1TJHH

Crystal structure of the broadly neutralizing anti-hiv-1 antibody 2f5 in complex with a gp41 11mer epitope
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
237
structure length
236
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanistic analysis of the anti-human immunodeficiency virus type 1 antibody 2F5 in complex with its gp41 epitope
pubmed doi rcsb
molecule keywords anti-HIV-1 antibody 2F5 Light Chain
molecule tags Viral protein/immune system
source organism Homo sapiens
total genus 44
structure length 236
sequence length 237
ec nomenclature
pdb deposition date 2004-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tjhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tjhH01
3F8UB 2XA8L 2EDFA 3BPOC 3KHQA 2HJLA 3SE8H 4G9FE 1U93B 4KQ4H 4H26A 5B38G 2Y6SD 4QRRA 4Y4HB 2HKHH 3HI6L 5D7JC 4PJIB 2YPKA 1QRNB 3VWJB 2CXKA 5HD8C 1QKZL 3X11A 2YMXH 2DDQH 1P4LB 1NGQH 4U6HA 3LKPA 4HIEB 3L5XH 5C0BE 5FUOL 4ELMA 5TE6L 4PGEB 4WFFD 4CRPA 5CILH 3WJJA 2FEEL 2ITDA 1AIFB 3BKYL 2FNBA 4PJ8B 4NO2B 1MEXH 1PSKH 4Q58C 3EYOB 3SDDB 1X4XA 4CW1A 5BQ7B 4F9PA 5M7QA 1G7MB 5HHPA 1BX2A 2J8UF 4PD4K 5IEHB 1CGYA 4JKMA 1YY8B 1QRND 1T22B 3PABB 5I8OH 1GGIH 3S5LA 4KUZL 3P4LA 1KCVL 3MRNA 1DUYA 5T3XL 3CFBA 3O6MH 1LEIB 1HQ4B 3JUZA 4BQ9A 1H5BB 2IJ0C 3DYPA 5F89A 4FZ8L 3FQTB 1OSPH 1DBJL 3L3GA 1Q1JH 4HWZB 4Z0XA 1KIPB 5HJ3A 3AU1B 3IB4A 2D03H 3E2HB 4HG4J 1TMCB 1U8NB 4LARH 2OXHA 5DUBB 4K07A 2CDFA 2PO6D 3PG2A 3VH8G 4NQCA 2HFGH 4QHKI 3CVHH 2VXUH 3MV11 3HE7C 2XFXA 1RUQH 3DX7A 3MUZ1 4MNHB 3L3HA 5FCUL 1F4AA 5L2KE 4KK8C 3DO3A 3P9LB 3QJFB 3MXVL 5GHWH 4S11A 1OGAE 4XB8A 5F7DB 2BNRD 3OX8A 2A38A 3LV3B 5DGRA 4FNLL 2VDOL 3CU1A 2AERT 4OM1H 1JPGA 4TNWF 3DVNB 5HDQH 4Y5XA 2OL3B 3HZKA 5DMJB 5GGRY 4PJ7F 5CEYA 2GYSA 3HMXA 3ULVF 4N90D 2H1PL 4KTEH 2CKBA 3DLQR 4FQ2L 2DQTL 2VQ1A 4XWOD 3U4AA 2ZSVB 4Q9RH 4D9RD 4GXVL 5JQ6L 2ICES 4MD5B 4MQSB 1H3PL 3V7AE 2P42B 1I1RA 2P49B 5C7XH 4OLUL 2FGWL 2MTPA 1FP5A 4KPHL 4HBCL 4KJPC 3SKNA 2SEBB 4LDLB 4ODHH 4NN6B 3MJ9H 5HDLA 4I0CC 2FO4A 3BHBA 3LKRA 4JFHE 4PJ8C 4PRIA 3OPZH 2VWEC 1X3DA 3SDDC 4F7PB 2FJFB 3L6FB 4HT1L 5LQBH 3AXLB 1JCKA 3CC5A 3VXQA 4JFFA 3MUGB 4KMTH 5KSBB 1N0XL 3CLFH 4ZDHB 1A1MA 2Z91A 4LBEA 3W82A 3P4MA 3RVXC 5DJ2B 1SJEB 1U91A 1EA9C 3CIQA 3QUZD 1RJYA 4PRPD 1ZKAA 5ESQA 5CLTA 1MFCL 2YSSA 3IDIA 4JFZL 2W0FA 1A6UL 1H5BC 3BH8A 3OAZK 3UYOD 3VFSB 1ZT4A 1Z9OA 2FIKB 1T7YA 3O0RL 3FOMA 1UEYA 4JN2A 5ITBL 2BOCA 4NN7C 4RIRA 5K9QI 3RNKB 4Z7UE 5D5MF 8CGTA 3E2HC 2EIDA 2ADIA 3CUPB 2FCBA 5L9DH 4N0RA 4NRYA 4XWOC 1ZSDA 1TQBB 2PYFB 4RNRA 4Y88A 3RA7H 3NVQA 4PRBA 5D1ZB 2F53E 3GJFH 4G9FA 4ZOCA 3IJYA 4XHJD 1QYGH 1MH5A 3DGCR 5D72L 1U3HD 1SJVA 1MLBB 1QFWM 2IH3B 3QUKA 3FQRB 2X4UA 3U7AA 15C8H 3ME0A 1IKNC 4HFUH 4QHUB 2YRLA 1PGRB 3QCTL 5C0BA 3GSOA 3SGEI 4OJFH 5GISH 3OV6A 3DXAB 3U9UB 4P46A 5ISZB 1M6OA 1S7UA 2AJZB 4NFCA 2LU3A 4ODTL 1MUJB 5DTFB 3VD4A 1A14L 2R29L 3IDMA 4XPFH 5C08D 3U0TB 4LRNL 5JOFB 4FTVE 2A74B 3TBSA 4EDWL 4PREB 5EFIB 5GZNC 3C6SA 3IDUA 2ITCA 3WCYA 1M7DB 4PY7B 2YXFA 3QUZC 5KN5A 4TUOA 4ESKA 4PRAB 3VFPA 3P4OA 1A9BA 2QQLL 2C3VB 3JWDC 1KUMA 2VMFA 1KTLB 1MHPH 2AXHA 2PXYA 5MEQA 3O9WB 1XIWA 3BQUD 4NN6C 1KB5A 3D39D 4QY8B 4EVNA 3CDGB 3I6LD 2P5WE 1LP9B 5IHLB 3ZKNC 1CE1H 5E24E 3VFMB 4X4ZA 1MJJA 4P5TB 3E8UL 3BOVA 3CXHK 3HNVH 4CBPA 4X6BA 5DHXB 3VDAA 3MJ8B 3DX6A 4HQQL 3H9HB 3KPLA 4LLDA 1XMWA 2Y36H 1CZ8H 1P69B 2NY5L 1XF1A 2ENSA 1I9JH 4M1GH 3AS2A 3GK8L 5B8CB 4XHJC 1D9KB 5EBGA 1S7RA 2X9YA 4PS4L 2HFEB 5L2KA 5D96B 2GSGB 2EDRA 3FFDB 2OJEA 3QQ4A 4PLNC 5HYJB 5IB3A 1V7NH 1OGAA 1U36A 5EO1B 1PX4A 1G7LB 3V4UH 4NQTA 4LASH 4D0BA 4P5TD 1I1AD 5D1QB 1S5HA 3RWHB 2VYRE 5F21B 1JNNH 3QXVA 2Y23A 3HRPA 1A6AA 1TQBC 1U95B 4L3CB 1UM5L 2CGRH 3P9WB 3N1FC 4XBGB 3O6FB 1D9KD 2IPUG 3GRWL 1QSFD 3INUL 5TF1L 2VOTA 2VLJE 1I1YB 1A6PA 4NUGL 1EV2E 4WHDA 5CD5D 3BQUC 3QFJE 5DK0B 1KN4H 3EUUA 1T1ZB 2I5YH 3L5JA 1Q8MA 1XCTA 1FVEA 1S3KH 5C07E 4BZ2H 3BP6A 4RGMB 2J1KA 1OAYL 1T7WA 4JVPA 3EO1A 4H25A 1OF2A 4OLVL 3T3PF 1DQTA 5D1QD 1OAXH 5J6HB 1NLBH 2R56H 2I9TA 5DFVD 3ZYZA 4P2QD 3BW9A 4KRNA 1SM3L 3H7BA 5DMGD 3NIDE 3MLTB 5BVPH 1VFBA 4NPYA 4WUUB 4DW2L 4Q7DA 4KJQD 1NEUA 2APXA 2CRIA 2E7LA 5EOCJ 3ZTJH 1AR1D 4LPTA 3ARZA 2JE8A 1MREH 3TT3H 3O9WC 5I1EL 1UACL 4I77H 4QRQB 3VG9C 2F5BH 4PLJC 2Y1VA 3TO4B 3ESVF 4YE4L 5FM5M 1T3FA 3MLXL 4U1KA 1Z5LA 4QHNB 4TSAL 3A6BL 4ZUVB 3W5NA 3UPRA 3GIZL 4PP2A 5KVEL 3GBLA 3DMMB 4P5TC 1I1AC 3MV7D 1AFVH 1QR1B 2XQBL 3MGOB 1LNUB 3KPQB 1MFBH 3HB3D 5BO1H 1ZLWH 2YWZA 4UQ2B 5HY9B 2HA1A 3VGEA 4YFLF 2I07B 4Z7UA 2NTFB 3CPLB 1R3HA 1BVKA 1R5VB 1BHGA 5F7FA 3D0VB 4O02L 3A67H 2R2HA 2CKNA 1AGEA 2NY6B 5B8CC 1D9KC 4XNYH 1HI6B 1BBJA 1EHXA 4PJAE 3S5LG 3HZYB 2F53A 5D96C 2Q6WA 1Q9OB 3UTTE 5CD5C 4XVSH 3BIBX 4KQ3L 2EYRA 5GS2D 3AREA 4PJCE 1A1NB 5D1QC 3E1F1 4MJ6B 1X6NA 3ZE2E 1FSKB 4CADB 3QUMH 4XZUA 1L7IL 2BY3A 4NQEB 4QHMA 1LE5B 1BQHB 4LCYA 5DFVC 5E95B 4YEFA 3LKNA 2OTPA 1FGVL 4X4XB 5L0QB 1UWXK 1NFDE 3O6FC 4TPRH 2NY6D 4J3WA 1VEOA 3PDOB 4FTVA 3GMLA 3K80A 4ZSOE 3VGFA 1AR1C 3VFOB 1XGQB 3UPCA 2YBRB 4X9HA 1DVFA 2O5XH 1IZJA 3MSPA 4RGMC 4XCFH 4I0PA 5I1GH 4TVPD 