1TJTA

X-ray structure of the human alpha-actinin isoform 3 at 2.2a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
224
structure length
224
Chain Sequence
AWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-actinin 3
publication title The crystal structure of the actin binding domain from alpha-actinin in its closed conformation: structural insight into phospholipid regulation of alpha-actinin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 82
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1tjtA02
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1tjtA01
3JAKM 1P5SA 1UJOA 1WYLA 2EYNA 4EDMA 2EE7A 2VZGB 4EDNA 4B7LA 3KMUB 4Q57B 3KY9A 4EDLA 1DXXA 2VZIB 1WYQA 2D85A 2R8UA 1VKAA 3FERA 1WYMA 2WFNA 3JARM 1AA2A 1V5KA 1BHDA 2D88A 2QJXA 2VZCA 3F7PA 1BKRA 2RR8A 1TJTA 1SH6A 3CO1A 2WA6A 2EYIA 3HOCA 5A36A 3REPB 2WA5A 2E9KA 1SH5A 4TXKA 3HORA 4Q59A 1WIXA 1P2XA 1WYNA 2DK9A 3I6XA 5L0OA 1WYRA 2R0OA 1UEGA 4TXIA 1PXYA 5A38A 2QJZA 3HOPA 1WYOA 2JV9A 1WKUA 2WA7A 2K2RA 2YRNA 1WYPA 2D89A 2D87A 1WJOA 1PA7A 1RT8A 5A37A 1MB8A 5A4BA 2D86A 2L3GA 3KMWB 3JALM 2VZDA 1AOAA 2K3SA 1H67A 5BVRA 5J8EA 4Q58A 1QAGA
chains in the Genus database with same CATH superfamily
3JAKM 1P5SA 5FMTA 1UJOA 1WYLA 2EYNA 4EDMA 2EE7A 2VZGB 4EDNA 4B7LA 3KMUB 4Q57B 3KY9A 4EDLA 1DXXA 2VZIB 1WYQA 2D85A 2R8UA 1VKAA 3FERA 1WYMA 4DDPA 3VP7A 2WFNA 1AA2A 1V5KA 2QJXA 1BHDA 2D88A 2VZCA 3JARM 3F7PA 1BKRA 2RR8A 1TJTA 2HL9A 1SH6A 3CO1A 2VE7A 2WA6A 2EYIA 2WDTA 3HOCA 5A36A 2HKPA 3REPB 2WA5A 2E9KA 1SH5A 4TXKA 3HORA 4LVPA 4Q59A 1WIXA 1P2XA 1WYNA 2DK9A 3I6XA 5L0OA 1WYRA 2R0OA 1UEGA 2EQOA 4TXIA 1PXYA 2IGPA 5A38A 2QJZA 3HOPA 1WYOA 5FMUA 2JV9A 1WKUA 2WA7A 2K2RA 2YRNA 1WYPA 3EAYA 2D89A 2D87A 1WJOA 1PA7A 1RT8A 2HL8A 1MB8A 5A37A 1EUVA 2WE6A 5A4BA 2D86A 2L3GA 3KMWB 4LVRA 3JALM 2VZDA 1AOAA 2K3SA 1H67A 2VE7C 5BVRA 5J8EA 4Q58A 1QAGA
chains in the Genus database with same CATH topology
3JAKM 1P5SA 1UJOA 1WYLA 2EYNA 4EDMA 2EE7A 2VZGB 4EDNA 4B7LA 3KMUB 4Q57B 3KY9A 4EDLA 1DXXA 2VZIB 1WYQA 2D85A 2R8UA 1VKAA 3FERA 1WYMA 2WFNA 3JARM 1AA2A 1V5KA 1BHDA 2D88A 2QJXA 2VZCA 3F7PA 1BKRA 2RR8A 1TJTA 1SH6A 3CO1A 2WA6A 2EYIA 3HOCA 5A36A 3REPB 2WA5A 2E9KA 1SH5A 4TXKA 3HORA 4Q59A 1WIXA 1P2XA 1WYNA 2DK9A 3I6XA 5L0OA 1WYRA 2R0OA 1UEGA 4TXIA 1PXYA 5A38A 2QJZA 3HOPA 1WYOA 2JV9A 1WKUA 2WA7A 2K2RA 2YRNA 1WYPA 2D89A 2D87A 1WJOA 1PA7A 1RT8A 5A37A 1MB8A 5A4BA 2D86A 2L3GA 3KMWB 3JALM 2VZDA 1AOAA 2K3SA 1H67A 5BVRA 5J8EA 4Q58A 1QAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAK M;  1P5S A;  1UJO A;  1WYL A;  2EYN A;  4EDM A;  2EE7 A;  2VZG B;  4EDN A;  4B7L A;  3KMU B;  4Q57 B;  3KY9 A;  4EDL A;  1DXX