1TJYA

Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
316
structure length
316
Chain Sequence
b'GSAERIAFIPKLVGVGFFTSGGNGAQEAGKALGIDVTYDGPTEPSVSGQVQLVNNFVNQGYDAIIVSAVSPDGLCPALKRAMQRGVKILTWDSDTKPECRSYYINQGTPKQLGSMLVEMAAHQVDKEKAKVAFFYSSPTVTDQNQWVKEAKAKISQEHPGWEIVTTQFGYNDATKSLQTAEGIIKAYPDLDAIIAPDANALPAAAQAAENLKRNNLAIVGFSTPNVMRPYVQRGTVKEFGLWDVVQQGKISVYVANALLKNMPMNVGDSLDIPGIGKVTVSPNSEQGYHYEAKGNGIVLLPERVIFNKDNIDKYDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar transport protein
molecule tags Signaling protein
source organism Salmonella typhimurium
publication title Salmonella typhimurium Recognizes a Chemically Distinct Form of the Bacterial Quorum-Sensing Signal AI-2
pubmed doi rcsb
total genus 119
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tjyA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tjyA01
3O2SB 4XFKA 5TQJA 3F7NA 1RPJA 1TJYA 3HUUA 2PUFA 4S04A 4F06A 1YMUA 2JVJA 1F4VA 3H5VA 3KKEA 3MA0A 4KK4A 4MR8B 5FBHA 1RXIA 2B4AA 4MAAA 2A9RA 2GBPA 1P2FA 3N75A 2FQXA 2WRZA 2IPAB 3JVIA 1DCFA 1SD5A 4MR8A 3MIZA 3ILHA 1S8NA 3C3MA 4EVQA 3FFXA 1PHRA 1DBPA 4Z99A 4G97A 2PUEA 3DLHA 4Y9TA 4W5RA 1ZGZA 3DLBA 4MYRA 4EYGA 5E3JA 4YO7A 2PUCA 3H6GA 3RVJA 5ED4A 4FE7A 1KGSA 5HQJA 5CNJA 3MQ4A 5TE9A 3CZCA 3RVPA 2NT3A 4G0XA 3ROTA 3NBMA 1JDNA 3CNBA 3OM0A 1USKA 3I42A 4Z9BA 5FWYA 4Z4FA 4TN5A 3HUTA 4F8JA 4ZPJA 1QKKA 2HQRA 3JS5A 3RH0A 3DGEC 4WXMA 1NXWA 3CG4A 4RY9A 1Z18A 3G85A 4DQDA 4Z4GA 2J48A 4YV7A 3MM4A 2PKXA 2X7XA 3C6QA 3LUGA 1QNLA 3S99A 3QLVA 2L18A 5JS1A 1NXXA 1EWKA 1A04A 3CS3A 3BRSA 3SAJA 4H3KB 3SQNA 3EGCA 2FXIA 4WZZA 2N9UA 3IPCA 1CEYA 3TO5A 4IGAA 1GCGA 2LIVA 3O74A 5FBKA 5IUJC 3EJWA 1JHZA 3FFWA 4Q6BA 3A0RB 3IDOA 3OMXA 5CNMA 3LMKA 2L17A 4YWHA 3C97A 1PEAA 3LUJA 4P98A 4KNYA 2MYUA 4TLLB 2R25B 3N53A 4OLAA 1JFTA 1NXVA 1TVMA 3JY6A 2QW1A 1BDIA 4RK5A 4RK0A 3K4HA 3LKBA 4KK3A 2FQYA 3JVDA 3HZHA 4MR7A 1DRKA 3GL9A 2FW0A 5KQPA 4EGSA 3KS9A 3RVRA 3N0XA 1QO0A 5TQ2A 3HS3A 4D74A 2PJUA 4P1ZA 1ZH2A 4MLCA 3OLWA 3TMYA 1XHFA 2RGYA 5DLEA 1DCMA 1YVUA 3IP7A 3KHTA 4MS3A 4TLMB 1EWVA 3H5IA 1K66A 4OTZA 1EHCA 5PNTA 3H5TA 5FWXB 2FEPA 4Z0NA 3HCWA 1BA2A 1Y1LA 4KQ9A 2JVIA 4N76A 4D6XA 4KQCA 1B00A 5JNSA 4MQEA 3EDCA 1U2PA 3LUAA 2GI4A 4LX8A 5FWXA 5KQGA 3LTEA 4RXTA 3UUGA 4RSMA 5EWJB 4RZSA 1JFVA 2IPLA 2MSLA 1APBA 5HSGA 4E7PA 1RZRA 2QU7A 2W42A 1P8AA 2JK1A 2OQRA 5IUKC 1FFSA 2GWRA 1L5ZA 4Q7EA 3C3KA 4N03A 3NHMA 1D1PA 3HDGA 5TQ0B 4WT7A 1ISSA 4NQRA 1XHEA 3Q9SA 3HK2A 3QX8A 3DGFC 3HVRA 1NXSA 3IP6A 5KQLA 3QELB 2F8TA 1DBWA 2TMYA 4LE1A 3BREA 3RVKA 2WY2D 1VPWA 1DRJA 2JBAA 1DG9A 4XASA 1PNRA 1R8JA 1QPZA 5BRJA 1SXIA 4QICA 2QZJA 3F6PA 4RXUA 4MS3B 1QP7A 4IF4A 1ZESA 3NNDA 3HO1A 5JNUA 2ZAYA 3N6VA 3QLUA 2YHAA 1PEYA 6ABPA 3FDFA 1HEYA 1FFGA 1MAVA 1TM2A 3BILA 1U0SY 1KRXA 1ZVVA 1VLZA 1ZY2A 1Z2DA 4XARA 1JL3A 1KMIY 2FMKA 4B09A 2P9HA 6CHYA 1EAYA 2IKSA 2MYPA 4EYQA 5EWLB 3A0UA 3MMNA 4EVSA 1P6UA 1YS6A 4OG2A 3O1IC 4ETIA 1VKRA 1SRRA 3HM9A 4IMIB 4G86A 3HDVA 4N41A 1E6MA 4MRMB 4DN6A 4ETMA 1A0OA 2CHFA 3JPYA 4QYMA 2L19A 1ZH4A 3RVOA 1ZN2A 3L49A 4ZMSA 2E4WA 3JTEA 3NNSA 3F6CA 1LJUA 4S05A 4MQFB 1QP4A 4JOQA 5CNKA 1ZAYA 3RVLA 1UDRA 2BGGA 4RXMA 5D2CA 3EULA 5KQMA 4YLEA 1GCAA 3EODA 3O1JC 4MS4B 2VYCA 3BRQA 4F11A 2FMHA 3T8YA 1JX6A 1NXTA 4ML3A 5CNIA 2OENG 4NICA 5GOTA 5HKOA 2I6FA 4KREA 1Z25A 2VUHB 4PE5B 1DBQA 3O2QB 3TX6A 1XWWA 3LUFA 1JYEA 2R4QA 2R48A 5TQ0A 4N0QA 5ABPA 4PYRA 3KG2A 4JA2A 1LBIA 4LE2A 1AB6A 1NATA 3QLVC 3GBVA 3H5OA 4RY0A 1D2AA 1QO0D 4XXHA 4WUTA 3KSMA 3E3MA 4H3HB 1CHNA 4RKRA 7ABPA 1JDPA 3QEMA 2VK2A 3E61A 2M98A 1Z13A 1Z12A 1M5TA 4JB2A 1LK0A 2WMYA 3QELA 1W25A 1ZHHA 3HV2A 2FMFA 3QEMB 4NCBA 4TMYA 4H60A 2H3HA 1M2FA 3GYBA 4KPYA 4RK7A 3FMVA 1U04A 3DZDA 2FEWB 1GUBA 4ZMRA 1YTUA 1EWTA 2FLKA 3LUDA 2HQOA 4ZYLA 3H5LA 1D4ZA 3F73A 5CHYA 2R47A 2NZVG 1ZITA 2JB9A 2MYTA 2XDYA 1LBHA 3Q7RA 4N0PA 2JVKA 1YS7A 3LFTA 1ABEA 5EWLA 4OATA 3CU5A 1FQWA 1GLGA 4Z9AA 2FN9A 2PMCA 3I5AA 1H9CA 1JLKA 1JH9A 4RU1A 3CTPA 3T95A 2LP4Y 2WJWA 3GA5A 3HJFA 2AYXA 2QXYA 1FFWA 2HSGA 2ID9A 4F3TA 3GV0A 3IP5A 3LKVA 5TPWA 1YK0A 3QEKA 3HEBA 3G1WA 4KV7A 4YGXB 1JWLA 4YCSA 4QYWA 3OQMA 1LJLA 3MF4A 1Z16A 3CRNA 3FFTA 4RY8A 4Z4HA 2O20A 3A3KA 3D02A 5IULC 2ID7A 4RK6A 5B3JC 4RKQA 3TB6A 2RJOA 1JFSA 3H75A 5IUNC 2FQWA 1MVOA 2IYNA 3T38A 4G0OA 4GNRA 5KC9A 3O75A 3GRCA 1DZ3A 4HNRA 3O2JA 3URMA 2YHBA 5EWMA 2E4YA 4L4UA 2HPHA 2CD7A 2M1ZA 1QQBA 3OO1A 4RK4A 3SM9A 1DJMA 4FE4A 3P9YA 1RXEA 3OM1A 3W9SA 3CKMA 3GWGA 4NV3A 1M5UA 1NTRA 1DP4A 1Z26A 4RDCA 3LOPA 4MPTA 3UK0A 3RVNA 2IOYA 3KYJB 2E4UA 4Z4CA 3M9WA 2FLWA 3SY8A 4E7OA 1TMYA 3O1HB 2V0NA 2NUBA 2IPNA 3KCNA 1TLFA 4JAVC 4RV5A 5F64A 4N47A 3RVMA 3QX9A 5JS2A 5GQSA 4FB4A 2FKAA 1MIHA 5DCLA 1BDHA 5BQ3A 3QLUC 4F12A 3NHZA 3SNKA 1YMVA 3QLTA 4MR9B 4KFCA 1E2BA 2KYRA 5KC8A 5FWYB 2RDMA 2LBPA 4UHJA 4G0QA 5TQ2B 2WWVD 4EYOA 5C5CA 2FSPA 3OMWA 1BDJA 4LE0A 4CBVA 3CG0A 1RNLA 5DKFA 4IRXA 3A10A 2HJ9A 3H1GA 4HNQA 4JB0A 4ETNA 2WJAA 4YRZA 1C0EA 4LDZA 1VRVA 2L2QA 5BR1A 4ZJPA 3TD9A 2QR3A 8ABPA 2GKGA 2FEKA 2PUAA 1NXPA 4YR7A 4EY3A 2QSJA 3C3WA 2E4ZA 3HXMA 3OO0A 5TPZA 2PUGA 2NZUG 3CFYA 1IIBA 3UKJA 1EFAA 5C5EA 4MS1B 