3CU7A 5IMMB 3BDXA 1MRDL 4Q74A 3S3SA 1VGKB 2FBOJ 5C6TH 3ARVA 5BV7B 2P5WA 4HK0B 2JKXA 3FO9B 3HB3C 2B39A 4ZPTB 1N5AB 2V5YA 4X6EA 4FA8A 4AMKH 3CLEL 2XTJD 5IFHH 3JV4A 1EO8H 1DL7H 1F97A 4KJWD 4WTWA 3HA0A 4ODXA 4R2GB 4R3SB 1AC0A 2KQNA 3HMXL 4OCWH 3QIBB 3SQOH 1NGZB 2CKBL 4DAGH 2WP3T 4LHUD 4M4PA 5EU7C 5E8NA 3TO4C 1G1CA 4X5LA 3HPJB 4KKLD 4K2UH 3ZDYF 3NA9H 1TQCB 3JSSA 1JTTA 3G5XA 4K7PL 1UWGH 5IVZA 5GS1B 2OQJA 2BVQB 1C5CL 5E8EA 4QF1B 4OKVB 4JRXD 3RDTA 2IANE 3C08L 2A1WH 4ZS7H 3STLB 4JR9L 1Y0LA 2G9HA 5EULV 3CFIC 3R06B 5IJKC 3IDJA 4KZEL 4MNGB 2CSPA 1FZOB 3MXWH 1FORH 1IGIH 2IPKA 3Q6GH 2APVA 2CIKA 1OB1A 3T65A 3MLUH 1S7WB 1IAIH 2F54D 2NY6C 2OSLB 3FCTB 1TJIL 3KPMB 3QIBD 4ZD3L 4TN9A 3OJDA 1QSEB 4XMPH 2YHGA 1K9TA 1CG9B 4ZNEE 2UZXB 3RHWF 4HZAA 4LSUH 3VRLF 1RUAH 3H6JA 4WHYG 5TH2B 1SYVB 2VAAB 4PJIF 5E99H 3U0PB 3VI4F 3WL9B 3I6KA 2VLJA 2ZCLH 3ARPA 4LKCB 4CU7A 3QFJA 4JFXB 2XA8H 3TM6A 1FSKC 5DK2A 5C07A 3T2QA 4MX7B 1K4CA 4QTHB 5JDJA 3TFKC 3FRUA 2EEAA 4OGYL 3FO1A 1EGJA 2XTJC 3W81A 1WC7A 1BLNA 4YO0B 2YRPA 1RJZB 2N56A 3QRFM 3O4LE 1A7NL 2J8HA 2GFBA 5L0QC 1KGCD 3X12B 2QR0B 1QKZH 1G6VK 3B9AA 4L3AA 5DC0A 5FUOH 1G7IB 2EDBA 1IFHL 5TE6H 3PL6D 1W8OA 4XMKL 4YGAB 1DANU 1U8OB 2UV3A 3BKYH 3N9GL 3ZYIA 5B21A 2CJUL 2Q7NA 3OBAA 3TCLB 4DOHE 4YDKL 5HDBE 1CL7I 2V5SA 2IQ9L 4I9WD 1E28B 4WTXA 1JZ6A 3R0MA 5CWSB 4R2GC 2HJKA 3RWJB 4IHOB 4U33A 3QIBC 4KUZH 4UILL 2VZVA 4NKQB 4NC1E 3GSXA 4UIKL 3U46B 1FH5L 1KCVH 1N0LA 3LKSB 4IRJA 5T3XH 5KAQG 4NUJB 2VXVL 5M95B 3BWAB 2ZWLT 4JKLA 2G60L 2RFXB 2EYSB 3VGDA 1TQCC 3TF7C 1JP5A 4FZ8H 4PJAA 1GXEA 4N0FA 3CVHB 1TLKA 1DBJH 3K4AA 3GKZA 5FF6B 2GJ6B 3UTTA 3FQNB 4GMTL 5FYKU 1RHHA 3BZDA 4Q6IB 3FB8B 3EFDL 1XF5A 1KB5L 4UV4L 1GCFA 4Y0GA 4PJCA 5DRXA 4XBPA 4UU9B 5JIIA 2P46B 1UWEL 2V2WA 2Q7YB 1S7TB 3C60B 5H2BB 3QSKB 4XH2B 5FCUH 4EJ1C 4WO4D 3MXVH 1U8HA 5ANMB 3B3IA 4XWGL 4ZFOB 1XGPA 4WI7A 4M5ZL 1SQ2N 1QFWI 1QD0A 1NFDA 3LQMA 1ZS8B 5L2JB 2H2SD 5C3TA 4FNLH 2VDOH 4ZSOA 1AY1L 5D7IE 4Y89A 2DN7A 1DSFL 3JWNC 1XGUB 3L3JB 4XVTL 5F7YC 4LU5L 2R39A 2FEDD 3HZMB 4S0TD 4JHWL 2FSEA 4TRPL 1U3ZA 3MGTA 3QDGD 4BSWA 3BKJL 2H1PH 1IQWL 4FQ2H 2DQTH 1ND0A 1FCGA 1JMZA 3RWIA 1I7TA 4GXVH 3NZHL 3QXWA 5JQ6H 2EZ0D 4LGSB 1H3PH 4LEXL 3GKWL 4OLUH 1J0ZA 4PIRF 5KSBF 4M7JL 2FGWH 4KPHH 3QWQB 2PNDA 4FQXA 4HBCH 2XG5A 1INDL 2FL5B 3UTZB 1TZGL 3UZEA 2V5TA 1KJ3L 1MSPA 3R4DA 2Q8BL 2HLFD 1XH3A 3FN3A 1WWBX 1CIUA 2X4OA 4HC1L 1DZBA 3U7WL 4YJZL 2IBBA 4HT1H 4F7TB 1JHLL 3MRRB 3OHXB 5E7BA 5DC9B 1EDQA 3S3JA 2Q86A 1N0XH 3BT2L 4V1DB 4P2OA 3OKNA 3GMPB 1FAIL 1K3IA 2IANA 1FN4B 1KLGA 1N8ZB 1RZIA 4TVSa 1VFAA 2YUXA 2R4SL 1JHTB 5EOTB 1IAKB 1MCJA 4AH2B 3D87B 2RBLA 3QNZB 1OW0C 1MFCH 2GQHA 4JFZH 4RMTA 1A6UH 1SBBA 5E94A 3SPVB 4E5XB 1IGYA 3O0RH 2IALA 1T1XB 1SBSL 2F8VA 4UAOB 1YMHA 3TNNA 1JUFB 3B83A 4ZNEA 5ITBH 5SWQB 3ZE0E 43C9B 1YEGL 2FEDC 1AJ7L 4JM2B 4Q6IC 5HYQA 1IM3A 5I66B 2XICA 3MZGB 4MA8L 3W0WB 1CXKA 1FC1A 5D6CA 4RZCA 5L8LB 1A7PL 1AI1L 2MQ0A 3N1PC 1I85A 3EAKA 1JGDA 4TQEL 3TPKA 2BVPA 3QNXA 1B0GA 4WFGE 3FFCE 1W72A 3EGSA 2EZ0C 1CICD 5KW9L 2XNAA 4HMDA 3KPRD 4JFEB 3QI9A 4MXQC 3SE9L 3O4LA 5D72H 4L1HA 4RMSA 3ARGB 1R5WA 4ONHB 1QNZL 5HHMD 3QCTH 3GSUB 1CFNA 4ZMAT 1ACYL 2HLFC 2GITB 3ILPB 3QIUA 5HBBA 3P0YL 3CFCL 5GGSB 4FOMA 1NCDL 4ODTH 2ICWB 1A14H 2R29H 2ZG3A 4MJ2A 3RPIB 5HPOA 5J06A 1OAKL 4LRNH 4PJEE 1LP9F 2ZOLB 4BKLB 4EDWH 4GKNA 3OZ9L 3ULSA 3VJ6B 4JZOB 5BZWA 5IR1B 3S6CA 4JAMB 3ZDXE 2Z93A 4JFED 5JW4M 3BPCA 3PWUA 3LIZL 5GQBA 2QQLH 4M43L 4JZNB 2O5YL 5D2LB 1I1FA 3UBXA 2UWEB 2I9LA 2YKLL 1D5ZB 4YDVA 4JN1L 3H9SD 2XN9B 3O3DB 4WY7L 2VSDA 1HNFA 2PR4L 3ARSA 1VPOL 3RL2B 2DRUA 4NP4L 3E8UH 3IXAB 5FUZL 2WWMD 2DM7A 1ITCA 3TA3D 2J5LB 4HQQH 1I3UA 1CGSL 1BJMA 1T89A 2VDQL 3V0VA 3HI1A 4B5EA 2OR7A 2NY5H 4MNQD 1KC5L 4LPCA 4RAUB 5C9JB 3TBYA 5E2UL 1KIRB 3GK8H 1S7VA 5E7FA 3E3QC 2Q3AA 3ET9F 4PS4H 1ZGLB 1E6JL 1UA6L 2R2CA 3SCMD 4S1RL 3KYMA 3WHE0 5GJTL 4UAOC 2I25N 3LN5B 3RBGA 5DYOB 3F7PC 5CSBA 2BY0A 4IIQB 4L29B 3UCRA 4TULL 4MQ7A 5D7IA 5FO9A 5J13B 1YMMB 4UTAL 2E6QA 1FFOA 1BPVA 1QHPA 4M8QB 3T77B 2DBLL 2PF6A 2VLLA 4DVBA 2QJDA 1UM5H 2AXFA 4Y19E 1HE7A 3FN9A 4QRTA 4L5FL 3GRWH 4U0RB 2VISB 3INUH 5TF1H 5L7XL 4NKOA 1D6EA 3IVKA 3MRBB 4NUGH 1YDPB 4ZUSB 3BMVA 3ARGC 4P9HC 4NRXB 4G3YL 1JWUA 5ACZA 5FM4A 2LV4A 2EIZB 2VAJA 4PTUB 3FT2A 5CP7A 1OAYH 3RX8A 3WNKA 1JJUA 3W11D 5D7LE 4MB3A 3OR7B 4OLVH 4PG2C 3RHWK 4U7MA 5DEZA 3MBEB 3SGKC 2WWMC 4LLYA 3CSBA 3TA3C 2Z92B 4DKFL 4EOWL 2NX5B 4JY6A 1XR8A 5C0IB 5CMAB 4AY0A 2LU4A 4R7NB 1SM3H 3T1FB 2JELL 1VEPA 4DW2H 4YFDB 4J6RL 4RRPA 4JQIL 1AHWC 1Y6KR 4X5XA 1KNOB 1MRFL 1OPGL 4TTDD 1VFUA 5I71B 3MRKB 2CLZB 1CFTB 5FYLE 3RX5A 3GB7B 1EGJL 5I1EH 2VDKL 5BCAA 1UACH 1GVIA 4MA3A 2M1KA 3MJ7B 3SCMC 1JV5A 4YE4H 2A77L 5JDSA 3MLXH 1T1WB 4TSAH 3A6BH 1MJ8L 4JCMA 3GIZH 2R2BB 3RY6C 5KVEH 5JIKA 4I13B 2FJHB 2XQBH 3LRSA 5JNYB 1MAKA 4JDZB 2J5LC 4GXUN 2NW3A 3CSYA 1XF4A 2OTWA 2O93L 2ADGB 4KI5D 4O02H 3LPWA 2VABB 3X13B 5BMFL 2AK1L 3VW3L 4B0MM 2RCSL 1U58A 4HGMA 1FL3B 2A83B 3DV4B 3IF1B 3FHAA 5BW7A 4PG9A 5EH1A 3FFCA 1ED3A 1YEIL 4WI8A 3NACL 3QUMB 4KQ3H 5E6IB 5CBEB 3A0OA 1B0RA 2VZTA 3KR3L 1CI5A 2BZDA 3P77B 