1TK7A

Nmr structure of ww domains (ww3-4) from suppressor of deltex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
GSPEFHMDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG4244-PB
publication title The structure and dynamics of tandem WW domains in a negative regulator of notch signaling, Suppressor of deltex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 12
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1tk7A01
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1tk7A02
2ZR5A 3TC5A 2MDIA 2LAJA 2L4JA 2XPBA 1WR7A 3KADA 4U84A 1EG3A 1WMVA 2XP7A 5CQ2A 3LE4A 4REXA 2ZQSA 2ZR6A 2YSIA 2E45A 1K9RA 3TDBA 2ZR4A 1ZCNA 3KABA 3KAHA 2XP3A 3L4HA 2ZAJA 2DK7A 1TK7A 2XPAA 2EZ5W 4QIBA 1I5HW 2ZQVA 3KAIA 3NTPA 2RE3A 3ODKA 1O6WA 2ZQTA 2ZQUA 3M85A 1PINA 2XP9A 1EG4A 1NMVA 2KXQA 2DMVA 2YSHA 2JMFA 2Q5AA 3KAFA 2DWVA 5AHTA 4U86A 2YSGA 2F21A 3TCZA 4U85A 2XP8A 3M7NA 1YW5A 2DJYA 1JMQA 3WH0A 2DK1A 3KCEA 2XP6A 2JX8A 3OOBA 2M8IA 3KAGA 1F8AB 2M8JA 2JXWA 2XP4A 2ITKA 2YSBA 2BA1A 1K9QA 4E5RA 2XP5A 3CNGA 2JV4A 2M3OW 2YSFA
chains in the Genus database with same CATH superfamily
2ZR5A 3TC5A 2MDIA 2LAJA 2L4JA 2XPBA 1WR7A 3KADA 4U84A 1EG3A 3MCBA 1WMVA 2XP7A 5CQ2A 3LE4A 5E66A 4REXA 2ZQSA 1RP5A 5U47A 2ZR6A 2YSIA 3MQHA 2E45A 5E62A 1K9RA 3LKXA 1FLCA 3TDBA 2ZR4A 1ZCNA 3KABA 3KAHA 2WAEA 2XP3A 3L4HA 2ZAJA 2DK7A 1TK7A 5E65A 2XPAA 3MCBB 2EZ5W 4QIBA 1I5HW 2ZQVA 3KAIA 2QRVA 3NTPA 2RE3A 3ODKA 4A0UA 2YAJB 1O6WA 3FSCA 2ZQTA 2ZQUA 3M85A 1PINA 2XP9A 1EG4A 1NMVA 2KXQA 5E5WA 2DMVA 2YSHA 2JMFA 2Q5AA 3KAFA 2DWVA 5AHTA 4U86A 2YSGA 2F21A 3TCZA 4U85A 4A0TA 2XP8A 3M7NA 1YW5A 2Y8NB 2DJYA 1JMQA 5E64A 3WH0A 2DK1A 3KCEA 1TR8A 2XP6A 2JX8A 3LKXB 3OOBA 2M8IA 3KAGA 3PQHA 1F8AB 3FS8A 2M8JA 3FSBA 2WADA 2JXWA 4GLXA 2XP4A 2ITKA 2YSBA 3MQGA 2BA1A 1K9QA 4E5RA 2XP5A 2OWOA 3CNGA 2JV4A 2M3OW 2YSFA
chains in the Genus database with same CATH topology
2ZR5A 3TC5A 2MDIA 2LAJA 2L4JA 2XPBA 1WR7A 3KADA 4U84A 1EG3A 3MCBA 1WMVA 2XP7A 5CQ2A 3LE4A 5E66A 4REXA 2ZQSA 1RP5A 5U47A 2ZR6A 2YSIA 3MQHA 2E45A 5E62A 1K9RA 3LKXA 1FLCA 3TDBA 2ZR4A 1ZCNA 3KABA 3KAHA 2WAEA 2XP3A 3L4HA 2ZAJA 2DK7A 1TK7A 5E65A 2XPAA 3MCBB 2EZ5W 4QIBA 1I5HW 2ZQVA 3KAIA 2QRVA 3NTPA 2RE3A 3ODKA 4A0UA 2YAJB 1O6WA 3FSCA 2ZQTA 2ZQUA 3M85A 1PINA 2XP9A 1EG4A 1NMVA 2KXQA 5E5WA 2DMVA 2YSHA 2JMFA 2Q5AA 3KAFA 2DWVA 5AHTA 4U86A 2YSGA 2F21A 3TCZA 4U85A 4A0TA 2XP8A 3M7NA 1YW5A 2Y8NB 2DJYA 1JMQA 5E64A 3WH0A 2DK1A 3KCEA 1TR8A 2XP6A 2JX8A 3LKXB 3OOBA 2M8IA 3KAGA 3PQHA 1F8AB 3FS8A 2M8JA 3FSBA 2WADA 2JXWA 4GLXA 2XP4A 2ITKA 2YSBA 3MQGA 2BA1A 1K9QA 4E5RA 2XP5A 2OWOA 3CNGA 2JV4A 2M3OW 2YSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR5 A;  3TC5 A;  2MDI A;  2LAJ A;  2L4J A;  2XPB A;  1WR7 A;  3KAD A;  4U84 A;  1EG3 A;  1WMV A;  2XP7 A;  5CQ2 A;  3LE4 A;  4REX A;  2ZQS A;  2ZR6 A;  2YSI A;  2E45 A;  1K9R A;  3TDB A;  2ZR4 A;  1ZCN A;  3KAB A;  3KAH A;  