1TK7A

Nmr structure of ww domains (ww3-4) from suppressor of deltex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
b'GSPEFHMDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQGQEVSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG4244-PB
publication title The structure and dynamics of tandem WW domains in a negative regulator of notch signaling, Suppressor of deltex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 12
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1tk7A01
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1tk7A02
2DMVA 3LE4A 1WR7A 2XPAA 2ITKA 3WH0A 1ZCNA 2ZQUA 3OOBA 4U86A 3CNGA 3KAHA 4U84A 1PINA 2ZR6A 2KXQA 3M7NA 2ZQVA 2EZ5W 3KABA 2DJYA 2YSFA 2XP8A 1EG4A 2BA1A 2LAJA 2ZR4A 2M8IA 1K9RA 2DK7A 2YSBA 2E45A 2JV4A 1NMVA 3KAGA 1JMQA 1O6WA 2XP9A 2L4JA 1F8AB 2ZQSA 2JMFA 2YSGA 2DWVA 2ZR5A 5AHTA 2F21A 4E5RA 2MDIA 1EG3A 2XP4A 3NTPA 4REXA 3KAFA 1K9QA 5CQ2A 3M85A 2XP7A 3L4HA 2XPBA 2XP5A 2M3OW 2DK1A 2JX8A 3TDBA 3KAIA 2Q5AA 4U85A 2JXWA 2YSHA 2M8JA 1I5HW 2ZAJA 2YSIA 3TC5A 3KCEA 1YW5A 2XP3A 1WMVA 2XP6A 4QIBA 2ZQTA 1TK7A 3ODKA 3KADA 3TCZA 2RE3A
chains in the Genus database with same CATH superfamily
2DMVA 3LE4A 1WR7A 2XPAA 2ITKA 3WH0A 1ZCNA 2Y8NB 1RP5A 2ZQUA 3OOBA 4U86A 3CNGA 3KAHA 3PQHA 4U84A 2WADA 5E66A 1PINA 5E65A 1FLCA 2ZR6A 2KXQA 3M7NA 2ZQVA 1TR8A 2EZ5W 3KABA 2YAJB 2DJYA 2YSFA 3MCBA 2XP8A 1EG4A 3FSBA 2BA1A 2LAJA 2ZR4A 2M8IA 1K9RA 2DK7A 2YSBA 2OWOA 2E45A 2JV4A 1NMVA 3KAGA 1JMQA 1O6WA 3LKXB 2XP9A 2L4JA 1F8AB 2ZQSA 2JMFA 2YSGA 2DWVA 2ZR5A 5AHTA 2WAEA 2F21A 5E62A 4E5RA 5U47A 2MDIA 1EG3A 2XP4A 3NTPA 4REXA 4GLXA 3KAFA 2QRVA 1K9QA 4A0TA 5CQ2A 3M85A 2XP7A 3L4HA 2XPBA 2XP5A 3FSCA 2M3OW 2DK1A 2JX8A 3TDBA 4A0UA 3KAIA 5E5WA 3MQGA 2Q5AA 2JXWA 4U85A 3FS8A 2YSHA 2M8JA 3MQHA 1I5HW 2ZAJA 3LKXA 3MCBB 2YSIA 3TC5A 3KCEA 1YW5A 2XP3A 1WMVA 5E64A 2XP6A 4QIBA 2ZQTA 1TK7A 3ODKA 3KADA 3TCZA 2RE3A
chains in the Genus database with same CATH topology
2DMVA 3LE4A 1WR7A 2XPAA 2ITKA 3WH0A 1ZCNA 2Y8NB 1RP5A 2ZQUA 3OOBA 4U86A 3CNGA 3KAHA 3PQHA 4U84A 2WADA 5E66A 1PINA 5E65A 1FLCA 2ZR6A 2KXQA 3M7NA 2ZQVA 1TR8A 2EZ5W 3KABA 2YAJB 2DJYA 2YSFA 3MCBA 2XP8A 1EG4A 3FSBA 2BA1A 2LAJA 2ZR4A 2M8IA 1K9RA 2DK7A 2YSBA 2OWOA 2E45A 2JV4A 1NMVA 3KAGA 1JMQA 1O6WA 3LKXB 2XP9A 2L4JA 1F8AB 2ZQSA 2JMFA 2YSGA 2DWVA 2ZR5A 5AHTA 2WAEA 2F21A 5E62A 4E5RA 5U47A 2MDIA 1EG3A 2XP4A 3NTPA 4REXA 4GLXA 3KAFA 2QRVA 1K9QA 4A0TA 5CQ2A 3M85A 2XP7A 3L4HA 2XPBA 2XP5A 3FSCA 2M3OW 2DK1A 2JX8A 3TDBA 4A0UA 3KAIA 5E5WA 3MQGA 2Q5AA 2JXWA 4U85A 3FS8A 2YSHA 2M8JA 3MQHA 1I5HW 2ZAJA 3LKXA 3MCBB 2YSIA 3TC5A 3KCEA 1YW5A 2XP3A 1WMVA 5E64A 2XP6A 4QIBA 2ZQTA 1TK7A 3ODKA 3KADA 3TCZA 2RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMV A;  3LE4 A;  1WR7 A;  2XPA A;  2ITK A;  3WH0 A;  1ZCN A;  2ZQU A;  3OOB A;  4U86 A;  3CNG A;  3KAH A;  4U84 A;  1PIN A;  2ZR6 A;  2KXQ A;  3M7N A;  2ZQV A;  2EZ5 W;  3KAB A;  2DJY A;  2YSF