1TJSA

E. coli thymidylate synthase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
264
Chain Sequence
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The additivity of substrate fragments in enzyme-ligand binding.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Methyltransferase
source organism Escherichia coli
total genus 80
structure length 264
sequence length 264
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1997-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1tjsA00
4G6WX 1JMIA 4TMSA 1B5EA 3B5BA 2TSCA 3BNZA 1BJGA 4E28A 3H9KA 4EILA 2RD8A 1TDAA 1AOBA 3HJ3A 4IQBA 1TVVA 1B49A 1RTSA 1BSPA 3C0AA 4H1IA 1EVGA 1NJBA 1F4CA 3HBBA 4LRRA 3GH0A 1BO8A 4Q0EA 2G8XA 1AIQA 1ZPRA 2TDDA 3DL5A 4JEFA 3EF9A 3UWLA 1HVYA 1KZIA 1TSWA 1BSFA 1TSMA 2BBQA 1BP0A 4FGTA 1KZJA 3BYXA 1TYSA 1DDUA 4GYHA 1F4DA 1BIDA 1EV8A 5J7WA 3UM6A 1JMHA 1AXWA 1TSVA 4E5OA 4KNZA 4H0UA 1TSLA 3TMSA 2FTQA 4KY8A 1TVWA 4GD7A 1I00A 3ED7A 1NJDA 1VZBA 5H3AA 2TDMA 3QJ7A 1TDBA 4FOAA 4FOGA 4XSDA 1BDUA 4ISWA 1KCEA 1HW4A 2G8AA 3UM5A 1BQ1A 1BQ2A 1JTUA 3N5EB 3BHLA 1VZEA 4G2OX 3B9HA 3DL6A 4DP3A 4O1UA 1BP6A 4IRRA 1F4FA 1F4EA 1VZDA 1LCEA 2VF0A 2FTOX 3BZ0A 1JMFA 1F4GA 3IHIA 1SEJA 1TSYA 3EBUA 3OB7A 2TSRA 1TSDA 1TDCA 1QQQA 3GH2X 3IK0A 1TSXA 2VETA 3QG2A 4XSEA 1TRGA 4FQSA 5H39A 1NJEA 5H38A 1LCBA 1NCEA 3DG8C 3N5GA 1HW3A 1J3JC 5FCTA 1EV5A 3EHIX 1F4BA 1JU6A 1J3KC 2FTNA 3INVA 2H2QA 3UWLB 4DPHA 3NRRA 1BPJA 1VZCA 3HB8A 4EZ8A 1LCAA 1JTQA 1VZAA 2ONBA 1AJMA 4KPWA 1B5DA 5WRNA 4F2VA 3EDWX 1BKOA 4GEVA 1JUJA 4Q0DA 5BY6A 3BHRA 4EINA 1TLSA 2OIPA 4KYAA 1CI7A 3BFIA 1TLCA 1JG0A 3CL9A 2G86A 1QZFA 3N5EA 2A9WA 2G89A 3EGYX 2RD8B 3KJRA 4O1XD 1BKPA 1NJAA 2KCEA 3IX6A 1THYA 3JSUA 3UM8A 1EVFA 4KY4A 2RDAA 5HS3A 3EJLA 4DPDA 4PSGA 4UP1A 4O1XA 3CLBA 3I3RA 1F28A 4XSCA 1B02A 1TDUA 1AN5A 4ISKA 1SYNA 4H0RA 1J3IC 4EB4A 3IK1A 1TJSA 1DNAA 1JMGA 4FOXA 3V8HA 1TISA 1FFLA 3IRMA 2G8DA 1JUTA 4IQQA 4O7UA 4DQ1A 1TVUA 4ECKA 1HZWA 3K2HA 3IJZA 3DGAC 1TSZA 3KJSA 3GG5A 1TSNA 1BO7A 1YPVA 1FWMA 3EAWX 3C06A 3KGBA 1NJCA 3IRNA 3IROA 3QGTA 2AAZA 3BGXA