2A9QA 2LUOA 3VNAA 5DGCA 3OLYA 4YS6A 5I4CA 3Q7TA 2QVGA 2H0AA 1U2QA 4MS1A 5KWSA 4MGEA 4HYEA 4PEVA 1FSPA 3K9CA 3LUKA 4W5QA 4WWHA 2ZWMA 2FTKE 4O5AA 1U8TA 3IPAA 2VUIB 1I3CA 4W5OA 2FMIA 3GBPA 1OXBB 4G0PA 5JNRA 4LDAA 4Z4EA 3OQOA 1ZGGA 5HM6A 1URPA 3KLOA 4MR7B 5KI6A 4JP1A 1DC8A 1NY5A 1D5WA 3L6UA 4W5TA 4W5NA 2MSKA 9ABPA 3N0WA 2PAFA 4KVFA 4O1HA 3LUHA 1W9HA 1USGA 3LUCA 4LRQA 4XLTA 1ISRA 3H1EA 1NXOA 2GX6A 4RK1A 3OQNA 4MS4A 5T3YA 2PL1A 4LZLA 4GPAA 2IDMA 3FGZA 4PZ0A 3RVQA 1T34A 2FVYA 2QVCA 3O21A 4G0ZA 1ZDMA 4NCAA 1Z15A 5IBQA 1L5YA 3JPWA 3I09A 3OLZA 1OXKB 1PNTA 1SXGA 2F8SA 4IILA 5DTEA 4PICA 3EQ2A 3CLKA 1Z17A 4EYKA 5JNVA 3OLXA 3B2NA 2A9OA 1QP0A 2PUDA 4JASB 1A2OA 3M6MD 4MRMA 1MB3A 2AYZA 3MYYA 1D1QA 1BAPA 1USIA 3H5WA 3RQIA 4UHKA 1YIOA 4KMRA 2P4UA 4MQFA 2DRIA 4Z4IA 1C4WA 2Q5CA 2JRLA 3D8UA 3Q15C 5TPWB 3SG0A 5T7BA 2JCGA 2LPMA 3IP9A 3DBIA 4XAQA 1J56A 4OBBA 2JBAB 1PUXA 3I45A 3NNNA 4EUKA 2E4XA 2PL9A 4OLBA 4KZKA 2HQBA 4G0YA 3QK7A 2A9PA 1E6KA 3EQZA 3VNBA 1DCKA 1M2EA 1SXHA 4Q6WA 1RZRD 4MQEB 3HSYA 2NT4A 1K68A 5IC5A 2RJNA 2PLNA 5EWJA 1QMPA 1KRWA 2IPMA 3EAFA 1DC7A 4D6YA 2PUBA 2B1JA 1BVHA 2CHEA 4RWEA 5B3JA 5BRAA 1ABFA 5EWMB 5TPZD 1YK1A 3Q7SA 3N8IA 3RVSA 5IX8A 4KRFA 1CYEA 3CZ5A 1QQAA 1GUDA 3N0RA 4QPJC 3Q41A 3KYIB 4EVRA 5JNTA 3GT7A 5IEBA 4DADA 5JNWA 4O1IA 2MSWA 3H6HA 3ILYA 3KJXA 4M88A 3T6KA 3H1FA 3KTOA 1MB0A 4YP9A 1F51E 1AB5A 4MR9A 1WETA 1E6LA 2PE5A 3CHYA 2WB4A 1JF8A 1JBEA 2CWDA 1P6QA 4RS3A 5IEJA 2MYNA 3R0JA 4G0MA 2QV0A 3ROFA 4MLDA 4IMJB 3M9XA 1Z2EA 3OLVA 2FN8A 3KLNA 4HNSA 1JYFA 4WXEA 2E4VA 3BBLA 4L85A
chains in the Genus database with same CATH superfamily
3WGZA 2ZUBA 3GJ5A 1R00A 4IG9A 3VR5D 4OHCA 1FFDA 1OFTA 1R6UA 3N28A 1HH4A 1BFKA 1KOJA 1M6EX 3O4HA 4KK4A 3MA0A 4TPKA 4W8HA 4MAAA 4UFOA 2QP3A 4N4AA 3ZUGA 4X60A 3BGIA 1I4LD 3DEKA 4PG4A 2C8VA 1HZZA 4K6CA 3GY0A 4YDHB 3ILHA 1RXUA 5C3UA 4ASUD 3QU9A 4EVQA 4X94A 1Z8NA 2HCTA 3TTWA 5JFGA 4FQ8A 3TZHA 1NDUA 3KEQA 1FP4A 3SKYA 4QNNA 2A0XA 5ELLA 4XDZA 5HHTA 2C82A 2ZYTX 4MI9A 1AH2A 4AKHA 3NAMA 2CJXA 2EG5A 3ZCVA 3FROA 3GJ6A 5H3HA 5SZIA 4EQ6A 4EVIA 1UOQA 4XUEA 4P0PB 1I3MA 3HJUA 3KHSA 4FE7A 5AUNB 3FYSA 2YMLA 1JKXA 1G6KA 3GFTA 4G0XA 2LTAA 1SRQA 4S2EA 4ACBA 5HKKA 3HBJA 4CV3A 1Y8QB 3TDNA 4ZAZA 5AXDA 5F9FA 1AD2A 3GU3A 3O8OA 4URVR 1J7JA 4BY9E 1P75A 5K4HA 2HK7A 3KC2A 6NULA 1W9MA 3OA0A 4JNCA 4B83A 2Q1UA 3LVBA 5CGQB 2EEPA 2ZU0C 2O2HA 2FU5C 1YJXA 2D5IA 3G6WA 3UB3A 3W5BA 3FBTA 1O9BA 3P0IA 4MDYA 3U4AA 3UYLA 2IGTA 3S99A 3STXA 3N3BC 3ACBA 1EWKA 5C53B 3S4YA 4B2YA 5TEVA 3ZQUA 3K2EA 2FXIA 5AJTA 3UPUA 4BYMA 1H9AA 2CLHB 5AJUA 3TJZA 5A2GA 8ATCA 3QF4A 3IKVA 2ZYGA 3QZUA 3KQTA 3RU9A 3THWA 1N1EA 4XZ3A 5LMCA 1DKRA 4B9AA 2NVUA 2Q2QA 2ZWOA 4L6IA 3O8RA 5IUJC 2ILVA 3JASA 1JHZA 3DTNA 4P4UA 1H2WA 5DN6A 2M9MA 1PK9A 3ZCXA 3TLBA 3K9QO 1IDOA 2IL1A 1B6SA 1NE7A 2CZGA 2QX6A 3DBHB 3EBLA 1MCZA 2P9QA 4LRXA 5AKLA 4ZYTA 2DMRA 5FBLB 4HB4A 1FFYA 3KR1A 1ECLA 4QDZA 2WQ7A 4R0VA 1CZRA 4ZD6A 3ERCA 4HWOA 4OFWA 5CLIA 3TLZA 2PUVA 3PJFA 1BHSA 1BDIA 3ANXA 4FGUA 4E1VA 4J0DA 4TKVA 3AHGA 3TNDA 4URZR 2AOUA 3RDPA 4XRRA 4U0JA 1IN6A 7AT1A 1HLGA 3DP7A 5A7GA 3RC9A 1NVAA 3LDFA 4ZN6A 3I12A 1I6MA 1Z3CA 1PNQA 1BU8A 5KYKA 2VCYA 3K70C 1T24A 4A15A 5DX0A 3GGSA 1DC5A 1TVKA 4NVRA 1H94A 1Y1LA 3ZX5A 3OJLA 1FSFA 4C0SA 2I9KA 1E60A 4LZNA 4X1YB 2AXPA 3U40A 4QDXA 3PV0A 1M1UA 5FAXA 2A5JA 2EKLA 2YMQA 1U2PA 2YW2A 5THXA 3G8AA 2Q49A 3RJMA 4B87A 1G59A 1QHHB 1JDZA 5F2KA 3C85A 2QM0A 3BEDA 1P39A 4BNZA 1TLLA 2IVFA 4WQMA 4LYHA 2W42A 3L7CA 1E1QD 3W6NA 2HH9A 2OHFA 4IY1A 1XD2A 3EFEA 4K9QA 5FA5A 3ZBPA 5C80A 2FZEA 4TMZA 1ISSA 3OTOB 1LH0A 1MLDA 2Q5FA 1L8OA 2C5GA 4K2AA 3N2GA 3RB8A 2QUHA 5E1MA 3TKAA 3UAYA 1EFVA 5HTOA 1XTVA 2BT4A 1ESCA 1H8EA 5TF4A 4EFMA 1A2QA 1DQYA 4QGBA 4N39A 5IBCA 4MYHA 3BRWA 3NAZA 2JBAA 2AOTB 3WJ7A 3WFIA 1LTKA 5FOSA 4M1TA 5FDFA 4QIHA 1JAHA 4YJ2A 1SU7A 1KEEA 3QKRA 3TPFA 3D3KA 5JLAA 2JHAA 3H18A 4V2IA 3KAJA 4MS3B 5EPOA 3T4UA 1JALA 4DCVA 2WWFA 4AC9A 5J4KA 5AI4A 4JBLA 3D7LA 1MD9A 4U7TB 4AWAA 2GLTA 3ZH2A 2OXTA 1EUZA 2ARKA 4JYAB 2GH1A 1NVEA 3U9SA 2KPOA 1SVLA 4E51A 1HEYA 1FFGA 1WUHS 4NHOA 1XZFA 4JJAA 4HEQA 5AJYA 3CRVA 1K6MA 2B1GA 2QWXA 1E4EA 3LC7O 3L4EA 3MOSA 3MS2A 4FZJA 3UMJA 2Q6IA 3GYGA 1E66A 4MRVA 2F2TA 5E38A 2WD7B 4MUJA 1DDOA 4UU1A 3S2IA 4DBLE 1GZSA 2YXPX 4F6CA 3MJDA 1M6VB 3BMQB 2P62A 2BI8A 2WIAA 4KV9A 3TH5A 3ZH9B 2X5OA 4GBED 4RH1A 4ETIA 1VKRA 1NBMD 4GQAA 1SXJC 2J4DA 3G2QA 1DUVG 4I50A 3V80A 1VYTA 3QEBZ 3HI4A 2GKSA 2JCSA 5HE9A 1AG9A 2ZE5A 5CEEA 3ICEA 1XLTA 4LOKA 1HTTA 4MKZA 3VR4D 3PCRB 4ZV7A 1WTCA 2NO0A 3F8TA 4FOTA 4TVBA 1SVIA 2C7GA 1C3EA 1IJKA 1BGXT 1QK5A 2HNKA 3GZNB 4JJGA 4V0KA 2J4CA 2QRZA 3WAKA 4IHJA 3W78A 3ESRA 1C2YA 2CDRA 2V59A 3F9RA 3KP1A 4RMHA 4D46A 4RXMA 4W5HA 1ZA1A 3FSGA 4PPQA 2WSMA 4LC9A 5C8XA 4B17A 1H2YA 3EODA 4HQRA 2F6RA 4B6QA 4Y2HA 2FMHA 2AKAB 2I6TA 2GTHA 3D7KA 4H7DA 4CUZA 4NYIQ 4C29A 4OK3A 2IFTA 4GR5A 1VLJA 5EMJA 2XAAA 4HAOA 1OXSC 1UKAA 3UYKA 1VMEA 2Q7XA 5EIWA 9GPBA 5J3JA 2R48A 5TQ0A 4N0QA 3EZNA 4GDFA 1AUQA 3BAZA 1A8SA 3E82A 5A4AA 2IUSA 4L2IB 4LTMA 4BX0A 3R77A 1B41A 4Y3UA 2PSHA 4IBOA 3KQSA 5IZCA 1E1KA 1R9JA 2ZPUA 2IYYA 3HR8A 1O4WA 