1RZFL 4IIQC 5IMKA 1G7PA 1HHGA 3S37L 3VXTA 3T1WA 4JGUA 1A7RL 1JI1A 3HAEA 4KDTA 4I48A 4PB0L 1L7IH 3K4ZA 4G6FD 3D85D 5GRVL 3RZCB 4XAKE 4ZYKB 1I3VA 1T80A 5B3JE 1LEGA 3Q6FA 3O8XB 1FGVH 3F6LA 1O7SA 1EVUA 4NKMA 1XGTB 4PJEA 3BZFA 3QA3B 4ZFZB 3OJMB 4D8PB 3EYVA 1KXVC 2OJZL 5IROC 1TNMA 1JPFA 4LL9A 4GUPB 3LRHA 4WRLA 1VCAA 2X4TB 1V3LA 3EOBB 1NH6A 1DBKL 5C8JA 1CCZA 4FG6C 3EDFA 4XXDB 1GYAA 3LKQB 2HT4D 1EZVY 1MRDH 3MBEC 3VFUA 3HMWL 4OLEA 1XGRB 3NN8A 4LF3A 5FB8A 3EDJA 5IEKA 3M1BB 3KVQA 4JFOB 1NCNA 3CLEH 5EU6B 4LAQL 5E2TL 2WINB 3QQ3B 5F3HA 3MLWL 5KG9B 2Z0BA 2F19L 2VLRE 3MRMA 5JPMB 3C6LB 3WIFB 2V9RA 3BVNA 3HMXH 3EO0A 3MRIB 5I71C 2CKBH 2CUHA 3SO3C 3TBWA 1KACB 2AJYL 1BVLB 1JK8B 3EOYG 4AEIL 3TJHD 3VXPA 2BMKA 4RWYL 4K7PH 4FFYL 1FRGL 3NPSB 1FNLA 5CHNA 5DRNA 4C4KT 5FOJA 1C5CH 2GEEA 3PGCB 4JFYA 4JO2L 5D93B 3C08H 2NMSA 3HLAB 2F58L 4JR9H 2FX9L 3ARRA 5DD1L 4OUUB 4KZEH 2R0KL 3ULUD 2BRRL 1EFXD 5IVXE 3CDYA 1TJIH 2CD0A 2DWEB 3AUVA 1SJXA 1IGTB 1P7KB 1JF6A 1SHMA 4UI2A 4GW1A 4Y19A 1A9EB 3V2AR 1BZ9B 1I4FB 1OTUC 3WHXB 3OKMB 5E6IC 4P23D 1CK0L 3D18B 4HAFA 4WHYH 2QL1A 5DVKA 4EKXA 3B2VL 5HDOA 3QO0A 4ZXBA 5J56B 3DVFA 2IADB 2HT4C 5B38B 2EDKA 3QDMD 5C86A 4NT6B 4XRCA 4XI5D 4F7CB 4BSVB 2P1YA 1LWRA 2PCPA 4NQDB 5D7LA 3RZCC 4OGYH 4WU5B 2Z31A 5F3BA 4H88L 5HHQA 3O8XC 4A6YL 3ZSTA 2RAMA 2CLVA 1A7NH 3IDGB 2F9BT 3MO1B 4M02A 4Y1AB 2BERA 3OGOE 1KCLA 3U2SA 5FHAL 4GAYA 1F58L 2XTLA 4QT5B 4YR6B 1IFHH 2UY6A 4RGNE 5SWSE 1NQBA 1D6VL 5EU3A 4XMKH 5C0JA 1W72L 3GSWA 2AJ3B 1RVFL 3TJHC 4P5MA 4UQ3A 3U1SL 3N9GH 4Z7WB 2IEPA 5DJ6B 3CH8A 3C5SB 2CJUH 4F33B 2ARJQ 2GTWB 2BSTA 4YDKH 1TZHB 2Y5TB 2AEWA 2IQ9H 5CLWA 4PV8B 4RBPK 4I18B 5FA4A 1DQLL 2EDQA 2WBJA 3ULUC 1FO0A 3KDMA 1FFPA 1PVHA 2DQCL 3RTQD 4UILH 4UIKH 5CGYD 4HEME 1FH5H 4LPVA 3SDXB 3SDCD 2JB6B 2V7NA 2VXVH 3C2SA 2G60H 5T1MA 1UENA 1ZVSB 5ADOL 3M17B 1YNLL 3GSQB 3TV3L 1FIEA 3VH8B 4GMTH 2DMBA 4MAUL 4Y4KB 1A3RL 4GRWE 1INEL 5I18L 5D93C 4CNIA 3EFDH 4UV4H 1KB5H 1OL0A 3GO1L 1MNUL 1JWMB 4APQB 1NUFA 4XI5C 5IFJB 2D3VA 2FYYB 1LEKB 1UWEH 3MYJB 3BEWB 3LN4A 3MNWA 2ZOKB 2Y5EA 1MI5E 3BPLC 1Q9KB 4OIIL 4NDMA 4XWGH 4KH2A 5IGXH 4YC2B 4M5ZH 2GAZA 5J89A 5BS0D 4L8CA 4JO3L 5T1KA 4W6XB 4XTRD 4S2SA 3PGFL 1P1ZB 1AY1H 4YIQA 1DSFH 4XVTH 5C0DB 4K71B 4P2RB 4LU5H 2LFGA 1YPZB 4ISVB 2KZ1B 1N2RA 3IDNA 1DJSA 4JHWH 4TRPH 4F8QA 1LDPL 4YHLL 5MENE 3BKJH 1IQWH 2HMIC 5I76A 5EIVA 4U3XA 4YHPA 3LSOB 1MHCA 3NZHH 5FV2A 5HGDB 3G5VA 4LEXH 2EXWC 3C2AL 3GKWH 4M6AA 3RTQC 1FPTL 5C0EA 1FYTE 4JDVB 2P8MA 5CGYC 4M7JH 5FV1L 3QT2A 3QZWA 2VLRA 2AJSL 1INDH 4PJFB 4B7LA 1TZGH 4DZ8A 3B4NA 4NBXB 1KJ3H 1EJ6A 3AB0C 2Q8BH 2D0GA 4HV8B 2LVCA 3UDWA 4HC1H 3U7WH 4KV5F 3RWGB 3JVGC 4FQQB 5I0ZA 2R0LL 1FLRL 3U7YL 4BZYA 1JHLH 1IZKA 2X5PA 1BECA 5E5MB 1NGXB 1QBML 3DSNA 1K2DA 4UIMB 3D0LA 1HCFX 4RMUA 5DF0A 3BT2H 1QLFA 4RA3A 4I18C 1T5XB 1F5WA 1FAIH 1T1YA 3WN5A 3HPLB 1YEDB 4JM2F 3F7YA 5LG1A 4Q6YA 3QNYB 3QEGH 4IOIA 3L9RA 2HLAB 3D69A 3TWCL 2R4SH 4G42B 3KG5A 2OK0L 1CVRA 5TDNB 5JHDB 4RRPG 4MWFA 5IVXA 3L3DB 1EERB 2YPLB 1C5BL 3HC3L 1S9WB 4XTRC 4XNQA 2V7HA 1DP0A 4X6FA 1PAMA 3ARDA 1J0HA 4LHJB 1SBSH 2WQ8A 2G5RA 1NFIB 4QCIA 2ZP0T 4LHQB 5DQDL 3FB5A 1YEGH 1U2HA 1AJ7H 4JRYB 4X6DA 3BIKA 5I8EB 2DIBA 2R23A 4Y4KC 3AGVA 4MA8H 5D4QA 4HGWA 1A7PH 1AI1H 4J8RB 5F1NA 3LPGA 3UJJL 4S1DD 1S9XB 1K8IA 3QAZC 4DFHA 5I1AA 4TQEH 2VLKD 1C5DB 1H0DA 3ECBB 3C5ZB 4NKDA 2DLEA 5DQJB 1YYML 5IF0A 3UYRL 3GSVA 5DJAA 1ITBB 4JFPA 1IM9A 2YR3A 5KW9H 3HNSL 1BREA 3U79A 3MLRL 4LLWB 3SE9H 5JHDD 4GKZA 5SWZD 5JZ7D 5TQ2L 1WISA 1LGVA 3CD4A 4GBXD 5AUMA 1QNZH 5CD3A 2XKNA 4H0GA 1JTOA 1QFUL 5ITFA 1ETZA 3KPSA 1ACYH 2I27N 5SWSA 32C2A 2YS4A 3P0YH 4M6ML 4DGYL 3CFCH 2DKUA 5E08L 5C1MB 1NCDH 5D2LF 2EDYA 2UWEF 2XRAL 1OAKH 3MCG1 1UH2A 2EICA 1P2CB 3HAEG 3OZ9H 3VXSB 3C5ZD 3OG4B 1C16B 2A6KB 1BEYL 3RUGB 5C0CE 43CAB 2PW2B 5T1LB 4LCIL 5C2BH 4NCDA 2MHAA 3LDBC 4UOW1 4CGTA 3LIZH 4K7PX 3E6FB 4M43H 2O5YH 2DQIL 5FA3A 2YKLH 2EDNA 1INQA 1NMBL 2VZ1A 4JN1H 4WY7H 3W2DL 5JIPA 3RY5A 2PR4H 4NC2B 1VPOH 2HTKD 4NP4H 4UB0L 4IJ3B 3I3DA 5FUZH 5ICYA 2W60B 5C70A 3OSKA 5I9QB 1AKJD 1MOEA 4JKWA 2DM4A 4HBQA 3U36A 4LCWD 2W65A 1CGSH 3TO2A 1HHIB 4G9DB 4OI9A 3REVB 4S1DC 3VXSD 2VDQH 1EPFA 3IDYB 1MJUL 1XR9A 4HJGA 4ZO8A 4HKZB 4MLIA 3P4NB 2P24A 4XNMB 1KC5H 5DVLA 3WS3B 2OTUB 5E2UH 2BVOB 1PKOA 1TTFA 4OF5A 1E6JH 5JZ7C 1MI5A 1UA6H 5EUOE 4GBXC 4S1RH 4U1JA 5SX5H 5GJTH 2QBWA 5E56A 1MWAB 5EDXA 4LDOB 4XX1E 4ZFFB 4TULH 1M1SA 2MMXA 1QSVA 4QRPB 4OV5A 4BJLA 5KS9B 3GIVB 4UTAH 4HUXB 3QWOA 1GGCL 2DBLH 5AAWA 1CL7L 1ZVHA 3BP7B 1BM3L 5CBAB 3C5ZC 5MENA 3PGDB 3DETD 5FKAA 5CJBA 4AIOA 1G7QB 5EN2A 4L5FH 3GEWB 3CFDB 1FZMB 2G5BB 1JMXA 5L7XH 1NC2B 4NO0D 1H15B 4JZJA 3HC0A 5F7MC 3PXJA 4ELKB 1FYTA 4G3YH 4LPXA 1FVCA 1WBZB 4JFDE 1YEJL 2EDHA 1RK0B 3CSGA 5ID0A 2HTKC 2HJLB 2JJWA 3NFSL 1KEGL 3K2MC 4H26B 2CIIA 2JTDA 5T3ZE 4DKFH 4EOWH 3FQWA 3HTLX 2X7LA 1DQJA 4QRRB 2YPKB 2JELH 5KSAA 4J6RH 1U6AL 4JQIH 1MRFH 1OPGH 1ZTXL 3X14A 4FP8L 4MAYD 4U6HB 3LKPB 3UTQA 5BRZE 1BOGA 3BN9C 4OD1L 3L7EA 4ELMB 1EGJH 2VDKH 5CSZA 4PR5B 1MCDA 4RDQG 2A77H 2JJVA 4HG4K 4J4PA 3TIDA 1MJ8H 4F7MA 2X6MA 4CW1B 4QHKJ 4IJ3C 5HHPB 1BX2B 