1TKBA

Specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
Total Genus 243
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
243
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
publication title Specificity of coenzyme binding in thiamin diphosphate-dependent enzymes. Crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 243
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1994-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkbA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkbA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkbA01
5DEIA 1V16B 1RP7A 2YIDA 1W88B 2IHTA 4JUDX 5DGTA 1POWA 1U5BB 1QS0A 2NXWA 3F6EX 2JGDA 2EZ4A 3EXEB 2Q5JA 4JU9A 4WBXC 3DUFA 4RJKA 1Y9DA 2IHUA 1IK6A 4JUFA 3D7KA 2W93A 3FZNA 2PGNA 1POXA 2BFBB 2BEVB 1JSCA 3M7IA 1PVDA 2WVHA 1TKBA 2QTCA 3M49A 3EXHA 3F6BX 3DV0A 5HJEA 2J9FA 2C3OA 1V5GA 2PDAA 3EY9A 2VK1A 3JU3A 4MPRA 1UPBA 1V1RB 3AHIA 2AG0A 2BFEB 1UMCB 1T9CA 2AG1A 3HWWA 4MPPA 1UM9A 3LQ4A 4KXUA 1V1MA 4RJJA 1X7XB 3EXFB 5I4IA 3ZHVA 1T9BA 1W85B 1V11B 2Y0PA 3OOYA 3L84A 5EJ9A 4K9PA 4K9KA 2BFDA 4K9NA 3MOSA 5I51A 1X7YA 4RJIA 1YBHA 3FSJX 4MZXA 2XT9A 5DGDA 4JUBA 2G25A 1B0PA 4D5EA 4KXWA 1UMBB 1YI0A 1OLUB 3EXIB 2XTAA 2QTAA 2BFCA 1TRKA 1UMDA 1WCIA 2BEWB 4C7VA 5HGXA 5K6RA 3AHCA 4Q9DA 1L8AA 1BFDA 2VK8A 3RIMA 1UPCA 1V5EA 5ERXA 1DTWB 2Q27A 4MPJA 3IAEA 2JLAA 1X7WA 2BEUA 4QELA 3UPTA 2R8OA 2BFFB 3EXG2 2VBGA 2XT6A 2EZ8A 2WVAA 2FN3A 2R5NA 2UZ1B 3DVAA 2IEAA 1R9JA 1V16A 1W88A 2C31A 5AHKA 1YD7A 3AHGA 1U5BA 5HHTA 2JIBA 3ZHRA 2OZLB 3EXEA 5I5GA 3IAFA 3AHJA 1ZPDA 2C3PA 2BP7B 2DJIA 2O1SA 2EZUA 4K9OA 3ZHQA 2Q5QA 2VBFA 5HYVA 2BEVA 2BFBA 2JI6A 1NI4B 1PI3A 1OLSB 4FEGA 1X7ZB 5EJ7A 4JD5A 2IHVA 3AHEA 1X80B 5K3SA 1TKCA 4K9MA 3UK1A 2R8PA 1ITZA 4JU8A 5ESDA 5C4IA 2X7JA 1V1RA 1OLXB 2BFEA 1UMCA 1QPBA 3EXHC 3ZHUA 1YHYA 2PANA 4GP9A 1X7XA 2FWNA 3EXFA 1TKAA 1W85A 1V11A 1Z8NA 2VK4A 3AHHA 2JI7A 1OVMA 3LQ1A 1V5FA 2C3YA 3EXG1 1OZHA 2JI9A 1UPAA 1QS0B 5EXDA 2JGDB 1GPUA 2BEUB 3OE1A 2VJYA 3DUFB 1UMBA 5EXEA 2Q5OA 1OLUA 3EXIA 5EJMA 3ZHSA 1MCZA 2BEWA 1PO7A 5EJAA 4KGDA 4GM1A 3EYAA 3EXHB 1DTWA 2UZAA 4GPEA 4GG1A 4XEUA 3HYLA 3DV0B 2J9FB 3ZHTA 4K9LA 1OZFA 2EZ9A 1N0HA 5EJ4A 4MQ5A 1NGSA 2C42A 2BFFA 1OZGA 2O1XA 4K9QA 5I5EA 3AHDA 1UM9B 2C3MA 3M34A 4KXVA 1V1MB 1YHZA 2UZ1A 2Q5LA 4FEEA 2Q28A 2EZTA 2BFDB 1KEKA 4D5GA 1YNOA 2JI8A 4GM0A 1X7YB 2OZLA 3AI7A 3M6LA 2G28A 4GM4A 1T9AA 4QPZA 2BP7A 5FEMA 2Q29A 5IMSA 5ERYA 4COKA 3EA4A 1PYDA 5EJ5A 1NI4A 2BFCB 4JUCA 1UMDB 1WCIB 1OLSA 1X7ZA 1YI1A 1X80A 3FLMA 5K2OA 4JUAA 3LQ2A 5EJ8A 4ZP1A 2E6KA 2VBIA 4KXXA 3HWX1 5EJ6A 3KOMA 1OLXA 3LPLA 2PGOA 4KXYA 2WVGA 2V3WA 1X7WB 5K6TA 1QGDA 3AHFA 1AY0A 2G67A 2JLCA 1T9DA 4C7XA 2YICA 3E9YA 1Q6ZA 3DVAB 2C3UA 4QQ8A
chains in the Genus database with same CATH superfamily
4F6RB 3M6UA 4W9RA 3VR4H 3GLQA 2VJOA 5JZMA 5KNCD 2A1UB 4TWBA 3OOJA 2Q8NA 2H4XA 3KT3A 2NPOA 1S8OA 4UTVA 4B3GA 1AH2A 2O06A 2IUUA 5BSHA 1QS0A 2ZTVA 3OZFA 5LQJA 3E70C 2FDRA 2VQSA 4MQEB 1YSCA 1TE2A 2D5AA 4JBGA 3FM9A 3LBAA 1YVUA 4ZEOA 3O47A 1N92A 3QHQA 3EWNA 5JLAA 2IC5A 4JMLA 4OK3A 2FDXA 2UYGA 4R1UA 1HG0A 1M1UA 2PUBA 3I28A 1M72A 1JR3D 3F5FA 3LZDA 2P9GA 2OP1A 1KK3A 2YJ4A 2ZBRA 4JLWA 3GEDA 1DXYA 4HADA 2OCYC 1HXHA 1SKYE 1IB0A 3C8HA 1PVOA 4D44A 1DKRA 1I1OA 2DCMA 4MP6A 1R50A 1TX4B 2EFYA 2GAAA 3FPSA 5CH8A 4MCAA 2PNJA 3U62A 3O4IA 3Q87B 3ZD7A 1T8RA 4EQ6A 3A6PC 1SVOA 1TU0A 3I5AA 4B1FA 4DUGA 1USGA 1ZONA 4IQ0A 4BX3A 3JD0A 3HU1A 4QDOA 1DINA 2YFYA 1B73A 3FPHA 1XMIA 2H54A 6GPBA 3EW7A 4I0WB 1PR3A 3AOEC 4L4RA 4PLYA 1QYIA 3F6BX 4N3CA 2OE2A 4CR8A 1GAQA 1KH1A 1HQCA 2ZTSA 3JV7A 1IDOA 4PGGA 4BNFA 3U5ZB 3FCUB 5DVZA 1O7JA 4V1CA 1P73A 2QWXA 3CR7A 3HB9A 1H05A 4CHGA 4F3KA 3UK6A 4TZ0A 1YTUA 3A9VA 2E4WA 3SQWA 2C9CA 3IB3A 4GKJB 5IVDA 1E1DA 4F2DA 3F7NA 1OXSC 1YR3A 2BFWA 2QJTA 4P3KA 5SICE 1WB6A 4O6VA 4OLFA 1D6NA 4P2BA 4NAUA 5AOVA 4PLHA 4YJ2A 3D6TB 3U0VA 1KHHA 4QTTB 1KP3A 4J0CA 2VAMA 1U3VA 3D5EA 4DXAA 5FNVF 1C41A 2Z08A 4K0RA 4HWGA 4TZTA 5DCWA 1NJGA 1PQUA 4DR1B 4JC8A 5ALVA 1NLYA 4LF8B 2PHZA 2PQMA 4GRIA 1V35A 1X6VA 4NFLA 3EFEA 4EJSB 2J9GA 2NSJA 1CF2O 1J0AA 2FPPA 1V11B 5FNZA 3I39X 3FH0A 5TS3A 4J4BA 3ZU3A 2XMDA 4PBRA 4YT4A 3DE6X 3H0KA 2YVQA 4NMWA 3X1JA 5KQRA 2I33A 2QB5A 3KT8A 1USKA 1S1CA 1VLZA 2J30A 1O6ZA 2MIIA 2NTVA 4WINA 2WWXA 2WJZB 4FCTA 4R68A 1TMYA 1C3OB 1TCAA 2ZS7A 5EZSA 5HCUA 3T3IA 4QFBA 3WRXC 2P11A 4DADA 2D7DA 1H6BA 2HK6A 4IMRA 3RVDA 2ZXEA 1ZUD1 2O0JA 3FLBA 3U16A 1X8LA 2XMGA 3GVXA 4QU8A 2FX5A 1RYZA 3ECCA 3CG4A 3DLPX 3ESBA 4G56A 2BRUA 3ZU5A 3AR8A 3HJGA 1XD2A 3E9RA 1FDRA 3OZCA 4WKNA 2G25A 4JJKA 5FWAA 3HCBA 1LY1A 4XYMA 2G1AA 3FSGD 4AKTA 3C3DA 2WDPA 4X1KB 4K8OA 1OLUB 4DV5B 2QW0X 1FFBA 3WOVA 1YR6A 2P1ZA 5KNDH 2IEYA 1AKRA 4TN1A 4COOA 1QFXA 1KL7A 3RJ5A 1NN3A 1FMLA 3TK1A 1ZVJA 3N74A 2BEWB 4TYPA 2H18A 4M7OA 4AF6A 4O5OA 3N0RA 2Q3FA 4RU1A 3V1MA 3UMCA 5IS2A 1SUIA 4C87A 4O1HA 3AHCA 4PX5A 2DGDA 2OD9A 1JKIA 1GDTA 4Z4CA 1FLNA 