4BE9A 1O6ZA 3K8ZA 5C1BA 1I3KA 2PK3A 1JDPA 5DM0A 5I9TA 2PGIA 2R8YA 4LDPA 3RC2A 4YCMA 3QKRB 2PANA 1XWFA 4ZU1X 1B0UA 3IVRA 1W25A 1TCCA 1ZHHA 4MWGA 1ODIA 2LDXA 4Q1FA 1JU9A 3GX1A 3T1YB 4TMYA 1F8GA 3FCCA 4YCJA 4MUNA 4PPYA 3K8YA 1U04A 2D4AA 3KXIA 3GQBA 2OY0A 1YB1A 2QP4A 3KLMX 3UJDA 2WJGA 1ADJA 5MGBA 2O59A 2CLFB 2WA2A 3U1BA 3K0AA 5JRDS 1UZMA 2CXNA 2ECPA 1T8RA 1YKFA 3JQCA 1HO3A 4G1MB 5G2OA 1M6VA 3BMQA 4C0WA 1AKTA 1EM6A 1QHHA 3WO0A 3NRJA 1X42A 5K3FB 4WACA 3PWKA 3W0LB 1R0WA 3R23A 1JHMA 3DC2A 2X0FA 1HWYA 1XQXA 3R6TA 3AJ8A 3HJGA 4NCXA 3KJGA 2ZBUA 2DWOA 4EECA 1TEZA 2HMAA 4H7KA 2ID9A 1GDHA 2A9FA 2VAXA 2VZ8A 3MXTA 4GXRA 1KDRA 3NM4A 1Z8DA 1RHRA 2DH5A 2RHOA 3LPAA 4UEKA 3UJ7A 2EIXA 4CPDA 5L3QA 4L22A 5FPHA 3AEZA 4QC2A 4RM3A 4WJKB 3UW3A 4CM6A 4GMGA 4Q7MB 2V3WA 1KFCB 1WF3A 2WW8A 1I6KA 4NFSA 5B1IA 1FK8A 1LPNA 5A5FA 1UM9A 1GHTA 1TMGE 3THRA 4ZCRA 4P5EA 4ND8B 4L4YA 2F1KA 1M5RA 2JJ8A 4PINA 2DGDA 1DZ3A 3O2JA 4DJDC 3D4OA 5LVAA 2VK1A 2YHBA 1P7WA 2Y1DA 4LY3A 1RKUA 3ZLBA 4CW7A 3VOBA 2Q62A 5MFZA 1R1DA 1JLHA 3PJEA 4NULA 3RRBA 3AW8A 3VR2D 3F4LA 4K86A 1X2BA 1NUUA 3E84A 3FJ1A 5EVCA 2B2CA 1MX9A 2VATA 1U9JA 4ZJZA 2A14A 4DZZA 3D6JA 4RVHA 2Z6QA 4AROA 4DXAA 4M83A 4HL6A 1THZA 2VNIA 1SCDA 3E4DA 2GK4A 4KVGA 1G1MA 1HQDA 5AVKA 4RDCA 3STHA 3UAZA 3LCCA 3WLAA 4D92A 2KW5A 3DE3X 3D43A 1PP4A 3KEFA 5EHNA 4GL4A 4UHCA 3PEWA 2IXAA 1QVAA 1SXQA 2RGNA 3DE5X 2LZ0A 2CXQA 5AK6A 4EYEA 2C31A 3IEMA 2QTBA 3CSUA 5EXSA 5HGJA 3QTTA 3ZKAA 4DDHA 1TRKA 3MGKA 5KU7A 5K4AA 3S81A 1TDJA 3CF4A 1RFGE 1QWSA 1Y1TA 4K40A 4M1WA 3EDMA 2WJ3A 4RH0A 1ULUA 4RPCA 3WQSB 1ZKMA 2TMDA 1T0UA 3EXIA 4RZHA 4Y2TA 2PMEA 5CAEA 2WWVD 2POCA 1JUDA 5A7HA 3L7JA 1GUYA 1XG5A 4CBVA 3IFSA 3FDZA 3WNDA 2JJ2A 2QN6A 1X7GA 2IY7A 3AHHA 3CUUA 1EXDA 3CXUA 1JHVA 1CUZA 3Q88A 5F9HA 2BEVB 2QMUA 2HPAA 3E18A 2JI6A 2H2GA 2NZYA 2PS1A 4IDBA 5TQVA 2COKA 4C7BA 4D96A 5AVVA 3GPLA 3B6ZA 1SCUA 1YB7A 5HKBA 5IVKA 2QLFA 4EHNA 1JIIA 2OZVA 2P1DA 1PJQA 1UBNA 1H9BA 2KLHA 3SZ3A 3MLBA 1YVPA 3LIPA 2LUOA 3OF3A 4EW1A 2HC9A 1RVV1 1WKVA 5JSZA 3E0QA 3VSCA 4E46A 2XUKA 3OP1A 3L05A 5KTTA 1ISFA 2ZJBA 4QSHA 4TM8A 1T9BA 4PEVA 2ZSHA 2O4UX 2BGMA 4P5PA 3CBGA 1IY8A 3DFIA 3MPOA 4Z86A 5AP9A 4W9MC 3A27A 1KF0A 1O95C 1QGUB 2ZJZA 3HCRA 3L6CA 3ZN2A 4ZYZA 721PA 2WIDA 3O2NA 1PL8A 2OBNA 1CQIA 3ISJA 3GJ4A 1HY3A 4NFLA 3KV3O 4FHEA 1Y3DE 1CZNA 4EGAA 1M2VA 3DFFA 4BB0A 4KPUA 4KIWA 4MMXB 4JU8A 1BMDA 2P0EA 1RAIA 1OOEA 4NDNE 5CIWA 2ANCA 4MV6A 3GRUA 5JYCA 3I9JA 4LRQA 4YJGA 4EB8A 3OY2A 1RQXA 3UIEA 4UCWA 1XMQB 3IV9A 2C7QA 1Y33E 5E7IA 3GMDA 1PR9A 2FP4B 2IDMA 3LNTA 2CLKB 1OLUA 4H27A 2H17A 4YALA 2Y3IA 1PCXA 1VHWA 1LPSA 4MJ7A 1MABA 3UKOA 4A1OA 2NO1A 5LJIA 3GNTA 5DW3A 4E09A 1C9DB 1FZQA 3IUJA 4G09A 4IILA 1JXOA 1Z8HA 5ETJA 3DEAA 5DTEA 2Y0DA 3SWWA 3THXA 1PHPA 4RBNA 4EQ6B 3ZJTA 2D5CA 4LZPA 3HBFA 3ZI0A 4FDMA 1RJWA 1SUEA 1KQOA 1B6RA 4LRSB 4JYBA 3ZHUA 4KG7A 3THYA 4KXXA 3TRIA 4I1RA 5BMOA 3N6RA 5BUZA 4L8WB 1VHQA 4FGSA 1NFQA 1W0JA 2C4UA 3KAKA 2VT3A 3GLIE 2VDWA 4XJXA 4OH7A 4BMZA 5L45A 2CMFA 1GZ7A 1MOSA 3NHYA 2VJMA 3WLLA 3IUSA 3JQBC 3A6ZA 4HVCA 1OWLA 2VXCA 3REOA 1ULBA 4DREA 2HLDA 3MWGA 2PR2A 4G5FA 4CMIB 4HZGA 3O3OB 1QOQB 3QW2A 3D59A 1YZNA 4PSVA 4G9GA 4QUIA 5B1HA 4B7UA 2C42A 5C4MA 4AN4A 2I2DA 4O4IA 4GM4A 4KRXA 3M6WA 1SOWA 4MRNA 3RBVA 2PLNA 1YQGA 2FPGB 3K09A 3M4NA 4H7JA 3WRVA 4EJMA 4FSHA 4IDGA 2YJ4A 3U3RA 1CR4A 2JW5A 1VYVA 2OORA 4KP7A 4C08A 4LAFA 5DRYA 3K6KA 3I6IA 1T10A 1RTKA 2AFHE 3H6HA 4BMPB 1FJHA 2WP8J 4JJFA 2NV2B 4JI0B 1C9MA 5JDCC 4X6UA 1QO9A 4K03A 2HFKA 4EHIA 4F5DA 2BFOA 3LL4A 1NP7A 1RWNA 2D2VA 4EHAA 3GLVA 1XIVA 4HNHA 2CLLB 4RJ2A 5IEJA 4J0KA 1AUPA 1Y4DE 1DXOA 2JFZA 2I4MA 4AJNA 4IMPA 1SNYA 1KERA 5AMXA 3WDLA 1N2OA 5DTMA 3HVJA 5ALKA 1P0PA 3A4LA 1HYQA 3T52A 4ENPA 3O2SB 4ZIRB 5TVKA 3F47A 2CXTA 2DUJA 4M9QA 5IASA 4PLTA 2MTBA 4KNWA 4ZOCA 5ENDA 4FINA 1NPDA 1XTTA 2PZKA 1RXIA 1GITA 2A9RA 3G79A 2R2AA 3PQ4A 3USZA 5K3FA 3WB1A 2G25A 1L7RA 2P2NA 1OYWA 1JSRA 4ZKDA 2H16A 2VIIA 4R2JA 4JGGA 3RTGA 3B53X 1UBFA 3NVKI 1UXGA 3C3MA 2O4CA 3K9HA 1PHRA 1DAFA 2M32A 3CLSD 3IOBA 1JHRA 3F97A 3PXBA 3QE0A 5B2ZA 3RFTA 1BQ4A 1O3YA 5KYUA 4RMJA 2QEQA 1IBRA 3TNJA 4EENA 3CUVA 3FHCB 5M34A 2ZT7A 1XCLA 3F96A 3ZGLA 4FDVA 4NH0A 2YWEA 5E3JA 4EYGA 4YMUA 5C32A 2NM0A 1S2NA 4F8EA 2VJKA 1GPUA 1X94A 4DARA 4DQUA 2O8BB 1KYVA 1PFGA 2GTPA 2EDCA 1H66A 1NFFA 2I7CA 5GPBA 3N2GB 4ALJA 2R7AA 2CMHA 3GROA 4R8RA 4QATA 4YAFA 3VGPA 3NFYA 1ZW6A 5CW1A 4FTWA 2ZRJA 1XWIA 3PUYA 4C0KA 1W19A 2P75A 3FIJA 2QK4A 3IS3A 4Z51A 4MEAA 4TQ9A 4H35A 2WB2A 3AC0A 3DTVA 4BXOB 4MUXA 4ZI5A 1S1CA 4XM0A 1JEYB 3N0TA 4BLUA 2BMFA 3LQKA 4BIMA 3W5CA 5ISMA 2HQRA 4UE2A 4BO6A 1TT5B 3QPDA 3KXPA 2NPIA 2R1ZA 3PXCX 1P72A 4KDCA 3G0HA 1PWHA 5BSGA 3R6GA 1RU3A 3NBFA 5JJLA 5K8LA 1O0SA 1UF9A 3QF7A 1QV6A 2GFHA 2L18A 1T6XA 2WPNA 1NXXA 2ECFA 3GFRA 1RD4A 4EUSA 4I6JA 4DL9A 4HNTA 2VDOB 2W2LA 2C4KA 4PC1A 5EKUA 3RYIA 3CKYA 4A6DA 5C8YF 3GDHA 4G4JA 4FDTA 3RIMA 1E7RA 1MJGM 1QQ7A 4AIRA 5I9IA 5D00A 2RBKA 3T9EA 1DX9A 2XQFA 2CVPA 1DEXA 1QVVA 2C5BA 3LVFO 1VJGA 2CLEB 1M8JA 1PX2A 1XEWX 3IDOA 4JC5A 3U49A 3AILA 1DBRA 2W2LD 5L3RA 4E2XA 1A27A 4J07A 5BVGB 4C05A 1PEAA 1V9CA 4POAA 3ZDYB 