A;  2XP8 A;  1EG4 A;  2BA1 A;  2LAJ A;  2ZR4 A;  2M8I A;  1K9R A;  2DK7 A;  2YSB A;  2E45 A;  2JV4 A;  1NMV A;  3KAG A;  1JMQ A;  1O6W A;  2XP9 A;  2L4J A;  1F8A B;  2ZQS A;  2JMF A;  2YSG A;  2DWV A;  2ZR5 A;  5AHT A;  2F21 A;  4E5R A;  2MDI A;  1EG3 A;  2XP4 A;  3NTP A;  4REX A;  3KAF A;  1K9Q A;  5CQ2 A;  3M85 A;  2XP7 A;  3L4H A;  2XPB A;  2XP5 A;  2M3O W;  2DK1 A;  2JX8 A;  3TDB A;  3KAI A;  2Q5A A;  4U85 A;  2JXW A;  2YSH A;  2M8J A;  1I5H W;  2ZAJ A;  2YSI A;  3TC5 A;  3KCE A;  1YW5 A;  2XP3 A;  1WMV A;  2XP6 A;  4QIB A;  2ZQT A;  1TK7 A;  3ODK A;  3KAD A;  3TCZ A;  2RE3 A; 
#chains in the Genus database with same CATH topology
 2DMV A;  3LE4 A;  1WR7 A;  2XPA A;  2ITK A;  3WH0 A;  1ZCN A;  2Y8N B;  1RP5 A;  2ZQU A;  3OOB A;  4U86 A;  3CNG A;  3KAH A;  3PQH A;  4U84 A;  2WAD A;  5E66 A;  1PIN A;  5E65 A;  1FLC A;  2ZR6 A;  2KXQ A;  3M7N A;  2ZQV A;  1TR8 A;  2EZ5 W;  3KAB A;  2YAJ B;  2DJY A;  2YSF A;  3MCB A;  2XP8 A;  1EG4 A;  3FSB A;  2BA1 A;  2LAJ A;  2ZR4 A;  2M8I A;  1K9R A;  2DK7 A;  2YSB A;  2OWO A;  2E45 A;  2JV4 A;  1NMV A;  3KAG A;  1JMQ A;  1O6W A;  3LKX B;  2XP9 A;  2L4J A;  1F8A B;  2ZQS A;  2JMF A;  2YSG A;  2DWV A;  2ZR5 A;  5AHT A;  2WAE A;  2F21 A;  5E62 A;  4E5R A;  5U47 A;  2MDI A;  1EG3 A;  2XP4 A;  3NTP A;  4REX A;  4GLX A;  3KAF A;  2QRV A;  1K9Q A;  4A0T A;  5CQ2 A;  3M85 A;  2XP7 A;  3L4H A;  2XPB A;  2XP5 A;  3FSC A;  2M3O W;  2DK1 A;  2JX8 A;  3TDB A;  4A0U A;  3KAI A;  5E5W A;  3MQG A;  2Q5A A;  2JXW A;  4U85 A;  3FS8 A;  2YSH A;  2M8J A;  3MQH A;  1I5H W;  2ZAJ A;  3LKX A;  3MCB B;  2YSI A;  3TC5 A;  3KCE A;  1YW5 A;  2XP3 A;  1WMV A;  5E64 A;  2XP6 A;  4QIB A;  2ZQT A;  1TK7 A;  3ODK A;  3KAD A;  3TCZ A;  2RE3 A; 
#chains in the Genus database with same CATH homology
 2DMV A;  3LE4 A;  1WR7 A;  2XPA A;  2ITK A;  3WH0 A;  1ZCN A;  2Y8N B;  1RP5 A;  2ZQU A;  3OOB A;  4U86 A;  3CNG A;  3KAH A;  3PQH A;  4U84 A;  2WAD A;  5E66 A;  1PIN A;  5E65 A;  1FLC A;  2ZR6 A;  2KXQ A;  3M7N A;  2ZQV A;  1TR8 A;  2EZ5 W;  3KAB A;  2YAJ B;  2DJY A;  2YSF A;  3MCB A;  2XP8 A;  1EG4 A;  3FSB A;  2BA1 A;  2LAJ A;  2ZR4 A;  2M8I A;  1K9R A;  2DK7 A;  2YSB A;  2OWO A;  2E45 A;  2JV4 A;  1NMV A;  3KAG A;  1JMQ A;  1O6W A;  3LKX B;  2XP9 A;  2L4J A;  1F8A B;  2ZQS A;  2JMF A;  2YSG A;  2DWV A;  2ZR5 A;  5AHT A;  2WAE A;  2F21 A;  5E62 A;  4E5R A;  5U47 A;  2MDI A;  1EG3 A;  2XP4 A;  3NTP A;  4REX A;  4GLX A;  3KAF A;  2QRV A;  1K9Q A;  4A0T A;  5CQ2 A;  3M85 A;  2XP7 A;  3L4H A;  2XPB A;  2XP5 A;  3FSC A;  2M3O W;  2DK1 A;  2JX8 A;  3TDB A;  4A0U A;  3KAI A;  5E5W A;  3MQG A;  2Q5A A;  2JXW A;  4U85 A;  3FS8 A;  2YSH A;  2M8J A;  3MQH A;  1I5H W;  2ZAJ A;  3LKX A;  3MCB B;  2YSI A;  3TC5 A;  3KCE A;  1YW5 A;  2XP3 A;  1WMV A;  5E64 A;  2XP6 A;  4QIB A;  2ZQT A;  1TK7 A;  3ODK A;  3KAD A;  3TCZ A;  2RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...