5KAPA 2IE8A 5BYJA 1KK0A 2J5KA 3UH0A 4DLKA 2JLYA 4M1QA 1EFAA 1Z2OX 2NPIA 3VPHA 3N7UA 3WRYC 2RH8A 2CSUA 4DLZA 1U7ZA 4JL6A 1DQNA 4I6EA 1DTWB 1EFRD 4QUIA 3UG7A 1R1DA 2X22A 1YC5A 3SQXA 4TLAA 2ZIVB 3TDKA 1GGNA 1TC1A 1ZA1A 2DY0A 4KSCA 4WXPA 4JB8A 2ZRGA 1RYHA 1K8ZB 4EUSA 5AUPB 4EB6A 2IUYA 4G5YA 1UDBA 1W8DA 3HXPA 3VDXA 4A1FA 4FSXA 3ZQ4A 3RSQA 3P2IA 4PEVA 5B30A 4LXIA 2F48A 3OE5A 4L08A 1HMYA 3WBJA 2OV4A 4OAPA 2HNBA 4ENVA 3UUEA 4B3RB 4KTVE 1LI5A 1SXJA 3FPJA 1DDGA 3ROXA 2PYZA 2E5LB 4ALKA 1FFYA 2XWQA 5LVAA 1UQTA 2DEUA 1LBIA 4GT1A 4MWGA 3SIPA 1GYPA 2IOFA 1FX0A 1OX5A 3HHEA 3JWIA 2P30A 3GROA 5BN5A 2C2BA 3BB1A 5A1JA 2VG8A 4B7CA 3P2JA 4LNUA 2WJYA 2ZDQA 2YZGA 2NGRA 1KO5A 4Y2TA 4YFYA 3O0DA 1N2CB 4OTZA 10MHA 1EVZA 4GX0A 1JEOA 2XQGA 4GIBA 5DTEA 4AJIA 2G36A 5FV7A 1VB3A 4YRZA 3WNVA 2WM3A 4O4HF 4U7TB 1G8JA 4S1VA 5T7BA 2XKAA 3PKJA 1I2BA 1ISFA 3MYRA 2A7XA 3DZ8A 1KQ3A 4PHGA 3ER9A 2MSNA 3N07A 2ZCJA 1SK9A 4X71A 3VI4B 1C8KA 2P1RA 5GOZA 3U31A 1F6BA 5BUQA 3VHXA 4F8JA 2GTIA 3DF7A 5LP1A 2Z3ZA 3RW9A 2BP7B 1MR3F 3MWDB 3K1YA 5EHIA 3DL7A 1T8SA 4Q3DA 4L4XA 3ZE7A 3HXOA 1OU4A 5AUOB 2FB9A 5BW8A 2PLNA 1U3TA 1GYRA 2XBUA 4B74A 1CWUA 1RLJA 3BE4A 4G5GA 4C3UA 1EHIA 3CLUC 1E2IA 5ALIA 4CM1A 2FPGA 3WHKA 2BGRA 2VPYA 4OQMA 5CJJA 3TM4A 2Q6IA 5EQJB 5BVHA 1P1KA 2CBGA 4WCFC 1CUFA 3AV0B 3TTTA 5CG2A 5ANRB 2CXQA 4CL8A 1E0KA 1RWPA 4J1QA 1EUDA 4WY5A 3GLFE 1CJMA 1MOPA 2OZKA 1UBLS 1ZO8A 2F3UA 2X8JA 2EV9A 3F1LA 3GMSA 3UW3A 1YZNA 3WK8A 2A7QA 5BSWA 1KSFX 4LRTB 1DBRA 4JYPA 4WFKA 4RSRA 5ALWA 2E3JA 3FGZA 2BELA 4HX5A 5CEEA 1YR7A 1DGQA 1GLGA 2XH8A 3SSOA 1O9BA 1PBNA 5KX5F 2IHZA 5DISB 1YKSA 2O23A 2QTVB 2WIBA 3M3PA 1TKCA 4BZWA 4EY8A 2RKOA 3FTPA 3ZGNA 2XUOA 4BMCA 4DGSA 2QXYA 4BGVA 1GCGA 1W5EA 4G81A 4HX9A 2QA5A 1XEFA 2IXBA 3C1TA 4O3MA 3TPZA 3M5PA 1A9TA 2WWWA 4MRMB 5DNWA 5GVRA 1JILA 4UC0A 4E1VA 5DIFA 3T5TA 2R8XA 5AKZA 2X7JA 4WLUA 4AMBA 4KFTA 1SVSA 1FQJA 2HLHA 4PF1A 3S8MA 3QU9A 2WJAA 2H4HA 3IILA 4DGQA 2ALJA 3WYEA 1HE1C 3KB6A 1Y8QA 3E58A 3VC1A 1AKYA 1OE0A 2F9FA 4LJRA 2VO1A 1UFOA 4HC4A 1WXHA 4DJ5X 4EPVA 2PANA 4KWIA 1UM8A 2EGUA 3PWSA 2QY6A 4G9EA 4CKBB 3V3KA 3KPYA 4QGBA 2OO5C 4I3GA 4R2IA 3L9XA 2FW0A 6AT1A 4AAYA 4GP6A 4IS3A 4BNLA 2QQFA 2ACVA 1MB9A 2ETVA 3I30X 3P8ZA 3EZNA 2PAAA 3PQ4A 1A8IA 3G2OA 2A78A 3SEAA 2A9PA 4LKRA 4QJ5A 3TD2A 4BP3A 1ULHA 1RBZA 2DUNA 4EHJA 1ZMRA 2MSDB 2WG1A 1G4AE 1Y7LA 1OT3A 1ND6A 1YRBA 5KI6A 1DLJA 4WESB 3BIJA 4XIYA 3DW1X 4B4DA 4BLOA 1IY9A 4BE4A 1UKYA 2G6BA 2C8VA 1QYWA 5J40A 2AYXA 1J5PA 2BL4A 1OZHA 4V0KA 1NX6A 5UKDA 4D42A 4OB8A 1P7VA 2FPIA 221PA 1BHSA 1FVXA 2W2KA 4P31A 3BGOS 2ZJ0A 3CCFA 4LXXA 4NJEB 4I55B 1KZ6A 2QIOA 1XF9A 4R5HA 3SYTA 4GAEA 4HH0A 5E6UA 4AJ9A 2W8BB 4CQMB 2EG5A 2OVBA 4HVLA 4NYMQ 1HDIA 2P7HA 5CK5A 2V98A 3EVCA 1N75A 2ZPUA 4INZA 3OLYA 4JA2A 4BE7B 2R86A 2IUSA 4D8YA 2J0EA 4I1PA 2WYVA 1EAYA 4M9ZA 3ZCRA 2GD2A 3A1CA 1KSJA 4KH0A 3QELA 1GZ7A 2I2CA 2GBLC 5BXYA 4YMSA 4U5QA 1DEHA 2PL9A 3BHMA 3CJRA 3F71A 3H2ZA 3PQ7A 3DM5A 1QHNA 4G0YA 3QUSA 4OKNA 1HE2A 2VHVA 5EI5A 5EWJA 4CF5A 1MTZA 2QRZA 3T1OA 1Z36A 1TXGA 2CBZA 4KCGA 2F9MA 3KQPA 1HC7A 3TZKA 4A16A 1CV2A 2IWRA 5EJAA 1OI7A 2E37A 1PNVA 4MVJH 1QF7A 3ZIAA 4BQOA 3T38A 1GTG1 2GHTA 4Y8VA 1VJDA 1XNJA 4P38A 3UK2A 2WIDA 3DFMA 1KDZA 3CX4A 4EUHA 2C20A 1OBHA 1NVTA 1Y4ZA 2UVPB 3HJTA 3KKOA 1M5RA 4PE5B 1KEVA 3FB4A 3HDYA 3DV0B 4TWAA 3PVZA 4XQEA 1T5SA 1EDDA 4BJ1A 4E08A 1VDZA 2PUEA 1GPYA 3C43A 4C0XA 2D13A 2DBRA 5M29A 3W9BA 2ZJ1A 2ZBFA 1EAMA 1H93A 2W2NA 3NRCA 4I36A 3MTDA 2GEUA 2I5PO 3F67A 2CWWA 5FUYA 5U4XA 3CFYA 1TFRA 4ZGWA 4LWPA 2IYPA 3GUCA 5HUHA 3K4QA 5DHSA 5DXAA 5CNJA 5HX7A 4RPHA 4I1VA 4LHWA 2IZOA 3U6BA 1VPTA 2J3EA 2Q9BA 1ZS9A 3HRIA 5IKOA 1MGPA 3AHDA 4P8RA 4Z0HO 3CRNA 2C3MA 2P35A 2YDXA 3LH5A 2Z56A 2W6ZA 2KMLA 5EHGA 4DAEA 4DPKA 4W5RA 1C1DB 1O96B 2DHDA 2JLRA 3FOBA 4WN9A 1Y9EA 5MGNA 2OXIA 5L4LA 4L5BA 3DWGA 3QENA 1VQ1A 2Q9UA 3OG9A 1EGMB 3JQAA 4DUPA 1W4BA 3A3PA 3KVNA 1D2CA 3IH5A 2P2LA 2ZSIA 1WDLA 4NYJQ 3UMMA 4EL5A 1ZFNA 4CODB 3SS8A 4JDUA 1MB0A 3AUYA 4PCVA 1W49A 4NCXA 5U9CA 4RE6A 1UBKS 4RXMA 3WFIA 1L7AA 1LW7A 3AI7A 1IOLA 5JHGB 2QG4A 5JJIA 1B23P 3RC2A 3WLFA 1DOAA 4BXOA 1DS6A 2FW7A 3HCCA 2QSJA 2QN3A 4QEZA 1OXTA 3V97A 2ZYSA 1GAEO 1FU8A 4HF7A 2C2HA 4NZ9A 1SIUA 2AZ4A 4BO1A 3ZLUA 1V48A 1P2BA 2C4NA 3OT1B 4TWJA 1WU7A 3GEMA 1DHTA 3GG9A 2MMCA 4F5DA 4MQFA 1EM8A 3DXXA 4ZT3A 4L6IA 3QXJA 3HFJA 1N7JA 2A86A 4D3SA 1NF2A 2XUAA 4MKIA 1NXXA 5E7JA 2X9GA 1NI4A 3FZQA 4KTTE 4L4ZA 3RI3A 3JYHA 1OUMA 2GN2A 5D01A 1EK0A 5BNTA 1J5XA 1WCIB 1OLSA 3AUSA 3OZTA 3W8RA 4P0QB 3D2BA 4Q7EA 3G49A 3KSZO 4M0LA 1XNHA 4N65A 5FBZA 1UXHA 3BWEA 2OQVA 5EE0A 3OJOA 2VA9A 2VYVA 3ETDA 5FHQA 2B4KA 5DDIP 3IMGA 2PKQO 2P9EA 4M9RA 1B93A 5D5PA 5D7NA 4JI5B 4DMHA 3PKIA 1ZGCA 1WOYA 4KU4A 4I5EA 3WHPA 2I22A 1FYWA 1GZ5A 1FUYB 2JA1A 3EVZA 2NZ2A 1S3SA 4IXTA 4KE9A 3VU9A 2KE5A 3VR5A 5AO9A 3H1BA 4YPOA 3EGXA 3FKSA 1CX9B 1RR6A 4P98A 4TXJA 4B84A 5JAMA 1YQEA 2BPOA 3P71T 2OPBA 1ZEMA 3HA7A 3P1JA 1BWRA 3NB0A 