4M8IA 5CLFA 1YBHA 3BFPA 5C3MA 5EI5A 1ODFA 4IDOA 2CHUA 3QVKA 4I3GA 1RQ7A 1YC2A 2DM6A 1FP6A 1F9EA 1TVMA 1PV1A 2F3UA 2KJQA 2QD5A 2VXOA 2XGGA 3UCXA 3VYRB 4F3KA 4CG0A 2CUTA 3NJ4A 2B0JA 3UAWA 4QOIA 3NIGB 2FW0A 1QGED 2W2KA 4KYUA 5KQPA 2B8JA 2BSQA 3ANTA 3GVXA 2FW9A 3D2CA 3HS3A 4WCFB 4D74A 3HWX1 1X7ZB 3ND8A 4UM9B 3TSCA 2QNIA 4XR4A 1C7FA 1H2RS 1Y7LA 5IAJA 1R9GA 4DHEA 3C41J 1EGAA 3OCYA 2Y1KA 3FWYA 4KUHA 1KI8A 2XYVA 3MT8A 4X71A 3WTCA 4OBXA 1AMOA 4FYIA 1WCWA 3BGOS 1Q3TA 5DYIA 1EHCA 5HZMA 1JQAA 3OPXA 3CNEA 1CY8A 2WNSA 3DCNA 2ROQA 1XA0A 1VBFA 4BNXA 3N2NA 4QJ4A 4FFLA 3OQ6A 3R3SA 4ZAYA 1KZHA 5DYWA 3TCXB 1KQNA 3A4IA 2GI4A 3C7CB 1YR8A 4OHRA 2QJTA 2DPYA 3MZ0A 4P4SB 3CWZA 4MWCA 3ZDQA 3RRJA 4D25A 1PZXA 3T7AA 3W8FA 1I4DD 2DFVA 4B7CA 5AFSA 3FY4A 3M7IA 2XDWA 2AZTA 4YUXA 5IVHA 3GFOA 2CUNA 1N9ZA 1L5ZA 2AHOA 1T1IA 2ZRBA 1V3VA 3KOXA 4TVOA 1D1PA 2QG4A 1U9ZA 2CMKA 2E5LB 4RSRA 3PYMA 3TVTA 1XHEA 2WTXA 3HK2A 4FXPA 2RHCA 3QX8A 4UARA 4QU8A 4OK5A 2DCUA 3S5UA 4E21A 5K0ZA 4PQFA 5A0TA 3WWOA 4H4CA 3FFBA 4LE1A 3RVKA 5AOAA 4F4DA 4PVDA 4V0QA 1EP2B 1R8JA 3PXGA 1WE2A 1QPZA 1I9GA 4B3SB 5H81A 4BX2A 5BRJA 1BFDA 1RPTA 3WKAA 2QZJA 3AJEA 4UREA 3ZWPA 1T4GA 2LWIA 3L0YA 1KRWA 2MJLA 3DW1X 3TZ6A 3PDIB 4LOIA 4GZ5A 1O94A 3OEEA 4RXUA 2PDAA 4WUTA 5JZSA 1J07A 1DC3A 4BV2A 4JI8B 2JZOA 3EPRA 3E1KA 4FOOA 4YJDA 1FS4A 1XROA 1F2TB 2XYQA 3A4NA 5H3CA 2J0QA 2NZ2A 3GAZA 2QRQA 1MAVA 4HAXA 3K9NA 4UM8B 1UAYA 1WNFA 1U8ZA 3R4VA 1QHFA 4JELA 4WOBA 3RS5A 3QKUA 3ZVMA 2HDNB 2ZZMA 1WZEA 3S7ZA 3G8DA 2OCIA 3PGJA 3DULA 6CHYA 1E6EA 1GPJA 2IXBA 4TN1A 2WKWA 5JCXA 1F12A 1FTYA 1W88A 4JCCA 2P9EA 2NW6A 4IFBA 3TL2A 1H23A 3KQMA 1QIGA 3ESXA 1GRRA 1CWUA 4ASUA 3QMPA 3W5HA 3EZ2A 5K8IA 3E3NA 2NUTB 3RNLA 2L19A 2O50A 1NZJA 5B53A 2QAIA 2W37A 4DZRA 5K99A 4C7XA 3PRHA 4I1UA 3DCIA 4N5NA 4LJSA 2WP0A 1OWNA 4MW4A 4H7EA 4PGGA 3VO1A 1UDRA 2QDXA 3M3DA 2HB6A 1A8QA 1VMDA 2ZE7A 5D2CA 3W04A 4BZQA 3EULA 1UZAA 4ADSG 1WVMA 1XAIA 4E5SA 2JKZA 2RB4A 3A6PC 4FEYA 4FT2A 5CNIA 3L1JA 4IGKA 1UEJA 2O2CA 4DF3A 5GAJA 1GFZA 2D7CA 4KREA 4I8XA 3EYWA 4PE5B 4CT0A 5I9LA 1NVTA 1VKJA 1X1QA 1R0SA 1RWXA 2CF5A 3RC8A 4YP5A 2P4HX 3Q9NA 4UNQA 2JJ1D 5JEDA 1XGKA 3O84A 1U2TA 1P0CA 1CFZA 1ECGA 5JY6A 2COEA 2DBZA 2QMYA 4GQBA 2ZJYA 4JLWA 1ISHA 5B30A 4JENA 3L7NA 2JRCA 2R65A 4YR9A 2A35A 3ABSB 2V65A 3ET4A 2HCFA 4Q1VA 4RENA 2XMQA 3IO3A 4LBYA 5CH8A 4F2DA 2F3PA 2Y1EA 3VV3A 3TRDA 5F3RA 4DLRA 4B6SA 3G68A 3G2MA 4BO9A 4ZCMA 5CPBA 5F77A 2FR8C 5M5BA 3EQ9A 4L02A 1Z4MA 4DAEA 4JZKA 5JCZA 3GYBA 1QB7A 4KPYA 3IO5A 1UK9A 1N1MA 1X15A 2GBLC 1WCYA 2RH4A 3AJ9A 3M6LA 3WLSA 2R751 3SSNA 2GZ3A 4ID3A 2FZ4A 2ZI6A 4FGJA 3PE4A 4ZC1A 3EH1A 2GEKA 4FDLA 3ABIA 1KTVA 2WG1A 3I9MA 3KQOA 3NOOA 1A7KA 5FD8A 2GPTA 3TEMA 1ABEA 1LTHR 4II2A 1EH5A 1ACJA 3LLVA 3AJDA 3EG9B 3GA5A 2WJWA 3GIWA 3B7WA 4JWKA 2EWWA 4B47A 2YIVX 3B3JA 3CR8A 4D8YA 1N5DA 5EP4A 2HGZA 1NF9A 3GJ7A 4BO3A 3KU1A 4K26A 4YCDA 1E9BA 3VZDA 1LLUA 4G41A 4MQMA 3OJCA 1JHXA 4KOAA 5LQNA 1HZJA 3IHTA 3N8DA 4D4HA 3K9WA 4KQKA 3OQMA 1L4FA 1ECBA 1FNNA 4BWFB 3BE6A 3VPBA 4L6AA 4C4XA 2Q6OA 1NN0A 3FFTA 2RIPA 5G0UA 5KTOA 1S7CA 2ERYA 4X00A 2I2CA 1WZIA 4EITA 1ML3A 4CE6A 3EWSA 5AW2A 4DYHA 1FX0B 1OKKD 2FQWA 4B85A 3V4RA 4EHBA 4Q9AA 1SKYE 3V8PA 1NC1A 3ZLTA 3RAPR 4DEXA 3WBFA 2XOXA 4DMKA 2Y0BA 2DPXA 3KOWA 5CB8A 4LY6A 1OIWA 1CJSA 3R5KA 3GVCA 2PVSA 5D3QA 1ZIDA 1WAMA 1X19A 2NZXA 3JZDA 3CEHA 4PLGA 4FI3C 4YYZA 3QU7A 3LHIA 4OGGA 1UJNA 3UO8B 3VAAA 5I8PA 1GUFA 2P9FA 3GLKA 2I03A 3TDKA 1SBIA 2QT9A 4LSGA 1G41A 2CMGA 3UWOA 2NTJA 1ST3A 4BQOA 1E7MA 4ZU6X 4NECA 3FYTA 2D54A 2Z4RA 3QE9Y 3VR4A 2P69A 5ED0A 4OL9A 1CEQA 1PDOA 1MEJA 3VR6D 3DDCA 2MDTA 3FYHA 2EF1A 5B58C 3NEYA 1U0BB 3IIJA 3PJGA 3ZVNA 3EMBA 1E0JA 3HP1A 3KYDA 3NB0A 2AQKA 2UYCA 1D4OA 1HLDA 3UH1A 5ADWA 1H4TA 1ZNQO 4D57A 1E2BA 3CRMA 4DCSA 1CS0B 4TV9F 2H08A 5DPMA 2DB3A 4DSOA 4MUKA 2OV8A 4N5MA 3VC7A 1KORA 4X1OA 5EN4A 1IJEA 1JJ7A 1U7PA 2JAQA 4TMFA 3C1TA 1RNLA 5LQDA 1TJ4A 1X1DA 3A3PA 1CKEA 3L8GA 4DHWA 1Q7CA 1RC0A 2IA5A 3UHOA 2BHTA 4FHZA 5AW0A 1E1RD 5DK6A 4HH3C 1JPJA 4ZJPA 3AQIA 1R16A 2H4HA 4RIHA 2QRPA 4ENSA 1SB8A 3LX5A 1W47A 4AECA 1C80A 2YV1A 3W6ZA 5FTKA 4U9UA 1IIBA 3ME5A 2ABWA 4OJTA 2EKDA 4L0QA 3VNAA 4MI1A 3TE7A 4EI2A 3T7EA 1X1AA 4JOCA 1V1MA 2XZPA 3CH6A 3OFND 3GUUA 2BUCA 3F2IA 5JR3A 1OXUA 3LE8A 4B5LA 4DA9A 2C84A 4BLTA 3BS4A 3KEGA 4YJFA 2BTOA 2PH5A 2PZGA 5EKTA 3JWIA 1ZP6A 2CXSA 2G5CA 3C74A 2PGJA 3PFGA 4O5AA 1NW8A 3DF9A 1JQJC 3EGEA 2ATCA 5ILQA 1W35A 3EEOA 3IE0A 4LVOA 2W90A 1I7NA 3CZ9A 3UJHA 3PR2B 1TVEA 3ZQJA 4DLBA 4PM4A 2VJCA 1GFIA 1W2GA 4L9WA 4O4HF 4W5WA 3FNRA 2Y68A 2FZVA 4IOKA 4E13A 5JYDA 3CW2A 2FB9A 5HF6A 1A9TA 4BAUA 4LJKA 4XD2A 3NVMB 3AKEA 3IB6A 4F5ZA 1XE3A 5CA1F 3IXQA 2QI9C 1ISPA 5IH3A 1CQPA 4GOOD 3GLFB 1V8BA 4H59A 1BH6A 2X8BA 1FNCA 1WZCA 5AKYA 5B55A 1WLYA 3MB8A 1R0BA 3OQNA 3B82A 5T3YA 1ES9A 2PL1A 1I3OA 4QUHA 4P54A 5DGHA 3EF1A 2ISSD 3KPWA 2QX8A 2O3QA 3FKSD 5BNFA 1T9GS 3STWA 3UICA 1BCSA 1UWCA 3GJTA 1H5UA 1RE0A 2VDQB 3PUHA 1UAGA 3Q5GA 4NBKA 3REFA 3R0QA 1EI9A 4NMMA 3M83A 2XQVA 1PQWA 2VJLA 3B2NA 2BJHA 4YRFA 2I91A 2G0NA 3KJQA 1V8ZA 4Q5IA 3AKZA 5C18A 1FCJA 2WWXA 5LXTA 4B6OA 1T29A 4PYKA 4C3OB 