1TKBA

Specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
678
structure length
678
Chain Sequence
b'QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title Specificity of coenzyme binding in thiamin diphosphate-dependent enzymes. Crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate.
pubmed rcsb
total genus 243
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1994-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkbA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkbA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkbA01
2UZ1B 4GP9A 1YHYA 5EJAA 1PVDA 3UPTA 1Z8NA 2JLCA 1B0PA 2BP7B 2VK8A 2Y0PA 4D5EA 2VBFA 4JU8A 1X7ZA 2G67A 1T9BA 2J9FA 3AHHA 4XEUA 1OVMA 1MCZA 5FEMA 2AG0A 3F6EX 1OLXB 4KXYA 2EZ4A 1POXA 2IHTA 1YHZA 4K9MA 1V5EA 4JUDX 2IHUA 2E6KA 2PGNA 1T9CA 2PDAA 3MOSA 1QS0A 1V5GA 4ZP1A 2BFFA 5K6TA 1TRKA 2Q5QA 1X7XB 1OLSA 1UMBA 1V16A 2JGDB 3E9YA 4RJIA 3AHDA 3AHJA 1V1MA 2EZTA 4C7VA 2YIDA 4JU9A 1OLUB 2C31A 1V11A 2WVHA 4MZXA 4COKA 1KEKA 3IAEA 2QTCA 3L84A 2BFCA 2EZ8A 5C4IA 2QTAA 2JI7A 5EXDA 1YI0A 2Q5JA 1V16B 3IAFA 3KOMA 2AG1A 1W88A 1YBHA 4MPJA 2DJIA 3AHFA 5I51A 2Q5LA 1OZHA 2BEVB 3OE1A 1OLXA 2WVGA 4K9PA 2C3MA 4K9OA 1UPCA 4KXVA 1X80A 3FZNA 1W85B 1RP7A 4GPEA 2O1SA 1U5BA 1YI1A 5EJ4A 2BFFB 1QS0B 1X7WB 1Q6ZA 1V5FA 3F6BX 5EJ5A 2Q5OA 2BFBB 3EXEB 4FEEA 1V1RA 3DUFA 1OZFA 2OZLA 5DEIA 1UMDB 2BFDB 2C3PA 1X7YA 2BEUA 1X7ZB 2J9FB 2Q27A 3HWWA 4GM4A 4QELA 2BP7A 3EXG1 5ERYA 3ZHUA 1AY0A 4KGDA 4WBXC 2Q29A 3EXFB 2C42A 4JD5A 4K9NA 1T9AA 4JUBA 5ERXA 2G25A 2R8PA 2BFEB 3LQ2A 1QPBA 1Y9DA 2IEAA 3EXHA 5I5EA 3DVAA 3ZHTA 1WCIA 4KXWA 4GG1A 4Q9DA 1UPAA 3LQ1A 1WCIB 2FWNA 3EY9A 1NI4A 4KXUA 1OZGA 3D7KA 5DGTA 2VK1A 2R8OA 5I5GA 2PANA 4QQ8A 3EXFA 5EXEA 3FSJX 2G28A 1X7WA 5K3SA 5AHKA 4MPPA 2R5NA 1YNOA 2BEUB 1YD7A 2JIBA 2BFDA 3EXIA 1U5BB 3EYAA 3DUFB 1GPUA 2O1XA 1V1RB 3AHCA 3EXEA 1R9JA 2JI9A 2BFBA 3JU3A 4MQ5A 1L8AA 2BEVA 2Q28A 3M49A 3DV0B 5K2OA 4K9QA 2YICA 5K6RA 1DTWB 3AHGA 4C7XA 1NGSA 2NXWA 2WVAA 5I4IA 2XTAA 5DGDA 5HGXA 1UM9B 2PGOA 2VK4A 1UMCB 1TKAA 1W85A 4FEGA 1X80B 1DTWA 4RJJA 1JSCA 2BFCB 3DV0A 2JLAA 5EJ9A 1TKBA 3M34A 1OLUA 1ZPDA 2XT6A 3ZHSA 5EJ7A 1V1MB 4D5GA 4RJKA 1UMCA 5HHTA 1W88B 1UM9A 1OLSB 3ZHRA 3LPLA 2C3UA 3RIMA 3UK1A 3EXHC 4K9KA 5ESDA 2JI8A 1TKCA 1N0HA 2C3OA 3LQ4A 5IMSA 1V11B 1POWA 1UPBA 1NI4B 4MPRA 3HWX1 4QPZA 3AI7A 5EJ8A 2W93A 5EJ6A 2JGDA 3EXIB 1QGDA 1UMBB 1T9DA 1X7XA 3ZHVA 1IK6A 3EXHB 2C3YA 3EA4A 4GM1A 3HYLA 2BFEA 5HJEA 1PI3A 1BFDA 2UZ1A 2V3WA 4JUFA 2BEWA 2FN3A 2IHVA 3AHIA 3AHEA 2EZ9A 2VJYA 3FLMA 1PYDA 3ZHQA 2JI6A 1ITZA 2X7JA 1X7YB 1UMDA 4JUAA 2OZLB 3M7IA 3OOYA 4K9LA 2XT9A 3DVAB 5HYVA 3M6LA 4KXXA 2EZUA 1PO7A 4JUCA 5EJMA 2UZAA 2VBIA 3EXG2 2BEWB 4GM0A 2VBGA
chains in the Genus database with same CATH superfamily
4BC1A 2ABWA 1OI3A 2XEXA 1OVMA 4RHUA 3GZJA 2ZDQA 4NCKA 2P2YA 4RZIA 3HA5A 4HGOA 4MUBA 5E95A 1F7VA 4IMIB 2B6NA 3MQFA 2WWYA 5IAGA 5EJIA 2W22A 2H48A 2L19A 2QN9A 4IV5A 4O4IA 3R8FA 1JWBB 2UUPA 3AY0A 1VSVA 3NBKA 4KH0A 3PGJA 3UH1A 2EZTA 4B79A 4BNZA 4C7VA 4EIWA 4UTRA 5KMGB 3S3TA 2O48X 5HEKA 3EFEA 4NCJA 1IDOA 1RWQA 3BS4A 3FIJA 2R97A 4HDRA 2FN7A 2UAGA 1MRZA 3IKVA 4C4PA 1MR3F 2G36A 4TMYA 1APBA 4N41A 1GQQA 3D5EA 3T5CA 2PX8A 3OURA 2QORA 3RSFA 4ZYVA 1F0NA 1YU9A 5CDYA 4LWOA 2B1JA 3QF7A 4AMUA 3SR0A 3U3OA 4B4WA 5ICGA 1RP7A 3TNYA 4ZFNA 1SIWA 2DETA 2YWCA 1YIAA 1XYVA 2PUHA 4TV9B 4G37A 3H1GA 3QKRA 1LC0A 3V7FA 1PL7A 2ZJ4A 2DH6A 3ABQB 3ZDQA 5BN1A 2PH1A 3OQ6A 3GH3A 1JHZA 3D8HA 5T41A 4UM9D 2C5AA 2C4WA 3KPJA 5BN4A 3DEKA 1KAQA 5ERYA 4I3HA 4BLRA 4DM4A 4XFDA 3A1SA 1KZ6A 2HU5A 1UOPA 4ALLA 2PMEA 5EZYF 1YC5A 2H6EA 2Z08A 2XR1A 2ZT6A 3O3OB 2WZQA 4IH9A 5AYVA 3EH1A 3R09A 4RHXA 1EGMB 1ICEA 1XTTA 2EEZA 2O20A 4HUQB 4QFDA 3LW7A 1E18A 1Q50A 1T3LA 4NG4A 4M1YA 3BBPA 1UWKA 1JR3D 3FVRA 1S2IA 2NPIA 2P11A 2VYND 3O9ZA 4IJVA 2JAPA 4IGIA 1CJVC 5KPDA 1M6YA 1EVJA 2XUDA 3IAXA 3HV2A 3PDWA 3DB2A 4H7DA 4FE3A 1HG1A 3CLRD 3ETGA 3FDIA 1KVRA 2CYBA 1JA0A 1EP9A 4X90A 3NHJA 1RXVA 1PWHA 1JHUA 4M60A 4RC9A 5F9MA 3RVRA 3X2FA 2A9KA 2CT8A 4OUKX 3FUTA 3AWIA 2J6BA 2GRJA 2ZE7A 4PCUA 2G9RA 1ZH2A 4DA9A 3DTVA 1DS6A 3QW2A 2HQSA 2VNJA 3W4IA 5AW3A 2DSNA 1S9DA 4Z4GA 4D5GA 2KYRA 4V0OA 4QUAA 3AF2A 1FSGA 1AGNA 2VDJA 3GJ8A 4FXPA 4CTMA 1B7GO 3L92A 1UF9A 4OG2A 4LG1A 4LXYA 1U94A 2V5AA 4YBZA 2K4MA 1WPXA 4HBZA 2YZKA 2HSEA 4MRRA 2E21A 3KV1A 4BO1A 3ZWKA 1ZVJA 1QGDA 2YUTA 1DEKA 3VU9A 1ORHA 3S2IA 4GO1A 4NMWA 2JKVA 3O8BA 3S2EA 2L17A 1QH8B 5LD2C 2Q3JA 3KELA 2XYRA 2NOAA 2DR2A 4GKBA 4JXKA 2H4XA 1T9GR 5A9SB 2AZXA 1P0IA 2YYYA 4DMCA 2P3SA 3MXTA 1Q0TA 1G17A 2WHXA 2UZAA 2VZ0A 3QE2A 3H5NA 4UEQA 4EUEA 4MV5A 1I4OA 1Z33A 1W59A 1RDFA 2Z5GA 5FV4A 4DV3B 3HKCA 5LQDA 1XEFA 3PLAE 2QR3A 3U44B 2ESRA 2VZ8A 3ZWAA 1L5ZA 2QN8A 4QD3A 2I2FA 2GYYA 3L5KA 2C97A 4K1LA 1SVLA 2V7XA 5ED4A 5ICMA 4Q1CA 3ICPA 4PHTA 4W7HA 2CYCA 2J59A 2LRHA 3ZI7A 2DBVO 5INTA 3WO0A 3KJHA 5AUQA 3S4YA 2ODWA 1CUSA 1CKEA 4RY0A 2X8AA 2M1ZA 1PZNA 2BH9A 1HGXA 1VHLA 2HV9A 4TMZA 1HLDA 1U1EA 5CCXA 2HWXA 2P41A 3LT2A 3PXUA 1GU0A 1OR8A 4TXMA 4BKQA 5J47A 1GA6A 4RVNA 2MSDB 5IBQA 3X1WA 3CVVA 3WGMA 