4UUPA 5ADHA 1VHQA 2IP1A 5TGTA 4BDSA 4ZTBA 1WZCA 1BOOA 1MHPA 2PRYA 2ZRJA 3R5SA 4NOLA 3EGOA 3TR0A 3U9SA 4ZFNA 1BCSA 1ZK0A 1DAEA 1SZCA 5DM4A 3ZLBA 4YO8A 5J47A 1SBHA 4B3SB 3TX2A 4C6RA 1UFQA 1WDMA 4RPCA 3STVA 4M89A 1GDDA 1OI2A 1QFSA 1JLRA 2DT5A 5FI5A 3RS2A 2BGUA 2QXTA 2HJSA 4ZYLA 1ZEJA 2W83A 1IG3A 3V4LA 2WJVA 4CM4B 1K88A 4OK6A 1TO6A 4BEBA 4E12A 4DC0A 3LXRA 3L92A 5B4TA 3HXMA 2IA5A 1KJIA 3T3DA 1RI4A 4Z9YA 3RYCA 1YC2A 1NYRA 2JIQA 2QM8A 1Z29A 2HH9A 2ZB8A 3QWHA 3EGDB 4OHVA 1C9NA 3FTDA 4F96A 1KZ9A 2HK8A 1I7PA 3IBYA 1J2TA 2P5SA 3BHIA 3PA6A 4HAOA 2L19A 2WLSA 3DD5A 3EARA 2CFSA 2RHMA 3KR9A 5EG5A 1N2XA 4RKWA 2QG9A 4ZVVA 4CTJA 1XCLA 4MNTA 2C00A 3AUTA 1P2SA 3TX6A 1QHHA 4DA7A 3LP5A 4Q9AA 1DB3A 1GT6A 1OC4A 4X24A 5T6MA 5TQ0A 2J33A 3ZV7A 2EG9A 2UVQA 2AOTB 4P84A 5IYZF 2I55A 1CDEA 1G9TA 1HETA 3BE8A 2PEYA 1HV8A 3B53X 4MW2A 4J03A 1V2HE 2P90A 4YLGA 5TMDA 5EZYF 4CQLA 3EIEA 2DFPA 1RAHA 4FYWA 4KG7A 2AFHB 3Q3IA 4L5JA 3KKEA 1QR2A 2I4MA 2XA1A 4X1IB 4Q1AA 3T1VA 2BE9A 5AW8A 3QI2A 4I4NA 3AKYA 2O1EA 3EB9A 2DE0X 1XXHE 5ALRA 1DHRA 1N3BA 2GZAA 2LTAA 3KLNA 1XQYA 1POXA 2OWEA 4TLEA 3UHAA 5JY1A 1KTVA 1ML4A 3HJUA 2OC4A 3NYRA 5JMWA 2R66A 5CXQA 2A6PA 1WXEA 1PZXA 4OMDA 3CE6A 2ZT5A 4BNJA 1XZLA 3K8YA 3TQCA 3KWFA 4LOLA 2G8NA 4YCAA 1TDJA 2D4AA 1NBME 2GWHA 3NBAA 5AKKA 1TKBA 4R2LA 3ZLTA 1FNMA 1MPXA 1EXDA 1UPXA 3DXFA 1G5IA 4D8UA 3LUPA 1XVLA 4UHJA 1RE0A 4GC9A 5LJIA 3KHTA 1RHJA 1MQSA 2H4FA 2CLHB 1GTZA 3N8KA 4ISCA 4XQCA 5EMMA 1D3AA 4OGFA 2YXEA 3QITA 5LSAA 3K9QO 3H6KA 3RTEA 4PYJA 4U7HA 4C88A 2JL1A 1WCV1 3UFBA 1Z35A 5TJHA 3REQA 2FSIA 3UJHA 1YZLA 3TR6A 1XKTA 4RS4A 2A3NA 2GNPA 4E14A 3WLMA 4KZPA 9MHTA 4NZNA 1DXOA 1JVNA 2FWMX 3R3JA 4WNAA 1LS1A 3QPDA 4QOHA 4UUQA 2AG1A 3K09A 3WMWA 2WKSA 2GO1A 2VHJA 3K9WA 5JJLA 5T8KC 3TRIA 2VH2A 1QP8A 3HA2A 5ARBA 1K7FB 3PUIA 2CNDA 1I24A 2CNKA 3JR7A 5HVNA 4QUDA 4BNYA 1GY8A 4RDXA 3FCSB 4BVAA 4RTMA 1ZOOA 1DARA 4GZ3A 4E4RA 4CKEB 2OO3A 3M6XA 3IAM6 3NHZA 4ZODA 3U61B 2NU8B 4YQFA 5HIKA 3VZRA 5K5EA 2O2GA 1W4RA 3HY4A 4BO6A 4KLCA 4K9PA 5HQ3B 3UMFA 1FUKA 1NW6A 2CHUA 2FUCA 4GR4A 4YRFA 5FX2A 4UE2A 1ZIOA 4BVHA 1CZHA 4I1RA 4RA9A 5AVZA 2AEMA 1G0OA 1FRNA 3G2QA 1TIBA 1MXFA 3LHIA 5ERGB 3Q6IA 3WLKX 1X7YA 1VE7A 4ICIA 1RVV1 2PZAA 4L1KA 5ALFA 1O54A 3LT4A 4AMUA 1QNLA 1II0A 1KIAA 3W5AA 3WYCA 3IUMA 1DCTA 2NUPA 2GPNA 4WOPA 4YJFA 1J0DA 3RO7A 3TIIA 3UJ6A 3ZHBA 3I83A 2VZLA 4S05A 4HWOA 4Z4IA 1MIOB 3F4LA 4JUBA 4OIFA 3VC7A 1B0PA 2ZJ6A 3OE4A 4ZVKA 2J3LA 3SXUA 1CR2A 3JYLA 3K0BA 4P5PA 5JYBA 2ANBA 2J6HA 3ZK8A 5MN4A 4I5FA 4M0CA 2P0EA 3LHKA 2AQ8A 3IT1A 3MTQA 2HXGA 2NSHA 2GBFA 2WWHA 1HDZA 3F49S 3HQ4O 3OKCA 4AKSA 1KNQA 2BMWA 1CR1A 1M66A 2PBLA 3GW8A 3ZGYA 3TXAA 1ST3A 3U7FB 4M1TA 2FQXA 1U04A 1NNLA 4BGEA 4J0JA 1BJKA 5LA6F 3ASUA 4C05A 1MP0A 3JYQA 1KJNA 1S89A 3VJLA 5LQCA 2BJVA 3C41J 3LX8A 3EBLA 4OKIA 4Y2VA 3RVRA 1H3NA 3CXUA 4HH4A 2WHEA 5KBYA 4YDHB 2PKYX 3W1WA 1ZA2A 1VLMA 1DJLA 3RQSA 5DBOA 4CEHB 3SJCA 1KZ4A 4UEOA 3ZHOA 4DQUA 3ADCA 1MNAA 1UPCA 5AVUA 2P3SA 4HDAA 3DLCA 3TAXA 1V45E 3H4MA 3B78A 4HNSA 4M3NA 4Y6SA 5BQPA 4C7OB 1EZ4A 2B8NA 4TSFA 3R7WB 5I8PA 5IDQA 4QUAA 3T0IA 3RT1A 1WBJB 3WYFA 1VOTA 5EPUA 4J0QA 2C0QA 5FF9A 1Y81A 1CQXA 4EA9A 4K6HA 2FZCA 2C07A 2YWCA 1YASA 4KE7A 1NZJA 1X7WA 2MSWA 4UE3S 4QPJC 2QLNA 5DWVA 1JPUA 5TVGA 3RVNA 5IJ9A 1PTJA 1SC9A 2HU7A 4MUYA 1N25A 3MGGA 1TEZA 3EXG2 2WKPA 5LM3A 4EVSA 2HA4A 5AXCA 4E5UA 5KWEA 1MF7A 2I4NA 2ZJFA 3CONA 2XT6A 1W34A 1T2CA 3DM9B 3OP1A 3HGTA 4PR3A 5AK0A 4CDMA 2ZUFA 1O4VA 2I3ZA 3HV2A 3L7CA 3NEJA 4AY2A 4E2YA 1C0PA 2XUFA 4PG5A 4LZWA 5D5QA 4ARZB 5IXSA 3K8ZA 4IICA 4B48A 1IN8A 2ASEA 3KBBA 1JHPA 1XCBA 4CLXA 2FSFA 4OV6B 3IAS1 3ZU4A 1TD9A 3P9NA 1K7CA 1N0UA 1Q91A 2IEAA 2QQEA 3EK2A 5EXXA 4FFRA 4ZEXA 4F46A 3DT8A 4X6YA 3AW9A 4F6RA 5JCOC 2A1UA 1OY1A 3DZKA 1IN1A 1A7UA 2FWBA 1DQZA 4NMMA 5PNTA 2YOFA 3R09A 4G2TA 5A71A 2DX7A 1QRSA 4IYJA 1T2UA 5F3DA 3ZE0B 4EF4A 2J5QA 1NMSA 3CYFA 3HR7A 1P31A 4RO0A 2H3EA 4FU0A 4BFLA 2HCJB 1XPOA 2Q7OE 4A3SA 5EIOA 5DM70 4C4RA 1NUUA 2O52A 4LYJA 3IV7A 5DW0A 2JHPA 3TGLA 4FXPA 4RJTA 3QBTA 5ECDA 4U8GA 1G2QA 2V7GA 4H7JA 3IFSA 3WIVA 1LWOA 3SVTA 3O9MA 2XQIA 4B83A 2F55A 2BH2A 1VJTA 3W2GA 5L3SB 1GNPA 4LDPA 5FUBA 1NVVR 3CZRA 4INAA 1AB5A 1QE0A 2BT4A 3DE7X 3D8UA 4DV4B 2A9RA 5HF8A 4O2BB 1TYEB 3T54A 1NFRA 3LLSA 2RI6A 4BVGA 4XWGA 5FTLA 5E1BA 1TUGA 5HYVA 4XCQA 1LQTA 3AWIA 3JALB 3KXPA 4G63A 2Z09A 3ZYZA 2R5FA 4BX8A 5B3LA 1P1FA 3G2PA 4BRUA 5AQ1A 2AYZA 2OKCA 1Z2EA 3OX4A 4OXRA 1E5QA 2O8BB 1RAAA 1WSDA 3EH1A 4TQGA 1SVUA 2ABWA 4KN9S 2WUFA 2OBYA 1OVGA 1A2KC 4X8LA 5EL0A 1KOGA 5LC1A 1FPQA 2JD1A 2Y66A 2OFXA 3ZGZA 4JAVC 3HLKA 2C4KA 2QGZA 3LI2A 1PLLA 1BU5A 1UK6A 1YIOA 5P21A 2RHWA 4G8CA 3SU8A 1B8VA 3BAFA 4QDXA 1XPRA 1OMOA 2JGLA 2XNDA 1Z9BA 2Z83A 1OHHA 1Z0UA 5DNUA 3UK1A 5CDFE 5LWQA 1HQYE 1DWUA 1PJBA 1LSUA 1TF5A 4L51A 3T4XA 3CG0A 3AR6A 4IMPA 5BP7A 1JS1X 1ZD8A 2N1MA 4J7XA 3TTVA 1ZSNA 1R6UA 5CIQA 3G8YA 1B1AA 2MR6A 3PYLA 4DR7B 1IHPA 3GT0A 3ILVA 5C5CA 3MSCA 