4DBZA 4JL6A 1J2EA 1DELA 4ZYWA 1JG6A 4JJKA 4N8SA 1DIRA 2Z2IA 4WFQA 2E21A 2XKJE 3LXUX 4WKGA 2F9FA 4AX4A 2DRIA 4F5EA 4LFBB 3L43A 1WW8A 1D3AA 3OOWA 2XCUA 1BQEA 1R0RE 3KLBA 1Z37A 2PGDA 3QM1A 1JHQA 1ZCFA 4MV7A 2IF2A 4PZYA 4PIPA 5IJZA 5K6AA 3AU9A 1NUPA 3JU3A 4U3JA 2OYSA 1K06A 1RAAA 3RSQA 2HQSA 2YMMA 3FB1A 4KSCA 5KS2A 3LCRA 4HGRA 1A82A 2NT4A 4WOPA 3K9BA 1QAMA 2PM8A 4MCAA 3YASA 3MQ2A 1W94A 5CIYA 1GKIA 4ES6A 1CRQA 2XNHA 1SXJB 4W9NC 2ONKA 1U4OA 5TT0A 1QRTA 2A9KA 4RWEA 5B3JA 3MT0A 4I2NA 5JWRA 1N5IA 2PZ8A 2WWTA 4R7GA 1NUAA 4MYDA 1F2UB 3KSBC 2W2MA 4MGYR 1HFWA 1Z4JA 3JSXA 3UJ3X 4XWKA 2JH9A 4PWYA 4QASA 4EVRA 4BLPA 3GT7A 4YMWA 3VDRA 2XUQA 2MSWA 2QUAA 2XADA 1GLVA 3NX4A 4HXYA 4RLSA 4AXXA 2OE2A 3ZEIA 5AT1A 2ZIAA 3B9BA 3BWCA 1F51E 3I6ZA 4L74A 4YP9A 5GJBA 1NBOA 2FG6C 3WYNA 3IT2A 1SB9A 4G2NA 3RTAA 1I5EA 3KKQA 4O59O 2IC5A 1JF8A 3PQEA 1RHQA 2GWHA 1QHNA 2W6JA 4ANFA 2D00A 3LQFA 4GPD1 4WN9A 3ZK7A 2H2IA 4RORA 3SNHA 1BEZA 1JXQA 3GVHA 5CVCA 1Y4SA 3PGA1 3S68A 2RH5A 4BGIA 2JASA 1TD9A 4CIXA 5ARBA 5F7OA 1TKCA 5LDGA 1E9CA 2CFTA 4WFKA 4Y6OA 3RYFA 1CQJB 3SJUA 1HLPA 3TFOA 3L8EA 2OV1A 2XLCA 3NYWA 3EGWA 1SH7A 4BQRA 2GAAA 3GPCA 2QGZA 3RYFB 3CVWA 4ND6A 3K6SB 1FEZA 4K0KB 3KTAA 4XIJA 1IZYA 1I3LA 1BC5A 4B4OA 5H4HA 4ZCLA 3DWEX 5FYQA 3E9DA 1XALA 1UH5A 4EKYA 4JSRA 3FDIA 1Y7PA 1ANKA 2Y0CA 1SHLA 3DLCA 2JFPA 1JG4A 3G0IA 3KKNA 4XD7D 5DHSA 3O8CA 3AUYA 4NJMA 4UPDA 4R0NA 5KJEA 2ZTMA 4NEHB 1AQJA 1RXWA 4MYRA 2APJA 1Q1EA 1IPHA 2V45A 3F3MA 3O9ZA 4HH4A 5KVVA 2H65A 5LU9A 1SKAA 1V11A 3CGWA 4WD3A 3VNSA 1TZJA 4ZHSA 2CJWB 5LIRA 2GZDA 2R1TA 4UNSA 4CQLA 3DLTA 2FZLA 3NWOA 3QWBA 4XM2A 1VIMA 1FFCA 4ARSA 4V0MA 5JBQA 2BBSA 1CUJA 1ZOPA 4K87A 2X77A 2NU8A 3TG8A 4TX1A 1MPXA 5C8DA 1SC9A 1ZL2A 1VLLA 1VJ0A 1U8CB 2PKXA 2XYRA 2NUAB 4COOA 2WILA 4OAPA 5AKXA 1YULA 4QUBA 2JC3A 4QG3A 3FCXA 3I0NA 1EYZA 4BKUA 1EK0A 3CBQA 1O6GA 2EC5A 3CR7A 1MDFA 2H51A 5DBGA 2HCBA 4BNDA 4CMAA 3C45A 3G9TA 4MB2A 4JP8A 1NRXA 5ERYA 2V58A 3G9QA 1I7DA 1DC4A 4LN1A 1N2JA 4O2BF 5G1NA 1E3IA 1PFKA 3THOA 4D9GA 3C4JA 4A6EA 1XRMA 2JLVA 4P4GA 5FTNA 2HYDA 2J45A 1DAIA 2Q3BA 3MEQA 3E8MA 1QZZA 1G66A 2ZU6A 2ZUCA 2VPWA 5T4EA 3RO7A 3EOBI 1ZN8A 3UOWA 3P71T 1LB1B 3IQFA 4L3WA 3L82B 4ZO7A 1NBEA 1KPGA 3OTGA 1JQLB 4F46A 1LXCA 5CCXA 4OX9B 2JJMA 3IULA 4PC6A 5JAQA 2CN1A 3G88A 4DXDA 2G1JA 4MAMA 4DR4B 1P2SA 3VPDA 4RA6B 4ENQA 1JXAA 4KLZA 1HDGO 1L1QA 3D31A 2Q6LA 1M2KA 2FQYA 2Q41A 3T9AA 2AJDA 1TJ5A 3ZCRA 1E9VA 4GEGA 2JLWA 3OTWA 5DTJA 2F3QA 3UHJA 2OAGA 3VJLA 1ACMA 5H9VA 1EUYA 3U4MA 1B42A 2WAYA 1BMFD 3EEIA 3OLWA 4MLCA 3RSSA 4CEJB 4V3BA 2QXTA 5A6SB 3H4MA 1XZQA 4LOHA 1PZEA 3JZIA 3D8RA 3GQBB 4R3WA 3D1VA 1NONA 3NT5A 1M33A 1M7HA 4E6EA 2N47A 1V25A 2VDNB 1SY7A 1WUTA 1D0SA 4KOEC 1EVYA 4HADA 1EP9A 3WBJA 1UFOA 1KKMA 2JIBA 3FHLA 1G6HA 4BB6A 3LHKA 1QRDA 2JD1A 1DC6A 3LZ6A 4KO3S 2NTYC 2R4UA 1XVUA 3B12A 2CE2X 1SKQA 2MSLA 4D3YA 4X8HA 4PHHA 4XGQA 5C4IA 1VHLA 4CGZA 3MAGA 1RWVA 3BFVA 1KAMA 3D3JA 4DWJA 1N0WA 4RFLA 4K6GA 3FCUB 3P9CA 1T2CA 5JAIA 1I7SB 3SYMA 1AUOA 5A9SA 2Z6AA 5NULA 1VMAA 3WBKA 2WKPA 1P4GA 2X4IA 4DG9A 3PC6A 2BFDB 2HBYA 4JI5B 2BE7A 4J0EA 4X7RA 3BOSA 4IG4A 2NUAA 4KBGA 4Q16A 1XCJA 1NHGA 4MA0A 1DRJA 1WMEA 4QFBA 4YAWA 1BXZA 4YROA 4Z8YA 1ZGCA 3W90A 3I5XA 3NWJA 4LYGA 4C4TA 2CBGA 2PSEA 3AUJB 2O6LA 3F6PA 3AIKA 3LBYA 5BSEA 1P4HA 1K2VN 1QYCA 1VFNA 4JVNA 1TZCA 1VCHA 2RSLA 2A30A 2X5JO 4F92B 3T1HB 2JA1A 1XNGA 3MLAA 3OJ0A 4GMFA 1MOPA 4JJIA 2F1JA 3DYVA 1C9EA 1OHHD 1G3MA 1XQVA 2JIMA 2ZM6B 4FEEA 1WVIA 3MGBA 4A1FA 1BWSA 5C52B 1XKXA 1E1YA 5ICCA 1UJCA 4FFNA 5F7ZA 4KIUA 1CJCA 1T0BA 4LK2A 4JR2A 4RJJA 1GNLA 1SZPA 2OHOA 3SBEA 5BVHB 5C7LO 4B6JA 1O9GA 5BQ5A 4CM5A 1BWQA 1PJRA 3HCEA 4P84A 1R6XA 2NAFA 2YJ6A 4WV3A 5T4HA 4RHCA 3AR4A 4XDHA 4ZCPA 3LFHA 5K2OA 3AI1A 2FFHA 1MB9A 1KZGB 3OZEA 2M2IA 4EY6A 4J43A 2SNIE 3UUFA 4H1HA 4BDSA 3THYB 3FSGD 2C7OA 1XMSA 2X1LA 3E3AA 4E30A 4MIEA 4BZXA 1M1ZA 4MQFB 1NT2A 3ON5A 4MEJA 1PIWA 3IV6A 4QDTA 1Y5NA 5BN5A 4D4GA 1ZNWA 2CNWA 5CNKA 1CUHA 1SAYA 1BCRB 1JB9A 1ZI9A 2BM9A 5JG7A 1TTHA 3DAOA 3OG9A 3SE7A 2X15A 4B7XA 2A4KA 3QIVA 5U4XA 1K8ZB 4F91B 5C1IA 4AZWA 4G89A 1DEOA 3LDAA 4CXMA 2PLFA 2QLBA 1OY1A 1YZHA 3BIWA 1XAHA 3FPAA 3OZUA 2D5LA 4OHFA 5LQRA 2B98A 2R8PA 4RZ2A 2I29A 4BFCA 4I66A 4Q19A 4DMHA 4G63A 4U7WA 1JDBC 4IH1A 2I99A 2WLTA 4O4HB 3V9PA 1HOXA 2G82A 4IYJA 1YD7A 1K2WA 1P44A 1PR1A 1TCUA 2IZ0A 3E70C 3TR5A 1RZVA 2PRZA 3ZWAA 5ABPA 1V2HE 3QVSA 1NNLA 3GP5A 1SU8A 4IJQA 2QL6A 1YOBA 1AB6A 4MWEA 4Q7KA 1R5JA 1E2HA 2GN2A 4BO1A 2YOGA 1P5ZB 1M2WA 4QBTA 3DO6A 3WJAA 1PJZA 2A9JA 1J8YF 2CK3A 2AE2A 3E35A 3GVPA 3Q7QA 4GMXA 4R05A 4XXHA 3H42B 3RJZA 2ZANA 2PPLA 4Q1CA 1CLUA 4EG6A 3P2JA 4X41A 5I9SA 2HYIC 4RKRA 3NT2A 4JU9A 1WB9A 5FLXA 2HA5A 1NG1A 4BFYA 2OXEA 4JNKA 3O3MB 1IUNA 1R0YA 6GPBA 4BUJA 4HSGA 4HAIA 1O03A 4X90A 2JLUA 3CVXA 4KUEA 1V8DA 1C7QA 2V7QA 1NMZA 1J06A 3ZDBA 4CVNA 2D1FA 3Q8XB 5KMGA 1K63A 1F6BA 3PJDA 4JOBA 2DLDA 3CUYA 1JZQA 1OBVA 4YRKA 2QOEA 3KNZA 4MARA 2BEVA 3NTRA 3C6ZA 3OQJA 4FWBA 5BWOA 3DMNA 4CQMA 1KAEA 4QRIA 3WGIA 2QYHA 4P9NA 1JSXA 3TNFA 2HMWA 3MD0A 3EYAA 3WGTA 2QROA 3HFRA 4IXNA 4ZVLA 2CEKA 3U5ZB 4Y1RA 4LZOA 3HGQA 4RO0A 3F98A 1U0NA 