chains in the Genus database with same CATH superfamily
4G6WX 1JMIA 4TMSA 1B5EA 3B5BA 2TSCA 3BNZA 1BJGA 4E28A 3H9KA 4EILA 2RD8A 1TDAA 1AOBA 3HJ3A 4IQBA 1TVVA 1B49A 1RTSA 1BSPA 3C0AA 4H1IA 1EVGA 1NJBA 1F4CA 3HBBA 4LRRA 3GH0A 1BO8A 4Q0EA 2G8XA 1AIQA 1ZPRA 2TDDA 3DL5A 4JEFA 3EF9A 3UWLA 1HVYA 1KZIA 1TSWA 1BSFA 1TSMA 2BBQA 1BP0A 4FGTA 1KZJA 3BYXA 1TYSA 1DDUA 4GYHA 1F4DA 1BIDA 1EV8A 5J7WA 3UM6A 1JMHA 1AXWA 1TSVA 4E5OA 4KNZA 4H0UA 1TSLA 3TMSA 2FTQA 4KY8A 1TVWA 4GD7A 1I00A 3ED7A 1NJDA 1VZBA 5H3AA 2TDMA 3QJ7A 1TDBA 4FOAA 4FOGA 4XSDA 1BDUA 4ISWA 1KCEA 1HW4A 2G8AA 3UM5A 1BQ1A 1BQ2A 1JTUA 3N5EB 3BHLA 1VZEA 4G2OX 3B9HA 3DL6A 4DP3A 4O1UA 1BP6A 4IRRA 1F4FA 1F4EA 1VZDA 1LCEA 2VF0A 2FTOX 3BZ0A 1JMFA 1F4GA 3IHIA 1SEJA 1TSYA 3EBUA 3OB7A 2TSRA 1TSDA 1TDCA 1QQQA 3GH2X 3IK0A 1TSXA 2VETA 3QG2A 4XSEA 1TRGA 4FQSA 5H39A 1NJEA 5H38A 1LCBA 1NCEA 3DG8C 3N5GA 1HW3A 1J3JC 5FCTA 1EV5A 3EHIX 1F4BA 1JU6A 1J3KC 2FTNA 3INVA 2H2QA 3UWLB 4DPHA 3NRRA 1BPJA 1VZCA 3HB8A 4EZ8A 1LCAA 1JTQA 1VZAA 2ONBA 1AJMA 4KPWA 1B5DA 5WRNA 4F2VA 3EDWX 1BKOA 4GEVA 1JUJA 4Q0DA 5BY6A 3BHRA 4EINA 1TLSA 2OIPA 4KYAA 1CI7A 3BFIA 1TLCA 1JG0A 3CL9A 2G86A 1QZFA 3N5EA 2A9WA 2G89A 3EGYX 2RD8B 3KJRA 4O1XD 1BKPA 1NJAA 2KCEA 3IX6A 1THYA 3JSUA 3UM8A 1EVFA 4KY4A 2RDAA 5HS3A 3EJLA 4DPDA 4PSGA 4UP1A 4O1XA 3CLBA 3I3RA 1F28A 4XSCA 1B02A 1TDUA 1AN5A 4ISKA 1SYNA 4H0RA 1J3IC 4EB4A 3IK1A 1TJSA 1DNAA 1JMGA 4FOXA 3V8HA 1TISA 1FFLA 3IRMA 2G8DA 1JUTA 4IQQA 4O7UA 4DQ1A 1TVUA 4ECKA 1HZWA 3K2HA 3IJZA 3DGAC 1TSZA 3KJSA 3GG5A 1TSNA 1BO7A 1YPVA 1FWMA 3EAWX 3C06A 3KGBA 1NJCA 3IRNA 3IROA 3QGTA 2AAZA 3BGXA
chains in the Genus database with same CATH topology
4G6WX 1JMIA 4TMSA 1B5EA 3B5BA 2TSCA 3BNZA 1BJGA 4E28A 3H9KA 4EILA 2RD8A 1TDAA 1AOBA 3HJ3A 4IQBA 1TVVA 1B49A 1RTSA 1BSPA 3C0AA 4H1IA 1EVGA 1NJBA 1F4CA 3HBBA 4LRRA 3GH0A 1BO8A 4Q0EA 2G8XA 1AIQA 1ZPRA 2TDDA 3DL5A 4JEFA 3EF9A 3UWLA 1HVYA 1KZIA 1TSWA 1BSFA 1TSMA 2BBQA 1BP0A 4FGTA 1KZJA 3BYXA 1TYSA 1DDUA 4GYHA 1F4DA 1BIDA 1EV8A 5J7WA 3UM6A 1JMHA 1AXWA 1TSVA 4E5OA 4KNZA 4H0UA 1TSLA 3TMSA 2FTQA 4KY8A 1TVWA 