1C9JA 2VAXA 1XQVA 1CUVA 3ND8A 4ZQEA 1KAMA 5ALYA 3SX4A 3FYTA 3WDMA 2A94A 2AMLA 3NASA 3OJCA 4L8VA 2P9BA 4AJLA 2O0LA 4H7FA 4XR4A 4HDQB 2AR0A 4H3VA 4A73A 4R1OA 4EWLA 1MAWA 3DNFA 1E9EA 3WQQA 4EJSA 1SJ9A 3DC2A 1V11A 2OAQ1 1NULA 2BJHA 1KQFA 3GT4A 4HRYA 1RAFA 1VLJA 3B20A 3OI7A 3AHHA 1L5MA 3W6UA 1GG9A 1M7HA 4B3MB 2JI7A 3OC6A 1ODLA 2L82A 3RSHA 1I3OA 2R6HA 1TJPB 1C3OA 1C8VB 2H07A 2GI4A 2NO9A 1MO4A 2J9XB 3AVXA 2Q41A 3B9RA 5BYBA 1GITA 4ZK6A 2C3YA 4W7HA 1BAPA 4GKAA 1NR5A 3PXXA 1B43A 1FRQA 3UG6A 2I7CA 1LRKA 4BYMA 5EXDA 3UUWA 4DRZA 1L7OA 2O7QA 4PCUA 1QG6A 5BSFA 1IUKA 2BGWA 1SIOA 3E9CA 4X1KA 1QYRA 4RSGA 2Q5OA 4XZ3A 5T5QA 1OLUA 3E1KA 1CUAA 2NXNA 4QXAA 4FFMA 1S8NA 4M36A 4GWGA 4P83A 2F3TA 3I64A 3GCDA 1JHZA 1KYZA 3CLSC 2NO1A 2BEWA 2FSVA 4YC7A 1WVIA 4U00A 1E2LA 3EHEA 3GP3A 3I9NA 4KSYA 4XR9A 1SKMA 1V47A 3WL6A 2WJ6A 1LZKA 1XKLA 5B2EA 4RK7A 5AI9A 3AR3A 3OCJA 1NAHA 2C7RA 5CEFA 5JZ9A 1S6YA 3SD7A 3DKVA 1ZJ6A 1KEWA 1QOPB 4DWJA 4UAVA 1B00A 4HT3B 4U3JB 2WSSD 4HEHA 5HCNA 3ZDEA 4DCPA 4TV8B 4AURA 3TTUA 1VFPA 4MIEA 3MRXA 3QIVA 1RQ7A 1HDEA 1R8YA 2OCKA 3K7EA 4WQMA 1MJHA 2C7GA 3GEGA 3V80A 3B9PA 3HB1A 1UT6A 2XGGA 1MAAA 1DTWA 3K0CA 4Q7JB 5COQA 2QL5A 1PR1A 4YAJA 2OLKA 4XEUA 3OLWA 1R16A 2RHCA 5EAIA 2EKDA 2F62A 3AFGA 5CDSA 4D4KA 5E1MA 1QDEA 4MVJA 3TW6A 2DR3A 1OI3A 2QRJA 3ZLJA 4MQMA 3G0GA 1E4EB 1E2DA 4S12A 3ZY6A 5EJ4A 3EDRA 1QC5B 4ASUA 3TOZA 1IM5A 4GLBA 1NGSA 3NVMB 1AF4A 2C42A 1HOXA 1KKUA 2HNKA 1N5LA 2Z1DA 3V6LA 3X1KA 5MDHA 3DMTC 3FRIA 4MICA 1DT5A 4IM7A 4NCHA 5K3DA 2VHZA 1WLSA 1KEEB 4YBZA 3LYLA 4CM6A 4DCNA 5B6IA 1JFTA 5AKXA 4IH1A 2JEOA 1UKAA 1ADFA 3DE1X 4FMCF 5IT9A 4LRQA 4RHXA 4DSNA 1AURA 3NBFA 5KREA 3KQMA 1DU4A 4JC0A 5E1DA 1N1DA 1TPYA 1Y34E 2B3DA 1N2CA 3AM5A 4R5MA 2VJAA 5HIMA 3T0FA 3F97A 4F2WA 4AS3A 3QVUA 3S1AB 3C85A 4I3FA 3TD9A 2XF8A 3IOCA 5FOWA 3ST7A 5LLTA 3FA2A 3IMKA 3A25A 1FUIA 3BDVA 4JLBA 1TF7A 1KZ7B 3QY9A 3ZG6A 1U7PA 1VBKA 2A5DA 2F4NA 4L9SA 1RXSA 1JDJA 4J7CA 1ZMBA 1OLOA 1U28A 1KRHA 2PD6A 2X3UA 3MWLA 3OZXA 1TMGE 4BN4A 2BP7A 2ZI9A 3MWDA 1X92A 4JKOA 4YRMA 1DX9A 1NUQA 3PV0A 4U63A 2JGJA 3D1VA 2ERXA 1CIJA 3OWOA 4Y1EA 3AYXB 1E6WA 1P0IA 821PA 3QVXA 4GX1A 3GFFA 4JJEA 4DUYB 4TMZA 1B14A 3BEOA 1GSOA 1ODKA 2PU7A 4CMBA 1U4NA 2VSOA 1L8LA 1QKJA 3A70A 4BMNA 1S2IA 3D3WB 1I51A 4L85A 4X20B 1N3IA 3AL3A 2OAP1 4F86A 1E6EA 2GAJA 2WFLB 4MB0A 3DFUA 5CDUA 4A36A 2VRWA 3LVFO 5FRDA 2AEFA 3EVBA 2PSSA 4Y1GA 1S3FA 1DFIA 1SY7A 1ISJA 3AXSA 5HBGA 3GGDA 3LC2O 3NDRA 2TYSB 4KVGA 4P22A 3ERCA 3AJEA 2BKUA 3CPJB 1F4LA 4DIMA 4JNKA 3U0BA 5G0TA 3AQIA 1QKIA 4ZC8A 1YDHA 2ZIZA 1H8ED 4HB0A 4V3BA 2QTVA 3Q4GA 5HE8A 3V8MA 4P3NA 2H17A 3TVDA 2GZ2A 2GBCA 3S7ZA 3NC0C 4P1ZA 1DG1G 5GJWC 3A9TA 2C2WA 2J8ZA 1J99A 3NHAA 4KXXA 4MRMA 3BCRA 1RQNA 3SN6A 4QLAA 2XE7A 4IIFA 4PNHA 1AMNA 1UC4B 1LXCA 2BDEA 4EBFA 4UTRA 2NVBA 1VG9B 3QWIA 5F5NA 1XLTC 1AKUA 1EZZA 2V3WA 3GDOA 4TKMA 4PSUA 3SGLA 5CFMA 2NZVG 4G84A 4RIFA 5BW6B 1R0RE 4RJLA 1V0JA 4CKBA 3T7JA 3CZCA 4HNRA 2GF0A 1NKTA 1K63A 3LUDA 4G07A 3EG5A 1HLFA 3CUWA 5DHTA 4BO2A 5K8JB 2H59A 4LSGA 1CIVA 4KSBA 3VR6H 1H1DA 3ETJA 2VHUA 3EF3A 3EQ7A 4OXNA 4PFJA 1SCKA 2QYHA 3O38A 4AXXA 3FTFA 2AC2A 2I6QA 1L7NA 1PDVA 1U6JA 2AD5A 1U1DA 4BNTA 3DSRA 4AQYB 1V43A 3FZYA 4WESA 3UWSA 1I1HA 2GYVA 3JVEA 3OMXA 1V16B 5IK2A 2ZZMA 3WWPA 1IUOA 4KKVA 1A97A 4OJKA 4DTCA 1KDYA 1FW6A 3F46A 5C34B 1TZMA 3BMNB 4IDPA 1J1UA 4WK6A 2EEPA 2B7CA 1P4HA 2CXOA 3FFXA 3O3CA 2QSUA 3QTTA 3Q5DA 3B5JA 3VPDA 2SICE 1Q57A 4R2HA 1ZBQA 2VXCA 3M5WA 4I55A 4NJEA 4DZZA 2O5CA 3ICCA 3KFVA 2IUTA 3QQ5A 4DMGA 1IL0A 5HKLA 2BR3A 4EECA 4KFSA 2VJCA 4BLWA 4Q7QA 2W8BA 3IMEA 3CLRD 3LRTA 4B6RA 4PIPA 4CQMA 4Z4FA 5CR9A 3FVWA 3NKLA 3V1YA 4BNGA 2ZUEA 3GQBB 5J1SB 1SCQA 5DP1A 2D3TA 3RUIA 3E7PA 3V4OA 3FOWA 3FZNA 2XZDA 4MUKA 1JEQB 3UHOA 1QZXA 1I13A 1MRZA 1UODA 2BFBB 2JZCA 3GQVA 4Q1EA 3A7EA 3AC0A 3FTCA 3ZX5A 3M7IA 3COYA 1V39A 4KQMA 4AJ1A 5K0SA 4J1SA 3DDZX 3TE7A 2NXEA 1ADYA 2Q7XA 4LQ4A 4Z3OA 1BROA 1B15A 1VJCA 4HGRA 4IIXA 3UMYA 1QQBA 2HRQA 1BSVA 4B3DA 1QQTA 3UJ9A 4NYIR 4YV2A 4MDEA 1QE3A 1QV9A 2WTAA 3JY6A 4NCIA 4C4SA 5GIOE 1P4RA 3BXGA 4BWGA 4BLVA 2XEDA 1EK1A 4DRXB 2FWRA 5HA5A 4GQAA 2UVPA 5JSKA 4ZJPA 4ENPA 2OZPA 1C0KA 3DV0A 4Y9SA 4YCJA 1R5NA 4LCJA 8GPBA 5AICA 2M32A 1Q0ZA 1QRDA 3DDUA 3M3HA 4GBED 4H6WA 5C4GB 2VK1A 4OPMA 2Q1SA 4C76A 4DUGD 5KYWB 4D9CA 4GI7A 1C7EA 1XPJA 1U98A 1DKQA 2GBGA 4RDHA 2EFEB 2Z98A 4FBMA 4JX8A 3GH1A 3OMLA 2PTGA 3D7RA 2PV7A 3R24A 4G4IA 4JCCA 3L4JA 4RD2A 1L4YA 3EF0A 4BXOB 3KRTA 1NJ6A 2H9IA 3EGEA 3LDUA 3FCXA 4BP8A 4OXKA 1XRQA 3GR6A 4GYKA 2ISSD 1GHTA 2I66A 2RE8A 3HYTA 5AD1A 1C1DA 1O96A 1X7XB 3C1OA 3EXFB 1YQXA 5ALTA 4ZN6A 4KB5A 3GRZA 3ETGA 4K28A 3RUAA 1J9ZA 1OYWA 2YV3A 4LAFA 5JVDF 3OOYA 4Z7JA 1GPDG 1BS9A 1GDHA 1R37A 2IYQA 5A62A 4MAAA 4YECA 3S2GA 1E7YA 3KZXA 3RV4A 4YCLA 3AF4A 5A4AA 4HGNA 1Y9AA 4MV5A 4B87A 1Z63A 3Q1KA 3NU1A 1E92A 2X8LA 2XUGA 3OEHA 2ZRIA 3H18A 3RUCA 3RS9A 4JVMA 3EZGA 3IO3A 3ONFA 1RI5A 2C54A 2E4ZA 1X7GA 3PRKE 