2R7KA 3AIMA 1FSSA 3C2QA 2ZBVA 1EVLA 1SG0A 1OWMA 1KL7A 2YXNA 1K4MA 4RVNA 4I81A 5E4YA 3T61A 5T64A 4WESA 1I5RA 2ZSIA 4RCVA 3H2IA 1UP6A 5ALDA 2ZIUB 4XR9A 5I5GA 5AVYA 2OP1A 3LHFA 1O6CA 1WMAA 4RKWA 4OAQA 1P0IA 1OI2A 3D02A 2HSEA 2XUFA 5D6NA 4UBKA 4IDFA 3L8ZA 2CMDA 3RIEA 3PLRA 5B1SA 3T3GA 2RAUA 1CUGA 1JMYA 3SEAA 1UC9A 1B3BA 2WSIA 4DVGA 1RE1A 2MSNA 3TIIA 6PFKA 4JVOA 1FLNA 1HFJA 5EWMA 1L5QA 3TZEA 8GPBA 2JDID 1AQYA 1I10A 1Y34E 3O92A 5C0OE 2ZQYA 3OO1A 1H8ED 4POOA 4X66B 4F56A 3U3ZA 3HO8A 2HF2A 3BQ9A 1AKYA 3K1AA 4FE4A 3JQDA 5ALVA 5SY9A 3GWGA 4TOIA 4RFSB 4MVJE 2C83A 4MPDA 1OLUB 3RASA 4Y2RA 3UOAB 4DMUB 5IDWA 1Q0LA 2IOYA 4N0EA 4Q9NA 1XMIA 4EQZA 2XF8A 1PZNA 1YKGA 3V42A 2FN4A 1CY2A 2WU4A 3W9BA 3BA1A 2FFAA 2PNFA 1F8YA 2HY7A 5EMNA 1ZIYA 2BMWA 3B6IA 4FGLA 4V0RA 2Q50A 2BGGA 1LRJA 1MIHA 2VJNA 3NHZA 2H1WA 1MU0A 4JUBA 5LC1A 4IZIA 1GTSA 1D07A 2G80A 2HPVA 3AWIA 4FNMA 1YQQA 3F4KA 1VE6A 5HNKA 2WFLB 4II7A 3KWJA 5TQ2B 2XOKD 1AZLA 2AOXA 2HWKA 3LL7A 2NYUA 3B8EA 4K7JA 3V3TA 1KFKB 2OZLB 3R6WA 1KFJB 2A78A 4GEKA 2XRYA 1WWKA 3PYXA 1ZIPA 3F74A 3QI7A 4JS0A 1SXJA 1IRXA 3AERB 5L53A 1VRVA 1DNPA 2OHGA 2VNSA 3A70A 3K1ZA 4EO7A 3PUKA 1GTMA 5I4IA 3Q3JB 1FRVA 2FMXA 3FOBA 4UQOA 4KDFA 1P5HA 2FSIA 4M0UA 3LBNA 3IESA 3DXXA 1LW7A 1EMDA 1KP9A 3AB7A 1DJNA 4PAMA 2B78A 3R0IA 1SKMA 8AT1A 5K51A 3L41A 3W34A 3FCSB 1IBLB 4MZDA 1ND5A 3RWMB 3TG2A 2VDKB 3ZDZB 4D80A 5IDQA 3LLMA 1E99A 4F3RA 4MS1A 4UTOA 4PLYA 2HDWA 4KW7A 5EJAA 1U31A 3Q8MA 5KYWB 1XYVA 3S27A 2C96A 2F55A 1XZGA 1YXMA 4MPPA 1P7VA 4H6VA 4OJQA 5CM8B 1R10A 4MQ6A 1ULAA 2VHXA 2W6ID 2JLXA 2G40A 5HM6A 1GPKA 3W1WA 1YZFA 1ZN9A 4LXYA 2IZ5A 2VNKA 2FDRA 2EX1A 1JSLA 2G4LA 2WF6A 3FNHA 1NY5A 2JAXA 2QD1A 1WD7A 1WLSA 2Y6UA 3OAAD 1UBRS 2OCLA 4IGIA 2IU0A 4F9TA 4M4SA 1GUZA 3VKUA 1X7WA 2IHBA 2WPDD 4PXSA 1USGA 4F72A 1BVHA 4EJ0A 5GTDA 4MUAA 3ETJA 3K0AB 4MB6A 2JAHA 4MS4A 5DBFA 521PA 1QS0A 4PZ0A 3FJYA 3IDZA 4IXMA 3PX2A 1J9EA 2FHSA 4Q05A 4RVGA 3WNZA 3SMVA 3ROXA 4UXHA 4FE3A 1SUWA 4MWSA 3QFSA 3WLQA 1MTOA 5FI1B 1GSIA 5EY5B 5IZ4A 1NL3A 4BTVA 3E2IA 3KHUA 3MJ4A 3VV2A 1QH8B 5KVAA 2OLJA 4EYKA 1VCMA 2FDXA 5JNVA 1DRWA 2A9OA 3R3HA 4I99A 1KIAA 5A02A 5LQJA 5F7XA 2O8EA 3M6MD 5DFAA 1J2YA 1SOMA 2PJZA 3D7MA 3FKJA 4RE5A 4WGFA 5CB4A 2GHQA 3QEOA 3WV5A 1H5QA 3CLHA 1GV1A 3QWAA 2F17A 2HIGA 4KMRA 2R8RA 3EOAI 3UG6A 4UTPA 5LL6P 2HLPA 2VWHA 4PW0A 3PC8A 5CP8A 1AZTA 2DPLA 1XLTC 2JAPA 3I9LA 3INRA 4HS4A 5CRIA 3W2EA 2CNOA 5LOVA 2Z2JA 1J9GA 1B8UA 4OBBA 2V6BA 1JJFA 1P1FA 1FL9A 4KXMA 2AJCA 5F35A 1R6BX 1VG8A 1UFRA 5L51A 3C6MA 3HPRA 4B4WA 1GT6A 1PVVA 2HQBA 4HH1A 2ZB3A 1CLEA 4YT5A 3EQZA 5I9NA 1SXHA 3PX3A 5F2EA 4QGHA 2E5WA 2PR7A 3ANMA 4IIJF 4P6VF 4UEJA 2P2GA 4LDRA 4L75A 4PC7A 4WNAA 3QVVA 3ZJ4A 2I6SA 1TKRA 2PBLA 5B7NA 3PFFA 3ZBTA 3A9RA 5G3YA 1XPRA 1VB3A 5H02A 2YW9A 3VBEA 2CK3D 3R8XA 3BUSA 4GR4A 4H1VA 1E1LA 1T5DX 1E3WA 2J5BA 5EJ2A 2VDRB 2X0KA 5JNTA 1TM5E 4CF4A 2EP5A 4R8MA 4KMMA 5DX1A 4E33A 1Z56C 1KZ6A 3FNGA 1KYZA 2ZI9A 4TUYF 4ZQFA 4JI2B 2IYVA 1VE3A 3E8XA 2X9LA 5E2AA 1JBKA 3QA9A 1WXQA 2WB4A 1FP2A 4I6GA 4PX3A 2HJSA 3PGLA 3A4TA 4G0MA 4WLFA 3UMGA 4MLDA 2QRMA 2P0YA 3EIFA 1AV7A 3M9XA 1OVGA 2FZ5A 1DOHA 1PT8A 2QZPA 2R87A 1NVKA 4II3A 4NJEB 3HYLA 5AW9A 3QOFA 3QG1A 2GF2A 3HHPA 2HMYB 2G1UA 3I9FA 2V4UA 1YGYA 1QGAA 3HBNA 2WF9A 1RRPA 4Z4QA 5A0VA 4UATA 4UHEA 4QNRA 1ZOSA 1ARZA 1YMUA 4M2LA 4PHCA 4KNYA 1GQOA 3EZ9A 1AKMA 1TGYA 1W0KD 4CKCA 1U99A 4TTQA 3IHKA 1R5BA 2E1RA 1U3WA 2VHJA 3A06A 3AP3A 5B3KA 4FONA 2Z3VA 3VSEA 4CKEA 3O4RA 1E1DA 1NP6A 1S8NA 4DG5A 2Y2VA 4JB8A 3ZCPA 1AX9A 1MXHA 1DRUA 2AW3A 3ADDA 4QT4A 1M1NA 1EFUA 2O07A 2XAUA 5JE8A 4QU9A 3MFQA 3CJRA 4CDNA 1DMRA 4A82A 2Z4SA 5B2FA 3KTDA 1O2DA 2J6CA 2ZR7A 2JFNA 2YUIA 3BULA 2HGSA 3LS2A 1XU7A 4WBNA 5JMTA 1VI2A 2H1LA 2AEFA 1ZMRA 4CKYA 2QVBA 3DBHA 4GZ6A 4Y2SA 5FJJA 3RYCA 1PJ8A 1NVGA 4MMYB 5IH7A 3ROTA 3ENZA 3NM6B 4NMHA 2VWQA 3ZD7A 3LZCA 1RI3A 5M7EA 5J1SB 2ZJ0A 1W5SA 1VSUA 3FR8A 1FYEA 4OJKA 4YRRA 5FO0A 1YJAA 1KRHA 3DL4A 4FPXA 1W49A 2XB6A 4GAEA 1QIIA 4XIFA 5CVUA 4IQ0A 4INPA 3I1FA 3WSWA 4Z4GA 5I8ZA 3TTUA 1ORDA 3E1SA 2GM3A 4HMQA 1LCIA 4BMVA 1G21E 4JWTA 2HX1A 2W11A 4QULA 5JZBA 5CG1A 2WINI 1P0FA 1VPLA 2LXNA 1L8LA 3WMGA 4KFRA 3KAPA 2ECOA 4L4ZA 3JRXA 4MA5A 3HB4X 1R0CA 5D01A 2VH5R 3TUJC 4QUEA 1ZK3A 4CLEA 5JQGF 4IGAA 3SSOA 4B7AA 1XA4A 2JCBA 2D0PB 3WS7A 4YB8A 3VHLB 3BJIC 4PYIA 1ELOA 1ZISA 3KD2A 4XTCS 1X86B 4J0HA 5KHOC 1EINA 2C54A 5DN9A 3K0BA 3OY7A 1E59A 3QBDA 3TLXA 5JCJA 5AJWA 4FFSA 4D0NA 3ZWBA 3DZHA 4ZZ0A 4IQ8A 4E88A 3IEIA 4HWRA 3PA8A 4ZGBA 4LWZA 1JLMA 1WXXA 4BAZA 4JBYA 1ZWKA 3CZPA 5K0NA 2LRHA 3IH5A 2OFFA 1SXJD 1IHUA 4K9NA 2I1LA 3U6KA 1MC8A 5CVVA 4JYZA 1P91A 3RVRA 4BQIA 4QO7A 3D8SA 2JARA 4M38A 4OQMA 5HE8A 3GLHA 2WUVA 3P45A 3SEFA 2VJAA 4C2TA 5BSVA 2WTBA 3O8QA 3VOSA 3W8NA 4LF6B 4TMVA 1U5AA 2BFBB 2FRVA 5FI3A 4I9UA 2JI7A 4QHTA 4HTFB 2JJ1A 1AIPA 3IVXA 1B23P 3HA7A 1EGMB 3CJTA 1BX0A 1CHDA 2D2IA 5E8RA 3DNFA 3OFSA 4UUOA 3FGPA 3P9SA 3RYTC 4N01A 1Q15A 5CPFA 1KI1A 5JV5A 1MV8A 4ZV4A 3CH5A 5AKEA 4PTLA 3QJYA 4NWIA 5CDGA 4AJHA 4C30A 2ACWA 3T3NA 3K35A 3EC2A 2FYTA 3GXBA 1D5CA 4X6YA 4L4SA 2V1UA 4LHEA 3OUZA 2ZJ5A 1V7CA 1KU6A 2JK1A 2Q6TA 3L7BA 