4GD7A 1I00A 3ED7A 1NJDA 1VZBA 5H3AA 2TDMA 3QJ7A 1TDBA 4FOAA 4FOGA 4XSDA 1BDUA 4ISWA 1KCEA 1HW4A 2G8AA 3UM5A 1BQ1A 1BQ2A 1JTUA 3N5EB 3BHLA 1VZEA 4G2OX 3B9HA 3DL6A 4DP3A 4O1UA 1BP6A 4IRRA 1F4FA 1F4EA 1VZDA 1LCEA 2VF0A 2FTOX 3BZ0A 1JMFA 1F4GA 3IHIA 1SEJA 1TSYA 3EBUA 3OB7A 2TSRA 1TSDA 1TDCA 1QQQA 3GH2X 3IK0A 1TSXA 2VETA 3QG2A 4XSEA 1TRGA 4FQSA 5H39A 1NJEA 5H38A 1LCBA 1NCEA 3DG8C 3N5GA 1HW3A 1J3JC 5FCTA 1EV5A 3EHIX 1F4BA 1JU6A 1J3KC 2FTNA 3INVA 2H2QA 3UWLB 4DPHA 3NRRA 1BPJA 1VZCA 3HB8A 4EZ8A 1LCAA 1JTQA 1VZAA 2ONBA 1AJMA 4KPWA 1B5DA 5WRNA 4F2VA 3EDWX 1BKOA 4GEVA 1JUJA 4Q0DA 5BY6A 3BHRA 4EINA 1TLSA 2OIPA 4KYAA 1CI7A 3BFIA 1TLCA 1JG0A 3CL9A 2G86A 1QZFA 3N5EA 2A9WA 2G89A 3EGYX 2RD8B 3KJRA 4O1XD 1BKPA 1NJAA 2KCEA 3IX6A 1THYA 3JSUA 3UM8A 1EVFA 4KY4A 2RDAA 5HS3A 3EJLA 4DPDA 4PSGA 4UP1A 4O1XA 3CLBA 3I3RA 1F28A 4XSCA 1B02A 1TDUA 1AN5A 4ISKA 1SYNA 4H0RA 1J3IC 4EB4A 3IK1A 1TJSA 1DNAA 1JMGA 4FOXA 3V8HA 1TISA 1FFLA 3IRMA 2G8DA 1JUTA 4IQQA 4O7UA 4DQ1A 1TVUA 4ECKA 1HZWA 3K2HA 3IJZA 3DGAC 1TSZA 3KJSA 3GG5A 1TSNA 1BO7A 1YPVA 1FWMA 3EAWX 3C06A 3KGBA 1NJCA 3IRNA 3IROA 3QGTA 2AAZA 3BGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G6W X;  1JMI A;  4TMS A;  1B5E A;  3B5B A;  2TSC A;  3BNZ A;  1BJG A;  4E28 A;  3H9K A;  4EIL A;  2RD8 A;  1TDA A;  1AOB A;  3HJ3 A;  4IQB A;  1TVV A;  1B49 A;  1RTS A;  1BSP A;  3C0A A;  4H1I A;  1EVG A;  1NJB A;  1F4C A;  3HBB A;  4LRR A;  3GH0 A;  1BO8 A;  4Q0E A;  2G8X A;  1AIQ A;  1ZPR A;  2TDD A;  3DL5 A;  4JEF A;  3EF9 A;  3UWL A;  1HVY A;  1KZI A;  1TSW A;  1BSF A;  1TSM A;  2BBQ A;  1BP0 A;  4FGT A;  1KZJ A;  3BYX A;  1TYS A;  1DDU A;  4GYH A;  1F4D A;  1BID A;  1EV8 A;  5J7W A;  3UM6 A;  1JMH A;  1AXW A;  1TSV A;  4E5O A;  4KNZ A;  4H0U A;  1TSL A;  3TMS A;  2FTQ A;  4KY8 A;  1TVW A;  4GD7 A;  1I00 A;  3ED7 A;  1NJD A;  1VZB A;  5H3A A;  2TDM A;  3QJ7 A;  1TDB A;  4FOA A;  4FOG A;  4XSD A;  1BDU A;  4ISW A;  1KCE A;  1HW4 A;  2G8A A;  3UM5 A;  1BQ1 A;  1BQ2 A;  1JTU A;  3N5E B;  3BHL A;  1VZE A;  4G2O X;  3B9H A;  3DL6 A;  4DP3 A;  4O1U