3BIOA 4GOOD 4TXLA 5CM9C 3L41A 3LUHA 2N42A 3AONB 3FWYA 4YASA 2DKNA 3H16A 1P74A 4B3FX 4YJKA 1J9EA 3RU9A 2DPMA 2R00C 2ZANA 1LCIA 4J6EA 4PLZA 1QTQA 3OT1A 4HZUB 4WLOA 1FLDA 2RGNA 1Z26A 3B60A 2AB0A 1HLDA 3MCZA 4WRRA 1HNXB 2NN3C 1VKHA 2RHTA 5IJZA 1LV7A 1SCUB 1T2FA 4RX1A 2FOXA 3NDJA 4JYMA 4KQ2A 1M8JA 3OF2A 2VP5A 2ZSHA 3WMXA 2VAPA 3S4YA 4GQBA 1PFVA 1T15A 2VDNB 1XTTA 3H87A 3JAKB 5EE3A 3MXOA 1WCIA 1D2NA 3TPFA 3KO8A 1E98A 4DMKA 2ECQA 4A23A 3VKFA 2K6GA 4Y2SA 1NYTA 3HDHA 4MW7A 1Z6TA 1AZWA 2C29D 4UCWA 3ET5A 4CPDA 2EHDA 4A0SA 5IN4A 3QVJA 5JNSA 4QEKA 2FZ5A 3SG0A 1DBQA 4M1ZA 5DLEA 4H7DA 3AU9A 3BHNA 1U81A 2RHBA 1KYYA 4DG8A 1LVUA 2IOFK 2B1IA 4WZ6A 4NEHB 4OJYA 5CU7A 4MA0A 3GF4A 5LYJB 1PHPA 1V5EA 3NC1C 3GA7A 4HN4B 4XVRA 3IPRA 4QGFA 3RTCA 5KEIA 3VHRA 2Y1CA 1E7RA 2QN9A 4EFKA 3M70A 2Q27A 3H2BA 1GZSA 2AMYA 3EWAA 2XMBA 3WWCA 2LIPA 4XASA 5EMNA 2QBYB 2ZUVA 4ZI7F 2Y1EA 4N03A 3UBTA 1QNFA 1TJYA 4YUWA 2XIQA 1LK7A 2CLCX 3GLTA 4EG6A 4J90A 2PJZA 1RBQA 4DCOA 2I2XB 4CCWA 3GEIA 4J76A 3SBOA 1GAJA 2E4YA 2VPXA 4PZ9A 1T2DA 2QL9A 5I7RA 4FGJA 3DMYA 4QSHA 1JHVA 4B9AA 1T9GR 4E5YA 4ME6A 2FF7A 1MG5A 3NZEA 3FUCA 4UTZA 1HFEL 2GJ4A 4CM4A 4XYLA 4NICA 2FN3A 2EGHA 1GTMA 4M2LA 3ZDDA 2EARA 3PFCA 1XTVA 2OGUA 4RCZA 3QOFA 5F4BA 4N47A 1L5FA 2E2WA 4JQOA 2X2EA 2VOJA 4WVFA 4MARA 3EGDA 3QFHA 2V7BA 1IHXA 1R9JA 3PP8A 2Y68A 2IY7A 3V4RA 3MELA 4ZHQF 1RRGA 4X6LA 1SKYB 5AT1A 1M6WA 5KJCA 1WUIS 1VSQA 4QVGA 1MMFB 4RJ2A 2ZYIA 3MUFA 2A0XA 5CITA 3AUAA 4RESA 3B3JA 1QGOA 4P5DA 2K2QB 4RIHA 4FX5A 3Q7EA 4TWRA 1K9VF 2HRZA 4Q12A 4I9GA 2E49A 4R1NA 3HXKA 3X1MA 2AOTA 3ORFA 3S2IA 4UTNA 4Y2RA 1EB9A 5CJPA 3ZVRA 3JQBA 4GWLA 2J3QA 4OLAA 4XD7A 3HL4A 3WX0A 2BGGA 3G7UA 5JD3A 3U37A 1TYDE 1JSRA 5DI3B 1LBQA 4MI6A 2AFHA 2X19A 3FGPA 3MAAC 4DHWA 3HBMA 2QN6A 4WKCA 3T52A 2DC1A 1AN0A 4K9OA 4X1IA 4FYVA 1H2WA 4HAUA 5EOVA 1IBSA 4BYGA 1EFHA 1FVFA 1K1EA 3GD7A 1PDOA 2H85A 1HSOA 2GN8A 1SQSA 4TN5A 4XPIB 1QO0A 3E61A 2WP8J 1E7MA 3TSWA 1JR2A 4NE9A 2YFHA 4PYLA 2G9NA 1AK1A 3H5OA 5ADWA 4RZUA 2FG5A 2GKOA 1PTKA 1YRAA 1UDCA 4OHWA 2QUBA 4DLLA 2IX3A 3MQ2A 5JRJA 4NRDA 3HKEB 3PJDA 2OOSA 1Z5WA 1UJ5A 3BK1A 4RIEA 3CUKA 2V55B 1KKMA 2WF5A 3SLKA 2ST1A 3O7WA 1RRVA 4HQRA 2R65A 2ONKA 3A9CA 4QQNA 3CB4A 5GAJA 2ZWOA 2XWSA 3LS2A 4KMRA 3BL5A 4JVLA 1V37A 3CNNA 3HFSA 1DPFA 2O50A 2DBQA 4K9MA 1ADJA 3SKVA 2YUIA 3I9OA 1QTIA 1RWKA 5IBCA 3HKBB 3T3NA 2CUZA 3L93A 5KQSA 2DWOA 1JAIA 3LF1A 3SZRA 4NS1A 3GJXC 5JLJA 5F2NA 4MWDA 3KJQA 1HFWA 1UXIA 3TMYA 2ZR8A 4UHBA 4GPZA 2JH8A 1QPBA 2UYCA 1T91A 4ENTA 4RK5A 3S29A 4MS1B 1TB4A 2HMAA 3QVSA 2MOKA 2F3RA 4ZDKA 2W6MA 5IVHA 4QDUA 3M82A 4IF4A 1U1CA 1DXQA 3AG6A 4B82A 3PWZA 4F8YA 4FYJA 4WECA 4MV3A 1LDEA 1K4YA 3G5TA 2NU8A 4K40A 3S55A 1DJQA 2QTGA 3D3NA 3DUWA 5IVIA 2VK4A 4JI0B 1PL8A 5HQ3A 1LPSA 1FFEA 2BGMA 4FYKA 3DONA 2JJ2D 4JJAA 4DPLA 2RCNA 3OCWA 4IJWA 4XX0B 3D2AA 4PLFA 2RSLA 5FPTA 1YQTA 3KVYA 2B0CA 1Z5PA 3IJEB 3LCCA 3VSAA 4B45A 1N5OX 4RZ3A 1JB9A 4UBKA 2CF5A 5KCMA 3UIEA 4ZQFA 4FN5A 5DTJA 2CZGA 1XO1A 1T6XA 1E2UA 5TXGA 3S5UA 1P7ZA 1UOQA 3BWDD 4JA0A 5TV2A 3NHRA 1BGXT 1MIOA 2JRLA 1PDWA 4UHEA 4WCFB 3RE1A 3WLOA 4BLSA 5BV0A 3SOZA 1C9DB 2W2PA 4ND2A 2YY5A 5IW8A 2IDZA 2R87A 5HKOA 1OWNA 1K27A 5JWRA 2I65A 1ZVQA 3FOFC 1RLMA 1PK9A 2GZRA 5FADA 3NEPX 1SOMA 1DV2A 1E77A 2DECA 1L5OA 2VSYA 3G1TA 5GV8A 1N1MA 3BJRA 1DRUA 2Z2YA 2CZQA 2ORYA 3EPRA 3M89A 1HI9A 2H9AA 3R6WA 4ZGBA 3KUDA 4IZ6A 3PK0A 5CCXA 1U8UA 3RB8A 3D6JA 2ZJYA 3TEJA 4X44A 2WYWA 3LGSA 5G3YA 5TSDA 3DQQA 3G85A 3ZXYA 3O4FA 3R7LA 5A9SB 1LGYA 5K1ZA 4TLCA 1R66A 5T4EA 1L5LA 3JAMA 1X42A 3A4YA 2IS1A 1X2EA 1ECLA 4MVJG 4PC2A 1UC5B 3E48A 4CEHA 1IK4A 2REQB 2DSTA 4MINA 4RPIA 2NU9B 3KR1A 2WM8A 5HBRA 3GYGA 3DDCA 1IOVA 2AFIA 1GL3A 2VPZA 1N9GB 1F2UB 1X3LA 2V6GA 3B52X 2Q5EA 2I7TA 3BIFA 1UQRA 3R0ZA 4MV8A 3UGJA 4C7OA 1VMDA 4GPEA 4HNGA 1V8ZA 3AEUB 1SKUA 1KP9A 1MIHA 4LZNA 4W82A 4Y2XA 3R7WA 2ODAA 1FVOA 3RBZA 4WN3A 3MJTA 1MH1A 3L8FA 4BUCA 4YRNA 3GO4A 4RVOA 5HPYB 5IAAA 3K70C 3AJ8A 1DLIA 1Q17A 2VDPB 4HXGA 3BL6A 4JLMA 3WNDA 4DC9A 3MXTA 4DNXA 4HQNA 2W4IA 1GU1A 2D3WA 2WTXA 4IH9A 5ENZA 3U4MA 3ZIAD 1Y98A 1N5DA 1E2JA 1F8YA 2P9CA 3T5MA 1FPMA 4ALIA 3L43A 3IKVA 3T34A 1QQ5A 3TOXA 2PO7A 3PHLA 3QEKA 1X1SA 5A7HA 3DBIA 2GPYA 4ARZA 2QEQA 5JV5A 4BMOB 4D8VA 3PB3A 3TLXA 3ND7A 1ES9A 2C59A 3QXSA 3KU4A 3TIFA 1DBWA 5CFZA 2D00A 2J09A 3QW2A 5JXHA 1QGZA 5BPHA 3ID6C 1Y7TA 5JUWA 3DAHA 1IN6A 1RKQA 3WKEA 2EJCA 2EYQA 1CIPA 1P72A 3GPBA 4JLDA 5B12A 2FLWA 2QORA 2XA9A 3PQ5A 4IGEA 5CRIA 3R3ZA 2VH5R 3A10A 4Q4DA 4NLLA 3TN7A 3WMEA 7AT1A 2JHGA 2PRKA 3R3XA 4XX1A 1N7HA 1YNOA 1ZK3A 4FMDB 1Q5PA 3KWJA 2W0SA 3ZNPA 4B81A 1Q2UA 1QIDA 2V1XA 1E0DA 4JLUA 3RK4A 4LFAB 1PRYA 1BE6A 1UPFA 1YO6A 1Z33A 4M9QA 4QYIB 5D6NA 3ZQJA 3GLFB 3OOEA 4Q3AA 1XYVA 2V4MA 4GGPA 4BRSA 5I7AA 4CNBA 4ZVNA 3FJ1A 3KQUA 1G5HA 2V4ZA 3TUJC 3ICEA 5FEMA 5C8YB 4NQRA 4OQQA 3PJEA 1VP3A 1BRTA 3HGMA 3OIWA 1NVBA 3AUJB 3CO5A 1U9IA 3DMNA 4MUBA 3WBBA 1A5TA 1N2EA 5FUWA 4GSKA 1PEYA 5L3SA 1ZGZA 