3L3OA 5I9QC 4IS6A 3MFFA 4HEPG 1HIML 3OF6D 1VEMA 1X5FA 5FYLL 3JV0A 1EEZA 3IFNL 3IDYC 1JYWA 4PRHD 4QO1A 2VXTL 1U92A 4WFHE 5BMFH 3S5LB 3DETC 1U8QA 2AK1H 4L8DA 3VW3H 2RCSH 1WFUA 3MRNB 1DUYB 4Z7VE 3CFBB 2CH8A 3V6OE 1YEIH 3UJIL 3TIEA 1QEWA 4IEFB 4X99A 1ZA3A 1FO0L 3NACH 4JREB 3F7RA 5F89B 3VG0L 2C1PA 2CRMA 3L3GB 3KR3H 4KC3B 2VXSL 4KY1H 4Z0XB 1RZFH 3PDDA 3SJVD 4O51B 3S37H 2GK0A 1A7RH 2D7MA 4PB0H 1UM6L 4NRZA 4NQCB 2W1NA 1IBGL 1X5KA 3PDGA 3TGXA 1PBYA 1T03L 2J8OA 2XFXB 3DX7B 4YHML 3IAGC 3QJHA 5A2IH 5IMLA 3FAXA 4RFEA 1I3GH 3TH2T 5HXMA 3OX8B 2OJZH 3T8XB 3O11B 2DIJA 3TEUA 5IQ9A 4K3HA 4QOKD 5C0CA 4X98B 5CZKA 2G2RB 4XCNA 1KLUB 1XT5A 1DEEA 1JPGB 1CYGA 3BMWA 1DBKH 5HHOA 2AK4E 3LEYL 4CN1A 3HZKB 3SQBA 5CEYB 3HMWH 2HRPL 2QSQA 2VQ1B 3CAFA 1ZHKB 3V7MA 3MV9E 4HS3A 4LAQH 5E2TH 3MLWH 2F19H 4EQ3A 2J8UE 2ESVD 4YXKL 3TYFA 4AG4L 2CXGA 1WZMA 4LAJH 1KLFA 4WWID 1MELA 4OZGE 2AJYH 3VDCA 3WJJC 5FYJD 3BHBB 1IEAA 1LK3L 4AEIH 5E6YA 4LOUD 3QZWG 2X4PA 1BBDL 4PRIB 4PJHE 4RWYH 2BVYA 4FFYH 3KPNA 5EUOA 1FRGH 4GAFB 3CFJA 5FK9B 3TVMA 3KPOA 4JO2H 4DN4L 3VXQB 4JFFB 3BISA 2F58H 4BA8A 5ID1A 2FX9H 1A1MB 2Z91B 4J23A 4LBEB 5DD1H 3P4MB 2BOBA 4NZUL 2R0KH 3AY4C 1U91B 3NCMA 2BRRH 4OB5L 4YFEA 2NYYD 2R1WA 2F8XC 1HXMA 5HGBA 3K7UA 5ESQB 3RWEA 2YSSB 1RULL 2C3GA 2W0FB 1ZT4B 1R6VA 3GJFK 4H1LG 3FOMB 3BUYA 1CK0H 3X3FL 2YC1A 1A7QL 2ORBL 3HE6A 4JN2B 4ZOAA 2BOCB 4KFZC 1A21A 4RIRB 3B2VH 4HWBA 1WFNA 2DWDA 2ADIB 4JFDA 1F4YL 2VN4A 5GGVY 3BP5A 4MHHG 4Z7WF 2VDNL 4NRYB 1ZSDB 4Y2DA 5DJXA 4FFZL 2P8PA 4RNRB 4H88H 3DNKA 1RI8A 4A6YH 4PRBB 1EMTL 4G9FB 3IJYB 2X42A 3C9NA 1UZ8B 3WFBL 2BX5A 4P57A 5FHAH 5A1AA 1MH5B 3PQYB 1F58H 3T3MF 4NZTL 5EZLB 5KANI 1D6VH 3QUKB 5TE4L 2IH1A 2HH0L 1W72H 5GGQL 2X4UB 5F1IA 4DJMA 1FVDA 1J0YA 1RVFH 2XV6B 2NY1D 5BRZA 3U1SH 2L7UA 2VERN 5I17A 1H3UA 3GSOB 5C0BB 2ZSWB 1M71A 3L3IA 4KHXL 3SDXF 3WUWA 2NY7L 4P46B 1M6OB 1MCCA 4UBDC 4X7TA 3TZVA 1RZ8A 4PLOB 1S7UB 2A6JA 3JBG7 4YFLI 3IDMB 5GSRA 4CKVX 3G5YA 5T1DL 3REWB 3QG6A 2OLDA 2J2ZA 4G8GD 1DQLH 2ITCB 4Y4FD 1T21A 2DQCH 3ZLQC 2NYYC 3QDAA 4TUOB 5IJVB 3P4OB 3MV8E 3D48R 3PQYD 1JZ5A 1OGTA 1U8JA 5FUCE 4U3HA 5MEQB 2PXYB 1AQDA 1XIWB 1RURL 3QEUA 3P9MA 1KB5B 1F42A 4EVNB 1A6VL 2IBZY 2ENYA 5ADOH 4WWKA 1G9NC 4HW6A 4Z7VA 4Y8AA 1YNLH 3V6OA 2XYCA 3TV3H 4R4FL 5AAMA 3WNMA 1H3TA 4MAUH 4ZFGL 1A3RH 4X80L 1INEH 4X6BB 5I18H 5IFAL 3GO1H 4PJ5A 1MNUH 3HR6A 1P7QA 3UJTL 3KPLB 3AS3A 3V8OA 4M1CD 1YPZF 2VITB 2MJWA 5GGRA 5MI0B 2RIKA 3GSNA 4MZ2A 2QKIA 1RZGA 5LAXA 1ONQA 3TESA 2KUTA 4OIIH 4YHOL 2XIDA 4YDIL 2AV1A 5L2KB 1CDYA 3D3VD 4YPJA 4JO3H 3QQ4B 5IB3B 2OJEB 5JLZA 3PGFH 5K9OA 1KB9J 1OGAB 4LMQI 2NY1C 2F5AL 1LQSR 1MFEL 4D0BB 4DEPB 4PJFF 2VN7A 1KBGL 4YHLH 1OLZA 4HF5L 2AK4A 4HULB 1A6AB 3BEVA 3VFVB 4Y4FC 3GMOA 3C2AH 2N4IA 1FPTH 4G8IB 2VJXA 3MV9A 5HGHB 3T09A 4ZOBA 3RPKA 2AJSH 1GOGA 5C0AD 2J8UA 1QOKA 5CJOL 4MDIA 1XCTB 3EYUL 1FVEB 4N1HB 2IGFL 2VTFA 3EO1B 4H25B 4OZGA 4AQ1B 1W2KT 1N26A 3EIFA 2FBJL 1T83A 1FLRH 2R0LH 3O4OC 3QISA 4OQ1A 4K8RD 3U7YH 3O3AA 4PJHA 1QBMH 2I9TB 4G6KL 3KHOA 4I4WA 3VMPA 4PRNA 3BW9B 1CVSC 4AEFA 5A2JH 2VQTA 3H7BB 4KKBD 3ROOB 1VFBB 4NPYB 1EVTC 3VFWB 2CLRA 4UUJA 3TWCH 4DZBA 2YZ8A 3OL2A 1E4XI 2OK0H 1PD6A 1XIWC 4NN5C 4WFEE 3WEXA 1C5BH 1YEFL 3HC3H 1PYWA 5CEZE 4U1KB 3MODL 1Y18A 2P8LA 1OAUL 3UPRB 5DD5L 5E0QA 5DQDH 1ZMYA 2JCCE 5LXGL 1MCEA 3GBNL 3T0ED 1CD8A 3O2WL 1KCRL 1TITA 1G9ML 4PJ9A 2I26N 5CZXD 4OZ4A 1X5LA 1KPUA 2DYPD 4Z7UB 3UJJH 1R3HB 1BVKB 3QUXA 5FO8A 2D0FA 3GHBL 1AGDB 4PLKD 3NFPA 4K3JL 1AGEB 5A16A 1YYMH 2VIRA 3UYRH 2ILLA 4KKCD 1E4KA 3HNSH 5HHXL 1BBJB 2E9IA 1CGUA 5F72S 1HDMA 5KVMC 3I3EA 5B39A 4GT7A 3MLRH 3S98A 4J3TA 2F53B 3BP4A 5TQ2H 1HWHB 1PW3A 2EYRB 4JKKA 4M7KL 3RUGF 1QA9A 1G7JA 4OCMC 3AREB 4OFVA 1QFUH 3SOBL 5ETUB 3BYTA 4M6MH 4DGYH 4DEPC 3DUUB 1HHKA 4K8RC 5JXED 5E08H 4XZUB 2B2XL 4QHMB 1GGBL 2XRAH 3LEXA 3LKNB 4KKBC 1D5XA 4GKOA 2P48B 3HAEH 4HWUA 1BEYH 4J3VA 4LPUA 4FTVB 3GMLB 4LCIH 3NCJL 5GGUA 1VKXA 1MHEA 5E2VL 5HVFB 1DVFB 2DQIH 4W4OC 1W8NA 3MV8A 4RSVA 5KJRL 3EZJB 1NCTA 1NMBH 2PYED 1Q72L 4I0PB 5KVDL 3W2DH 4HHAA 4Y16D 5F8RC 4OD2A 4YZFF 4UB0H 3UTPD 2P5WB 4XP6L 5AYUL 5DVNA 1G6RA 2BNQE 4OUOA 1EHLL 2X40A 3JV4B 5GS0L 4UT7L 1MJUH 3I84A 1Z9MA 4PLKC 4ODXB 4FTVD 5KS9F 1QO3A 4OD3L 2E7LC 4HJ0C 1GZPB 2A73A 3RI5K 1EXUB 3VFNA 1WITA 5EPMA 3BZEA 4JPVL 5E8NB 5HI4D 4H5SB 4LDEB 4LVNB 5ESVA 4FZEL 1G7HA 1GHFL 4X9FA 1YYLL 1J8HD 5IVZB 3CDFA 3I6GB 3OG6B 1JPTL 2OQJB 1HKLL 4G43A 1AO7D 5E8EB 1NC4D 1AXSA 1UB5B 3RDTB 1JYVA 2E5EA 5TE7L 5JXEC 1NCCL 1TFHA 2J3SA 1GGCH 2G9HB 2EDJA 3GJFA 3OGCB 1FV1A 5F96L 4P4KA 1CL7H 3IDJB 2ZNXA 1BM3H 2IPKB 2CIKB 4OZFA 3T65B 3WHE1 2I24N 2DLFL 2C3WA 4MXVF 3IGAA 2B4CC 3OJDB 3DROA 1K4DB 4PGBB 5ICXB 1C8PA 3QEQE 3VD7A 2WP3O 4D9QD 2H26B 3K3QA 1IRAY 5C09D 5IVNA 3FZUD 3F7QA 1J87A 3L3KA 3I6KB 1SEQL 2VLJB 1YEJH 3AREC 1T2JA 5I2IA 4MA1B 1SVCP 3QFJB 4F37F 4ELMF 1DE4A 4Y16C 2D31A 1QFHA 1ZOXA 5C07B 1K4CB 3ROLA 5LWYL 3NFSH 1KEGH 4URTB 1TVBA 4ODUA 3O41A 2CR6A 3FO1B 4OAWA 4LMQE 1BF8A 3KYAA 1XZ0A 1BLNB 4HWBL 2YUZA 3UAJD 4WDIA 1M7IA 2GFBB 4ORGA 1U6AH 4QWWD 1ZTXH 4FP8H 1V3JA 5FOBA 3H3PL 2QQKL 4OD1H 1FZJA 3VFGL 2DBJA 