A;  1BP6 A;  4IRR A;  1F4F A;  1F4E A;  1VZD A;  1LCE A;  2VF0 A;  2FTO X;  3BZ0 A;  1JMF A;  1F4G A;  3IHI A;  1SEJ A;  1TSY A;  3EBU A;  3OB7 A;  2TSR A;  1TSD A;  1TDC A;  1QQQ A;  3GH2 X;  3IK0 A;  1TSX A;  2VET A;  3QG2 A;  4XSE A;  1TRG A;  4FQS A;  5H39 A;  1NJE A;  5H38 A;  1LCB A;  1NCE A;  3DG8 C;  3N5G A;  1HW3 A;  1J3J C;  5FCT A;  1EV5 A;  3EHI X;  1F4B A;  1JU6 A;  1J3K C;  2FTN A;  3INV A;  2H2Q A;  3UWL B;  4DPH A;  3NRR A;  1BPJ A;  1VZC A;  3HB8 A;  4EZ8 A;  1LCA A;  1JTQ A;  1VZA A;  2ONB A;  1AJM A;  4KPW A;  1B5D A;  5WRN A;  4F2V A;  3EDW X;  1BKO A;  4GEV A;  1JUJ A;  4Q0D A;  5BY6 A;  3BHR A;  4EIN A;  1TLS A;  2OIP A;  4KYA A;  1CI7 A;  3BFI A;  1TLC A;  1JG0 A;  3CL9 A;  2G86 A;  1QZF A;  3N5E A;  2A9W A;  2G89 A;  3EGY X;  2RD8 B;  3KJR A;  4O1X D;  1BKP A;  1NJA A;  2KCE A;  3IX6 A;  1THY A;  3JSU A;  3UM8 A;  1EVF A;  4KY4 A;  2RDA A;  5HS3 A;  3EJL A;  4DPD A;  4PSG A;  4UP1 A;  4O1X A;  3CLB A;  3I3R A;  1F28 A;  4XSC A;  1B02 A;  1TDU A;  1AN5 A;  4ISK A;  1SYN A;  4H0R A;  1J3I C;  4EB4 A;  3IK1 A;  1TJS A;  1DNA A;  1JMG A;  4FOX A;  3V8H A;  1TIS A;  1FFL A;  3IRM A;  2G8D A;  1JUT A;  4IQQ A;  4O7U A;  4DQ1 A;  1TVU A;  4ECK A;  1HZW A;  3K2H A;  3IJZ A;  3DGA C;  1TSZ A;  3KJS A;  3GG5 A;  1TSN A;  1BO7 A;  1YPV A;  1FWM A;  3EAW X;  3C06 A;  3KGB A;  1NJC A;  3IRN A;  3IRO A;  3QGT A;  2AAZ A;  3BGX A; 
#chains in the Genus database with same CATH topology
 4G6W X;  1JMI A;  4TMS A;  1B5E A;  3B5B A;  2TSC A;  3BNZ A;  1BJG A;  4E28 A;  3H9K A;  4EIL A;  2RD8 A;  1TDA A;  1AOB A;  3HJ3 A;  4IQB A;  1TVV A;  1B49 A;  1RTS A;  1BSP A;  3C0A A;  4H1I A;  1EVG A;  1NJB A;  1F4C A;  3HBB A;  4LRR A;  3GH0 A;  1BO8 A;  4Q0E A;  2G8X A;  1AIQ A;  1ZPR A;  2TDD A;  3DL5 A;  4JEF A;  3EF9 A;  3UWL A;  1HVY A;  1KZI A;  1TSW A;  1BSF A;  1TSM A;  2BBQ A;  1BP0 A;  4FGT A;  1KZJ A;  3BYX A;  1TYS A;  1DDU A;  4GYH A;  1F4D A;  1BID A;  1EV8 A;  5J7W A;  3UM6 A;  1JMH A;  1AXW A;  1TSV A;  4E5O A;  4KNZ A;  4H0U A;  1TSL A;  3TMS