3WS7A 4MW0A 2VNIA 4ZI5A 3EQ6A 3LLVA 4BZZA 2N1BA 5B3JC 5HZKA 2F59A 4Q21A 3CU5A 3ADKA 4O2BA 1BMFA 4MLPA 2DF8A 2Z04A 4XQ0A 2W2LD 3H9EO 5H81A 5HQTA 1EA5A 2LE0A 2JFZA 1KK1A 3UHPA 3EIOA 3N58A 1GNTA 3JALA 3OM0A 4JLJA 3UOWA 1WCXA 3CSUA 1UXKA 3PDUA 5SYAA 3PHGA 4U2KA 3EMVA 4HAWA 4QYWA 1JA1A 2O8BA 2A5FA 5CMLA 1SQ5A 5K20A 1VE9A 3ECSA 5JH7B 1JAHA 1ZU4A 2A33A 2I6FA 4M49A 4US1R 4IZHA 1RI1A 3JRNA 3TS1A 5K2OA 3MMSA 3CVXA 2XDYA 2J0QA 1S2NA 4QRDA 1J8DA 3P9ZA 4YCDA 4CCYB 3AVYA 4X3CA 1KMHB 3I0ZA 2I6UA 2Z9DA 4GUAA 2P40A 4H17A 1OAOC 1L5WA 3TF5A 4OHPA 1XZQA 4QEDA 2NVWA 3E3MA 1LS6A 1RC0A 3PTLA 1TYZA 4TQAA 3R0QA 4FINA 1VI2A 1PZEA 3VPFA 3GUZA 1PJTA 1GUYA 3IPAA 1A5BB 3R23A 4K9DA 4EPTA 4JB2A 1LH0A 2F1KA 1LRLA 4ARBA 1QUFA 2REOA 3DMFA 1GYQA 1B2RA 3FJOA 1NW4A 3K96A 1C9EA 2H8GA 1JBKA 1HE8B 2ZWAA 3RBVA 4FNMA 3GZ4A 1K4KA 1QM5A 4V03A 3W7AA 1QRTA 4E15A 2YWBA 1E63A 5H16A 1JAYA 4DMCA 1YMUA 2WTMA 1BWSA 3FR8A 4TGLA 4YVFA 4ZVRA 3N05A 3VR5D 4OB7A 1BJRE 3FKSD 5AW5A 3RRJA 4JXXA 3CT6A 1JALA 1P0MA 2V9CA 3Q5GA 3TH5A 3EPKA 4YMVA 4AYWA 1D7AA 3H6HA 4Q9IA 3JZMA 3KJFA 1XTZA 3LXXA 5L9AA 1RXIA 1XDSA 3DOCA 4G8DA 1DUIA 5A5FA 1U2GA 5KWVA 4PQEA 4BB0A 1Z83A 4OH1A 1NPTO 1SBTA 4Z49A 1W0KD 4RMIA 5CM2Z 3NHFA 2I4LA 1QB8A 2DTEA 1R4AA 2J6BA 2Q6KA 4RVCA 5IU6A 2C03A 3VR6A 3GGSA 4BP1A 2OGZA 2YBDA 3K9HA 4ZKDA 4HKTA 1X39A 1OA1A 3IKJA 3R7DA 2HWWA 4DCJA 4M98A 1E6CA 2CFOA 4OFZA 3TRDA 4PG8A 5JIBA 3BJIC 2WYUA 3KR2A 4UHCA 5DGTA 2UKDA 2PSFA 2GJAA 4NFSA 2FPRA 3LBFA 3LKVA 1T25A 3DE5X 2IYSA 4IWYA 4IHJB 3DP9A 4LMAA 5EIHA 1YWGO 2YINC 4C20A 2CVOA 2EDCA 1M6NA 2HYDA 4CMCA 1CR4A 1H2RS 3EXEB 3U09A 2XF2A 3NCHA 3EEYA 1PAUA 3FG9A 2AXPA 5CVVA 1HFKA 1Z2PX 2C4HA 1BDIA 3LGXA 4RJKA 3CT4A 1CUWA 1DX6A 2ZIAA 2YWJA 1M76A 2G70A 1OBVA 1NNSA 2IDKA 2YIMA 3BD9A 3FDJA 2FEMA 1TLLA 2Q2QA 3R5KA 4MAMA 3ZBTA 5K3EA 2P75A 4I9FA 5K0LA 1MVLA 4X61A 3VR4D 4EW1A 2XUHA 4V0LA 4W7SA 2XCRB 4WSOA 3Q8KA 2ZWPA 5GPBA 3AF6A 3UAWA 2ZBEA 2ZQ5A 4UFNA 4Y2YA 1IEVA 2QROA 1PZMA 5CA0B 3R0VA 2VDOB 4U3JA 3SHTA 4YH1A 1M74A 1RWVA 4JXKA 1UEJA 4TV8A 2P69A 2WP0A 4IXDA 2EXXA 1FEZA 2QTCA 1P4AA 1VXOA 1JG6A 2HJGA 3UCFA 3W1EA 5PGMA 4UOQA 3OO0A 4Z6KA 4N3AA 3U56A 2I29A 2CHEA 1Y3CE 1ACMA 1J0CA 3CZ9A 4YROA 5GZ6A 2YYZA 1ATIA 4ZZ2A 1WULS 4K6OA 3L4EA 5D6OA 4Z5XA 1ORIA 1TGYA 4TVKA 3SIXA 2P9HA 1TUBB 3CLRC 2C3OA 3U7HB 3G3EA 5DV9A 4DR2B 1E4EA 4RL6A 5THKA 1AA6A 1QC5A 3BXOA 3QE9Y 2O2SA 1JWLA 5EZ5A 1L0BA 2D8MA 1Q22A 5J4LA 5CYGA 1IZZA 3AHIA 3JWJA 3Q88A 4PANA 5G02A 2FVXA 1Y80A 3GZTB 1Z28A 1MUUA 2JASA 1GZDA 1NM5A 2ADOA 4OXXA 2LCQA 1FS4A 1EGVB 1SC3A 1Y0BA 1A50B 2G4CA 2R25B 3MBIA 5AM3A 2P4SA 1KEEA 3MTJA 2L42A 1ESCA 4Q4JB 4CT4B 5JSHA 4YT8A 1I7DA 5ECWA 4EYGA 1M2FA 2FZ4A 3TI9A 4F11A 4J3JA 3DLIA 1HE4A 4QT0A 4R3WA 1QWOA 4LOIA 3MJHA 4PS0A 4REQB 4D02A 4ECAA 2Y0PA 2OLJA 3ZGOA 3CMMA 4P33A 2G5GX 3KKPA 3II6X 1UANA 5H7XA 4IMJB 1JT9A 4CW7A 3S1AA 4JZKA 3F9RA 1REQB 4MO9A 3UXHA 1Y3BE 1Z06A 1MO2A 1ZCAA 2NV2B 3I2FA 3OX1A 4CR6A 1J49A 4ZVLA 2YC2C 1VYHA 2Y1KA 1LV8A 5ALOA 1G6OA 2D0PB 4BEVA 2V9ZA 1M5TA 1W4CA 4Z1OA 1XUOA 4OM7A 3EGVA 1L4KA 3GEEA 2P68A 1OWLA 1M6HA 3ANXA 3ZHYA 1A88A 4XM0A 4ER6A 5LFAA 5GOTA 1ZMXA 1XU9A 1EEXB 2XT9A 3UK0A 4B3JA 1AKEA 2OO7A 1S2LA 5AVTA 2X14A 1WKCA 2B5WA 4ZYZA 4AKHA 3CZMA 1LBHA 2O8FB 4B2IA 3DO8A 2CEKA 1QVVA 1OTXA 2RAFA 1U4OA 5E9QA 3OEWA 4PC7A 4CKYA 4CKCB 3K6SB 4WL0A 5DNYB 1AZSC 1G3UA 4HK4A 3C3PA 2YCBA 3D3WA 4X20A 4B33A 1XCJA 1QIGA 2I2BA 3NX4A 2HSDA 2WFLA 3P0JA 3VJRA 3BOSA 5DTQA 3GUVA 3EDQA 4LDQA 4NONA 3CZPA 1BMDA 1R4ZA 1A7KA 1VIMA 4IAOA 3T7KA 1ZINA 3ADOA 3ETNA 1QKKA 4F2GA 2Q1TA 1YZQA 1WS6A 3Q5EA 1ZKDA 2WU8A 2PMBA 4RK6A 5HF9A 1OXBB 5CIWA 3ASYA 3HBFA 3A05A 4M0PA 4LKOA 4MRNA 5CXSA 4OGWA 5KDDA 1AMUA 3RIMA 2ZBQA 1JI0A 4W7IA 3L1VA 5B1IA 3O74A 4G26A 5JC1A 3AVUA 3W5BA 1YE5A 2BJWA 3SSNA 2NZWA 3EC2A 2O2YA 3F4BA 1EVKA 1E3QA 3IT0A 2ZBDA 5KNDD 1KR2A 1ZNYA 2WAOA 2EJVA 3FI9A 3QHAA 3VU8A 1YFLA 3EZ9A 4OL0A 4D1YA 5BV7A 3IKMB 3CF0A 1MT0A 1MC4A 1HKUA 2NYRA 2OAGA 2OZEA 2RG1A 2WW8A 3A26A 3FBGA 3P7MA 1I0LA 3MOIA 2OL4A 2GD1O 4JP1A 3DZIA 3HFRA 2PUGA 2G9UA 4U2CA 2QN2A 3JQGB 3H13A 2CXPA 3NR2A 1OJ7A 2F1RA 3ZVLA 1R4NB 2G9QA 1U7WA 3UFXA 2HGSA 1BX0A 3GWGA 3PSAA 4EJ2A 5JAOA 1CB7A 5L6LB 1Y63A 5HF6A 2HTFA 4Q9JA 4TSFD 2A67A 1NV9A 2P1DA 2QTBA 1IMJA 1XROA 3LQFA 3NC4A 5JECA 4AJJA 3V34A 3NM4A 3MGAA 3R6TA 4LJ7A 1TQHA 5KTSA 4UNQA 1Q21A 5EVJA 1Z0IA 1GIAA 2C4VA 4L4YA 1F0YA 5GVSA 4EMBA 3PC8C 3M4NA 2CJYA 1V16A 3JQ9A 4GD3Q 4KXNA 3L02A 3U7JA 1XFDA 1XXHB 5FUQA 3UWKA 1IPHA 5JNRA 3BMNA 3M6IA 1H8HA 1JQ5A 3AHGA 3RRFA 5ALDA 5HHTA 3UT5B 1Z38A 4C0LA 4GXNA 1XAIA 3VISA 3X1DA 1LSOA 1P5RA 3PD1A 4O25A 1PJQA 3ZOZA 5KQPA 5IXJA 1ZP6A 4PYNA 3ZH9B 2SECE 1I80A 4JBLA 3SFTA 2C3PA 4EI2A 5LKRA 4CN8A 2QPAA 1JJ7A 3L77A 1HT3A 3N2GB 2W11A 5EIBC 3WJ1A 4E70A 4EGAA 3UJNA 4IKOA 4WXYB 2BBSA 2GM5A 1KI9A 3GQBA 5FPYA 1DAIA 2I6GA 1I3MA 4ZC1A 2HMVA 5K3CA 4I46A 1R9NA 3WHIA 3SX0A 5L7TA 4AY6A 4KLNA 5IAJA 5F7JA 1JEQA 3T7DA 3B1ZA 3U19A 