4CL7A 4UDTA 1Q0XL 3K8KA 3J7HA 1AE6L 1DVFC 3QCUL 5T3ZL 3EYFA 5TGBA 3VGAB 1FNGB 2VLJD 2MSPA 1MVUA 4LRIA 1K85A 2I60L 2AQ3A 4HD9A 2GT9B 3ZDZE 4YBLB 1HIMH 5JHLL 3WUWG 4XNUL 5FYLH 2JK5A 2VDLL 1OTTD 2JCCA 5DQ9A 3EJZD 4QNPF 1OTSD 3IFNH 1K6QL 1SMOA 2YZ1A 2VXTH 2HJKB 2E6PA 4F9LC 1NGPL 3BPNB 4WFFE 3GSXB 4IRJB 3WFEL 2OZ4A 2LABA 3UJIH 2DJSA 1FO0H 4G5ZL 4LVNC 4POYA 3VG0H 4GFTB 4WW2B 3D2UA 1T0NA 3LRGA 3DO7B 3CZFA 2VXSH 3UTTB 5LJYH 1RHHB 1JL8A 1AR2A 3RDTC 2XOTA 1XF5B 3WE6A 1QRNE 4PJCB 4GKSB 5DRXB 3IETA 1L0QA 1UM6H 4XBPB 1UKTA 1IBGH 1CWVA 2V2WB 1A1OB 4O58L 2JIXA 4CUCA 1T03H 4L4VD 4XVJL 4YHMH 4DWHA 5D9SA 4XPHL 4RAHA 3B9KD 1U8HB 3B3IB 4XNZB 4FFWC 5C92A 4NZDA 1X4YA 3WFZA 3CMOL 4GRLB 3LS5L 4BH7A 5GZOD 1Z9LA 1NFDB 3D5OF 2OI9B 3GSNL 2BSSA 1HKFA 1P4BL 4MZ3A 4LSTL 4RAVA 3UTTD 4MA1C 4OLXL 1KCUL 4UMGA 3V5KA 5IIEA 3LEYH 4DK6A 2FSEB 3GM8A 3QPQD 3KWWA 5INDA 3AAZB 3MGTB 2XKSA 1I7UA 4BSWB 4JGMA 1QFOA 2HRPH 3W5MA 1OTTC 1ND0B 3EJZC 1I7TB 2BNRE 2V2XA 2W0LA 1F00I 1T7XA 2ZUXA 4QXTB 2FWOA 1IC1A 4AG4H 1ZWIA 2BNQA 4Y5YA 4YXKH 4Z77B 4GRLD 2NNAA 4WENB 1LK3H 5IG7A 1AD9B 3VGAC 4KMLB 3OKKA 1BBDH 2IFFL 1A22B 2KPNA 4P48A 1MCHA 2X4OB 1UB6A 4N90E 4JHZA 1UH3A 4D9RE 4HKBB 2IAMA 4YBLC 3U48A 3HZVB 3ARYA 3DRTA 4DN4H 1FC2D 1S5IL 2Q86B 3SDAA 4P2OB 1WQVT 3OKNB 3MREB 1XCQA 2IANB 4NZUH 5JW4N 1RZIB 4OB5H 3BPNC 3NZ8B 3B9KC 1VFAB 4IRJC 4PV9A 3ARFA 5GZOC 4GAJL 1RULH 2HG5A 3ES6A 3F62A 5E94B 1SEBA 4U7SA 1IGYB 2IALB 2V17L 4NQXA 4OFKA 4WW2C 3X3FH 1A7QH 4B7IA 2ORBH 3TNNB 1YMHB 3V52L 4WVRA 3HS0A 1S78D 1A7BA 2UYLA 3QEQA 4H1LH 3ZO0A 4IOFD 3WYRA 5I74C 5MHSD 4KRPB 1IM3B 4XCYA 3QPQC 1R3KA 5D6CB 4RZCB 1F4YH 5DRWB 1MY5A 4C58B 2DB8A 2VDNH 2GW5A 4PRPE 4MJ4A 4LKXB 1A4JA 2IC2A 4FFZH 1JGDB 2WUBL 2J4WL 2BVPB 3IJSB 3QNXB 1B0GB 4HIXL 3QB7C 4EI5D 1W72B 3EGSB 1EMTH 3W9DA 1MCSA 2XNAB 3QYCA 3UTSD 4CVXA 5C9KA 3NA4A 5JUEL 3WFBH 5H37G 3QI9B 3WNNA 5L8KB 2QTEA 1RUKL 3T0XA 4MD0A 4GRLC 2BHUA 4X6CE 3OWEA 1CDCA 1NBZA 3O4LB 3F12B 4NZTH 4HX1A 4EZMA 1NGWA 5TE4H 1R5WB 2X89D 5KAQF 2HH0H 5GGQH 5B39G 4F57L 3T08A 1CFNB 5IB4A 3LQZB 3ZMRA 4P2CG 4KHXH 1ZGLM 3QIUB 4OM1L 2CO7B 2NY7H 2JJSA 3FMGL 4KRPD 1MHHA 4DKEL 3VXRD 4U6XA 4LQ1A 3CFKA 1WJ3A 3O3BA 2X4NA 1J0KA 2A2QT 4JQXC 1JHKL 5T1DH 1WAAE 2BCKB 3OKYA 4GKNB 3LD8B 3ULSB 5IOPA 2BP3A 5KOVC 1T04A 3GMQA 5BZWB 4DOHB 1ES0A 2Z93B 2AV7B 4FQJL 3QI9D 1NAML 3NFNA 3PWUB 5DFWH 4L9LC 1J86A 3ELAT 1RURH 2Y4SA 1ACZA 1I1FB 3UBXB 3T0DA 2I9LB 5TF0A 1HILA 1A6VH 4YDVB 3QO1A 3L5IA 2EIEA 4OGZA 5C08E 1S78C 4R4FH 4ZFGH 4X80H 4L8SA 5IFAH 3V0AC 1R3JA 2VXQL 3MX0A 4GQPH 4XCCL 3QBTB 2EE6A 3MLYL 4P2OC 4Y7MA 4PUBL 3UJTH 3V0VB 3HI1B 2FR4A 1QRNA 4LSRL 2H6PA 4XP9L 5DJZA 4EI5C 1DDHA 2WV3A 3TBYB 4MS8C 3DIFA 4WNQA 1S7VB 3D39E 1VADA 1G6RL 3I6LE 4QXGL 1FG2A 3IFPA 5HVGB 4GRWH 4YDIH 2HVKA 3VE0A 3WBDA 5H8DA 3HC4L 1J0JA 1FFQA 1HYSC 3ARTA 3KYMB 3NCBB 3OXRA 3ULVD 2F5AH 1MFEH 2IPUK 2H9GA 3L1OL 4KRPC 4MQ7B 1KN2L 1GZQA 5D7IB 5HTSA 3BDYL 1FFOB 3PV6A 1KBGH 2EKJA 4HF5H 2PO6A 2VLLB 4DVBB 1YY8A 2WBWB 5IM7A 2GHWB 2KDGA 1H3XA 2AXFB 3WDJA 5JW4R 4QRTB 4TSBL 3ORJA 2EE9A 3GNML 3QI9C 2BNRA 4MXWL 4OZFG 1CD9B 4FQPA 1D6EB 4NKOB 3IVKB 3MNZA 4MB5A 5CJOH 5D5MB 5ACZB 3EYUH 3TN0D 2IGFH 5CP7B 1EO7A 3U6RA 4CAGA 2JJUA 4G8FA 3QIUC 3RAJL 3MUY1 1KIPA 4O2CA 3BN3B 3E0GA 2FBJH 2X09A 4M48L 4LLYB 4KVCL 3K0WA 4FABL 5LGKA 4G6KH 4ODBD 2LE9A 4FFVD 3NIFE 4JY6B 1XR8B 3MRDA 3MRPB 3WIHA 4F37K 4BZ1L 1QSFE 2YD4A 5GRYA 4FQHA 4NSKA 4NYLB 4X5XB 2H8PA 4MD4A 4Z7UF 1CDBA 1BQSA 5IHZA 5CFHA 1KELL 4MA3B 4NC1C 1YEFH 5JDSB 1CF8L 2CO6B 2XACC 1O0VA 3MODH 1GOFA 3ULVC 1OAUH 2C4XA 5DD5H 2OL3A 3MMEA 4P2QE 4TNVF 1X6LA 3STZA 5LXGH 3SGJA 3GBNH 1WTGT 4NHCL 4KK5D 3LRSB 2ICEA 1L6ZA 1MCRA 4D2NA 3O2WH 1KCRH 1G9MH 4V2BA 5DWUL 2NW3B 3Q3GA 3CSYB 1XF4B 1BVZA 3P0VL 2Y7QA 3GHBH 5CGMA 4K3JH 4K94L 5CEZL 1JBJA 1ZHNA 5CS7A 3QUZA 2ARJA 4PRPA 4U6TA 1KTRL 4N0UE 1U58B 5HHXH 3G5ZA 2Y07L 5KSUA 3PP3H 3VI3E 4PG9B 3LZFL 1WSST 3FFCB 1ED3B 3MNVA 1K8DA 2DQDL 2MQCA 3MV7E 4M7KH 4O5LL 1B0RB 4X6CA 2PTUA 1OD7A 3TPUA 3SOBH 5IMKB 1G7PB 3AXLA 5JIHA 2OZ4L 1JNJA 3VXTB 1IGJA 4LLQA 3HAEB 2B2XH 4MYWB 1GGBH 1I9IL 2BSRA 2P5EE 1WK0A 4WI4A 4OI7A 2K3TA 4G7VL 3Q6FB 1SJEA 2VLMD 2AEQL 4NKMB 4PJEB 5FIEA 3BZFB 4XP1L 5DEGA 2WAHA 1WAAA 3NCJH 3EYVB 1ZHLA 4ZUTA 1U3HA 5E2VH 2VKWA 5KJRH 2NY2B 1EAPA 3QUYD 2I5YL 3MPCA 1Q72H 5KVDH 2DJ4A 2DLGA 3RNKA 4KTYA 1KCSL 3RWFB 3VFUB 3BGFB 4K7FA 4KK5C 5EOCL 3PWPD 5FB8B 1N3NA 4XP6H 4AL8L 5IEKB 5C08A 5AYUH 4CVUA 1EHLH 2IPTL 5F3HB 5GS0H 4UT7H 2NR6C 1NEZA 1IL1B 5GSVA 3WFDL 3BVNB 5I16A 4UOJA 4OD3H 3EO0B 1J1PL 3TBWB 5D1XD 3DV6A 5KANG 1MLBA 2QSVA 4JPVH 3BQUA 4TVPE 3B9EA 3EYQD 3MTRA 3D39A 3VXPB 2BMKB 4FZEH 1GHFH 2YD7A 1YYLH 5I8CA 3VXOA 5CHNB 5DRNB 4CMHC 1JPTH 1HKLH 1S7XA 2XTJE 4JFYB 1DANT 2AGJL 5DTFA 5TE7H 5HSFA 4GW5A 5F8QC 3VXUD 2UZIL 1NCCH 3VXMD 2OMNA 5DJCA 3KLHC 2FZ3A 4OZHE 5F96H 1OQOA 1GC1L 1H9VA 2YD8A 5HVHB 3ALWA 3QHFL 2V2TA 3SE3A 1TNNA 2DLFH 1UVQA 5I15L 1QTYT 3HG1B 5F7HA 3THML 1BIHA 4GW1B 5J4MA 4Y19B 3Q2CA 3DPBA 4HCRA 4M4RA 4CDHA 3SHSA 4L3EE 1IGCL 2CDGA 3CDGA 4WV1B 4JRXE 4HFWB 1SEQH 3NIDF 1YA5A 3QO0B 4ZXBB 5DGQA 1I1AA 5IT2L 2ZG2A 4KDTC 