1GJRA 2PH3A 2V7VA 4TLAA 1D8TA 5A4JA 3FETA 1RRCA 1GV0A 3AYZB 3W3AA 4M53A 3V00A 1I2BA 1OZHA 2BJHA 1P91A 1N2HA 1WNFA 3R23A 3EC7A 4WKOA 4XYEA 4IIEA 1HXHA 3LDGA 3PGKA 5ALIA 3QXGA 3VX4A 4C89A 1KPIA 4D3ZA 1J23A 2NT3A 6ABPA 1NC3A 3QBTA 1FP6A 3IB6A 4DLSA 3O3MB 1QU2A 1JALA 3EW7A 4HL6A 4GI1A 4LJ4A 4M9CA 1I3OA 2X8WA 3ITKA 2H1FA 4U3JB 1E3IA 2PJDA 4JNCA 2C7OA 2IHYA 1A77A 5GIOE 3THOA 2ZIGA 3WK9A 5BSFA 2HRZA 1Q16A 4GM4A 3WV5A 4X64B 1CQXA 2XVYA 1TU0A 2RHGB 4RH1A 1AY0A 2OAP1 4GXRA 4QVIA 2ZR9A 4Y2TA 1TTPB 4DWVA 4LA4A 3VSBA 4UCXA 3R7WB 5JHGB 1DAMA 1F8GA 3L4JA 3N8KA 1GTMA 2VSOA 2JA2A 3D8NA 1WEKA 3OE4A 2P2SA 4O2BA 4XOUA 5D8DA 3RYFA 4DWWA 2XRFA 5ITSA 4GEGA 1P2BA 4LGCA 4TXLA 4RA6A 4U3JA 5TVKA 1KDRA 1IY8A 4LJRA 3N5CA 4MUEA 1PR0A 3JR7A 3CW9A 1VYTA 1H0RA 3C3XA 3V33A 2R11A 4EX6A 4CTOA 5IT9A 5EIHA 4U7TB 3K0KA 3KBBA 5EHNA 4A8JA 2KBFA 4Y2RA 3CZPA 3UAXA 3EBOA 2PUGA 1XRSB 2PGJA 3MG9A 4Q9LA 3LP6A 4GX5A 2IUEA 5K0EA 5K6RA 2WICA 1ZJZA 4ALMA 1JHMA 3TDMA 1QAQA 2A2ZA 4NAHA 4Z4QA 3GD5A 1J8DA 4YMWA 3SC2A 3EPPA 4FEGA 2QT9A 2AA3A 3R3SA 1OBVA 4RVHA 3SHVA 5FOWA 4YRQA 4WZ6A 3TX2A 4ZI7A 5LP6B 1JUDA 4F8YA 3E3OA 3OFSA 4GI2A 4PYNA 1IG3A 1XUOA 4MWTA 5DIZA 2WD8A 2C3UA 2Q0QA 2ZTHA 2Q0HA 2R65A 3FDZA 1I30A 1PGPA 4JVSB 4QYTA 3A6JA 4RZUA 5TEVA 1PJCA 2ODTX 2QUKA 2QRQA 2HLDA 1D7AA 5AP9A 5E9AA 1MO2A 3CBGA 1XZ8A 2IOYA 3FB1A 3QWAA 1UKBA 1SKQA 2ZT8A 5DWQA 5AXBA 2VH2A 4TN5A 3W3AD 3SG0A 2WTEA 2CV1A 2C2BA 1U0SY 1J33A 2FAXA 2AK3A 4ZZ1A 4X3OA 4S04A 4DLZA 4IDNA 4YI5A 1GZUA 5FOUA 4DBVO 1TTQB 3MWFA 5K3DA 2XDYA 3FAZA 3K8ZA 3KR1A 3I01A 1Z5PA 4NYIQ 3IELA 3PKIA 5K4GA 1KXJA 1JFRA 3BWMA 1ZMOA 2ZYSA 1Y8RA 5EXPA 3H04A 1EIZA 2R1VA 3BBLA 3WNDA 4CGYA 1W25A 5DTMA 1O4WA 5BWNA 2BI8A 1BX3A 4X7MA 5EIEA 1R0RE 2F1KA 1X8KA 1JPNA 3O4GA 3ZYCA 4FNGA 1CRZA 2AFRA 2EW2A 1NXPA 1TU3A 1YB7A 2JNWA 5E3JA 5DBGA 1PKEA 1V16A 3JSXA 1MO6A 3AW8A 3JZAA 3AHJA 3KKZA 1O89A 4JU9A 5T6MA 1ZGBA 3BRWA 2HT1A 5KCZA 2WLSA 3KJZA 5FORA 3HEAA 3TOVA 5F21A 1KK2A 3ESQA 3SE0A 4EHDA 5AUPB 3OFJA 5KB3A 1SXIA 2EBWA 4IFEA 2AQHA 3AIOA 3H8WA 2WJVA 3U61B 5HF9A 3NUQA 3OHPA 3JZFA 3N7TA 4HQNA 1XJ5A 1E20A 3IPAA 3SEQA 4X65B 4A0GA 1C9DB 1CBUA 4G0YA 1R5JA 5FV7A 5AICA 2JIDA 1SVUA 2IODA 1XNGA 1JP7A 2FPXA 2MR5A 4QU9A 3ELUA 2XE6A 2NZYA 3B5JA 4J1SA 2H59A 1N2CB 1K06A 3DL0A 3FJ1A 2UZ4A 4JB8A 4U9UA 4NFHA 3SGLA 3ZWVA 5KSWB 4YK7A 5FH9A 1UQUA 5DK4A 4QRDA 4WCVA 3KOXA 3PDIB 2GQ0A 4JXZA 1G55A 1FVFA 221PA 2VF5X 2Y1GA 4PYRA 3AW9A 3K9FC 1GZ7A 4J76A 2X9QA 4AS3A 5AJWA 4D4GA 2C42A 2QRJA 1FLDA 3U3JA 4EFNA 1LXCA 1ZJ6A 4QYWA 5DYYA 4DV0B 5LVAA 3E03A 5BT9A 3DCJA 2O7VA 3TX6A 4YJ2A 4BVAA 4L07A 1GG8A 3CHYA 2QM3A 5LDGA 2DULA 4R1SA 2G1JA 5CU7A 3NVKI 2ST1A 4XQ9A 2ONJA 5GZ1A 3IVXA 1I9CA 2QMEA 1ANKA 3TZLA 2ENUA 2DPLA 2AJDA 1IY1A 2WTXA 1E7SA 3B38A 5LBIA 3WGJA 1AURA 4YRMA 5HIKA 2OD2A 3K6KA 3A10A 3A31A 3I9KA 4NJEA 1DWQA 4TVOA 2HOQA 4NV1A 2AEMA 1ZAYA 4BE9A 2I6SA 4PBRA 1BQ3A 3V4PB 3M4XA 4R9NA 1JDUA 2QNBA 3EDOA 1GZVA 1FQOA 1YNSA 4ND2A 5KYUB 5JVDA 3V6LA 1Q0HA 2ZR8A 4M88A 3A0UA 5FTKA 1M8PA 1PNTA 2BHNA 4GHWA 4NMHA 4C2UA 1E2EA 4AZ0A 3LKZA 2XGOA 4BCCA 2JFUA 3IOBA 1CUAA 2WF7A 2ZJ5A 3QY0A 4II2A 3GOQA 4D9CA 4RTSA 1E58A 3SVZA 3RK1A 5EPEA 2FX5A 5CVTA 4TQ9A 3CX3A 2Q5CA 2ZQ5A 1XZJA 2BW0A 2FF7A 2ISCA 2JJ1D 3I9JA 3ZDAA 3IDSA 4KLRA 2O8DA 4NNOA 3DVAB 2CJXA 3DD5A 4U6QA 3TFWA 4JP5A 1OTYA 4D8XA 1WW3A 2QRVA 3VO9A 1YJBA 3LI2A 3G49A 5DLQC 5I9SA 2J3EA 2R2GA 1AGYA 2IYNA 1AZLA 2QD2A 3GCWA 3DVLA 4P5EA 2BLNA 3QH4A 4Z9FA 3ZQ4A 5B3JC 4N82A 3DKPA 4MIYA 1HDRA 1C29B 2W2KB 2DCUA 2YCBA 3HUEA 1ZYUA 5B3LA 5IM4A 5FFNA 1ZNYA 2OUIA 3MTBA 4HPXB 3WI7A 3GMDA 3BMXA 1UZLA 3IHWA 5BWOA 1L4BA 1VG8A 1OLSA 3JQPA 2BKVA 1YONA 4CMKA 1D6NA 3SHOA 3QXCA 1AHIA 5ANRB 3IEVA 5KNBD 3N7AA 2HMYB 1OGYA 1QRAA 3L84A 4RA9B 4CL8A 4ZAYA 3COSA 3JZMA 3HJCA 3P2IA 4KX3A 5EE0A 3ZYZA 3BZWA 3IH5A 3ZWMA 4E2ZA 3G5MA 2BR4A 1HNWB 2GNOA 3FR8A 2OQIA 4MTLA 3TQRA 1V0JA 1Q5PA 2QB5A 4LOIA 3N1UA 3OE1A 1TM5E 5EZ5A 1E6LA 1QIEA 4PYKA 4QASA 5F5NA 1GFZA 4R8SA 3FNHA 1BEEA 2W2MA 3GLTA 1EX7A 1Z08A 2EJWA 4PM4A 1IQ0A 1EA7A 4M9QA 3V8EA 3O90A 4G81A 1OILA 1ZUWA 3HGQA 3R3HA 2ACWA 4IF6A 1B3BA 2VPYA 4D46A 4JLMA 4HDNA 1V45E 1WUJS 3GJ5A 4QVKA 2J9ZB 5KO2A 3UYLA 1S4MA 1V7CA 1ZVMA 1N5IA 2QP9X 3G2IA 2GEFA 1XPUA 2H65A 4CL2A 2JFNA 3H13A 1NI5A 5AVWA 4YRIA 1PVOA 1ZCZA 4N49A 4ZYUA 3BREA 5JHHB 3OM0A 3F71A 3EAGA 2V0NA 3KX2A 4L76A 5CNKA 3N76A 1PJ3A 3SJAA 3UGKA 1FB5A 1FW8A 1MPXA 4L28A 5B58T 4HV4A 4CIBA 2HV8A 2J08A 2P3LA 4JODA 3W77A 2R62A 1DT5A 4YCSA 3AL3A 4UFPA 1D4FA 5FR1A 1LX6A 2DRIA 1USIA 3OF3A 1P9WA 1D8AA 2QS9A 5CX4A 2ZP1A 4Z0TA 5CAEA 1VRCA 2H7CA 2AQKA 2EX0A 3PLRA 3ICVA 3I64A 3MXOA 2ZRPA 1WSDA 3A1EA 1DTEA 2C07A 5FBQB 4RY2A 1U3UA 3LA8A 4KE9A 4KIGA 1XEWY 2B30A 2GHQA 5HOEA 3V1YA 1KBQA 3K9HA 3TTYA 2O2SA 2C5LA 5LOVA 1ES9A 5CVDA 1ODFA 1G21A 2AG6A 3QXJA 5B3JA 1IXKA 5G02A 4E5NA 3A1FA 3H1PA 1CULC 4ESEA 4C21A 2I9PA 5K3FB 2PWAA 2VOEA 1MH9A 3H2SA 4RJLA 1ISRA 4QXAA 2F59A 3ZOZA 5KC8A 4DDTA 2GO7A 4GBED 2XUFA 3ZCTA 4Y6PA 1P6XA 2B94A 2RAUA 3A4IA 5TC4A 4H4EA 5JNSA 1ZNXA 1BA3A 3N5KA 4TV8A 1Z15A 1TEVA 3DP7A 1P8JA 2QY6A 3SQXA 1FQJA 1QFXA 