A;  2VZI B;  1WYQ A;  2D85 A;  2R8U A;  1VKA A;  3FER A;  1WYM A;  2WFN A;  3JAR M;  1AA2 A;  1V5K A;  1BHD A;  2D88 A;  2QJX A;  2VZC A;  3F7P A;  1BKR A;  2RR8 A;  1TJT A;  1SH6 A;  3CO1 A;  2WA6 A;  2EYI A;  3HOC A;  5A36 A;  3REP B;  2WA5 A;  2E9K A;  1SH5 A;  4TXK A;  3HOR A;  4Q59 A;  1WIX A;  1P2X A;  1WYN A;  2DK9 A;  3I6X A;  5L0O A;  1WYR A;  2R0O A;  1UEG A;  4TXI A;  1PXY A;  5A38 A;  2QJZ A;  3HOP A;  1WYO A;  2JV9 A;  1WKU A;  2WA7 A;  2K2R A;  2YRN A;  1WYP A;  2D89 A;  2D87 A;  1WJO A;  1PA7 A;  1RT8 A;  5A37 A;  1MB8 A;  5A4B A;  2D86 A;  2L3G A;  3KMW B;  3JAL M;  2VZD A;  1AOA A;  2K3S A;  1H67 A;  5BVR A;  5J8E A;  4Q58 A;  1QAG A; 
#chains in the Genus database with same CATH topology
 3JAK M;  1P5S A;  5FMT A;  1UJO A;  1WYL A;  2EYN A;  4EDM A;  2EE7 A;  2VZG B;  4EDN A;  4B7L A;  3KMU B;  4Q57 B;  3KY9 A;  4EDL A;  1DXX A;  2VZI B;  1WYQ A;  2D85 A;  2R8U A;  1VKA A;  3FER A;  1WYM A;  4DDP A;  3VP7 A;  2WFN A;  1AA2 A;  1V5K A;  2QJX A;  1BHD A;  2D88 A;  2VZC A;  3JAR M;  3F7P A;  1BKR A;  2RR8 A;  1TJT A;  2HL9 A;  1SH6 A;  3CO1 A;  2VE7 A;  2WA6 A;  2EYI A;  2WDT A;  3HOC A;  5A36 A;  2HKP A;  3REP B;  2WA5 A;  2E9K A;  1SH5 A;  4TXK A;  3HOR A;  4LVP A;  4Q59 A;  1WIX A;  1P2X A;  1WYN A;  2DK9 A;  3I6X A;  5L0O A;  1WYR A;  2R0O A;  1UEG A;  2EQO A;  4TXI A;  1PXY A;  2IGP A;  5A38 A;  2QJZ A;  3HOP A;  1WYO A;  5FMU A;  2JV9 A;  1WKU A;  2WA7 A;  2K2R A;  2YRN A;  1WYP A;  3EAY A;  2D89 A;  2D87 A;  1WJO A;  1PA7 A;  1RT8 A;  2HL8 A;  1MB8 A;  5A37 A;  1EUV A;  2WE6 A;  5A4B A;  2D86 A;  2L3G A;  3KMW B;  4LVR A;  3JAL M;  2VZD A;  1AOA A;  2K3S A;  1H67 A;  2VE7 C;  5BVR A;  5J8E A;  4Q58 A;  1QAG A; 
#chains in the Genus database with same CATH homology
 3JAK M;  1P5S A;  1UJO A;  1WYL A;  2EYN A;  4EDM A;  2EE7 A;  2VZG B;  4EDN A;  4B7L A;  3KMU B;  4Q57 B;  3KY9 A;  4EDL A;  1DXX A;  2VZI B;  1WYQ A;  2D85 A;  2R8U A;  1VKA A;  3FER A;  1WYM A;  2WFN A;  3JAR M;  1AA2 A;  1V5K A;  1BHD A;  2D88 A;  2QJX A;  2VZC A;  3F7P A;  1BKR A;  2RR8 A;  1TJT A;  1SH6 A;  3CO1 A;  2WA6 A;  2EYI A;  3HOC A;  5A36 A;  3REP B;  2WA5 A;  2E9K A;  1SH5 A;  4TXK A;  3HOR A;  4Q59 A;  1WIX A;  1P2X A;  1WYN A;  2DK9 A;  3I6X A;  5L0O A;  1WYR A;  2R0O A;  1UEG A;  4TXI A;  1PXY A;  5A38 A;  2QJZ A;  3HOP A;  1WYO A;  2JV9 A;  1WKU A;  2WA7 A;  2K2R A;  2YRN A;  1WYP A;  2D89 A;  2D87 A;  1WJO A;  1PA7 A;  1RT8 A;  5A37 A;  1MB8 A;  5A4B A;  2D86 A;  2L3G A;  3KMW B;  3JAL M;  2VZD A;  1AOA A;  2K3S A;  1H67 A;  5BVR A;  5J8E A;  4Q58 A;  1QAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...