4FZVA 4QPDA 4US0R 3TB4A 4PLWA 3CRQA 1Q83A 3GRYA 2J3MA 1J0AA 3GW8A 4P2GA 3K09C 4KKXB 2QRNA 4BEBA 5KWIA 1D2RA 2H8GA 2WAMA 4DDTA 3MWJA 4QBIA 2VF8A 3KKZA 2NV0A 2QM7A 1H1DA 4XQCA 1T43A 2ZXFA 3WTBA 1AGPA 1GTZA 2OLEA 3H8SA 2IWRA 1U9YA 1YRHA 4JC8A 4XSVA 3I2FA 1DG9A 1GAEO 1CEEA 2IHVA 1WVGA 5A9TA 2I3AA 1XCPA 2FPPB 5ESXA 4G0NA 3TRKA 1GGFA 4I14A 1Z5VA 2OLKA 3E27A 5JDCA 1KK3A 3ED1A 1TFUA 3LYLA 4DA0A 5GV8A 2ZZKA 4X1IA 4HF7A 4G26A 3PC7A 4DMMA 3OSUA 3DBRB 1OBCA 3R0XA 2J3IA 5BO5A 4YCCA 2J7KA 4B33A 4A8TA 4IGEA 2Q1YA 2B25A 3LT2A 1NBME 4JBNA 1I32A 3ANNA 1L7MA 4XARA 1U7HA 5IP5A 5AVQA 1KS2A 3ACCA 3P2IA 5CT5A 5C8ZA 1QV9A 1KI2A 2Q46A 4E4TA 1CIVA 2OXCA 3EFBA 3VX3A 5KNDD 3A0UA 4EL5A 1JAXA 3ZTWA 3JQ9A 1G20B 3OM8A 4OG2A 3G89A 4JHLA 4WMLA 3GF4A 1SRRA 3IQXA 4XFDA 1G4AE 4DLYA 4G86A 2EJVA 3LDUA 3V1TC 3WGQA 2XA9A 2BPOA 4NPCA 1ZOIA 1A0OA 4I4TA 2CHFA 5REQA 2Y99A 4FYJA 4M1QA 4FW8A 3EUAA 3GWZA 2B4RO 2QP9X 2HU8A 3O73A 1OZAA 2NO4A 5B36A 2Y27A 5EE9A 4PAQA 3SF0A 1T8WA 3U3DA 2QUIA 1LSUA 4NZZA 3WP0A 4L6CA 4MYCA 4C03A 3KHKA 1GQRA 3ZY6A 3TEFA 1RCTE 4BRWA 1VBNA 4LXUA 2JFFA 3O1JC 4MS4B 4M9UA 1DPGA 2ZSUA 3L5KA 3QY0A 4INOA 4K9KA 3ORRA 1QHYA 3JWJA 4NICA 3WB2A 5DRTA 4Q4CA 4PS0A 5AM5A 1ORVA 2BMJA 2PX0A 3JAKA 4KGXA 5KOJB 3LX4A 2Q0QA 3CMCO 4PZCA 1XWWA 3QQPA 1LQUA 4XWAA 1SWVA 2G70A 1A9YA 1Y48E 4JKOA 5I6DA 4B40A 3L6DA 3COSA 2OCYC 1YZQA 4ZQCB 4D44A 3LLUA 1ESNA 4DLPA 1TCVA 1VMIA 5F1YA 3RHZA 3CF4G 1AKRA 3GBVA 2HTEA 5DLYA 3ZZUA 2ZG6A 1OBHA 3CN7A 1IM8A 1E9FA 1IK6A 4MVCA 1X1TA 1D2AA 4N40A 3VZSA 4NSNA 3LG2A 3HJRA 4JEHA 4V0ME 3KQQA 4RJKA 2IK8A 4US2R 1W73A 2AUTA 1BXRB 1TK3A 1WPGA 4CEHA 3QMWA 4YV0A 4YIKA 2PT6A 3X44A 3UHPA 1AKVA 2FWMX 2HU2A 3NS7A 4YJ3A 5T41A 2B7CA 4PFJA 4S3MA 2C1EA 4EF6A 2NPOA 4N6NA 3NHWA 1I7QB 3FUCA 3CF2A 4QRDA 4H60A 1ZM9A 5T57A 3RSHA 3QSYA 3D8NA 5HIMA 3DB1A 3HPQA 5BQXA 4K8RB 1J21A 1R50A 4UTXA 4P38A 1HNWB 1ONBA 3AYXB 1GAJA 5EPUA 4OFBA 1O54A 2Q28A 2QKYA 1LBHA 5KJCA 3NRBA 2Z5GA 3OECA 4MVXA 2GPNA 2RAFA 2PMCA 4NKRA 2OWDA 4RMIA 2OZEA 3GZTB 4BS9A 1YR3A 3P9RA 3V8NA 2EV9A 4EB6A 1F0NA 1Y9JA 3RS7A 2WJYA 4F3TA 3H9GA 1LU9A 3W5DA 5ICSA 1ZS9A 2IYOA 2WD7A 3INNA 1EHYA 1Z5NA 2I6QA 1GDDA 4UEQA 4X9XA 1QP4A 5JCOC 1T1RA 3CQ9A 4YCSA 2NMVA 3F78A 5FB3A 2D8MA 2HHLA 4IJUA 1UP4A 3I92A 2WU3A 2YRXA 3AUSA 3CRNA 1GIAA 1WABA 2O0KA 4OI2A 1PKXA 5K20A 1JG1A 2IZ6A 4EPXA 2JZCA 1P77A 2OFWA 2O5RA 5AHWA 1S89A 1P81A 2K6GA 5ADUS 3DWIA 1XQWA 4ARIA 3WYGA 3BSSA 4GWKA 1P5FA 4MUBA 2MMGA 1ZH6A 3KOUA 1RZUA 5KC9A 1NNUA 1RYYA 5FOUA 3DE7X 5IK2D 1LBSA 4QGGA 4R2LA 4CM9A 1PLJA 2G5GX 2P9JA 4JLMA 5CVJA 3DM5A 4ED9A 2GZ1A 4IO0A 4NAUA 3MMPA 4ZOEA 4PFSA 3GNQA 3RK1A 3JQGB 3RHFA 1AKEA 4Y9SA 1X7YB 5HGXA 3G8CA 1U63A 4WKOA 2A4MA 4DILA 4ABYA 3QRWA 3H11A 4IL5A 3AFOA 4GOJA 4P7BA 4I6EA 2GN0A 4IYRA 4Q02A 4IVQA 3SCZA 1AKQA 1Q1BA 4Y2VA 1M2NA 1A7UA 2IUFA 2PD4A 1Q95A 4J4HA 3VJMA 5BV8A 4RTPA 1SUIA 3NC0C 4X62B 2Q2VA 2VNHA 3QPBA 4DY6A 1LWOA 3FPGA 2PUTA 2V8OA 5FUYA 1U7XA 2QW0X 2PXAA 4DRZA 4TYNA 4HBGA 3SP1A 1R74A 4WLUA 4DMGA 4Z4CA 4U63A 4DC0A 4YMLA 4UBMA 1SBQA 3RFFA 4XPZA 4XYMA 4N47A 1JHAA 3RT7A 3P4YA 3NHAA 5AKIA 3I9V1 3JAWA 1G17A 4B6RA 3W7BA 2C07A 3SNKA 1KZYC 1T5BA 1Z0JA 2O2JA 3PGVA 3HCFA 2BMEA 5FRDA 1P2DA 2FJUA 1NMQA 4C20A 3AR2A 3IKJA 3ROQA 4MGKR 3VU1A 1PGJA 5KYYB 2XJ9A 3QH4A 4L0CA 3O4GA 2QTTA 2VR1A 3K70D 3Q6NA 1A9SA 1XCGB 2ZRFA 1WCIB 4Q1DA 4BBPA 2A0UA 2K2QB 2NG1A 4LGCA 3TSAA 5BSKA 4Z7OB 1IBSA 5HFAA 2B92A 1Q19A 5HUHA 4CMKA 2OEPA 2HJHA 3SQOA 1FB5A 5TY0A 2VRCD 4LF9B 1C41A 2HL6A 2QIPA 3K0HA 4OB8A 4TQAA 3TD9A 1G7SA 1PWYE 4H18A 4GMKA 1FP1D 4XOIA 1U5BB 3JQRA 3O0TA 4FFMA 3HLKA 4QE3A 1G5TA 4X3OA 3FLBA 5J63A 1FDSA 1Z4KA 1V8OA 3UK1A 2PD6A 4ZYYA 5DGCA 2IYPA 2D3WA 4HH0A 2O0MA 2OV4A 3OPQA 2ODPA 4GWLA 4EY4A 3WNVA 5JTUA 2J5RA 3QHPA 4C7OA 3JTMA 4UVIA 2P2SA 3L2OB 1EXMA 1VPVA 1SK9A 3WY9A 2AG0A 3B6MA 3T1NA 3IPAA 4UVDA 4C2AA 1DEKA 2P30A 1ZU5A 2HEIA 3NGXA 3EVDA 1Q44A 1YRBA 2AXNA 1ZGGA 1CEXA 3OCUA 1GNRA 1J0XO 3QG5A 1SHJA 4B74A 2QBYA 4JP1A 2C59A 4NC9A 4AW9A 3QYFA 4Q3DA 2P8SA 3C7KA 5JOQA 3H2BA 4Y6RA 3WFJA 3NVAA 4EG7A 1D8TA 3LQRA 2I80A 3N0WA 4YO8A 4NY1A 2GSWA 3RU3A 1HDYA 2IDJA 3PXEA 2GX6A 1E2KA 1Z2CA 2XVZA 3FDXA 4GM1A 4NNOA 1YE5A 1Z5WA 4TMWA 4BLSA 4D9CA 2OXIA 3TI9A 5CB0A 4MW2A 2BCEA 1OH6A 2ZTSA 4ZT7A 1N9GA 3BZBA 3GLUA 1U1GA 3GLSA 3UEOA 1L5YA 3MCTA 2A0WA 4M1MA 4HDNB 2OECA 3DBVO 3DVAB 1WZUA 3O90A 5HJ2A 2O8DB 4QEZA 3PDCA 1UKBA 4XI9A 3SQMA 5AIAA 2EJUA 1HK7A 1Z2AA 3QLJA 1Y7IA 3ELYA 1N0VC 1XVLA 1ZI6A 3DOCA 5B3AA 1JVSA 2YJZA 4AZ3B 3QEAZ 2R6CA 5IDVA 4BV8A 3WAGA 3BKWA 4FD2A 3PE3A 1YRYE 3A25A 4H6XA 3QX3A 4BX9A 1WR8A 2ET6A 4KR7A 1GZHB 2V5VA 4IXWA 2PL3A 3KM0A 1VPEA 3PEFA 1ICIA 5BVHA 3HYTA 1I0IA 1M8KA 2NSLA 3BE8A 4LJAA 5ADHA 5KNCA 5TPWB 4H7FA 4DQXA 1MTZA 1XMOB 4RGYA 3H13A 3F6RA 1X39A 3C8HA 1TM3E 3IMCA 4LYEA 1QDLB 2E4XA 1QUFA 2ZRQA 2DHEA 1FYWA 4GNRA 3V4VB 2FH5B 4G0YA 4CLRB 5BWBA 2XBMA 4FHDA 4WZ6A 3ZWCA 4C0LA 1N3IA 1PK7A 1Y82A 3CIFA 4RETA 1VJ1A 1CY0A 5LP6C 4X1KA 1T0IA 4R16A 1MQ8B 1Y3IA 1YU6A 1SKYB 5GP1A 2EERA 2KBFA 3EAFA 2FPMA 2P5YA 3KTFA 4JX9A 5E0KB 4HWSA 4JQOA 1JT9A 2EVWX 2IOHA 3FSJX 5JJIA 5LA6B 4TKUB 3VZQA 4L15A 4K28A 4AO7A 