3EZ2A 3JWIA 3EULA 1OLOA 5H82A 4LSMA 5HA5A 1F8YA 1PYDA 3JQFA 5DV9A 2WPDD 3WQSB 4BNWA 5B7NA 1G5RA 3HJAA 3H5WA 2JLWA 4MMYB 4XDGA 3IRUA 1EDEA 1FRFS 5SZKB 3HVIA 3R0JA 5ICCA 1PEKE 3BIOA 4GM0A 2FPPB 1M2OA 4KV9A 3U1TA 4IIHA 4LZJA 1RYDA 2A1TR 2RHRA 2VKQA 5A5VA 4Z9BA 4EI9A 2XGSA 1ZMTA 4R2HA 2O3JA 1R1DA 4E14A 1SUIA 4HNRA 4I6GA 3SKXA 3PEUA 3WWCA 4PY2A 1ECBA 1PJTA 2ZRKA 3DKRA 4KO4S 2EFEB 4EK9A 5BSUA 1Y1TA 2BFFA 3HKEB 1IZ8A 3P0RA 3DO6A 1W5EA 2J46A 2B0CA 4OQZA 1MJGA 1L5SA 4ADSG 2CF5A 3RTDA 1UBKS 2VHYA 3D3QA 4JGIA 1H9BA 1XMOB 2QLFA 3TUIC 3HO8A 2NTVA 1L3IA 3I76A 3JX9A 3OOEA 1EGVB 3A27A 2DPXA 1L1RA 4GX1A 4Z4CA 5C51B 3ETLA 1UMKA 2HJRA 3IR5A 1YL6A 1M0TA 2PQ6A 1ZIXA 1HLPA 4J91A 1S8FA 5DX8A 1JKJA 3D1VA 3FYSA 3CM0A 1GYQA 1D2MA 4UKDA 1H0KA 1N5LA 2ECOA 3VJKA 5IVPA 3BTOA 1M6VB 2OC9A 1L4MA 3LBIA 4BASA 1XTVA 4NIMA 2QX4A 1U28C 2PZBA 2WUEA 3I5UA 3KUKA 3IQHX 4OSPA 2HBZA 1ILWA 2YNMA 4S35A 2KPOA 1UXJA 1XO1A 1Z8HA 3Q9NA 3VSAA 3DPUA 4TX1A 4W5OA 5COAA 5CCBA 2RB5A 4NBWA 4KVGA 2XUOA 1NJ5A 3MMNA 4RPJA 4J7XA 1ISHA 3UUWA 1PDWA 1RSZA 1NYQA 3ULKA 4RDIA 2B78A 4Z0HO 2R8PA 1WKBA 4DCJA 2FFRA 3M6MD 1K5GA 1TU4A 4JENA 2J3JA 4YAFA 3HXQA 4JN6B 2EJUA 5HZHA 2Q3EA 4FMPA 3RFVA 3ZWQA 1LPSA 1Z5NA 3HI4A 3S1AB 1ENPA 1KOJA 4ENVA 5HIAA 4M1SA 1J06A 1NVTA 2CXTA 2HJHA 4LDAA 4HNTA 3P2OA 2RHOA 1X94A 3JW8A 3K9QO 1EHYA 1GPBA 3OMXA 4PSVA 4BCDA 3SC4A 4U8GA 4HLNA 1GPUA 2DLNA 2E0IA 4MRPA 4LYDA 3K1AB 4YJKA 5EHQA 4KO8A 3GG2A 1G8AA 5E0OA 3O1LA 3D8TA 1OFHA 1Z0ZA 2BGMA 2DT8A 2HO4A 4U5QA 4EG6A 3AL0C 1JEQB 2QRPA 2AR7A 4P4GA 5ER6A 4ARVA 3OQ1A 4CCYA 3MINB 4AG3A 1RT9A 4MUYA 2DVMA 2V6IA 4Y1RA 1QH1A 2DT5A 1FBTA 1DJOA 2OFWA 5DM4A 2ZAGA 2Z5VA 2E89A 2CLEB 3ZS8A 5LQAA 2Q3CA 5ECYA 3WNCA 5L51A 3EQ9A 5JG7A 1BNCA 5DN6D 1SCDA 2YWRA 1RD4A 1MO4A 4LQCA 1I14A 2VNIA 2I4MA 3GBVA 1PLKA 5MN5A 3GDWA 2HHJA 1SZJG 3EH2A 5DJ5A 3J80A 1TB4A 3I73A 1DBRA 5CVEA 3UT6A 2B4RO 4EA8A 1DUSA 4FN5A 5IUJC 2GPSA 3I6IA 2QPOA 4Y2GA 5KQSA 3HYNA 3DTVD 4US0R 2IYPA 2BGUA 1H6BA 2CVHA 3GEEA 3N6VA 4HDQB 1FA9A 2C0QA 2WYHA 3ISVA 3ND5A 4OI2A 4MI6A 4ZOCA 5IJXA 1NMZA 1YZUA 3W6OA 5LU9A 4JFAA 4ZJUA 3ZDYB 1RKBA 2EDAA 4EBFA 4DIMA 2C5GA 3R44A 4IXNA 1WDKA 3QXSA 4U7HA 4QGSA 3DC2A 4DQXA 3CURA 4DRZA 3LT5A 2C7BA 2HMVA 5JC1A 4TZ6A 1TIPA 3STYA 3KZVA 4DSAA 3AF3A 3D6MA 1EWQA 1JKMA 1K2VN 1B0PA 1G3UA 2BL4A 3E53A 5IKXA 2F4VB 2C96A 3MT0A 4CM8B 1CUHA 1H2WA 3NKLA 5SZHB 2BN4A 3SYRA 3EGOA 3WMRA 3WYFA 3IOCA 5K0ZA 1QP7A 2VYVD 2YNMC 4OKIA 4Z3KA 3RADC 3AINA 4EAAA 3UFBA 1CR6A 3PITA 4YP0A 4F4UA 4JT4A 5BVHB 2PJZA 1JDBB 2A9OA 4LRSB 4GXQA 5ALOA 2JLQA 1K6IA 4JLAA 3AI3A 3WIOA 1P4JA 2Y77A 2DHDA 4M49A 2HL6A 1VXOA 2WF8A 2FEAA 1SXHA 3CLSD 1HR0B 2W4QA 3OZDA 1YR2A 5TQ2B 3T3MB 4B34A 2ZCUA 5DNEA 1N1MA 2OA0A 1C4XA 5HQ3B 5CXXA 2OQVA 2I29A 4CQJA 1KDOA 1E6WA 4UEKA 1L7OA 1CY8A 1L5WA 5IX8A 3PDHA 3D4LA 5JQGA 2W6ZA 4Q4DA 1UP6A 4WECA 2AG5A 1E9DA 3BE8A 3MAJA 1JIXA 1JLLA 1E63A 1QLHA 2R4TA 2GOYA 1G63A 1J22A 1V6SA 3E6AA 3R3UA 4IIJA 4Y2HA 5G0SA 2CZCA 3RS5A 5B64A 3B7GA 3BD7A 4Z86A 1SK9A 1E1QD 2ZBUA 2NU8A 3RK4A 3STWA 2D54A 3WLOA 4PNEA 1I4EB 1QQ6A 2GK3A 4LV8B 4B43A 3BD9A 4N5IX 3PFBA 4MXDA 4PFSA 3VR6A 4JD5A 4DCMA 4DR4B 2W2TA 2RJNA 1QPBA 4NMMA 4XRGA 3I8XA 1J6UA 1QIIA 4JS0A 4LBYA 4PFKA 4HVAA 3E58A 3ZD8A 2IYQA 1SQGA 3K0FA 4DA6A 1CDZA 4KMRA 1VTKA 2ZKIA 2PS1A 4G4IA 2ZIFA 1A82A 3GFOA 3NDJA 1SU4A 2B20A 3TIFA 2XUQA 2XRZA 2VHEA 1ULBA 4RIHA 1DKNA 5FHQA 3EARA 2CL0X 3QVUA 3DCYA 1KI1A 5DVZA 2VSNA 1JQ3A 2OCBA 3GLUA 5BSWA 3W5CA 1WVIA 1WZCA 3KL2A 3L7LA 1LFDB 4HUTA 3D7MA 3DLHA 4NQZA 5KVQA 3E9CA 4YFYA 3N9IA 3WK5A 4BUZA 5HCUA 5D00A 1DKLA 1UBEA 4UXIA 1E4YA 1TC2A 2X7HA 4BV9A 3PXCX 4QO7A 4UDNA 4BRSA 4ZI2A 3IR7A 4AKGA 1NRJB 2BY4A 3AEUA 3MVEA 4C7OB 2OCDA 1TQDA 3RHTA 4ZT6A 3NDIA 1PEDA 1ZJ5A 2QMHA 3VYRB 2JZNA 1HNZB 1XJ0A 1IVSA 5JQGF 3QV1A 1UJ2A 4MJLA 1BW9A 2NAFA 4E09A 4F2DA 3T3NA 2Y1LA 1PW7A 4L3OA 5DM70 2RHWA 4EOGA 4CTJA 4DPLA 5KQRA 4WFIA 4DCUA 1U0GA 2HHAA 2H2FA 1H65A 4QPNA 3A1WA 4BN5A 4AVYA 3QHQA 1EM6A 5I3ZA 3NC0C 3UTDA 4G07A 1XQXA 4KIUA 4N18A 1S2OA 4B6SA 3T0IA 3TR6A 5JFTA 2ZUTA 4AU1A 1HL3A 1E2BA 1J9ZA 2OORC 3EG5A 2FEMA 3GLFB 2CNKA 3O92A 4NQRA 1O6CA 1BS9A 2HF2A 4OXQA 1DG3A 1JFFB 1ZOIA 3K2QA 4MUNA 5HF5A 5B2ZA 3TRDA 4CMIA 3TG8A 2C8LA 2QN7A 1QSGA 3ZD6A 3CWCA 1LUAA 4N7BA 4RKFA 4ZICA 1U8ZA 2LCFA 4TTJA 3L06A 3FROA 1D0IA 2V7TA 4UBKA 1YRWA 5BN4B 3FFAA 2QL6A 1V4NA 2G83A 1QKJA 1DQNA 3KHTA 3NWOA 4DWOA 2DKFA 4TLEA 4HH1A 4MKXA 3IBTA 5G3ZA 3DE0X 3C3YA 2QYOA 4R3WA 3N8HA 1XKQA 3OX2A 4J2HA 1ZK2A 2I2WA 4YT5A 3T3PB 1Z5VA 1JHYA 4Q24A 5BMVA 2PFSA 3I01M 4GSLA 2NO7A 1E32A 3ADPA 3B2QA 2LCQA 3UMVA 5I4KA 2Y6VA 13PKA 1ZH6A 5JECA 1T9GS 3DL4A 3ER9A 2H4FA 2HDWA 5K0NA 3LK7A 4OB8A 2FETA 3FPGA 1OT3A 1EUDB 4HB0A 4UNQA 4CG3A 4NFYA 1TFRA 1HA3A 5D2CA 1E0DA 3T52A 1IYZA 3D6NB 2WILA 1E61A 4HUJA 4ONEA 4R01A 3THYB 5K0TA 1WJGA 3AFNA 3E7FA 1EFCA 3MHPA 4L15A 3QA3E 3L40A 4LISA 3W5IA 1CZKA 3KYDB 4CKBB 4LJ9A 1BWPA 1LBQA 1U6JA 3JQGB 3QWBA 4U6NA 5DNVA 3VDMA 1YRHA 2ATIA 1GY8A 3CW8X 2NXCA 2I2DA 4FJ1A 3TQHA 3DOJA 2WT9A 5ARBA 1NZJA 3NBZC 3NUGA 2PZGA 3UATA 3CR3C 3GIWA 2CV0A 3SAJA 5CM8B 1P7CA 3GZ4A 