2BFBA 5K6AC 3KYBA 4DQXA 5IARA 2TMKA 3BREA 5JZVA 4O63O 4FEGA 2R85A 3HDQA 5TPWB 5JFTA 1L7XA 1TK3A 4H35A 5D00A 2COUA 3KR0A 4OMFG 2VKTA 5KYKA 3JVVA 4N76A 2CSXA 4ND3A 5NLLA 1O94A 1BE1A 3BF7A 3WDLA 5FORA 4ATNA 3UHJA 1OKKA 2FR8A 3LQRA 3ONDA 3NDBB 2VHCA 2WKQA 1XZEA 2WF9A 4WOCA 3TSZA 4DRXA 5LIPA 5EEHA 2C2GA 2HSZA 1V7PC 2BZ1A 4YHBA 3RSLA 1U7UA 1ORHA 2VYND 3BHJA 4MRSA 4UKDA 2CCJA 2C58A 4Y9UA 4LYAA 4YWJA 2QLJA 4PSVA 3ER8A 2ZRMA 5KYWA 2AC7A 1BWPA 3H3JA 4EYKA 3WLJA 3ILYA 1LTHR 2Q9CA 3HPQA 4QBTA 2P6OA 4V0ME 4RULA 2W00A 4Q6BA 2R8BA 4P4TA 1VBMA 3MT0A 2VXOA 4ID3A 3HZRA 1T3ZA 5HDQA 2AT1A 2UZ0A 1LPPA 2JBHA 1WM1A 3IVAA 1OJLA 5E3IA 1PW7A 2VI5A 3TLAA 3P32A 2CDNA 4LY0A 4UM7A 3SQNA 1IOWA 4EYOA 1NHWA 2R5WA 3QYFA 3RS7A 3N2KB 3OFSA 4AXBA 1T0PA 1X7XA 2ZPTX 3EXFA 1OHHD 3A9SA 4GXQA 4QC2A 4S1WA 2ZBPA 1G17A 2OHHA 3EH2A 2PYDA 2FMXA 2PUDA 1ZW6A 2VZ0A 5JCJA 1KI2A 2VDJA 2YWEA 3T3PB 3OC0A 2N75A 4BO5A 1P1JA 4PN7A 1EXVA 4BBJA 2RB5A 4U9IS 3IMFA 2PFGA 1N8NA 3YASA 4R6XA 2FXVA 4W1RA 3TQHA 2CV2A 1RXYA 2JA2A 2PQ0A 5ABPA 1JFFB 1N57A 2G7ZA 3E2IA 4RTRA 3U7GA 5JE8A 4BRZA 3QFTA 4RL4A 4JIGA 1XQ6A 3HS3A 4YP6A 2CVPA 3OE7D 1ZIXA 1UC8A 4DA6A 2ZJ3A 1VHJA 3IALA 2CLOB 3KSAC 1N1EA 2QUIA 3B36A 4XJSA 3BIWA 1Y82A 3Q3EA 4ZVMA 2ADFA 4PPFA 2ZRQA 4YWHA 1SEVA 4BVBA 1GM5A 2PUAA 3JZAA 1KJYA 1L5GB 2VF4X 3RF7A 4G0XA 3TRFA 5JASA 4NU5A 5KQGA 2B61A 1AVTA 4LZPA 2FKAA 1GVHA 4HZUA 2H5JA 4I50F 4E11A 1VL8A 3DUFB 3EDMA 3MZ0A 4AN1A 1Q92A 4XEHA 2BI8A 1YFJA 1SCUA 4RKFA 2GCIA 2X5KO 1A5ZA 4LUCA 3MWGA 1H2BA 3L07A 1BGVA 3PQ2A 3WIUA 1E0JA 2B99A 3KSDO 4JJIA 3V4ZA 2E6UX 3AOEA 2Z5FA 1RHUA 3JAKA 3ROFA 4P0PB 4O3FA 5BMVF 3VYVA 4ZYWA 3ESRA 5AK3A 3U7IA 3MS2A 2OHXA 1WBBA 1XP8A 1U1GA 2HF2A 3LDHA 2DG2A 1EDZA 1PO7A 1L8XA 2DKOA 3UAGA 3FPBA 3VUEA 4S0ZA 4I08A 3AR5A 5FPHA 3JWGA 3QKUA 4RWEA 3U3KA 3WVNA 4M99A 3WYBA 3BXHA 2W6JD 1IZ7A 3I1FA 1CNEA 1ZLYA 3BZWA 3K0HA 4N8EA 5EJFA 4BHTA 5F4ZA 3SHQA 1G8MA 1QIHA 3G9UA 3K16A 4O4HB 1PHRA 4OHMA 2F64A 4Y6QA 5LYJA 4JI1B 5DXFA 2R4UA 4D0NA 3E2PA 3BRWD 4MR8A 4IY1A 4P86A 4ER7A 4Z53A 4I14A 3O2QB 4OU5A 4GG1A 4M9CA 2HT1A 4LYDA 2QBYA 1ZN2A 4L76A 3ROGA 4JFAA 3GFOA 4HAZA 2JDIA 4YP1A 3LUJA 3HABA 2BDTA 4DQKA 4LGVA 1KQPA 1N0HA 2G4LA 2QMOA 4OQPA 1Q0RA 1XK7A 2AI3A 3PGXA 3WK7A 4Q1VA 4HLQB 2AMVA 2PJUA 2OCPA 3P0IA 4L07A 1NP3A 1J21A 1V4NA 3WAKA 1GUZA 5LDDC 2EBHX 2WIKA 4J0EA 5IKPA 1TJ4A 1THZA 2PLFA 1CQJB 3P2OA 4H0NA 2ZI5A 4HFNA 4MVXA 4A03A 1HPLA 3ETLA 2NT4A 3TLGB 3WRXA 1EVQA 3IJ5A 721PA 4ZYYA 3HYSA 4MVJD 3L4BC 2NV6A 4S0XA 4LJYA 1V1MB 4R1MA 4XWTA 1F51E 1H23A 4MJXA 4FYYA 4KMMA 1GAXA 1B74A 4EEKA 1IN5A 3DL4A 5JNLA 3B3FA 2V3CC 2KB0A 4BO3A 2VHXA 2JJ1A 4EIWA 4FCVA 4UNPA 4QPNA 5DJ5A 2D4HA 2IV3A 1L5YA 2H0QA 4IOMA 4D5GA 5DN6A 1QVAA 3G2JA 3NOQA 2IZZA 1ZK1A 2JCBA 2B4RO 3A1DA 3LUCA 5DBGA 3RWBA 1MABB 2FFBA 5K3BA 2UU9B 2X9QA 1GEGA 1UOOA 2A9KA 2R6DA 4BTLA 2G1UA 3PPWA 2AN1A 3JVIA 1ESMA 5F77A 1UK7A 1GRNA 1FDSA 1L4EA 2R79A 1M5UA 3I0NA 1WA5A 3ZCPA 4KW7A 1JDTA 5DI3A 2Q29A 1PJSA 3DYIA 3K3PA 3LPCA 5G40A 3WNQA 2EQ5A 3AG5A 2IUEA 2F17A 5IAEA 3ITNA 5CLIA 4B6GA 2HLPA 2R48A 5B1HA 1T9ZA 2BD0A 2DZDA 3GK3A 3PUYA 1YBAA 3HJAA 5AKLA 5B53A 3RK1A 4D6YA 1KNXA 2YXPX 4RD6A 4X7RA 5I9TA 3WRYA 4DJEC 1HORA 3KYCB 4XPIA 3S2ZA 3OTOB 1GKIA 1D4OA 1W1UA 1WXFA 4KXFB 4LXTA 4XW2A 4DABA 1E89A 4RQTA 1G64A 2QMYA 3EQ9A 4DM3A 3K9FC 3AFOA 3ELBA 4IDGA 5CNMA 4XSHA 4Y2JA 2ZYWX 3HKEA 3WHLA 4IUCS 5IVPA 3SAJA 5JHHB 1KZGB 2JEZA 4AZSA 2EDAA 2FR0A 4CKZA 5DKFA 1Z4PX 3MB8A 4EHKA 1RRKA 2OVFA 5F33A 3AIKA 2NP6A 2GH1A 3JRWA 3T7AA 5CVDA 2IQ5A 3NBMA 2B20A 4I1YA 4JODA 2WIGA 2X4LA 2BM0A 4TWZA 2YMPA 3I2IA 2UYQA 1RKUA 3HKBA 4R2JA 5ITVA 1ACJA 1W0JD 4HPWA 2YMQA 3QQPA 4BKPA 2FA9A 1W6RA 5AI4A 1DSSG 2NT3A 2OG1A 5H80A 3KKZA 4G1FA 2CN1A 3UOGA 2PG3A 4PO9A 5DTMA 4DARA 4KLZA 1SIBE 2W2QA 2H2GA 4Q7MB 4MS1A 3RJZA 4HQKA 1KQGA 1N2GA 1LX6A 1EM6A 2Q3CA 4YUZA 4JVOA 4DNPA 1WHTB 2AMJA 1NMZA 1OREA 2QTWB 3CRW1 3PGA1 3A4VA 3LBYA 4HDRB 1GFSA 5JPIA 3KXDA 1BHO1 1KZYC 2D5BA 4OM8A 1UBJS 1TEXA 2PKEA 2ZKLA 1XDGA 2D7JA 2FPXA 2JGIA 2MT9A 4EKEA 2A9JA 4YUXA 5LMNB 2YL2A 4XOIA 1BKSB 1IEXA 3D7LA 3SE7A 1L4GA 4HGYA 4LDNA 4E94A 2GM4A 2ZYVX 1HX7A 1VKJA 3RSCA 4XX0A 3FZGA 2H2FA 2ZJZA 3B1WA 1PFGA 1ZN9A 2JKVA 4ZYXA 3KYDB 2PK3A 4YAGA 2HFKA 2JJYA 3EMBA 5H4HA 3CZAA 4OBBA 2FE1A 1BGWA 5FOSA 5G53C 6REQB 4YRKA 5KVSA 5L4SA 3CXRA 3H8SA 3HH8A 3ZEAA 3FR7A 3P5BA 3FCEA 5DYWA 3ZWCA 3TWOA 4C6TB 3ZWBA 4GOKA 1QLHA 4WCFA 3E5RA 3RK0A 3PUZA 1UBOS 1N8KA 4F6CA 2NZ8A 3F6PA 4YNBA 4DBLE 3OX3A 5IK2D 4O59O 4RANA 1UC9A 3DEJA 1MEJA 4L5CA 2RFLA 3ABOB 3NTVA 3QLUC 3D7KA 1U65A 3EFHA 1NW7A 4JBIA 4HUJA 5AVJA 2P3LA 4CU2A 1VHWA 4XARA 1YZUA 3A4TA 4AY3A 4D4HA 2POCA 2W93A 4IJMA 4PLCA 1G3RA 2UDPA 4TKUB 3IUBA 1IQUA 1R6AA 1OD6A 5EA2A 3RREA 4G5OA 3GJSA 3VR3D 1P18A 1GTJ1 5KPJA 2R6FA 3CHYA 1OIXA 3GP5A 4D8XA 2QGFA 5A9SA 3ABSB 1PR5A 2G1PA 1HH4A 1JEEA 2REQA 2XCTB 1GQYA 2NU9A 3K35A 5LZ4A 6CHYA 4N8SA 1N9GA 1F2UA 3WJ7A 4E2WA 1F9AA 5FFMA 3WL4A 5IC4A 