A;  2FTQ A;  4KY8 A;  1TVW A;  4GD7 A;  1I00 A;  3ED7 A;  1NJD A;  1VZB A;  5H3A A;  2TDM A;  3QJ7 A;  1TDB A;  4FOA A;  4FOG A;  4XSD A;  1BDU A;  4ISW A;  1KCE A;  1HW4 A;  2G8A A;  3UM5 A;  1BQ1 A;  1BQ2 A;  1JTU A;  3N5E B;  3BHL A;  1VZE A;  4G2O X;  3B9H A;  3DL6 A;  4DP3 A;  4O1U A;  1BP6 A;  4IRR A;  1F4F A;  1F4E A;  1VZD A;  1LCE A;  2VF0 A;  2FTO X;  3BZ0 A;  1JMF A;  1F4G A;  3IHI A;  1SEJ A;  1TSY A;  3EBU A;  3OB7 A;  2TSR A;  1TSD A;  1TDC A;  1QQQ A;  3GH2 X;  3IK0 A;  1TSX A;  2VET A;  3QG2 A;  4XSE A;  1TRG A;  4FQS A;  5H39 A;  1NJE A;  5H38 A;  1LCB A;  1NCE A;  3DG8 C;  3N5G A;  1HW3 A;  1J3J C;  5FCT A;  1EV5 A;  3EHI X;  1F4B A;  1JU6 A;  1J3K C;  2FTN A;  3INV A;  2H2Q A;  3UWL B;  4DPH A;  3NRR A;  1BPJ A;  1VZC A;  3HB8 A;  4EZ8 A;  1LCA A;  1JTQ A;  1VZA A;  2ONB A;  1AJM A;  4KPW A;  1B5D A;  5WRN A;  4F2V A;  3EDW X;  1BKO A;  4GEV A;  1JUJ A;  4Q0D A;  5BY6 A;  3BHR A;  4EIN A;  1TLS A;  2OIP A;  4KYA A;  1CI7 A;  3BFI A;  1TLC A;  1JG0 A;  3CL9 A;  2G86 A;  1QZF A;  3N5E A;  2A9W A;  2G89 A;  3EGY X;  2RD8 B;  3KJR A;  4O1X D;  1BKP A;  1NJA A;  2KCE A;  3IX6 A;  1THY A;  3JSU A;  3UM8 A;  1EVF A;  4KY4 A;  2RDA A;  5HS3 A;  3EJL A;  4DPD A;  4PSG A;  4UP1 A;  4O1X A;  3CLB A;  3I3R A;  1F28 A;  4XSC A;  1B02 A;  1TDU A;  1AN5 A;  4ISK A;  1SYN A;  4H0R A;  1J3I C;  4EB4 A;  3IK1 A;  1TJS A;  1DNA A;  1JMG A;  4FOX A;  3V8H A;  1TIS A;  1FFL A;  3IRM A;  2G8D A;  1JUT A;  4IQQ A;  4O7U A;  4DQ1 A;  1TVU A;  4ECK A;  1HZW A;  3K2H A;  3IJZ A;  3DGA C;  1TSZ A;  3KJS A;  3GG5 A;  1TSN A;  1BO7 A;  1YPV A;  1FWM A;  3EAW X;  3C06 A;  3KGB A;  1NJC A;  3IRN A;  3IRO A;  3QGT A;  2AAZ A;  3BGX A; 
#chains in the Genus database with same CATH homology