1HZZC 4CTNA 5KSOA 3QTBA 3HPRA 2FSGA 4MLCA 3CKLA 1EZ1A 4B7CA 1QH8A 1AZTA 4PLTA 3CNBA 1SUCA 4FP9A 3KLOA 3N2EA 3OIUA 4X92A 2IRWA 5ECDA 3F2VA 3NAZA 4FFPA 4NWIA 3AJ8A 3DQPA 3IQDB 3U81A 1KNXA 1N8SA 2DMRA 3FTQA 1ODSA 2R8EA 2RGCA 3B1ZA 4M0CA 5AW5A 4OFXA 1PQYA 4HY3A 4Q03A 4C78A 3PYMA 3U6KA 3NFYA 2WZBA 1UT8A 2YINC 5JJKA 1P1CA 1JQJC 3FKSA 5EINA 1O5TA 4ILEA 4BQPA 1W73A 2D8AA 1TM1E 1S1CA 4TXJA 4URVR 4Z2AA 3EVZA 4PFJA 1ZM2A 5JAHA 2VYCA 2ATCA 2IW1A 4NS1A 4WK6A 5GVRA 1W7AA 1DBQA 1KAHA 2FZ4A 3SZUA 1BN7A 5EPUA 4QDTA 4JNKA 2X0FA 4RPKA 3G2JA 1SJ9A 1IUNA 1KJYA 3G9XA 4MCIA 5IEBA 1JHXA 1ZMXA 1GDDA 1IN5A 1QGED 1REQA 4NRDA 1MOQA 5AVOA 1RLUA 4P98A 1F1BA 3R41A 4E94A 2ZXEA 5IC6A 1Q20A 5HHTA 4M1OA 2HO5A 4OQQA 1KMNA 4ZMBA 2AFIE 2NU7A 4M38A 3LYLA 4AZ3B 1PGNA 4CR8A 3TTSA 4IIGA 4AYXA 2WJZB 3B9BA 3F78A 3JYOA 3PHLA 4REMA 3IIKA 1HTBA 4J75A 1GSOA 3HV0A 1DRVA 3MJHA 3N70A 4LHSA 4LJ5A 5AVQA 1XMVA 2YIVX 4UCWA 3Q9LA 3UUFA 1S2LA 3RU2A 1TJ3A 1U3DA 1UPXA 1XJWA 3G8DA 2FN9A 3FY4A 3I23A 4B45A 2UU9B 1IN6A 4C5AA 4KJZA 2VJDA 3AKDA 4L6AA 2NUTB 3FKQA 3U4GA 2AI3A 4E51A 4CKWA 4JUAA 3D6UA 4YJGB 4LE2A 1JXAA 3E0XA 3EODA 1JR6A 4PGHA 3H6KA 3IULA 3ND6A 1CQWA 3W1WA 2CNNA 5KJEA 3K2IA 4QTUB 3WL3A 3WIDA 2P9QA 2A4KA 3A3NA 2DQSA 3BH6A 4KPYA 2FSHA 2XWQA 3AVQA 3RE1A 4AICA 4DSUA 2NXEA 1J0BA 1G7TA 1ZJYA 2O3UA 3WLHA 1N3IA 3ETJA 3ZK7A 1G6Q1 4I55A 3AEQB 4CDGA 1SXJE 2NGRA 3LFTA 2VJQA 1EJ2A 2Z6AA 1G38A 2D59A 4FI3C 3HP1A 5CFOA 5LU8A 4KKVA 2I9KA 2X8LA 2WSYB 1O0CA 4HK4A 4FLMA 3PC7A 4B3FX 4HNGA 1CJSA 2EARA 3GLHE 4RUKA 3U31A 3CBQA 4L5BA 1EEXB 1J2EA 2ZQYA 1O4VA 4YX9A 2RGRA 4X60A 3VH2A 4CKXA 2W98A 2QRGA 1UK6A 4ZHQB 4Q4AA 4KUHA 4H7JA 3H2IA 1X7WB 2BR3A 4KQGA 4BBPA 3W2EA 4DWJA 2PE5A 4AZ3A 4KO3S 4JX8A 1CZNA 1Q0ZA 2AEEA 1G2IA 3AUYA 3E5RA 3AP2A 3KXDA 1X7ZB 3OOJA 4YRRA 5LSAA 3ASUA 2UYCA 1LTKA 4DV6B 3D59A 1ULAA 3MM4A 5TT1A 1VLZA 1YUBA 2FGJA 1FMLA 4MQ6A 1AZWA 2ZRMA 3NWBA 1R4NA 2Y76A 4FFLA 4LRWA 1TRHA 3B7PA 1Q14A 2O0MA 3LU1A 3GUUA 3A4VA 3H4IA 2C1EA 5JROA 5EE5B 4YLEA 1Y6ZA 4DA8A 3LBFA 1KK0A 2JK1A 2ZYRA 2F00A 3CEHA 4HLUC 1W29A 5EE9A 1HE3A 4HDCA 4P3XA 2ODNA 4J3NA 1FMTA 1U5BB 4MH0R 4EPRA 5E1MA 3HVRA 4MV0A 4R3NA 2NUAB 2BFPA 4G5GA 2O0JA 2QQEA 3WR5A 3DDNA 3V34A 3TXAA 4EP1A 1Z39A 2XJ9A 5HCIA 3IURA 1N2CA 3H5RA 4PNHA 5THKA 3DFFA 3N2GA 4HAZA 4KN6A 3WYCA 5KOJB 1TDJA 1YS1X 1UFKA 1CZLA 2I7XA 1VBNA 5DRTA 5LQNA 1N2BA 2DYKA 3NP7A 4JFRA 4L4RA 4CV2A 1GUYA 1D5WA 1W6RA 3LHSA 3OMWA 3I9V1 1DJQA 4IJ6A 4AN1A 3CLUC 1F7UA 3PEEA 1IPFA 4M9UA 3MYYA 2D4HA 1D04A 2H1CA 3LGSA 2PGXA 1S5PA 4H2DA 1R16A 1MNAA 4YP9A 5HRAA 4NMLA 2WAMA 3T1HB 2BTQB 1W30A 2WKQA 1YAHA 3EZFA 4IXWA 4LJLA 1F8UA 1MX3A 5ALDA 1NBIA 3NONA 3X1JA 3RFTA 3KVOA 3TLEA 1S3GA 5EP2A 1HOTA 2MU1A 2OAEA 1DSSG 2CF6A 3EY4A 3FSEA 1XVIA 4FDMA 2F8TA 3DMYA 3DTYA 2DHCA 4QFCA 1G59A 4ZT3A 3Q3HA 3M6IA 1C2YA 4U00A 2XLCA 1F6WA 1U0OC 4R05A 3G1WA 3MTQA 3LXMA 4RW0A 2OO5A 3N2LA 2AZTA 2CSUA 3W78A 3UCEA 5SYNA 3U62A 3ZUGA 4HGPA 1EB8A 2JF0A 4EKEA 3DZBA 4H3HB 1E1MA 2Q0XA 3KXPA 3JTMA 3PXXA 2RMKA 2IXBA 4C14A 4KQJA 1C0IA 1P3Y1 2D62A 2XMRA 2BPOA 3ESXA 4GOMD 4RU1A 1PBTA 5ETJA 1QDLB 2YW9A 4G5QA 5CLGA 2IZ7A 1Y1LA 3BCUA 1JF8A 4UNSA 2GZDA 1FU8A 3V32A 2CHVA 2XMCA 3O4IA 2QE7A 4NZMA 3G82C 4GX0A 3KAQA 3VNSA 4RTJA 1UK8A 1RMYA 5EXDA 1U9IA 1D7OA 3Q0TA 1UH5A 2YOHA 1M1YE 3UJCA 3ADKA 3PNYA 2PGAA 3CSSA 1NR5A 3ZHYA 4JY7A 5IXYA 5LQCA 2W2XA 4MWEA 4KLZA 4RDCA 4OFZA 4ZK6A 4OAQA 3H5AA 5C1PA 2WYOA 1CUEA 4DBLC 1A7AA 2PCLA 4IGKA 2J0UA 2R6JA 1XRJA 2J7KA 3HFGA 1AHHA 3ZLUA 1GRQA 3QFHA 1W8DA 5A3RA 5L95A 1BDHA 1QGZA 2B5VA 4J0JA 4PRZA 4KOAA 2WIAA 3GW8A 5K0LA 3TCXB 2AXQA 2AYZA 3U09A 1KY4A 1RC0A 5E9WA 4O4JB 4UM7A 3B3FA 1YKGA 4LNUB 2ZQZA 4J6EA 2OFOA 4KC0A 1GT91 2PX3A 1VE3A 2HUNA 2F6RA 1O54A 1FRVA 2OO3A 2WQZA 4ZK2A 4CGZA 4TUYB 2JLBA 3VR3D 1JLHA 3MB8A 5DX1A 1CS0A 2AJ8A 1NSYA 2AF4C 2I6UA 3ENNA 3GPBA 1ISJA 3M6AA 3OT1B 4PTYA 1I6LA 1OXMA 1TGYA 5A7GA 1GP2A 4M0FA 1SUAA 1R6XA 1NWHA 3N6RA 4G65A 5D51S 2XSZD 1J21A 1X74A 2ATXA 1WP9A 3EXEA 1YOVA 3KUUA 1M34B 4I2VA 4JKYA 4MR8B 5CH5A 2D6FA 2YFHA 3G5AA 3OICA 4XJXA 3FHTA 4BX3A 4GMXA 2GS9A 5ECWA 4JSYA 2I87A 1JA9A 1D1QA 2C4UA 3EVEA 1G7CA 3FUCA 2BUCA 2FZGA 2Q3MA 2V4MA 4UE2A 4AUKA 1FFAA 1BH2A 2I7DA 4MKRA 5JLAA 4EX7A 1MLDA 1GVHA 1MB2A 1SB8A 3OPQA 3K5HA 4G2TA 5FBZA 4KFSA 5A5FA 5JRZA 3FOWA 4QOHA 1KH1A 2G71A 4HI0E 2VAVA 4M99A 4ZYYA 1Z8DA 1O6BA 4HQOA 4ZMSA 3MCUA 5L45A 1O9HA 5FUVA 1XKTA 2QVCA 5IFLA 3WHIA 3RUEA 1IG0A 1RI5A 3NHFA 4BMDA 1A4RA 1OAKA 2ZWVA 5D84A 4D25A 2YDYA 4JX9A 3HBJA 5J5VA 2ZSDA 2M9MA 2X4LA 5CYPA 3CVJA 4ZDKA 1DG9A 1G8KA 1X13A 4JCOA 2XZLA 5BR7A 4XGIA 2OP1A 4F4JA 3T5AA 3TNFA 2YJ3A 1Z2OX 3KQWA 4XR9A 1VKNA 4Z1MD 1NNEA 2YYSA 3I39X 3FCCA 4TSKA 5BQXA 4OAPA 3HCAA 4NZYA 1Z17A 5H68A 4UUPA 3QE4A 2EJTA 4YP5A 3UWOA 3WMGA 1N6IA 2Z2XA 3IBSA 4NXNB 2QOEA 2YBEA 1TJYA 3T0GA 2IYOA 3AILA 2C4HA 3JV7A 3PUXA 3ZNQA 2ZPUA 1NR7A 2VEOA 4TKLA 5C1DA 3LUGA 4NPCA 1PJAA 3L49A 3K0AA 3ORHA 1IOZA 1LWNA 3KM0A 2NV2B 3OFNA 4OEHA 3UPDA 1K7EB 3L8HA 3LZDA 1RP1A 1U2DA 3GFGA 1YFJA 2VJAA 1K0UA 3FBWA 1ZK1A 1DJLA 2LIVA 2YH2A 2OZPA 3FCOA 4N3BA 2WJ6A 4H7KA 3WSWA 2C7PA 