5FTWA 7ADHA 1YK1A 4C3VA 3BH0A 1QTQA 5IVIA 1N8KA 1D6SA 2B21A 2JGAA 1KY3A 2Q07A 4NCIA 4IM7A 1QM5A 1AHHA 1ZINA 2CYAA 2HADA 4I08A 4F38A 3EVCA 3IEKA 3H0EA 3KJXA 5I3ZA 3IPLA 3QENA 4WXYB 1F1BA 1XN4A 3N8HA 5DX8A 3T3HA 2I4OA 1A88A 4LZZA 1CF4A 1X8KA 2RK4A 3K0FB 4TXNA 1JI3A 4JBIA 1ESEA 4HYQA 1BKDR 4R40A 1IQ0A 2WV9A 5TV2A 1WBDA 1DRVA 3R7WA 3SVTA 1N3YA 4UMDA 1CUFA 2OHHA 2IEBA 3A1TA 4EJSC 5EERA 5LJLA 4BATA 1VJCA 4WXEA 3U4DA 1JEYA 2EKZA 3C98A 1YR9A 2Z95A 1DIHA 2WUWE 4EW6A 3FOWA 5HFJA 3D3WA 5EJ7A 1A98A 5DI3A 3VI3B 1C9YA 4XFKA 1C1DA 4FN5A 3DBLB 5LQMA 5KHLB 2VO1A 1LFAA 2G88A 2JVJA 2C78A 1QG2A 1QYVA 5FBHA 3VC3A 2H57A 2G9NA 3H3JA 4TWZA 1FLDA 3G2HA 4KQEA 2ZIXA 2DFTA 1XMXA 5MF6A 1SO8A 4X24A 1NASA 2HIHA 3ORSA 4KE9A 5H82A 3NHUA 5C31A 2PV0A 2O2EA 2JKVA 2QTZA 4MYSA 3MBIA 5DEIA 3U13A 3VDXA 3I6MA 2YWFA 1OLSB 4KNVA 3VI4B 3LI2A 2MU1A 3B1KA 2IYEA 5DK4A 4X85A 3EISA 2A5DA 5JYEA 4D1YA 1Z5ZA 4K6KA 3MOIA 2XMDA 2QT0A 3LBHA 3JRNA 1FTGA 1UPCA 3JATA 3OX2A 3I5MA 4O4LA 4HATA 4WNCA 3CZCA 4FGWA 1IXZA 4OU4A 3N3AC 4LYFA 3IEUA 1ZONA 4C87A 5E7QA 1KKLA 3CX6A 3PNSA 4K3VA 4NJEA 1LNZA 1BOOA 4BTEA 4RPGA 1J70A 1EFLA 3K2QA 4EF4A 5CXSA 1QIDA 1NXWA 5BW6B 2ZB7A 2QG9A 2XB9A 3EZ6A 3WMEA 1SXJE 1G60A 3I9KA 1LPMA 1AOXA 3IERA 2XQJA 2OAP1 2IWHA 1YNSA 1ZCAA 2UYQA 3BORA 4UM5A 4NENB 1B8OA 1IOWA 3PLAE 4DNQA 4OI1A 5JS6A 4GX1A 4PZUA 4CM4B 4LNUA 3ZWVA 1WXWA 4H4EA 4B8ZA 1A77A 2YWBA 4C2BA 1Z63A 1GTRA 3W8RA 4YLYA 2W98A 4UBIA 1CB0A 3ECAA 2YWHA 3O38A 3VR6A 4YCNA 1Q20A 4KDRA 3VKWA 3UGTA 2Y9MB 2FX3A 4G1UC 3GJXC 5J4VA 2XBLA 1EE9A 5GADl 3V1NA 3CB2A 4NR0A 2HT6A 3HFSA 3DZCA 2XIQA 2F3RA 3OP4A 4XW2A 5FQNA 2BBTA 2QLLA 3CCFA 4M49A 2BEJA 3KYCA 2ISQA 3M5DA 2YNMA 3ILVA 5FUXA 5BQOA 3G5AA 5FO1A 4QZVA 3TI7A 4LXIA 3GP3A 4OLAA 5CDHA 1JQ3A 1T1SA 1NXVA 3AVWA 1QGUA 4DNXA 1N5JA 4AP6A 3IKMB 2EFDB 2UUPA 3D6NB 3JY6A 4PYOA 4QFMA 1TQ2A 5LYJF 3OZAA 4M6WB 4RK5A 1DSSG 3DL2A 3EMDA 4NH4A 4IDCA 5G4KA 2PH3A 3EIUA 3HZHA 3JVDA 2ZJOA 3ZWMA 4K3UA 4MR7A 1XTKA 4C88A 1WSBA 1Z7YA 4K9LA 4IVNA 1ECJA 2ADFA 3EH2A 1ZGHA 3A04A 3KEOA 4B84A 2D74A 3C48A 3LJKA 4MQ4A 3N6XA 2F1OA 4JC4A 4XOUA 1SR8A 5FOWA 1SQFA 4WDRA 3OJEA 1COZA 3TMYA 1KYWA 3CW9A 3UV3A 5LU8A 2HV8A 3TSOA 1VP9A 3HVKA 3QOWA 2WAOA 1BJRE 3LUBA 3A6EA 3N7TA 4X1IB 1OXVA 5A9RA 3A7DA 1K66A 1Z2NX 1MJNA 5DJ5A 5A71A 2C04A 2JIPA 5LA6A 3AGQA 1LQTA 2BR4A 3CVYA 2VQEB 4EMBA 1MABB 3RG2A 1JKJA 4F7DA 4HNUA 3IBTA 1Q7TA 4KSYA 1CNMA 1DAEA 1SBZA 1IUPA 1K27A 3V8EA 3UUGA 5DSZA 4RSMA 4EG5A 3UAXA 2XWJI 1XD2B 1QH8A 2WIKA 1JFVA 4GHWA 4BVGA 1HX7A 1XAJA 3RKUA 5FUWA 3ICCA 3RRMA 1V45E 4TSFA 2ICAA 1FFSA 3COWA 1WOYA 3IAM1 3R9KA 5KINB 5DHRA 1GZ4A 3HG7A 1AGYA 1VRWA 3LQ4A 4WECA 2BZ1A 4OHKA 3LCJA 1ZMTA 4J7CA 4EO9A 3CE9A 2I4RA 1W75A 3LHSA 4UVGA 3PC3A 2PWZA 4LPKA 4BFWA 3DR3A 2GM4A 1VLHA 4KWCA 3ZVLA 3B5IA 4LCJA 2H06A 1ORRA 1MQ9A 4LDJA 2G06A 5AI5A 2WSSD 2QX4A 5KCZA 1N9GB 1OI4A 2I54A 1ID8A 2XWPA 1Z88A 4GQIA 4DVJA 5AM2A 5JJ5A 4HDNA 2Q0XA 3P9PA 3EAQA 5JDIC 3EFOB 3OKFA 3T5GA 4I3FA 2PRJA 4D81A 4IEEA 1OLSA 4U8HA 2XWQA 3TWOA 5JZMA 1NAHA 2I76A 3TOZA 1JAYA 2RHBA 4ALKA 4N3AA 3K6SA 1SIUA 1Z2DA 1V16B 3DQPA 1BMTA 5L3SB 1UADA 8OHMA 5KNBH 4IIGA 4JVMA 4IFTA 5T4FA 1DX4A 4B09A 1HKHA 1EAYA 1QTIA 4O2AF 4H4DA 4H7IA 3HY4A 3C5EA 5EWLB 1V16A 1XTJA 1L4EA 3HZRA 4LSWA 2AZ4A 3I4FA 1ENZA 3N2IA 3O1IC 1U6KA 4HEA6 4LMBA 4XCXA 5KDLA 3B78A 4YRGA 2YV3A 3KBOA 5CW2A 2WK1A 4MRMB 2VG8A 4JN6B 5ALUA 5EXXA 4YP6A 2XNJA 4WINA 4WVFA 4AP5A 1F7UA 4EF5A 5IKOA 4XB6B 3R9IA 4TZ6A 3L49A 5L3QB 2ZSDA 3EUWA 4M22A 5LMNB 1EXNA 2ACKA 3KDSE 5CCDA 5CAEB 3OIUA 4OFXA 3P0JA 1ZAYA 2E49A 3T7CA 5JQGA 1YQEA 3G02A 1MH9A 3OZDA 1MOZA 4EKNB 4RJTA 1W5BA 5K3EA 4DV1B 3LU1A 3MMZA 3PQ7A 2XR1A 5L4SA 4E03A 4B2PA 1XZCA 3AEQA 4A2QA 5AJVB 5DNWA 4PFKA 5ESRA 4D5EA 4TROA 5KSYA 3EA0A 2NQ8A 5J2TF 5GOTA 3MTAA 4N0MA 4HOYA 2V54A 2Z30A 1ZRSA 5GZ6A 2XB4A 1JVBA 1VSBA 4X64B 3ZW9A 1E5TA 2YWCA 2B3TA 4NL4H 4FVTA 1DINA 2OPBA 3KE8A 4GSLA 3EX7C 1P7CA 3SKVA 2R4QA 2FP3A 2QQFA 2O8FB 3VKGA 4G8CA 3P2YA 2LCFA 4MRSA 1C1XA 2IEYA 2M6LA 6REQB 5JH7B 4RESA 4WX2B 4HAUA 4EY5A 5JC1A 4O25A 2X7JA 3NM5A 5IJWA 4YTEA 1NSFA 4QAJA 1PV2A 3OEHD 2GK6A 1QCCA 3GELA 4GZ3A 3T06B 4HEJA 6REQA 2RE8A 2IODA 3RS9A 1VL2A 3JASB 2B82A 1ZI8A 2YOHA 4I1VA 3ZR4B 4TXHA 3HNRA 1VLMA 4Z54A 3GLGB 1MENA 1NR7A 7ABPA 5ALHA 2FEMA 3OQVA 4GVPA 3CZMA 5CT8A 4HRAA 1YIAA 2FEAA 4ROSA 1M5TA 2CSUA 3U3OA 2FPOA 3IXMA 3K30A 4HVAA 4JOSA 1KQFA 4ZVKA 4RV4A 1ZZEA 3EXIB 5AXAA 4TVSA 1UBUS 5AIBA 2W0MA 1THTA 2H5JA 4GGPA 1P3DA 4C5AA 2FLKA 4H9GA 1W8IA 3PVZA 4IZ6A 4D5GA 5KAPA 2EARA 3JQGA 2FLVA 2QQ0A 3Q3IA 1ZO8A 3S8MA 3W5IA 1RLJA 1JG7A 3QX7A 3DT8A 4K9SA 2J7PA 4OQFA 3RIYA 5AVZA 5ITZB 4N0PA 1YA8A 2JVKA 1UPBA 4YQYA 1SCNE 4RH3A 1B74A 3T95A 1SVUA 5SZHB 2BUAA 1M7GA 3AOEC 1P33A 3BXFA 3JALA 4MV9A 3WR5A 5D8DA 2GYUA 4PO3X 2NPFA 4YYEA 5A4MS 3TUZC 2IYUA 3KZVA 4KV7A 5IBPA 1NVVQ 3W4IA 1JWLA 2XW6A 1O57A 3P9NA 5BN5B 2ZJ7A 3CEMA 2H4XA 2JKYA 1LJLA 1RPNA 1KK0A 2RHHA 1I2MA 1IXRC 4CIVA 4TT3A 5EJGA 3ZBQA 4ZI3A 4BMOB 2DTEA 2P9TA 4D9HA 4X63A 3N2YA 3RRZA 1T26A 4PRKA 1WKBA 3TKLA 3VNUA 3QYAA 1I94B 1MVOA 4J0QA 4TSRA 4WY2A 2JI9A 2PMKA 1CSEE 2V4ZA 1BKSB 5E2IA 1SCQA 1AV6A