3D9M A;  3PNL B;  5JJ7 A;  4B8A A;  5G04 J;  2YHC A;  4LEU A;  3BG1 B;  3FUD A;  3VLF A;  3QWV A;  4AY5 A;  5BV0 A;  3LY8 A;  1WM5 A;  3Q49 B;  2IU1 A;  3ZEF A;  3ZYK A;  3VLD A;  2WMN A;  1A17 A;  1L5J A;  5E75 A;  2MHK A;  3MKR A;  1E8Y A;  3QAR A;  4L7T A;  5BUZ A;  1KT1 A;  3HVE A;  3RIB A;  4JEU A;  4GCN A;  1PC2 A;  2LNI A;  4ILI A;  1INZ A;  2C0M A;  1SQM A;  2RD0 A;  4DK5 A;  3QJZ A;  3FUH A;  1IQU A;  1XNF A;  3R7Q A;  3ZYM A;  1OWP A;  1SZA A;  3APC A;  3JYS A;  1JPL A;  1PAQ A;  3ENE A;  4BFR A;  3EIQ C;  1IQR A;  5ARF A;  4G26 A;  3QWW A;  5CMY A;  3PRE A;  3S7J A;  3RRM B;  4KT6 B;  4L2Y A;  3G2V A;  4GPK A;  3FTZ A;  3L08 A;  1WAO 1;  4N3B A;  4GA1 A;  2WXM A;  3HIZ A;  2X6K A;  1X5B A;  1FVF A;  2X6J A;  2WXF A;  3D9N A;  2CG2 A;  3L13 A;  4RSY A;  5KJK A;  2XPI A;  5ANL A;  2PL2 A;  4WND A;  2C0L A;  2V5F A;  5C1D A;  4QFV A;  4IYP A;  2WB2 A;  3CIA A;  5T3R A;  3CHO A;  4MLP A;  3LVR E;  4P29 A;  4I1O B;  4GML A;  3QDN A;  2IOL A;  1E96 B;  4I2W A;  3U9W A;  4HOS A;  4CCA A;  4KXK B;  1ZU2 A;  4U07 A;  4AIF A;  5LX8 A;  4DJA A;  1JWG A;  2CHZ A;  1Y8M A;  4GMJ A;  4AP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...