4GKVA 4I3FA 2P35A 1TJ4A 3QVGB 3R0QA 2AOTA 1L5QA 3A37A 3MGGA 1IN1A 4GYWA 1V11A 4I6EA 4JBXA 3B48A 4DBLE 3LWZA 2AR9A 2C7GA 2X9VA 1AKTA 3ZZ1A 4YPFA 5TMPA 1I1OA 2DJIA 2BMAA 4P4NA 3AOEA 5D86A 4ZQCB 4DDKA 2ILTA 2OGWA 1U7DA 3KG2A 4FC6A 1TA4A 1L5KA 3I5YA 1J9GA 4MKHA 3HA2A 4DC1A 4IMJB 3B8EA 3LKDA 3PWSA 1T5LA 5EJ4A 3ZJUA 1CXZA 1RQGA 3ZJTA 5FPTA 4MVJH 4BLQA 4C3VA 3DGFC 5ED0A 5AXCA 3UO8B 1HT2E 4MO2A 3CEPB 4W8HA 4QQNA 4DRXA 4K7JA 4E3WA 2FFQA 1FNBA 2GO1A 4TLMB 2A0FA 4XASA 4S2UA 1YE3A 5K3AA 5LBUA 2J41A 1ARZA 2P75A 3ZI0A 2AB0A 2Q29A 3AXSA 3I2FA 2QTVA 4X7PA 2XXBA 2ORIA 4NXMB 3LQ2A 1WU7A 3UAOA 3DO5A 1WETA 1K8RA 5FFFA 2A78A 1UPAA 3WO1A 3GDFA 1OE0A 3V8MA 3NRBA 2ZIXB 2HM7A 2OCYC 4YRFA 7AT1A 3HFJA 2WJGA 1OH6A 1R4MA 2DWQA 5K3BA 4YACA 4FZJA 1QFMA 3ILHA 4QATA 3FH0A 3DHWC 2IBMA 4G9BA 4JR2A 4DGSA 2QPAA 2XSZA 4CKCB 2BBOA 1DCKA 1NBHA 2HAEA 4QGGA 5LZ4A 3DMRA 3QPDA 3UANA 2XOXA 2ZB3A 1VLJA 3FNFA 1J99A 3O4RA 4CKEA 3H18A 1EK6A 4M9SA 1DTWB 2CNWD 4DV1B 4CM1A 2HFKA 4DLUA 2P78A 2PGOA 3OM8A 4V38A 4X1IA 2RIRA 3TD2A 3PNKA 3WLIA 4ZGGA 3U4DA 4JI2B 3W3AH 1K7XB 1CG6A 5ITVA 2YXLA 3G0DA 4BVKA 1U28A 2LCIA 1ZM9A 3CF0A 3HCNA 4RIFA 3ITDA 1ZBDA 1MW9X 3UJAA 1T1IA 3RT9A 2C99A 1A9TA 1IQRA 4H7EA 1T6NA 2ZSEA 3VZQA 3I12A 4OP1A 1K97A 4J0GA 1EK0A 1POWA 4DJDC 2Q49A 3HWRA 4M89A 4GYYA 3ZE7A 3RPEA 4BV3A 4E30A 2V3CC 3AEKB 4C4ZA 2QPTA 3U4CA 1E0KA 1XOIA 2VUUA 2ZUCA 3GHHA 1Q3HA 3N75A 2BEWA 4MVJF 1X1RA 5I3CA 4D6XA 3FNBA 2PFGA 4LC1A 1D2RA 1QO0A 2J4FA 2Z8YA 2IW3A 5DNDA 3L43A 4BO5A 1KEEA 4ITUA 1NOKA 2H16A 1GTJ1 3R7DA 2C2WA 3TDNA 1M76A 1T3SA 2FV8A 4A82A 1CUIA 2IYZA 4GBGA 5JNRA 2GFHA 2ZSFA 3H2BA 4Q5IA 4YCAA 1X1EA 1G19A 3T5MA 3VU1A 5B7GA 5JIBA 1TYDE 3ODPA 4QDXA 4I4LA 3T4EA 3OCUA 3U1BA 2PGNA 4MS3A 1JQEA 4QUIA 2B34A 1T9CA 1VRVA 2Z1NA 4IHJB 1SEPA 5K6TA 1UPFA 4N54A 1SXJD 2JFVA 3MOGA 4WESA 1I2AA 3OIWA 4M0MA 5BYAA 1R64A 2AXPA 3UA3A 4BE7B 1YFZA 2W2LA 4P35A 2H51A 2XMGA 3C7CB 4FUTA 4RSMA 1KGSA 5E38A 4XQEA 5G1OA 5H02A 1QH1B 4D9GA 4YAUA 4BAUA 2IV3A 3UICA 4Z0NA 2DWPA 2JPDA 4YHHB 4JV5B 5ESWA 1GQ2A 3R75A 2Q0SA 3OEHD 1IWOA 4DR3B 3CH6A 3M6XA 2XQJA 1V5IA 4L57A 4P3YA 5KS2A 3GRPA 5DTJA 3W05A 1KMMA 1VPDA 1RHJA 1VLVA 3UAVA 3AFIA 1CT9A 2CCJA 3DEFA 2OGTA 3QEJA 3U4IA 4K9PA 3ZBPA 4ZRDA 5B7QA 1KAGA 3HXLA 2RIPA 4PHGA 4XGQA 5A1TA 3ZTYA 4RY8A 3UB4A 1HURA 1VDMA 4ZOQI 3LRXA 2QI9F 4B17A 2NZXA 2VT7A 3VC3A 4H6XA 1XEXB 4W5JA 1MN6A 3TW4A 2XYVA 1DWUA 1M8FA 2FMUA 3EGCA 4PRKA 5LOVF 3STTA 2ZI3A 3ZWOA 1B1AA 4JJ7A 5FLXA 4E4RA 2EGGA 1YDFA 1PG2A 1CZRA 1G8FA 1QLWA 1T4CB 2J1LA 3QWHA 1BFKA 2Q6IA 3DT8A 5DHTA 1UQTA 3SJ7A 1ILEA 4I4TF 3H6HA 2OFPA 3R4VA 3A05A 3FAKA 3NHKA 4P7FA 3V1UA 4KVAA 1TYBE 4UU0A 4LXQA 4DJAA 1QQAA 3AVXA 4XGRA 3B1VA 4FYVA 4AYWA 3PVZA 4MW2A 3RTCA 4WQMA 2X5OA 4CW7A 1C81A 1GFIA 3GK3A 2XHEA 1D2NA 3OC6A 3R6TA 5EWJA 1DJNA 4IHAA 1NXQA 1BMDA 3OUTA 2VNAA 3MWYW 3IS3A 2IVZA 2XDQA 4M7OA 3VR4H 4CI0B 5CXSA 3ICOA 2ZRLA 4M1EA 3TIIA 1P4SA 4LI3X 4PV7A 3INYA 4X9XA 5DOZA 3G1UA 3DCIA 4I5EA 5HX7A 4N6OA 1ZEMA 3FRJA 4F7WA 3AY3A 3WL8A 1DBPA 3OJEA 4G5HA 4RFVA 1RQ7A 2QX7A 1YB5A 3CQ9A 1Z6QA 4W63A 4QFMA 2A0XA 2GVZC 2IY8A 3HE3A 3BHMA 4ZO9A 1Y89A 1ORIA 1SHUX 2GD0A 2PZLA 4Z49A 3JQAB 2P67A 3LT1A 5IEJA 2NZJA 2DUUA 3TLCA 2PG3A 4WKCA 3D3EA 3TQTA 3BWVA 3K2BA 4JBYA 4DQKA 1W5SA 1RBMA 4WI1A 4X61A 4U5XA 4RDHA 3ZHVA 4CQMD 1JDJA 4PIPA 1TVCA 4KSYA 1BFDA 1G18A 2Z56A 2JIOA 3N8GA 1IJBA 5HIMA 3NS7A 3ZU4A 5NULA 4IQGA 4JLJA 5JBIA 5JZMA 4ARCA 1P81A 1SR8A 1MEEA 2GA8A 1LS6A 3LQYA 3A4LA 4XLLA 4OI0A 4PLWA 1EWTA 4R98A 1EBBA 2AN3A 2J5QA 4MAAA 5AW0A 3DMTC 1H93A 2YWEA 4BBJA 5TY0A 5JCPA 3NTQA 4BB0A 5AVKA 2NU6B 3JPYA 3TWOA 4R7GA 4EW1A 1GL3A 4H0NA 1A9SA 1T1JA 3NIBA 1NRXA 4PF1A 2H85A 2GEKA 2WUDA 4KDFA 1ZBQA 1R9NA 2C5FA 4IM7A 1V35A 4P31A 3DV9A 4ACAA 3O5AA 2E37A 1KJ8A 3CGWA 4YWJA 1I80A 1GDTA 4TTRA 4PQRA 1G64A 2GSWA 2IEBA 2ZZMA 4B5KA 4W9NC 1E77A 1NKSA 3EQZA 4HDMA 5BSVA 2QMOA 4FOTA 3THWA 2PA3A 1ZR4A 2QN1A 2WFMA 4EH1A 3OZFA 1P8AA 2KSQA 1ESEA 2J4CA 2AG1A 3NAQA 1UBJS 4EHJA 1AKWA 4RZ2A 1QP0A 3O1IC 3SHFA 4FIZA 4BO7A 1SC4A 2Q3LA 3FZNA 3SMQA 3LPMA 3HLKA 5FWXA 4RLSA 1PG0A 3LV8A 5FADA 3VKVA 1JJVA 4EJSB 2BM1A 1OC2A 3FIUA 1GR1A 3OJFA 4YUVA 2AX4A 1BDJA 2EJBA 5ALZA 2XCSB 2JARA 4ZYZA 5F9FA 4OHCA 5GOZA 1P1KA 4JZYA 2NVOA 3G8YA 4JOSA 1NU8A 1U8YA 3DL7A 3QX8A 4WRRA 3LM8A 1G8YA 2BFMA 4BWVA 1P39A 2E9SA 1GPDG 3OLCX 4MA0A 4D42A 2EFHB 2VZEA 3IHKA 1KEVA 3ITEA 3IV7A 3OQIB 5FOXA 5BURA 1KEPA 2XQFA 1C3VA 2OHJA 3BZUA 3HU2A 3UJNA 2F48A 3KWFA 3OPXA 4RYDA 4KK3A 4V3CA 4IS2A 3V4FA 2GCNA 4TS3A 3M4YA 3QYAA 4B7ZA 2IKQA 1OASA 3HU3A 2HIHA 3WLMA 4W99A 4KPUB 3HI6A 4DKJA 8LDHA 3LYHA 3CUKA 1SUDA 1YR1A 3ZLBA 2OFXA 4ER0A 3UMRA 3Q87B 1G8PA 2P8JA 2UYHA 5JYEA 2BFBA 3TLYA 2DJ5A 5FOVA 4ZWNA 3BJEA 2ZSAA 3IP1A 1D2CA 4HNHA 4KODA 5KYGA 1YJ8A 4UOZA 1BVRA 3LOQA 3OCYA 3BMNB 1UKAA 3Q98A 4AYTA 5HKLA 1M1UA 2X23A 4FNOA 1QLJA 4LTDA 3SZLA 2ZETA 5ADHA 3MMPA 1BHQ1 2IUSA 3QE0A 1U3VA 3KZOA 2V5UA 3ACDA 2IUYA 4YRPA 3ENWA 3C6YA 2Q1YA 1CRQA 2ZE6A 3IE2A 4LOLA 3R9KA 1DINA 2V6BA 3ND8A 1TZKA 4LSZA 1XMXA 3EZ7A 1VPTA 4G86A 3W4KA 4K9KA 5CEJA 2VJMB 4Q9IA 4H60A 1IATA 4IEIA 3B5EA 