 4G6W X;  1JMI A;  4TMS A;  1B5E A;  3B5B A;  2TSC A;  3BNZ A;  1BJG A;  4E28 A;  3H9K A;  4EIL A;  2RD8 A;  1TDA A;  1AOB A;  3HJ3 A;  4IQB A;  1TVV A;  1B49 A;  1RTS A;  1BSP A;  3C0A A;  4H1I A;  1EVG A;  1NJB A;  1F4C A;  3HBB A;  4LRR A;  3GH0 A;  1BO8 A;  4Q0E A;  2G8X A;  1AIQ A;  1ZPR A;  2TDD A;  3DL5 A;  4JEF A;  3EF9 A;  3UWL A;  1HVY A;  1KZI A;  1TSW A;  1BSF A;  1TSM A;  2BBQ A;  1BP0 A;  4FGT A;  1KZJ A;  3BYX A;  1TYS A;  1DDU A;  4GYH A;  1F4D A;  1BID A;  1EV8 A;  5J7W A;  3UM6 A;  1JMH A;  1AXW A;  1TSV A;  4E5O A;  4KNZ A;  4H0U A;  1TSL A;  3TMS A;  2FTQ A;  4KY8 A;  1TVW A;  4GD7 A;  1I00 A;  3ED7 A;  1NJD A;  1VZB A;  5H3A A;  2TDM A;  3QJ7 A;  1TDB A;  4FOA A;  4FOG A;  4XSD A;  1BDU A;  4ISW A;  1KCE A;  1HW4 A;  2G8A A;  3UM5 A;  1BQ1 A;  1BQ2 A;  1JTU A;  3N5E B;  3BHL A;  1VZE A;  4G2O X;  3B9H A;  3DL6 A;  4DP3 A;  4O1U A;  1BP6 A;  4IRR A;  1F4F A;  1F4E A;  1VZD A;  1LCE A;  2VF0 A;  2FTO X;  3BZ0 A;  1JMF A;  1F4G A;  3IHI A;  1SEJ A;  1TSY A;  3EBU A;  3OB7 A;  2TSR A;  1TSD A;  1TDC A;  1QQQ A;  3GH2 X;  3IK0 A;  1TSX A;  2VET A;  3QG2 A;  4XSE A;  1TRG A;  4FQS A;  5H39 A;  1NJE A;  5H38 A;  1LCB A;  1NCE A;  3DG8 C;  3N5G A;  1HW3 A;  1J3J C;  5FCT A;  1EV5 A;  3EHI X;  1F4B A;  1JU6 A;  1J3K C;  2FTN A;  3INV A;  2H2Q A;  3UWL B;  4DPH A;  3NRR A;  1BPJ A;  1VZC A;  3HB8 A;  4EZ8 A;  1LCA A;  1JTQ A;  1VZA A;  2ONB A;  1AJM A;  4KPW A;  1B5D A;  5WRN A;  4F2V A;  3EDW X;  1BKO A;  4GEV A;  1JUJ A;  4Q0D A;  5BY6 A;  3BHR A;  4EIN A;  1TLS A;  2OIP A;  4KYA A;  1CI7 A;  3BFI A;  1TLC A;  1JG0 A;  3CL9 A;  2G86 A;  1QZF A;  3N5E A;  2A9W A;  2G89 A;  3EGY X;  2RD8 B;  3KJR A;  4O1X D;  1BKP A;  1NJA A;  2KCE A;  3IX6 A;  1THY A;  3JSU A;  3UM8 A;  1EVF A;  4KY4 A;  2RDA A;  5HS3 A;  3EJL A;  4DPD A;  4PSG A;  4UP1 A;  4O1X A;  3CLB A;  3I3R A;  1F28 A;  4XSC A;  1B02 A;  1TDU A;  1AN5 A;  4ISK A;  1SYN A;  4H0R A;  1J3I C;  4EB4 A;  3IK1 A;  1TJS A;  1DNA A;  1JMG A;  4FOX A;  3V8H A;  1TIS A;  1FFL A;  3IRM A;  2G8D A;  1JUT A;  4IQQ A;  4O7U A;  4DQ1 A;  1TVU A;  4ECK A;  1HZW A;  3K2H A;  3IJZ A;  3DGA C;  1TSZ A;  3KJS A;  3GG5 A;  1TSN A;  1BO7 A;  1YPV A;  1FWM A;  3EAW X;  3C06 A;  3KGB A;  1NJC A;  3IRN A;  3IRO A;  3QGT A;  2AAZ A;  3BGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...