2XP3 A;  3L4H A;  2ZAJ A;  2DK7 A;  1TK7 A;  2XPA A;  2EZ5 W;  4QIB A;  1I5H W;  2ZQV A;  3KAI A;  3NTP A;  2RE3 A;  3ODK A;  1O6W A;  2ZQT A;  2ZQU A;  3M85 A;  1PIN A;  2XP9 A;  1EG4 A;  1NMV A;  2KXQ A;  2DMV A;  2YSH A;  2JMF A;  2Q5A A;  3KAF A;  2DWV A;  5AHT A;  4U86 A;  2YSG A;  2F21 A;  3TCZ A;  4U85 A;  2XP8 A;  3M7N A;  1YW5 A;  2DJY A;  1JMQ A;  3WH0 A;  2DK1 A;  3KCE A;  2XP6 A;  2JX8 A;  3OOB A;  2M8I A;  3KAG A;  1F8A B;  2M8J A;  2JXW A;  2XP4 A;  2ITK A;  2YSB A;  2BA1 A;  1K9Q A;  4E5R A;  2XP5 A;  3CNG A;  2JV4 A;  2M3O W;  2YSF A; 
#chains in the Genus database with same CATH topology
 2ZR5 A;  3TC5 A;  2MDI A;  2LAJ A;  2L4J A;  2XPB A;  1WR7 A;  3KAD A;  4U84 A;  1EG3 A;  3MCB A;  1WMV A;  2XP7 A;  5CQ2 A;  3LE4 A;  5E66 A;  4REX A;  2ZQS A;  1RP5 A;  5U47 A;  2ZR6 A;  2YSI A;  3MQH A;  2E45 A;  5E62 A;  1K9R A;  3LKX A;  1FLC A;  3TDB A;  2ZR4 A;  1ZCN A;  3KAB A;  3KAH A;  2WAE A;  2XP3 A;  3L4H A;  2ZAJ A;  2DK7 A;  1TK7 A;  5E65 A;  2XPA A;  3MCB B;  2EZ5 W;  4QIB A;  1I5H W;  2ZQV A;  3KAI A;  2QRV A;  3NTP A;  2RE3 A;  3ODK A;  4A0U A;  2YAJ B;  1O6W A;  3FSC A;  2ZQT A;  2ZQU A;  3M85 A;  1PIN A;  2XP9 A;  1EG4 A;  1NMV A;  2KXQ A;  5E5W A;  2DMV A;  2YSH A;  2JMF A;  2Q5A A;  3KAF A;  2DWV A;  5AHT A;  4U86 A;  2YSG A;  2F21 A;  3TCZ A;  4U85 A;  4A0T A;  2XP8 A;  3M7N A;  1YW5 A;  2Y8N B;  2DJY A;  1JMQ A;  5E64 A;  3WH0 A;  2DK1 A;  3KCE A;  1TR8 A;  2XP6 A;  2JX8 A;  3LKX B;  3OOB A;  2M8I A;  3KAG A;  3PQH A;  1F8A B;  3FS8 A;  2M8J A;  3FSB A;  2WAD A;  2JXW A;  4GLX A;  2XP4 A;  2ITK A;  2YSB A;  3MQG A;  2BA1 A;  1K9Q A;  4E5R A;  2XP5 A;  2OWO A;  3CNG A;  2JV4 A;  2M3O W;  2YSF A; 
#chains in the Genus database with same CATH homology
 2ZR5 A;  3TC5 A;  2MDI A;  2LAJ A;  2L4J A;  2XPB A;  1WR7 A;  3KAD A;  4U84 A;  1EG3 A;  3MCB A;  1WMV A;  2XP7 A;  5CQ2 A;  3LE4 A;  5E66 A;  4REX A;  2ZQS A;  1RP5 A;  5U47 A;  2ZR6 A;  2YSI A;  3MQH A;  2E45 A;  5E62 A;  1K9R A;  3LKX A;  1FLC A;  3TDB A;  2ZR4 A;  1ZCN A;  3KAB A;  3KAH A;  2WAE A;  2XP3 A;  3L4H A;  2ZAJ A;  2DK7 A;  1TK7 A;  5E65 A;  2XPA A;  3MCB B;  2EZ5 W;  4QIB A;  1I5H W;  2ZQV A;  3KAI A;  2QRV A;  3NTP A;  2RE3 A;  3ODK A;  4A0U A;  2YAJ B;  1O6W A;  3FSC A;  2ZQT A;  2ZQU A;  3M85 A;  1PIN A;  2XP9 A;  1EG4 A;  1NMV A;  2KXQ A;  5E5W A;  2DMV A;  2YSH A;  2JMF A;  2Q5A A;  3KAF A;  2DWV A;  5AHT A;  4U86 A;  2YSG A;  2F21 A;  3TCZ A;  4U85 A;  4A0T A;  2XP8 A;  3M7N A;  1YW5 A;  2Y8N B;  2DJY A;  1JMQ A;  5E64 A;  3WH0 A;  2DK1 A;  3KCE A;  1TR8 A;  2XP6 A;  2JX8 A;  3LKX B;  3OOB A;  2M8I A;  3KAG A;  3PQH A;  1F8A B;  3FS8 A;  2M8J A;  3FSB A;  2WAD A;  2JXW A;  4GLX A;  2XP4 A;  2ITK A;  2YSB A;  3MQG A;  2BA1 A;  1K9Q A;  4E5R A;  2XP5 A;  2OWO A;  3CNG A;  2JV4 A;  2M3O W;  2YSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...