3OOWA 3WYDA 1BXRB 1KMCA 2Y05A 2A88A 3WAGA 4N39A 3I6BA 3PFWO 3U7IA 3AUTA 2IUUA 1W1UA 2FG5A 1ND6A 1ZHHA 2SKEA 3V1NA 3QKIA 5CGZA 4ZTBA 3ZY3A 4CLOB 1MJHA 2VP5A 4W9NA 4FCVA 3ROTA 3K9NA 4CM6A 4ARSA 3FOCA 4K2AA 1L5GB 1R4ZA 3OF2A 2M6RA 1PJLA 1N2ZA 2C94A 1P44A 2CKDA 3D3JA 3OWOA 3W34A 3IMCA 1BG6A 1W34A 1H94A 4TSRA 4PN3A 2FRDA 4WASA 3UPTA 4YH1A 4C0XA 3KTFA 1U2QA 4LKRA 4EJSC 5EEGA 1L6IA 5IAAA 2GARA 1UZMA 1DQZA 1N8TA 2AQ8A 2WMDA 3NATA 2QSJA 3WK6A 1NN5A 3D6TB 3DBHA 3SDBA 1HT3A 2CFTA 3GP8A 1T36B 2VDKB 3JQ8A 2GASA 1RZRA 2Y0EA 4KVZA 5EEHA 4I1OA 1CY7A 1V5GA 2OPHA 3EPLA 3E8MA 1EUCB 4L73A 3G0BA 3L1VA 1TCUA 4A92A 4GOND 5JT1A 5F23A 1KEKA 3P2EA 4JXJA 1L4LA 1BCRB 2P6OA 3KVNA 4CQNA 3FSRA 1ZY2A 1RCTE 1VE5A 1FIUA 1II8A 2C5HA 2I4LA 2C9ZA 1OAAA 3FDZB 4KQEA 3B1JA 4DLKA 3KOMA 2ANBA 1DKPA 1QRRA 3NV7A 1G7SA 3KT8A 3Q72A 4NJEB 1NVUQ 1G6KA 1KDZA 3ZV4A 5C4MA 2A0UA 3R3YA 4JLVA 1K9VF 1D6MA 3QOFA 3PUIA 3EIXA 2QDKA 2Q2NA 1GD1O 3QKUA 1UJBA 4HH0A 5DF1A 2V7GA 3V9AA 5IWAB 4YGYA 5CG1A 4LNAA 4EPWA 3ECCA 3AJAA 3LXUX 2Y9MB 1VOTA 1DKRA 1PZEA 1CUYA 3IERA 1OF1A 1VGRA 3BH0A 5GONF 1SUSA 2AMYA 5A4FS 3OX3A 1PZHA 4FYMA 3K8OE 3PPVA 5JTTA 1KKMA 3B3JA 3IT1A 1EWYA 4S2EA 4B46A 2HGSA 2QT1A 2XUAA 4RKQA 1N32B 1CQZA 3PWTA 3PD1A 3CISA 3AF4A 4NG5A 3V4RA 4O3FA 1T9AA 1GGMA 3E22B 1N5OX 2RGXA 3IFSA 1T2FA 2FNAA 2IEAA 5D01A 3GRFA 1T0HB 1E3LA 4EZBA 3PV0A 4TWBA 1ONNA 3IR6A 4PZEA 3NIGB 4C3OB 2RB4A 4YVFA 4D9KA 2J4DA 2FMKA 4NBNA 1YRQA 2BGIA 3UY4A 3U7RA 5J4YA 4QTTB 4PCLA 1LJLA 5ALXA 2O8CA 1HORA 3IAUA 4ZVTA 1IIRA 3KYCB 2C8VA 3QOYA 3ROGA 3MOIA 1WNTA 2PH7A 1PJ8A 2X6RA 3DE4X 3U9TA 1EUYA 2XY4A 3T15A 1MC4A 1KP2A 3TOZA 1WW2A 5AW1A 3G17A 1KQFA 1SKMA 1KI9A 1N0VC 1JFVA 1CJMA 1ULTA 3E9DA 2PLNA 1LS1A 2H31A 1TECE 2ICAA 2JBAA 1I4DD 3QIAA 1TT5A 1DARA 3DAFA 3EVBA 1FNCA 5JS2A 5B2FA 2C8KA 4LFBB 4DV7B 2GPNA 5IKMA 2J7PA 3DA8A 4QRIA 4ENQA 2J9GA 2KLBA 1JGTA 4P54A 5JVDF 4LDNA 3ANXA 1Y7HA 4WEQA 3MCAA 1Z5UA 1KQ3A 6YASA 4KQ6A 4WZZA 4EYQA 1GPNA 4URXR 3OT1A 1ZA2A 2YJ6A 4Y7CA 1HC7A 1F2UA 2F1RA 4S1TA 5ALFA 5LZ9A 2IQ5A 1KI6B 5IWCA 3OZVA 1V47A 3D6JA 1FRZA 3RSLA 4E22A 1IVNA 2GVDC 4YRCA 2BMVA 3RIGA 3KZMA 4FFNA 3UIEA 2P7HA 2ZWAA 1MOSA 4MV4A 1SOWA 2QJRA 5F2EA 3O0DA 3H83A 1COWD 4F4FA 1Q44A 2OFFA 4ER3A 2Q3HA 1JHDA 2VHQA 4U4AA 2XYPA 5AW2A 3R9XA 5EJMA 2BF7A 4M1KA 3TXXA 2V9PA 4WOJA 3IEXA 2ZWOA 4XB2A 5DM0A 3RFUA 4DDWA 2IHTA 4KNVA 1JTEA 1G4UR 4TZKA 1CZHA 1XRRA 2ZAYA 3OWHA 3VZBA 2VP3A 2VQ6A 3W1VA 1R0BA 3SXPA 3TLZA 3R8CA 2AHRA 1Q1ZA 4C5BA 2I6XA 1Z4MA 1JYEA 2C31A 2Z2KA 4LXGA 4LRYA 1W4RA 2G1KA 2ZXFA 3SX4A 3AIIA 4MI3A 4YNBA 1XD9A 2R6CA 2XYHA 3N59A 4FKBA 1SM4A 2II6A 4ZQHA 1CZOA 1GNQA 1ODLA 3KTAA 3KFLA 3RUPA 3WYBA 4FW8A 4AY2A 1DEOA 2FHPA 4IV0A 3WYGA 3LX6A 3PC8A 5ADUS 1HKHA 4ZVOA 4XOIA 1CDDA 5ADWA 2I3DA 1PK9A 3OX4A 1GV1A 3FKJA 3IUMA 3DOCA 1XU9A 3JAKA 4X20A 5G3YA 3GA7A 4BFTA 3OQNA 3BKXA 5EOVA 3SKVA 4IIBA 2X3UA 1V5FA 2ZJYA 3CZAA 3H1TA 3BG5A 1W76A 3KZKA 3DYBA 1R3UA 1JQBA 4CPDA 5JMTA 3TQSA 4ZC8A 1E3QA 4WACA 3TDKA 1Q15A 2H1HA 4OMFG 4XVCA 5ITWA 4ZTUB 3U0VA 1JHVA 2LGJA 3AEZA 1GUAA 1PD1A 1Q22A 2NQTA 4KH1A 1PNOA 1QCCA 3E05A 2QUJA 3GB9A 4WKBA 5AHRA 2Z4TA 4EF4A 3B6KA 4N4AA 2QD1A 4QG7A 3I3SR 1M5RA 3CT6A 1P1FA 3EQ2A 4QGBA 3V7UA 3BMCB 5DGTA 4C6TA 5LLDA 5K3FA 3DLBA 2IYLD 3L1KA 2QZSA 2WSLA 5D3KA 5IBRA 4YJDA 4AXBA 2AOWA 1XXHE 1P7VA 1WO8A 4UPVA 4HNAB 3VKUA 1TKRA 2FQYA 3U4HA 3IT3A 1E59A 2QRZA 2EHDA 3D0OA 5KTYA 1RRFA 2DY1A 3EIWA 4Q37A 4DQVA 1M33A 1CDOA 4RQTA 3DMGA 2IWRA 2V0CA 2WV9A 1BOFA 1RWXA 3L1UA 3E84A 4W1RA 5AOCA 4F7DA 4P6VF 1IN8A 2BKUA 3EHDA 1B6RA 3N86A 3R3WA 1U3FA 4I5DA 4I0WB 3R3VA 2LUOA 3G2HA 1J90A 1HMPA 4LK2A 2V4ZA 1AH2A 1WUTA 3OTOB 2OHGA 5DHUA 4L0MA 3JQCA 3VBCA 4EB0A 4I9UA 1L7QA 3ON5A 4HX9A 1MKYA 5JJ5A 1YOVB 3A28A 4WGFA 3WBFA 4E15A 1A7JA 4MRMB 4P4UA 1MB4A 4DYVA 4CHTA 1I2MA 4LHWA 2C84A 3ZDXB 1RR6A 4I1YA 4R9SA 4QOIA 1G20A 1TCBA 2FWAA 1LPMA 5BW6B 4TMWA 1O58A 2FMHA 2G9VA 3S1AA 4BKPA 1U1CA 5IH3A 4PLHA 2J48A 1QQBA 2RHBA 1X1TA 1F8FA 3G85A 3IQWA 5I9TA 4G85A 4RS3A 4DRXB 4NCAA 1QPZA 1QHSA 4TLDA 3P97A 2Q7OE 2CHFA 1AS2A 3BD8A 4AB1A 4DV2B 1DC7A 2QU8A 4YASA 1VIMA 3T5TA 3URKA 3FNIA 5JNTA 3PT9A 2VK8A 2PBRA 4WY8A 2MSWA 4CF4A 3FOBA 3IQXA 1S1MA 2IXEA 2ZT7A 2YMMA 2H63A 5K8JB 4IIDA 2F1HA 2FMFA 3H4MA 1QO7A 4GPD1 4UFNA 5HUQA 3AXTA 3FPLA 3QUTA 3HU1A 4KQ1A 3HPQA 1NW9B 4Q93A 4YYEA 4UEWA 1MDFA 5LA6F 3Q6MA 4IDCA 2YVLA 1DTSA 1TRKA 4IDFA 1GDHA 2ZJAA 1MQAA 5FHRA 2IHZA 3MGBA 3M4NA 3LZCA 4ER6A 1E62A 1Q0SA 2A92A 4O2BF 1DT3A 5JMWA 5FWYA 2QX8A 2BTOA 4Y1RB 4A6PA 4BMXA 4CEHA 3GCXA 1KS9A 2RHDA 5C7YA 1KP3A 1A8QA 3WHLA 2BGLA 2YV5A 3R24A 4U0JA 5M29A 2IYFA 5BV0A 4UDYX 5BMVF 2NSDA 1S2GA 5HQTA 1IJEA 2YIMA 3IA7A 3GEDA 3Q12A 4N3AA 1SKUA 1SCAA 2CV2A 3UGQA 1QYCA 1IXSB 1TYZA 2EAUA 3MYRA 5TLSA 4ETNA 3R1IA 3WRYC 4QYSA 1I0ZA 1JHAA 2VHUA 4ASUD 3HM2A 2ATEA 3N7UA 2ZAIA 3OIGA 1PJBA 3OUZA 4NECA 4R71A 2UUBB 3ZE6A 1XHFA 2ZROA 4RD3A 4IYRA 1TQ6A 1ZDMA 2HLNA 1K8ZB 3TPCA 3I6ZA 4P32A 3BDIA 3HKBB 1B42A 3RAEC 4IJQA 3R5JA 4UTOA 2XZDA 4PG7A 2DFLA 5CT6A 2VP4A 2CVZA 3AZOA 4RETA 1UKYA 2G06A 4M83A 4X6UA 1F17A 5C8YA 1CK4A 2DR0A 4JJFA 5L3QB 2HSDA 