4M3KB 2YUVA 5F7NC 4XRCB 1URLA 5AG9A 5H94A 5J7CC 5LWYH 1YECL 4X83A 1RD6A 2PCPB 2F54E 4U6VL 2EXYC 2Z31B 5F3BB 1Z6JT 4QGTA 5HHQB 4LLVB 4HWBH 4LGRB 2CLVB 1ZE3C 2NZ9D 5B8CA 3BD5A 4Z76A 1D9KA 1ZT1A 3HG1D 5DUML 4GAYB 1QSFA 2R9HD 5EIQA 3H3PH 2QQKH 3KGRA 3VFGH 5D1XC 2HFEA 4M9PA 4KKNA 5C6PB 1Q0XH 5EU3B 1IARB 3GSWB 1AE6H 4DUVA 3QCUH 4P5MB 4UQ3B 3K2UL 3BRGC 2LTQB 5EO9A 2APWA 1VACA 5KVGL 5D1QA 4MNGE 2I60H 2BSTB 3BGFC 5JHLH 4XNUH 1KGCE 5AYQA 1VSCA 4WW2F 1D5MA 2VDLH 4P2QA 1U95A 2XZQL 4AM0A 5FA4B 2ICWI 1K6QH 1T0MA 2WBJB 4X4ME 1FO0B 1P6AB 3KDMB 4XBGA 1FFPB 4N68A 1NGPH 4N8VA 4AJ0A 4PJCF 3KXFD 5D7JD 1E27A 4J7RA 3GMMA 2VZSA 5HD8D 1X5AA 3P2TA 3WFEH 1I8KA 2V7NB 3ZE2F 1S7QA 3P73A 5F7WC 4RFOL 3MLPA 5T1MB 4N0UA 4G5ZH 4J1UB 3RGVD 1T5WA 3QXUA 1YN6A 1S9VA 3RIAF 1KTDA 5DVMA 4G6JL 4I9WE 1NFDF 3MV7A 4EXKA 1PG7L 3OAYH 4EN3D 5FGCE 1EUTA 1UJ3A 1HEZA 3PUCA 4O58H 5EU4A 2YN5A 3OR6A 5SX4I 1WLHA 3LN4B 3MNWB 4XVJH 2P5EA 1TVHA 4XPHH 3DOSA 2NZ9C 4NDMB 1XFPA 4ETQA 2R9HC 3CMOH 3LS5H 3RKDD 1E4XL 1A4KB 1HNGA 4L8CB 5T1KB 3GSNH 3KYOB 4S2SB 4WV1C 4YIQB 4EQ2A 1P4BH 5JOPD 5EZIL 4LSTH 3W39B 3B9DA 4NQSA 1U42A 1KCUH 2DKSA 4OLXH 4H0IA 1BP3B 3H0TA 1QR1A 3IDNB 3MGOA 4KK9C 1KPVA 1CU4L 2J6EA 3C87A 3ZL4L 2FATL 4FQCL 5EBMA 3T04D 4YLQT 5A2LH 2Z31C 3CPLA 4TUJA 5I76B 4YHPB 1DQQA 1MHCB 3PV7A 4AT6A 1X5HA 3HE7D 1HH9A 3G5VB 3V6FA 1QPPA 4ONFL 5C0EB 4YHNA 2ZUVA 5ALBL 2P7TA 3LS4L 4ZUUA 4KK8D 2P8MB 4PGDA 4RCAA 3I02A 2OS7A 3QZWB 2VLRB 3HZYA 2AVGA 1Q9OA 5IB2A 3GBML 4GMSL 4GSDL 4DZ8B 4AEHH 3MACL 4RQQA 3IYLW 1II4E 3RGVC 4X9GA 3FB6A 4Q9QL 2IFFH 3QDGE 4PP1C 3S88L 1A1NA 2OMBA 5FGBC 5IK3A 1K2DB 4EN3C 4OLZL 1BIIA 3D0LB 3HUJE 1S5IH 2AAVA 5TPWL 5HGAA 3TH4T 3VRIB 2CUIA 4HGKC 3WN5B 1T1YB 5IMOA 1OQXA 2WBJC 5C71A 1I9RL 2XT1B 3F7YB 1O7VA 4U0QB 3S97C 3UXFA 4JQVA 3FO0L 4Y4HD 3L9RB 2V5RA 3S96A 3D69B 4OZHA 3VWJD 2B20A 2ZCHL 5F7UA 4LHUA 3WIHL 3ZT5A 3VFOA 4MWFB 3RKDC 3DX8A 5IVXB 4GAJH 2C1OB 2YBRA 4KJPD 4XNQB 2V7HB 4X6FB 3ARDB 2V17H 1NSNL 3V52H 4GW4A 4PGCA 4PJ8D 4QCIB 4YGVA 3FB5B 4EDXA 2BDNL 4X6DB 3BIKB 1VGKA 4L3EA 3SDDD 4R6UA 2OR9L 4OFYD 4JRXA 3TP4A 1ZAGA 2KQMA 4HGWB 4OF7A 5F1NB 1N5AA 2C3HA 3S36X 5I1AB 2DAVA 1K8IB 2OL3L 2WUBH 4TNVK 2J4WH 3JXAA 1H0DB 1W0YT 4HIXH 4NKDB 5IW6A 2MOVA 5IF0B 3RVXD 4GRMA 3GSVB 5D8JL 1HSAA 5DJAB 4DCQA 1X5ZA 3QIBA 2F54A 1IM9B 4JFPB 5EIIA 3RX7A 5JUEH 4NBZB 1RUKH 4JCLA 2UUDH 1JI2A 4GKZB 2OR8A 1XGYL 2UZYB 3FT4B 4M5YL 4XAWL 4U1MA 2DMKA 1RIVL 2FO1A 5HDBF 5AUMB 4F57H 5CD3B 2XKNB 2GIYA 1FNEA 5ITFB 1ETZB 3KPSB 4RGNB 5SWSB 4HS6A 5F93C 3FMGH 4DKEH 4MJ5B 2R1YA 1NMCB 3X17A 3MFGB 4H8WC 5I1DA 3T2OA 1IAMA 1YNKL 3IT8D 3R06A 1JHKH 4MNGA 3FAWA 2XZZA 3FO2A 3KPRE 3E3QE 4C57C 1AGFA 3ARBB 1S7WA 3FCTA 4FQJH 4Y4HC 1LO4L 4ZTOL 1NAMH 3VWJC 2DQJL 4D0CA 4YNYA 4HK3J 5HHME 4X4MA 1I7RB 1CE6A 3PL6A 2NY3B 1CTOA 5FA3B 2HN7A 1DTUA 1INQB 4V2CB 3WL9A 3GSRA 3KPSD 3LH2L 4GG8A 1C1EL 3UDWC 2CK2A 5ENWB 5FECA 2VZ3A 5ICYB 4MQXD 4QTHA 2VXQH 4K55A 4WEUD 3L5WA 4XCCH 3U36B 1J1XL 3OB0H 5SX5K 1IEBB 2W65B 3MLYH 4IDJL 4M9OA 5DEFA 3TO2B 4JFEE 2KZWA 4PUBH 4GRWB 3WN5C 1XR9B 4HJGB 2R4RL 1KCKA 3U0WL 4E42A 3ARBD 5D7IF 3V4VL 2P24B 2D9QB 4LSRH 4XP9H 3X12A 2H3NA 5GZND 4YX2L 1KPRB 3NCYS 1G6RH 3OTTA 4QXGH 1NEZG 1ZHBA 1G7IA 5TDOB 3H9SE 2MPAL 1GL4B 1MI5B 1JYXA 3HC4H 4Z5RA 4U1JB 2EEDA 3R8QA 4JJ5A 5EWIL 1RU9L 3VCLA 3L1OH 4QKXB 3ZKND 1KN2H 4OV5B 3BDYH 1J05A 4Y5VB 3QWOB 3VA6A 4MNQE 1Q94A 1HK6A 3QHZL 4O9HL 5MENB 2O61A 5FKAB 1Z2KA 4TSBH 5D2LE 4WO4A 3JTTB 4HLZG 5EN2B 3GNMH 1MLCA 3U46A 3HN3A 2AP2A 3LKSA 5K9KA 3MV01 5J57B 5DD3L 3MRGA 4MXWH 4K9EC 1FDLL 3BWAA 1T7VA 5C2UB 4JZJB 4OZFH 4OFDA 4JPKL 4RGNC 3RAJH 3K74B 1YUHB 5ID0B 3B8SA 4HCRL 3FB8A 4MQXC 4UOW0 4M48H 4MMXC 4KVCH 2QQNL 4FABH 3QDGA 3PNWA 1DR9A 2CIIB 3QULB 1BJ1H 3FQWB 3TBTA 5C0GA 2X7LB 2Q7YA 4BZ1H 1CD1A 4Z18A 4CDGC 2NW2A 5KSAB 3ARBC 3HUJA 5EC2A 5D1ZD 4HPYL 3UTQB 3WXVL 4X7EC 3ZE0F 4ODSL 1BOGB 1C7SA 3L7EB 4K3GA 1ZS8A 4S10A 5CSZB 5AEAA 1T6VN 1KELH 1CF8H 1BJ1J 1IILE 1RUML 3TIDB 5FDYA 4HH8A 3PIQA 2RR3A 1MJ7L 3DXAD 3L3OB 4NHCH 3WO3B 5ISZD 1QLRA 1CXIA 4IS6B 3MFFB 1RK1A 2APFA 2XQYG 1MCFA 2XZAL 5DWUH 5GPRA 2YD3A 4U1SA 5DJ0A 1EEZB 3BH9A 3CJJA 3P0VH 4LSSL 2XWJA 4K94H 5CEZH 1U92B 2W0PA 2VL4A 1U8QB 4L8DB 1JGLL 2X9WA 1TZIB 4EI6A 1M4KA 1UG9A 5CJXC 2Y07H 1J88A 5GRVK 2YN3A 5I1KL 3LZFH 2FL5A 1OSZA 4N8VG 5FAAA 3TIEB 4X99B 1ZA3B 3ARXA 5MEOA 3O9WD 2DQDH 4J4PD 2C1PB 4PJEF 1DLHA 4O5LH 4GAGL 3TBVA 4PLJD 5DXWA 5E8OA 1PZ5A 3IDXL 2OZ4H 3MRRA 3ZDXF 5EO0A 2GK0B 4JY5L 5I0DA 4KI5E 4Y5VC 3WLWD 4E41B 2GI7A 4GQ9L 2GKIA 1I9IH 3QXDA 4NRZB 5KOMC 3GMPA 3RIAK 2ZPKL 1R3LA 4G7VH 1HOCA 3DSFL 2AEQH 1N8ZA 3QJHB 4W81A 5IMLB 1CICA 2DQHL 4XP1H 4RFEB 5KVFL 5D1ZC 3NCEB 3KPRA 5I1JL 4TUKL 3S9DB 1CR9L 1ZGLP 3B2UD 3DVGA 5IQ9B 4JZJC 5I1IL 1FNFA 5F9JA 4HC1A 4BFGA 4YBQC 1NUNB 4HUVA 1FL5A 4XCNB 5HYJD 1T7ZA 2BJML 3NH7L 5I75B 5HHOB 5IBLC 4AENA 4GLRH 3F5WA 1KCSH 4I2XE 4E41D 5EOCH 1AD0A 1N59A 4AL8H 4KJYA 1J10A 1EJOL 4YH6A 1AGBA 2IPTH 1GIGL 1QQDA 3MZTA 1C12A 5KSAC 1N6UA 4MSWB 4F8TA 2J6EL 3EKCA 3WFDH 5FFLA 3TYFB 1WWAX 4JFEA 5TQ0L 3O6FD 3LHPL 1J1PH 5DJ8A 2EC9U 3OXSB 4YK4B 4JB9L 4U1LB 1PQZA 3S4SB 