2OUKA 3QEAZ 1M54A 1M6VA 2WR8A 3KKEA 5H80A 2OXFA 3U2QA 2HBQA 2FF5A 4ARZB 3FPKA 4DIKA 2ZYVX 1YXMA 3TKYA 5JXJA 1A8PA 1E6CA 3QPUA 4Q34A 4B8WA 4URUR 4Q9KA 1PV1A 1RXWA 4B74A 3CLTC 3BQMB 3RANA 1UOOA 5TQVA 4C2BA 4IQ8A 5JS8A 1YVDA 1CQIA 2YHAA 1E1RD 4YDQA 2DEUA 5DH9A 2GR9A 4BFLA 2W2QA 2VDUE 3ED1A 2WP8J 3BGIA 1ZW6A 3K5WA 2BR5A 4ZYLA 1EP3B 1AKNA 1D2HA 4MW7A 1US8B 3WKBA 3L6UA 5REQB 3HKEA 3EX7C 2ECFA 4B3XA 3RSZA 1JHOA 3DEZA 4MS3B 2POQX 1JZTA 3WLPA 3G0IA 3O8QA 5LN1A 2QI9C 5EIBD 1DCMA 1XFAA 2G76A 1F48A 2NXJA 2IOQA 2GERA 3OPYI 4NYMR 3MK31 3OETA 2FW6A 3AX6A 5TMDA 1VZ2A 3SM9A 4EEXA 2CY0A 1ECGA 5A0VA 3WIEA 2FSIA 2RGYA 2BVNA 4EG5A 4CL3A 3G8AA 1ZM3A 1Z4LA 4CM8A 7MDHA 3HCDA 1VSBA 4KXXA 4MGIR 4P81A 4XA8A 2PO7A 1OW3B 1TNDA 5GGXA 4FMDB 5JSUA 2ZJBA 3IX7A 2JGMA 4B3IA 1UXKA 1DBIA 5I9BA 5I8ZA 1YIDA 4Z3DA 3CVYA 1POXA 4PLVA 4XPZA 3G2LA 5E6SA 4CF3A 3D3WA 3ZCVA 4ACBA 2QX9A 1NBWB 1PJRA 1ZWLA 2GZRA 3BM5A 3HMQA 3KVRA 1DUVG 3NUZA 3V1TC 1YB4A 4DEYA 3IL2A 1KETA 3DPIA 2H7YA 4O63O 2VO1A 5FNVF 5CB4A 2QUZA 1UOEA 4GLFA 121PA 3UYKA 1NVMB 1EQUA 1WPRA 2D0PB 1L4UA 2ZBEA 4IEFB 1PZXA 3EIUA 4MK4A 1IM5A 3S68A 4EJ6A 3OKPA 2FW8A 1FNSA 1RM0A 1UKVY 4MVJI 5EWMB 3PNBA 3C5HA 4G4GA 1PE0A 3DXYA 4FLFA 1GNTA 1WVMA 3JATA 2FH5B 2J67A 3F90A 3EK2A 3ZDZB 3P4YA 1H8HD 3T9DA 5AVRA 3CG0A 3S8EA 1K6MA 4FGKA 3I58A 3BJZA 2HRBA 3F3KA 4I1IA 3IKMB 3SDZA 4MUKA 2XUJA 4KXQA 4BO8A 2F3PA 1NVVR 4BRWA 1WXQA 3AQ4A 3NDPA 4KDCA 4AMZA 3GBPA 3GNQA 4XZ3A 4H77A 2Q5OA 4KWIA 4UVGA 1DV1A 1SC9A 4FFOA 1KE1A 2W2VA 3U1VA 2WV7A 4DMUB 3ICWA 4JI6B 3L05A 2Q6OA 4RO0A 2EHJA 4UATA 4WCFB 5KQPA 2PXHA 4BFXA 4BYGA 3KLNA 4IWYA 3K94A 3P9ZA 1NYRA 3TS1A 3QUSA 2IS2A 5I8WA 4TWIA 5M2QA 4KK4A 1HT0A 4LWPA 3IV9A 4Q4CA 4U63A 3EGXB 1K3UB 1TAGA 1P9RA 1UC9A 1AOXA 2EKQA 4TLCA 1ULSA 5KWEA 1KH2A 1CCWA 3QLUC 2FSFA 1R8JA 5JJIA 1IBMB 2HQOA 1FL9A 2AGVA 5B1DA 3AESA 1G66A 3UB2A 1R00A 3LUKA 4Z99A 1KPHA 2FX3A 3BK2A 1UEXC 1I0IA 1T2DA 5JAZA 3TVYA 5K03A 5FUMA 3E8XA 5F73A 4B0PA 1Y81A 2QZ4A 3KXKA 1L7AA 5K2OA 5E7QA 1JLKA 3AEUB 3GFBA 2IDKA 4JJEA 1PJSA 1WXWA 2OZVA 4JC5A 4DLXA 4EITA 5IBCA 2UDPA 4MROA 3IKTA 5T4EA 1Z37A 4J90A 1Z45A 4QNMA 3BUSA 1KK3A 1CF9A 4MWCA 3B51X 3G1TA 3UMGA 5BUZA 1H2BA 3M34A 4S1NA 2YZNA 3AG5A 3GUCA 5DHPA 4H1VA 1JA1A 5JSYA 2OTCA 4HLCA 4AP5A 2GM3A 2XBLA 3SJZA 1IOLA 2B2NA 4EECA 2IS6A 3H5OA 1TD9A 1KKUA 2XCUA 1SIOA 2VDLB 4PQGA 3G88A 1QC5A 3A1NA 3A8TA 5TPZA 1P9NA 3U4AA 4L9SA 1LEHA 1RRPA 1FNDA 1WM1A 4DLLA 2C3YA 2PJUA 3R4CA 4QHSA 2UXBB 2WIFA 4US1R 4JI1B 1KQPA 2QXUA 1SU7A 2R9VA 1LB1B 3HL0A 3KRTA 3I9NA 3L8ZA 4JIGA 1A96A 2P0EA 1G8JA 4OL0A 1ZD4A 3MJRA 4BNKA 1UWCA 4NK4A 4C03A 4F4IA 1XLUA 3JYNA 3QU2A 3N3AC 3GP3A 2D5AA 1NUHA 2IXTA 1UBTS 4L8VA 2F3UA 4FDLA 3PD0A 1P2TA 3B6IA 2ZSIA 4XQ0A 3RREA 2EWWA 3NHPA 4XUGB 1E3TA 2VAWA 8MHTA 1CNMA 2J31A 3A32A 4J29A 3I8OA 1Y3BE 1NVEA 2ZB8A 4N0QA 4WNIA 5J2UA 1MW8X 5F35A 4LUCA 2C4NA 3RFXA 3TL3A 4B8YA 2Z5LA 3KKQA 3D4BA 4GGOA 2HWYA 5EIWA 3ZV7A 1A2BA 4JGGA 3AHDA 3KYDA 4YREA 3RU9A 4YN3A 2HRDA 1F1JA 4PZLA 2GHTA 1EXVA 3AJRA 2HA6A 4I1RA 2C58A 3PGLA 1XMPA 2JI7A 5IUNC 3ANMA 2QAIA 4L95C 1E3MA 4YV2A 1A4XA 3CUWA 4MDHA 4NARA 3E5HA 3LP5A 1CTQA 4GAEA 3UB3A 2V98A 2JGFA 2GNPA 2ERCA 4DANA 1FP1D 2C3MA 2XHZA 2NPOA 2VPPA 2EATA 1F4PA 4MVCA 3E7DA 4WBSA 2MINA 4Q7JB 4FFSA 2X2EA 5KIAA 1Y42X 3S81A 5B4VA 2B6HA 4TL9A 3E23A 3H8VA 4PLPA 4XGNA 1FDVA 5A7HA 3ZY6A 2OGSA 1M73E 1R0SA 2CHQA 2J3QA 3KE8A 4W5NA 4B75A 4XR4A 1EXDA 4GBJA 2VRBA 3HR7A 3PA6A 3VHXA 4PO1A 4CKWB 4Y2QA 2ID4A 2DUMA 4XIGS 5F7ZA 3A4NA 3QBJA 3TL2A 4CG2A 4WPGA 3MWDB 2M6LA 4IIYA 5TGZA 4DPKA 2R2AA 1Y6FA 3NT2A 3R5TA 4WZBB 1M72A 2JHFA 2VSXA 4XCXA 2PKXA 3RFFA 1DGQA 1CY6A 3EY9A 4E3ZA 4Z7JA 1SD1A 2Y67A 5LNK6 3ADBA 1ONSA 1SXJC 4JI7B 3I9MA 5FA5A 4AKTA 1FP2A 5GJCA 4PPGA 5ITZA 4D4HA 4TL8A 2HRCA 2NU7B 3G8BA 3QMPA 1I1QB 5DNWA 2EBFX 1F5NA 4G4SP 4R6XA 4JL6A 4F5DA 3HDTA 2VDOB 2QTWB 1BS2A 2ZUDA 2HIMA 3COYA 4OQEA 1PR3A 2BEVA 3HY4A 3MT8A 3TEJA 5C8VA 4Y67A 2A1UB 2HPHA 3P2YA 1P1HA 3BWDD 1ZN8A 3O26A 3DBLA 3D4NA 4TTAA 4LOAA 2FSUA 3QUBA 5HKKA 3COWA 4KYVA 1JKFA 4MW0A 3UK2A 1S3FA 1JXMA 4FXOA 3CJQA 4G0WA 2ZSHA 5I9NA 4TYMA 1GAXA 4ZVQA 1GSHA 4UOQA 4DLYA 4BE4A 1H0HA 5FUQA 5KC9A 1Z3CA 1U98A 3H2KA 2O2IA 5LNK1 4RMNA 1XQ9A 1TZ2A 3TI7A 1E2NA 2C5EA 1X9GA 2QQ5A 3VKWA 4AQYB 5JJCA 1NPTO 3KSMA 1X1BA 3OEWA 1L1EA 2BRUC 2DQYA 1IXRC 2IDMA 3D43A 5BUSA 4O4HB 1R8XA 4MPRA 1FFEA 3VXKA 3NNSA 1NNLA 1A69A 4DUYB 1I1HA 1Y8QA 1XCOA 1BE1A 1DRWA 2WAYA 3HYLA 2CFSA 1XD2A 5I7EA 1SVOA 2W8ZA 5HRCA 1CJUC 3PQEA 1YC2A 5FDFA 1QAOA 2EV9A 2FEWB 3CZCA 4JB2A 5AM4A 4DMMA 4WN9A 4UZSA 2VXBA 1R50A 1XF1A 2CKMA 3NHLA 4HS4A 1Q1EA 2OC4A 3FPJA 3O4VA 4BO2A 4QBTA 3GFQA 5H83A 2JEYA 2F3SA 4Z0PA 1ZJJA 1Q1AA 1ZM7A 5CW2A 1GGJA 3NW9A 5EJAA 3HUTA 2GAIA 1V4BA 5CA1B 2VBFA 4YMVA 1RXCA 5DISB 2QM8A 3NKVA 4QJBA 5DO9A 1NBOA 1XROA 3AB8A 4CKBA 1KP9A 3BTSA 4MW9A 5IFKA 3GJ6A 1F06A 3LLMA 4UMEA 2J33A 1J70A 4H3KB 1N77A 3G9UA 2Q50A 4DA4A 4KUEA 1U5AA 3DYVA 2WZDA 4OGKA 5EIFA 3F49S 2W90A 1DUIA 4MOWA 3FVQA 4CNBA 2JFXA 1OLUB 2OEPA 4L3VA 4PSUA 5IVKA 1ZMRA 4EVQA 1T9ZA 5M7EA 3CX6A 4OP3A 4U2DA 1AMNA 3QGMA 5BW5A 1PNVA 3BSYA 1RJ9A 2GZ1A 3IVRA 2R96A 4L8LA 3SEAA 3IAFA 4F4DA 3OIYA 1VDZA 1CR0A 3RCBA 4CU5A 2JAQA 2HJVA 4N5DA 5AM1A 1SC1A 1XL0A 4EABA 2HW8A 1YL7A 3P1JA 4KPEC 3K96A 2QTNA 3QF4B 4IKOA 1H2XA 5IU6A 1GGNA 3OESA 4FDUA 4Q9HA 2C77A 2BGKA 2NQ2C 4REOA 3S2SA 1X70A 4JBHA 1XCLA 1LA2A 3A2LA 5L7TA 3VSCA 3MPOA 2XWJI 1KSFX 2PIDA 2J3DA 4FYYA 2C3PA 1JG2A 3RTGA 5A6SA 2RG1A 1U7TA 1Y9JA 2EU8A 1AUPA 1BAPA 1PW5A 4HVLA 1N2JA 3OWXA 2XCIA 2Q62A 3KPYA 4HN4B 1SBQA 1SG9A 4ARIA 4EM6A 1ORVA 2R0QC 4UEOA 1S4QA 3CH5A 4XXHA 3LQ1A 3TNJA 2WW8A 1NRIA 2FPGA 2V1UA 4KWEA 2NYUA 4O2AA 4RKRA 2Z2ZA 2X1LA 3G0CA 1XYYA 4AF6A 4BJ1A 3ANNA 1GFSA 4C7BA 1X7WA 4UZFA 1A9XA 1AKYA 1C1HA 3QF4A 1RW4A 4JLKA 3JAKB 4RIGA 3RU3A 3EGIA 1NF9A 1Q7EA 4HAYA 1JSXA 3G5UA 4UBIA 4A8PA 3OD1A 1E8NA 2FP3A 2GWHA 4MVJD 1SVMA 2FPRA 2F3RA 4OJMX 5ABPA 1TMGE 3PQ4A 2W37A 3LH5A 1XVTA 3R3ZA 4O59O 5LFAA 2KW5A 3PHCA 4LVOA 1ST2A 4LQ4A 3P4UA 4E03A 2OZKA 3SNKA 1H4TA 2ETVA 2YFYA 3KDAA 1Y8AA 4C9BA 5F1YA 2BBWA 1H8ED 2AFHA 4R1TA 4ZC1A 2OL4A 2BHLA 3EPKA 4C4RA 2QEQA 5J2TF 5AW4A 4LMAA 3WLLA 4EA7A 2LD4A 1BVYF 4ZZ0A 2PT9A 1TQ8A 1MV5A 2O8FA 4M86A 1IBCA 1VG0B 2G3YA 1ZD3A 1CUZA 2JIZD 3KYJB 1S7CA 1HTTA 3CEAA 3HUFA 4PSDA 4I7EA 3ILXA 3A1CA 3PX3A 4M1QA 1QFJA 5HW0A 1XZMA 2IHBA 3KFVA 5JAUA 2EW8A 1VE6A 5G40A 3D5TA 3FUWA 4OBXA 4WFJA 5IJ9B 3H7AA 2CDRA 3C3KA 2ZT5A 3S29A 3TZ6A 1ZO8A 1A5TA 1OA0A 2G8NA 2X86A 2E4YA 4OMDA 4ZQIA 4C05A 1PYOA 2Q07A 2X3FA 4JI8B 3AR7A 2XF2A 2XZTA 3GJQA 3TOCA 4BU1A 1FP4A 5IABA 1UC8A 1JX6A 4DLBA 5CJ2A 2FU5C 4LQDA 5IYZF 4D4JA 4D5EA 3CT4A 4N6NA 2OBMA 1AF7A 1IY0A 2GK7A 3C6KA 4DLVA 3EPJA 4DIOA 2P1DA 3E7XA 3QU9A 4IJ5A 4IKEA 5J5CA 4ZI5A 2NMVA 1OXUA 2FX2A 2WSIA 3KWMA 4GOJA 1ST3A 4HAVA 1X0XA 3R2JA 4R4JA 1SCBA 4B3BA 2WIKA 1O6GA 4K03A 1M8JA 2Q21A 3DOUA 4PONA 1QE3A 4MS1B 3EUFA 4COKA 4AW9A 3WRYA 1MF7A 6Q21A 1KWGA 4I4IA 3IPCA 4UJ3A 4DBZA 1YFKA 1E9AA 1B8OA 3H97A 1NUAA 3KJGA 4OHBA 4HG2A 1KZGB 3FYUC 2DOKA 1ZD9A 2PX2A 1ETHA 1R6DA 3VPCA 1LGYA 1E9BA 2AFHB 4AJKA 4C06A 2CNBA 4HXEB 3GNSA 4OK3A 4UTPA 5BSGA 3A0RB 2Q9CA 3RR2A 4AD8A 4LF9B 3QELB 4H0FA 4LBZA 2ZI5A 2OVBA 5DT2A 2J45A 4WXHA 4GP6A 5CMLA 3BXHA 5ICEA 1RXSA 1XCGB 1YVPA 3RUCA 4FFVA 1JIUA 1T1EA 1R66A 4JVOA 3T0FA 2RGAA 4KHPB 2JJYA 3K09C 1AE1A 3FFWA 1Q7GA 1YVRA 2JCXA 5G4KB 5JALA 4LVCA 3L8FA 5I7OA 4TM8A 1HE2A 3NEJA 5D87A 4EG3A 2ZIAA 4OL9A 5AUOB 3ZHUA 1NJGA 4PNPA 5DYIA 2P6UA 1EXNA 2I3GA 3ODGA 5KJ6A 1N25A 2IYSA 1MPTA 3RSOA 5J43A 1A3CA 1NURA 5DXAA 2PS0A 1WAMA 1YR3A 4H27A 3PHIA 5DFAA 2IYVA 3EXHA 1JE0A 1VSUA 5JXGA 4DCOA 3VNVA 1ZOSA 1DEXA 1YI8A 4C4AA 1T9HA 2VRWA 1Z74A 3IUPA 5KX5A 3GCGA 1NM5A 5GP1A 5M04A 1H42A 3ZU6A 1V3VA 2VATA 4QQ8A 1MHTA 2W42A 2IBSA 3HB4X 3NOOA 4HGRA 4KFRA 1MAVA 1IHUA 2R66A 2IU3A 4J0HA 4JROA 3GMSA 4ROSA 1YQEA 3VOTA 5CNJA 5L3SA 4FUQA 3UJBA 3CJTA 3FWYA 3I42A 1U9CA 1J97A 1Z3IX 1NP7A 2OWEA 2Q3BA 3KPVA 3PI6A 3MUOA 5DEOA 3ZW7A 2O2HA 4KN5A 3OQPA 4MW5A 2FHSA 3QY9A 3ZZUA 3RJ9A 3ZCUA 4KR2A 1ZICA 1G4AE 4DL9A 4U9IS 3WMXA 2VHXA 3IJ5A 5FR2A 5C32A 1F8XA 4FBLA 2WZCA 4ECEA 4X54A 5HGJA 2KI5A 4E5VA 1K0FA 1OOEA 3HACA 1Y9ZA 4BLWA 4EJ0A 2IGBA 3OKFA 4N9WA 1V5WA 2YN2A 3ZWNA 3TJRA 4Y6OA 5DSZA 2ZUBA 1JXOA 4NE7A 4D99A 2Z6UA 2X76A 3AF5A 1JECA 1GL6A 3OE7D 4K9DA 2ZM5A 1JXQA 3AR3A 2JB9A 2ZR0A 1W48A 2Y0BA 1AU9A 5CBPA 3E3LA 1E5VA 3T12A 1G3IA 2HMWA 2IIBA 3CTMA 1T2NA 2FEOA 2NYRA 2ZIXA 4K1XA 3A9TA 4D74A 4G09A 3TTUA 1JSZA 3WGQA 3ORSA 1Y5IA 4JXXA 2R1TB 3N53A 2VBIA 1HI9A 4LCEA 1VGVA 2F4NA 1E5XA 1SRRA 1NW8A 1DAEA 4RD4A 2JHCA 4C0QC 4H3VA 5AI8A 3DTTA 1UL1X 5T3UA 4D97A 5KPJA 5GOTA 1V4VA 2ODBA 5KJ1A 3D6AA 2ZW9A 2XNDD 4H7FA 3F73A 2DZDA 1SUWA 2BGWA 5AJXA 3X3HA 1DIBA 2H0QA 1QS0A 2IYEA 3WP0A 3H0CA 3WV4A 5L6LB 2AEJA 4G56A 1SBIA 2XA2A 3PC6A 4ID3A 2YIDA 1W4BA 4B73A 3NHRA 3O7WA 4B40A 1TYEB 2QTGA 2XUIA 5FF9A 1UBMS 3QXHA 3DWEX 4V0SA 1TCCA 3M4JA 1GKYA 1KS2A 4IWNA 2H4ZA 3AETB 6LDHA 2IFTA 5CIWA 4RZSA 2Q5LA 3D6HA 2QG9A 1OLXA 3PHJA 3KQOA 2G0NA 2Z2JA 3GJRA 2AWNA 2AOTB 4DE5A 4YRBA 4KWTA 3LBYA 5HCNA 3L0CA 1WP4A 4UUAA 2IHNA 1K6XA 4BB9A 5JCJD 3GLSA 2FPPA 4ZO6A 3LO8A 2B9VA 2VL7A 5CIQA 1V96A 1R8SA 1VQ1A 2TMGA 3BCSA 3WHKA 4JSRA 4BGUA 2UV8A 4H31A 5BN5B 5B4UA 1U8XX 3OX1A 2XMPA 4WZAB 4C20A 4TYWA 2WT8A 4PZDA 1G20B 4FHGA 4AX8A 4KUGA 2JEOA 2NNLD 3SR3A 3UQYS 3UCFA 5K6AA 3HB5X 1VLQA 2WF5A 3AKEA 4GPIB 1GEGA 2OYRA 3TR0A 4HEQA 4H17A 1IZ0A 2QD4A 2I6QA 2P6PA 4YUZA 3NXKA 5ES3A 5LIRA 2GLTA 1JI3A 1LPOA 4TM7A 3FFXA 4EFMA 5F33A 4GWKA 1GTSA 1CRPA 1BEUB 1EUQA 5LWHA 5K20A 2Q3FA 1WPQA 2PMKA 3W2FA 2ZI4A 1H2FA 3L02A 3HCCA 3L82B 3X1XA 3H5TA 5ALYA 3WJ2A 1R9JA 3T3DA 5KTKA 3R5HA 1XF9A 4MICA 3T1NA 1IWBB 1W1WA 1XVAA 2FLVA 3PTZA 4N0MA 2HQRA 2OHIA 1G8MA 5TQ2A 3DF9A 5KEIA 2HF7A 1XCBA 2VK4A 2ZJ0A 1W85A 5A4IS 4CF5A 4YI3A 1BQEA 2JK0A 1UXGA 4NE9A 1JG7A 4TN1A 5DHRA 4B35A 1OAOA 3K9LA 2AJTA 2MSNA 3ZC3A 4D79A 5FWNA 1EX6A 4AKHA 1AUVA 2RGDA 5DBEX 3WGGA 3VYUB 3JARB 5FPPA 2ZRCA 4ECAA 5BVHA 2WNHA 3CUVA 3N8IA 5ESDA 3S40A 1N0HA 5CPBA 4C1BA 2P5YA 3JWHA 1CY2A 1OGJA 4BLVA 4BNIA 3UT0A 1XEWX 2INGX 2IPOA 1CEXA 2P4SA 4K0KB 3NC4A 2FPLA 1RBYA 2W93A 5JBNA 2VWPA 1N92A 3H11B 3KSAC 5L3QA 2LV8A 1CUUA 2F17A 3K0SA