1UXWA 1TETL 1IEAB 4ONHA 1G9MC 1GSMA 2X4PB 4J4PC 2B0SL 1CFVL 4GG6E 5HHOD 3KPNB 2CDEA 3H9SA 5EUOB 5DUPL 3CFJB 1PLGL 4PG2A 3TVMB 3KPOB 3MA7A 1I8MA 2AGJH 1R0AL 3RPIA 3WLWC 2HJFA 2UZIH 4LP4A 1RHFA 3TA3A 2AI0L 3TJEL 2ZOLA 1OWRM 4TVPL 1GC1H 2BOBB 2C5DC 4NO3A 1K5NA 4G80A 4MNQA 3QHFH 3BO8A 4XGZA 1AHWA 1FL6A 2NY0B 2D7OA 4WUUD 5IVOA 1HXMB 5I15H 4O2EA 2X4QB 3THMH 1A0QL 1J7VR 3QRGL 3B2UC 3DI2B 5D2LA 3SCMA 1IGCH 3BUYB 4D3CL 2YC1B 4LHUG 3HE6B 3TO4D 4RDQF 5JW4Q 5FYKD 3RL2A 3TYGL 2DWDB 1F3JB 4PJGE 5IT2H 3DMMD 4JFDB 5E8DL 1P9MC 3ULUE 3BP5B 1YECH 2ZUQB 4U6VH 4Y2DB 5DJXB 2PN5A 1U8KA 2GK2A 3QFDA 4ZNCD 4NM8L 3ZHLA 5C9JA 5ERWA 3FONA 4JFQA 5DUMH 4WTZA 3HI5L 5BXFA 4BYHA 1U8PA 5F1IB 1FVDB 5I17B 3K2UH 2OCFD 1M71B 3QDME 3L3IB 4HDIA 4J2XA 4IIQA 3WUWB 4L29A 1CLZL 5GS0C 4X7TB 5KVGH 4PJXE 1RZ8B 3TZVB 4ENED 2A6JB 4M03A 5E2WL 3CX5J 3FKUS 3UPAA 4XPAL 4NCC2 5GSRB 4BSJA 2FD6L 3G5YB 4NQED 3LCYA 2XZQH 2X4RA 3KLDA 3TFKD 4M62L 1MFDL 1T21B 3CCHB 5T3ZD 3C8HA 1KB9K 3MRHA 3H3KA 1OGTB 1U8JB 5IROA 2ATKA 3WLBA 1CFQB 1AQDB 4YK4C 3T0VA 3PWLA 3QEUB 3CZJA 3P9MB 4RFOH 1J12A 2EIZA 3V6ZA 2VO5A 4WWKB 4Z7VB 4TOYL 1F4HA 2W9EL 1OP5H 1KT2A 3JWOL 1FHGA 3CSPA 5B3JF 4CVZA 5I1CL 5F44A 1C7TA 4G6JH 5DR5L 1TXKA 3IFLL 1PG7H 3DMMC 5AZ2L 4PJ5B 4KROB 4ZQKA 3B6SA 1SYSA 1R5IA 5F9WB 5SV4A 4LSVL 5EU5B 5GGRB 2WLYA 2QKIB 1RZGB 5LAXB 1ONQB 2Z4QA 5M94B 4UV7L 3MRKA 2CLZA 4R2GD 5KSVB 3GB7A 4MA7L 3ZZ1A 1ZK9A 2AV1B 1E4XH 5E03A 5JLZB 1GRWA 3FHQA 5F1SA 3HE6C 5EZIH 4JY4A 2GUOB 2RJMA 1IC4L 2EKSB 3EBAA 1MCIA 4ENEC 5JNYA 4PJ5D 2Q20A 4D94A 1YQ2A 2F15A 4XHQA 1CU4H 3ZL4H 1EEYA 2FATH 4FQCH 1WWCA 1GAFL 1ZLSL 4Y2DC 3D85A 3QEHB 3BEVB 4GOSA 2ADGA 4I2XA 3BUTA 4N5ED 3X13A 5BS0E 3GMOB 4ONFH 5ALBH 3LS4H 3MV9B 1RMFL 2ZG1A 4XBEL 4WI5A 2GY5A 5EBLB 3O6KL 1QSED 2GY7B 3GBMH 2GSIB 4GMSH 1V3KA 4GSDH 4MDIB 4G8EA 3MACH 5CBEA 1AH1A 4PBVC 2XWTA 3WS6A 1EO5A 1OM3L 4Q9QH 4OZGB 3RVVD 3LAFA 4LLAA 4ACPA 3S88H 1CXFA 4HWNA 3TZVC 4YDLB 5IVXF 3O3AB 4DQOL 4PJHB 4GG6A 1BZQK 4OLZH 2D2OA 1F3DH 4I4WB 5BV7C 4LLUB 4PRNB 5TPWH 3G04A 2QV2A 4P4RA 3EW3B 4U49A 4X6DF 1I9RH 3FO0H 2CLRB 3QA3A 2EDLA 1J18A 1Q0YL 5CAYB 4PRDB 4DZBB 3KYNB 2ZCHH 4X4YB 3WIHH 1YPZE 2FLBT 4PJDE 1RFDL 3WEXB 3VMNA 1F3DJ 1PYWB 4UINL 4FXLA 4WWKC 1NSNH 3RWDA 2P8LB 3V6OC 1Q38A 2BDNH 4BQ6A 3O2DA 5GS1C 2OR9H 2EECA 2BNUA 4KROC 4PJ9B 4OZ4B 4JO1L 5CEXB 2AEIT 3ARQA 4WI6A 3M1BA 2ZUSA 3QUXB 5FO8B 5F9WC 2WINA 2OL3H 4PJGA 2BXZA 3NFPB 9CGTA 1UEMA 4N5EC 1NDMA 3KNBA 5JPMA 2GCYA 2VIRB 2IG2L 1EFXA 4MCYA 1EHNA 5D8JH 1FFNA 2AW2A 4NQVA 1HDMB 3EFFA 5B39B 2E9WA 5F88A 1XGYH 3BP4B 5IGXL 4M5YH 1GGUA 2EO1A 2VDRL 4XAWH 3U82B 1RIVH 3BGAA 4R4BA 2CR3A 1QA9B 1QFPA 4P23A 5DJYA 3WFCL 2E27L 3WKML 1MRCL 4U2YA 3HR5A 4BK4A 5K59E 4XC1L 3RVVC 2AJXL 4ZS6C 1HHHA 5IW1B 2GJ6D 5CIPA 3EDEA 2VLKE 3QDMA 3MCLL 3LEXB 5F1OB 1YNKH 2PTTB 5FDWA 1CTNA 4PJXA 3UZQA 2VL5A 1D5XB 5LGHL 2ZJSL 4M61A 5SWZE 3C60D 2XPGA 4LQFL 2DJUA 5DDHA 4HUNB 1R24A 2W9DL 1LO4H 4S0SD 3GJEA 1WZ1L 4ZTOH 2DQJH 1MHEB 1I75A 5DD6B 4GRWF 5DRZA 5J0BA 4MXQD 3QXTA 2W91A 3MV8B 4QTIL 3D18A 5AZEL 2E8YA 3LH2H 1C1EH 4HHAB 2QSCL 3DRQA 1IQDB 4OD2B 1T83C 2KL6A 3AM8A 4YDLC 4NT6A 3MA9L 1N4XL 1PEWA 4HJJL 1J1XH 1HWGB 3Q5TA 1G6RB 3GFUA 4IDJH 1ZA6A 2R4RH 3U0WH 3KAAA 3V4VH 3IDGA 1QO3B 3RTQA 1N7ML 3VU2A 3F7VA 1HZHL 1QP1A 4YX2H 2A73B 4ODWA 2ZUUA 3BZ4A 3QEGL 3VFNB 4N0YL 3SDCA 5EPMB 3BZEB 4R0LA 2MPAH 1F6AB 4I3RL 5ESVB 5TDPA 5IB5A 3WUZA 4RX4D 3C5SA 4G43B 4LCWE 3UZVB 4MQTB 1RU9H 5EWIH 4YHZL 1AXSB 3RRQA 4P9HL 3V79C 1IEHA 4PJ9C 3RUGE 4GO6B 4A6YA 2Y5TA 3GJFB 5MP6L 1FV1B 3QHZH 4P4KB 1UM4L 3QUXC 1T20A 3MRJB 5AD0A 4I18A 4V1DD 2COQA 2ED7A 4FS0A 4O9HH 4U4BA 3C60C 5F9AC 1E4KC 2CPCA 3IGAB 4A2MA 3DROB 4LCUA 3RL1A 5DD3H 1CGXA 4HLZH 1FDLH 2VDML 1F45A 2EH7L 5BS0A 4MMZC 1WEJL 3MLZL 3D25A 5F70A 2AABL 3TNMA 3L3KB 4JPKH 5I2IB 2D31B 4HCRH 1S8DA 3ROLB 3MRFA 3CVIL 4JM2D 2QQNH 1DBML 5IFJA 4BELD 1TVBB 4ODUB 1NUGA 3O41B 3W0WD 4M00A 4OAWB 2A0LD 2D9CA 3GUTB 4WDIB 1M7IB 3RJQB 2EYTB 1XF3A 1ZEAL 4G7YL 4HPYH 3WXVH 4PB9L 4ODSH 5ICZB 1RZ7L 1FZJB 4UDTB 5C2BL 2IF7A 1DQML 3UEZA 5GIRA 4EUPA 1UJTA 3BJLA 4LNRA 4WTZG 5TGBB 3IS1X 1RUMH 3ARGD 5C0DA 5C0RL 4FMFA 3FOLA 1W0VB 1CLOL 1YPZA 1MVUB 4PJDA 4OF8A 4X7SL 4ZPVA 2X70B 1MJ7H 4LFHD 3TT1L 4WJ5A 4NKIL 2MKLC 3N1GC 2JK5B 1FBIL 1IJ9A 2XZAH 2JCCB 5DQ9B 3R0NA 4QRSA 1X5YA 4LSSH 5HYSA 3OKDA 1JGLH 4JDVA 2MWCA 1H8SA 4HUUA 5I1KH 1I3RB 3MCKB 4U1NA 1WCQA 35C8L 3UYPA 3PHOA 4HV8A 3D2UB 5DJDA 4GAGH 2ID5A 1T0NB 1TJGL 3ZE1E 4HMEA 2XN9D 1F6LL 1OVZA 4A2LA 1I1CA 3IDXH 4OCXL 5EUKA 5E5MA 4XVUD 1NGXA 4KXZI 3WE6B 4JY5H 4PRHE 4NHUA 4GQ9H 3IETB 1DEDA 4JM2C 5INCB 4P4KC 4MDJA 2XZCL 2VR9A 3NIGE 2A0LC 2L4OA 2ZPKH 3HPLA 1YEDA 3T0BA 4L1DA 4NFDA 5D9SB 2VLKA 1RQ5A 3DSFH 4Y8DC 3QNYA 3PHSA 4OZIB 2DQHH 3WSQL 5KVFH 4G42A 1NBVL 5I1JH 4TUKH 4BH7B 3VWKB 1JWSA 1CR9H 4H20L 5SWZA 4K3DL 5I1IH 1S9WA 4GBXA 2BSSB 2ADJA 4R96A 3SJVE 4Z95L 4AIXA 4RAVB 2BJMH 3MRCA 2K7QA 3NH7H 1HXYA 3V5KB 5IIEB 5JMRA 1UCTA 5I8EA 3D9AL 2D7TL 5JO5A 1RIHL 3O45B 3KWWB 5L6YL 5INDB 1B4JL 1QLEL 1I7UB 4J8RA 1YMMD 5JTWA 2XWBA 1EJOH 3FTGA 5GS2H 1OAQL 3SBWA 2N7AA 5EUOF 2FJGA 1GIGH 1QVOA 3C5ZA 2V2XB 2FH8A 2J6EH 4QOKE 2FWOB 1ZWIB 2BNQB 4Y5YB 4HIHA 5TQ0H 3LHPH 3VWKD 2NNAB 3PE9A 4Y2OA 1F02I 5B3NA 4JB9H 1TETH 3TLRA 3OKKB 2B0SH 1CFVH 4JJHA 1LE9B 3VFRA 1FYHB 1UB6B 4LRIC 5DUPH 1PLGH 4K94C 4JEGB 4FG6D 2IWGA 4XVUC 2AXGA 3RQ3A 2IAMB 1R0AH 3DRTB 1AKJA 3MBED 3SDAB 2AI0H 2VZOA 4LCWA 3TJEH 1LD9A 2ESVE 1XCQB 4TVPH 2NX5D 2DI8A 5JORA 3RUGA 5FGSA 2H32A 3IU3A 5FYJE 4FQIL 1BAFL 3BESR 2XY1A 2Z8VC 3Q0HA 3ARFB 3T4AA 1A0QH 1KYOJ 5SV3A 3QRGH 2HG5B 3ES6B 3WJLC 1SEBB 2C4FT 5GGVL 4L4TB 1HQRA 1QHOA 4NQXB 4D3CH 3HFML 4UT9L 2R1XA 3HS0B 2UYLB 3QEQB 3TYGH 3QWRD 4XCYB 2IAMD 1R3KB 3JV6B 4KY1L 4PY8I 5E8DH 2Y9RT 1P7HL 4WCYL 3LQAL 5J13C 2VE6A 1KG0A 1ADQA 4Z7OF 1A4JB 5DC4B 4OCLC 3O2DL 3LKOB 3IJHA 4MJIB 5DI8A 3PWJB 4OFIA 3W9DB 5ACLA 2BVTA 4NM8H 1ZANL 2DQUL 4CVXB 3L95A 1L0XA 4MD0B 3VWKC 1NBZB 1I3GL 4U0RC 4NO0A 3HI5H 4HX1B 1NGWB 3ULUL 1RIUL 4L4TD 1A47A 4FXKA 1OTUD 2DL9A 5E9DE 5IB4B 5E6ID 1EFQA 5F9OL 5B22A 3KLAA 1MWAA 3N85L 1BOYA 1A5FL 1CLZH 1MHHB 1OLLA 1IE5A 4U6XB 1MCWW 5E2WH 5DD0L 5E70A 5K9QG 1ODAA 3CH1A 3CFKB 1JE6A 4HUXA 2QADB 2F74A 1MCWM 3O3BB 4XPAH 2Q76A 4Z7VF 2FD6H 3G08B 1CQYA 5E5RB 2X1PA 4M7ZB 5IOPB 1RZJL 3RZCD 3GMQB 4OM0L 4MJID 1ES0B 4M62H 1MFDH 4RFNB 3O8XD 1A3QA 4Y5YC 3O6LL 1T0PB 4JKPL 2VNCA 4MAYA 3NFNB 1HH6A 5DMKA 4KI1A 5IQ7L 4U6YA 1MCBA 3MBXL 1HILB 3QO1B 5D71L 5I30L 4TOYH 2VH5L 2W9EH 5FM5O 1RK0A 3JWOH 4KWUA 5MEPA 1X7QB 5I1CH 4EIGB 5DR5H 1NKOA 4F80A 3IFLH 4L8SB 3BGMA 2QADD 4G8GE 1R3JB 2IAMC 4YHIA 2B8OT 5AZ2H 2R8SL 4P5KA 1I9EA 3OF6A 3SDAC 5IKCA 1OT2A 3PQYE 5GRZA 2XA3A 4LSVH 4MCZA 4PRHA 2FR4B 2H6PB 5EU6D 5DJZB 8FABB 1DDHB 3WV0A 4F3FA 3QDJB 4RA0C 4UV7H 3DIFB 3C6LD 4WNQB 3RP1A 5MERA 1VADB 5C0FB 3ARFC 1FG2B 3IFPB 1BJ8A 4MA7H 3MR9A 5L8JB 2HVKB 3VE0B 4CU6A 4PR5A 4Q9BA 3OXRB 2MKWA 4JVWA 5DFTA 1ORSA 1IC4H 2H9GB 1MQ8A 1HCVA 1GZQB 1JF5A 3SJVA 3BI9X 3L7FA 4KRLB 2YEZA 4BUHA 3PV6B 1B4RA 2PO6B 1IMHC 1GAFH 1ZLSH 4OZGF 2A6IA 5IM7B 3AY4A 1F8TL 2AKRA 3QDJD 2YA2A 3D3VE 2HWZL 4PJHF 2DIAA 4HH9A 1OOAA 2BNRB 1RMFH 2DF3A 4XBEH 4CMMA 1BWWA 1WBYA 1CDHA 3MNZB 3O6KH 4QOKA 5DLML 25C8L 3U6RB 2H41A 3EJYD 1OM3H 1IKFL 4G8FB 2D4DA 2Z8WC 4NN7B 2JJSC 4HKXB 4O2CB 4O51A 3LB6D 4PJBB 3NAAL 2QADC 3U4EA 4DQOH 4KU1A 3MROA 1NJ9B 3MRDB 1IGFL 2Y6SC 5KZCB 4M7ZC 3PF2A 4NQDD 3QP3A 3SKMA 2HMID 4FQHB 2B5IB 4RFNC 3ZYJA 4NSKB 5CP3A 5C0AE 2H8PB 1Q0YH 2ESVA 3LVEA 3C6LC 4MD4B 2EXWD 4M3JA 3T8XA 3O11A 4Y1AD 5IHZB 1CXEA 4X98A 1RFDH 2W38A 1NMAL 4DGIL 2WQRA 2G2RA 5GS3A 3WNPA 4UINH 1KLUA 4L8BA 3FJTA 1MCNA 3V4PL 4RMWA 3PP3K 3MMEB 3RWCA 3G6AA 1XAUA 3MRLA 3STZB 4EUPG 5K9JL 2P4AB 3M45A 5JW5A 5BVJA 3NBNA 3NPSC 2ICEB 4L8SC 4XPGL 2YXMA 1PKQB 4HXBL 4X8JB 1BFSA 4JO1H 1ZHKA 3Q3GB 1NCUA 5KZCD 1KJVB 3JUYA 2Y7QB 5T3XD 1PFCA 1WCBA 1EZVX 1ZHNB 2IG2H 3QUZB 2ARJB 4PRPB 1N6VA 2DLTA 2K7PA 3G5ZB 5KSUB 5HYSG 1I7ZA 3MNVB 1EHAA 4ONOA 1K8DB 2VDRH 4X0KA 3D1MC 5EBWA 3T0EE 3I75B 3WFCH 4X6CB 2E27H 3WKMH 1MRCH 1I8LA 3EJYC 3TPUB 4Q97A 4XC1H 2AJXH 5FK9A 2HVJA 5FEBA 3V5DA 1FAKT 3KPPA 1IGJB 1WZKA 4LLQB 1MIEL 3LB6C 1QZ1A 5E9DA 4Y4KD 3FQUA 2BSRB 3MCLH 2PO6C 1WF5A 4C83A 7FABL 4APQD 4U1IA 3IFOB 5ESAA 2RHEA 5LGHH 2ZJSH 4WW1A 1KJ2A 4LQFH 1JRHI 5DEGB 1U41A 4LEOA 2W9DH 2X10A 1WZ1H 2VUOA 1ZHLB 4ZUTB 3SY0A 1W0WA 5J9PA 1U3HB 1RJLB 4DUXA 4QTIH 1ZT7A 1EAPB 1ROWA 5AZEH 1UZ6F 3DX9A 5E8PB 4Z7NE 1D5BA 2QSCH 5DZNA 1A2YA 4P2RD 4WHTA 5F97E 4K7FB 6FABL 3MA9H 1N3NB 1N4XH 1IC7L 5C08B 4I3SL 4HJJH 5DSCA 3ISWA 2H2PD 1FCCA 3OKEA 4G8GA 5C0ND 2P45B 2B5IC 1NEZB 4HIJA 4Y4FA 4C56B 5GSVB 2DKMA 5I16B 1UZ8A 1N7MH 2NY4B 1VA9A 1HZHH 1C08A 4K23L 5EZOL 3PQYA 4YAQA 1YC8A 4N0YH 3DV6B 4XC3L 2PYEE 5EZLA 4XMLL 3BQUB 4YXLL 4H1LA 2VR4A 3D39B 3AVEA 4I3RH 3UTPE 1BD2E 3BSZL 2ZSWA 3BE1L 5I8CB 5ADPL 2NLJA 3VXOB 3SKOA 5E1AA 3VGBA 2WK2A 2V9TA 3SGJC 1S7XB 4YHZH 3GI9L 4P9HH 4GW5B 2Z35B 4AIZA 1MAJA 5D2NE 3S35L 5DJCB 2FZ3B 1LO0L 5MP6H 4APQC 3REWA 1UM4H 1LK2B 4C56D 3DWTA 2V2TB 4NNXA 2NY4D 1A64A 1UVQB 5IJVA 3DBXA 4YDJB 4JG1L 1J8HE 1FLTX 2D0HA 1Q9WA 3VG9B 2VDMH 2EH7H 4YC2C 3D3VA 1WEJH 3MLZH 4LSDA 1ZLVH 5J6GA 1AO7E 2AABH 2CDGB 2YPLD 3TH3T 4NZRL 1I1AB 4P3WA 4K71C 2ICWJ 4ZO9A 1OWWA 4JRYD 1U8IB 4WU7A 3CVIH 5H94B 1DBMH 1KXTB 3DYMA 1S7SA 3ALPA 2NXZB 2VITA 2H2PC 1TCMA 5C0NC 4D9QE 5SX4H 3CMGA 1M7XA 2WW8A 4DUWA 2L7JA 4Z76B 1ZEAH 1ZT1B 5L88L 4G7YH 1MCPL 1QSFB 1ADQL 3BKCL 4PB9H 1RZ7H 5C09E 1PDKA 1IT9L 2JCCF 1CFSA 4DTGL 1U3HC 1NKRA 1DQMH 5C0AA 4W4NA 1A6TA 2WBKA 5C0RH 4PBWD 1HHJA 5EO9B 4M93B 4OI8A 1CLOH 5ECJE 1VACB 5EC1A 4X7SH 4ZTPL 3TT1H 2UY7A 1VESA 4NKIH 1D5MB 1FBIH 4P2QB 2NXZD 3ETBF 1MWAL 2UVFA 4AM0B 3VFVA 2Y06L 1CFBA 1T0MB 3JTSA 3OAYK 2RGSA 4N8VB 3WNOA 2NY4C 4G8IA 1E27B 1TPXB 1TJHL 3GMMB 1AGCA 5T1LD 5A2KH 5HGHA 1I8KB 1QR4A 3PWVB 1S7QB 3P73B 3BN9D 3LN9A 2AQ1A 1OP3H 4N0UB 4KHTL 5JXAL 4W4OA 4OZIF 2ZUTA 35C8H 1T5WB 1TJGH 1QRKA 1YN6B 1S9VB 1KTDB 2FLRT 4JPIA 3UBXI 2CRYA 4YWGL 4OCXH 3MV7B 3T0EA 3GI8L 5A40E 1OARL 1WZLA 2M26A 5H35B 3KLSA 5HPMA 1UJ3B 1U3JA 1HEZB 1B9ZA 3N1MC 2DYPA 3QH3A 1IAOA 2XZCH 5EU4B 3OR6B 3ROOA 4UNVA 4E0RA 3I9GL 3SE3C 3VFWA 2P5EB 1TVHB 1JIBA 4LPWA 2CUMA 3WSQH 2DQFA 4ETQB 1NBVH 2VR5A 3G6JB 1JPSL 4H20H 4NNYB 4K3DH 4YBHA