1FX1A 4BUJA 3MHTA 3NUQA 3VNQA 2VEDA 4B2PA 4F1WA 3AEUA 1I6KA 2DT8A 1DG3A 2GZHA 4B6SA 5TB5A 1W52X 3PEUA 3JZIA 2OBMA 1L7VC 4KQGA 4UFOA 4IIJB 2OO5A 2H0AA 2DFLA 2PDAA 3ANSA 3AZPA 5IF3A 5J43A 2ZXFA 3CTMA 1YJ8A 3SYNA 4IYRA 1JE1A 1JZTA 1V1RB 1W2HA 2JF0A 2XUDA 2YJ6A 1DEKA 1Z6QA 3TUIC 2YJTD 1A69A 1H42A 3ZWYA 2AJLI 4HS4A 3OPYI 2ZJ5A 1Y5MA 2A92A 1JQJC 1CUXA 1KIFA 1Z6XA 2CK3D 2XY4A 3LO5A 3M6AA 2A4MA 1Q1BA 3JVUA 1I7LA 1RZVA 1XVVA 4PQFA 4RD0A 5CCDA 2EERA 5LP6F 4AU1A 2HXYA 5KOJB 1P6QA 2HHAA 4DDMA 4LA4A 5A5EA 5K45A 2ZWIA 3P94A 5FH9A 3KALA 3LYAA 4AJEA 4JP3A 3PNVA 3NOOA 3WG9A 2KBEA 4J2HA 1G7CA 4Q48A 4MVJP 2EHJA 5EJ9A 2XECA 2V96A 2P9TA 2XMQA 4DHEA 1FDUA 1GKUB 2ATXA 2J0SA 1W581 4TKZA 2KM1A 2HSWA 1WUTA 1EXWA 3C0KA 4NCAA 3CX6A 4N40A 3NM5A 2AQHA 2FI1A 4N5LA 3ZDAA 5AHOA 3KLOA 2HUPA 1JQEA 3RNLA 3GLFA 4DBLC 2ECFA 3FY4A 1PVVA 1H1TA 3KKNA 4M0UA 1L1FA 4TXMA 4EKGA 4KH1A 2ZDGA 1R18A 2CLEB 3OFJA 1TT5B 2GBLA 5C8YA 4N5NA 4MZXA 3WO0A 2EWWA 5A4DA 5DOZA 2RI0A 4FR2A 2FP3A 2R4QA 3CKMA 3GIWA 3U1TA 4BNXA 2JARA 3HJHA 4OA5A 2ONJA 3K05A 3KG2A 4F7DA 2YR0A 3EASA 3UGTA 1O5OA 2QUZA 3HBLA 1CUDA 1Z47A 1URPA 4KV9A 4OREX 4WDQA 4UDYX 3G23A 3WL7A 4A0FA 4YCSA 3ICOA 4R69A 4YK7A 4KOEC 3LLCA 3T3EA 4D99A 4PGFA 4M8NE 1WUYA 2Q4BA 4LMBA 4UPEA 1KO7A 3BWCA 1USIA 1K5DA 5AJVB 3R3YA 2H7XA 4HZGA 5H3HA 3LC7O 2B6NA 1JJFA 4QX6A 4DZRA 5I7WA 1GUFA 1VE5A 3NIFB 3DR3A 5JH7A 3HVHA 3TGPA 1P2DA 2CL6X 3QSGA 1FYDA 3NM6B 4U4AA 4OHXA 3G9XA 3NHYA 2NTNA 2IU0A 5C9ZA 2CNWA 4FJ0A 4ZV9A 2O8EB 1IZ9A 4LG1A 1U9ZA 3GLKA 4CCYA 1KMHA 3QLVC 3VBCA 4UEJA 4H27A 2IDMA 4MQBA 4RSHA 4EG1A 5A04A 2CT8A 3JQ6A 1VSTA 4AS2A 4ND8B 5IYZB 4UBMA 4FZRA 1GCAA 1C3VA 1YVEI 2YOHA 2ZRFA 1SZDA 2QGNA 4HH1A 4DIEA 1E79A 1KMCA 3RSOA 5EZYB 3UC5A 5JQGB 4QYIA 1BX3A 3P96A 3O3NB 2QUJA 4D0GA 1HA3A 1KAQA 3TCKA 1KYQA 1SUPA 1T26A 4KMOA 1T43A 5AUQA 1EP1B 1KFEB 2BBWA 3UTDA 3W8EA 1IE3A 4YRTA 2QVBA 3EPLA 1JFSA 1CZKA 3QMVA 3UMSA 4NZPA 1W4ZA 2IU3A 5HW0A 1BQ3A 1LJLA 1Q7RA 5GTDA 4L3VA 3IOMA 1Z8HA 2C8KA 4K7JA 2ZUSA 4C2AA 1YDGA 2FWPA 2O2JA 3OJLA 2TMDA 2W71A 4FUQA 4GC5A 2NU6B 3H4VA 1UBRS 3EHDA 1JHOA 5EE5B 1KOJA 1OXVA 1QIKA 1JXQA 4A0RA 3AF3A 4BN5A 5D3QA 1SVLA 2QY9A 5FKJA 1ONOA 2DULA 1P5JA 4AKIA 4G0VA 1Z37A 4FE4A 1E58A 3KKQA 3JTMA 4IRUB 3N76A 5IM4A 1I7NA 1I5EA 2X77A 3QE4A 5FIUA 3FJYA 4A6PA 4Q7KA 1T3HA 2FSUA 5GIPE 2C2ZA 1OWMA 4RGBA 2HRRA 1FUUA 4IHJA 4OJQA 4XWYA 3O26A 4DSAA 4PPGA 4CEIB 4DQDA 3S2UA 3WMGA 3EXEA 5L7YA 4N4AA 1E8MA 3GPDG 3Q3CA 5DM60 2BDUA 4AWBA 1T6BY 4LI3X 4Q0MA 5EGNA 1JJVA 4G5XA 1ZQ9A 5B1DA 3HO6A 1CCWA 2PR2A 5TT0A 3UB3A 4DL9A 4A91A 1MKYA 4LJ9A 5AXDA 3C7CB 1QV7A 4PRKA 1PNTA 1MTOA 1DJOA 1JTFA 1XA4A 4XTRA 3W5SA 3ENQA 4KFCA 1IWBB 3OIYA 4RV5A 4BBPA 3OM9A 1N6KA 1WMBA 3OM8A 4BLUA 1J8MF 2VT2A 2HMTA 3CPEA 1CEEA 3AX6A 3R76A 1KE1A 3C6MA 3UMGA 3N87A 1W9MA 5CA0A 1WDWB 1UKEA 1L7PA 1IQPA 4AS1A 4TPKA 2DLCX 4XD7D 1OYVA 1GQFA 1QCYA 1SG9A 1TVEA 2HA7A 3DCYA 3DKPA 3IQEA 3ISJA 3O84A 2CFTA 3OAAA 4HO1X 3VYRB 1OX6A 3BRCA 1KE2A 1F8GA 4L16A 4XWKA 4Q3KA 5HR5A 5LMZA 1RZUA 4UQLA 2ZVJA 3MTBA 3VPCA 1KVUA 3H84A 5FPSA 2QX9A 2R7NA 1HDRA 1L8OA 1RPAA 4FR5A 4QREA 1B2LA 4H7HA 5FQOA 3U7RA 1QO0D 1P91A 1R00A 4FHFA 1T8PA 4RCVA 2HZBA 3GJ4A 1TUBA 3STHA 4MEAA 3DA8A 3ZGXA 4F0JA 4HFMA 4Y2HA 1X0XA 2BSXA 1GP2A 2OMEA 5ER9A 1GZUA 3H05A 2P65A 3FGOA 4R2XA 3C6KA 3WQHA 4Z2AA 3FHOA 4PZ0A 3W5UA 2CYBA 1ACLA 1HY3A 2BN4A 2PA0A 2AHRA 2YV5A 3LHDA 1HQDA 1RJEA 1YR8A 1G59A 1ZD3A 1JLLB 3FWKA 3HADA 2P2ZA 4Q4JA 4DJDC 3AJAA 2GCNA 4ETIA 5KZMB 4LV8B 1LLDA 4TRMA 1RXCA 4W99A 2QRPA 3C5HA 5LA6B 1K8RA 4MS3B 2ZSAA 3W5HA 4AJKA 1CS4C 3HB4X 1ODIA 3IR5A 3VSEA 2DHQA 1RJFA 3OZSA 4REQA 1YBFA 1ORWA 2ETXA 1G5TA 2GKGA 4FKBA 3FUWA 1Z0ZA 2CXXA 4JL8A 4N8DA 1PZGA 5THQA 1REQA 5TEWA 4XPZA 2TMGA 4YUYA 2QRKA 1OFGA 3AY3A 1U0EA 3X1YA 4G5RA 3H0CA 4YX9A 1U1EA 2RBGA 3ZJ4A 1AUOA 1ZOSA 2EWMA 2G1JA 1K6MA 4UEWA 3ZD8A 4CM8B 3WV5A 1IIBA 4J7AA 3U4GA 1ADCA 2JCVA 1RM4A 2JZNA 3CUVA 3DZHA 3LT5A 4HZIA 4BPRA 3NJ8A 1ZCZA 3EUFA 1KU0A 3FNQA 3KOXA 2PRJA 4KRGA 4OCZA 1PR4A 1H1LB 1Q12A 5K03A 1Z8DA 1ODFA 4Y6RA 4RZXA 3JAWB 5FL7A 2O8FA 3D6VA 3D0KA 5KNCA 2H1VA 1VKZA 1JG3A 2QTNA 1WG8A 3BH6A 4P7KA 3OF3A 4J4TA 4PPYA 3RU2A 4B46A 1Q3TA 3ND9A 4CKCA 3K6SA 3VHQA 3ABQB 2OHJA 2CHQA 3CUTA 5T6BA 2CEAA 3H9BA 1PWEA 4OO3A 1Z62A 2PWZA 2WEKA 5KHOC 2XTNA 1GKKA 5C35A 3KDAA 1C7ZA 1XA3A 4HWRA 3L8YA 4ZQIA 2QVZX 1H0KA 1MFPA 3GLIE 3DMPA 3HEMA 1N6IA 2G0TA 3MYYA 3IP1A 3KPVA 4ND5A 3EE6A 1EX7A 4R2MA 3SF8B 3V5NA 3NCTA 1I2CA 3QVVA 1P60A 2AH5A 2M9MA 3ITKA 4RADA 2ISQA 4OQFA 1KVSA 2QZ9A 1BN7A 5ALKA 4WACA 3H04A 3RYTC 3T5GA 4OHOA 3AGPA 4PAWA 5EXPA 1KTIA 3H97A 1G2PA 2CLFB 4ENQA 2BM8A 5AK4A 1VPLA 1Y6RA 3I1YA 3LK6A 3QA3E 1QLJA 2I78A 2JI4A 2RAPA 4ZZ3A 2PH7A 5D1HA 3UGKA 1N8TA 1MJ5A 4K9LA 3ECAA 1WSBA 1NF3A 3V46A 3ISVA 2GRJA 3N7TA 1MC1A 3HUDA 3JQGA 3TJRA 4DLRA 1TVMA 1TYCA 4QWMA 2R6JA 1RHKA 4HNQA 1R4NA 4R2KA 1C80A 1A0OA 2B9EA 1TIPA 3CEMA 3ZXUB 4DLPA 4GBJA 3CVUA 1E2NA 2FVYA 1PJ4A 3GCXA 3VPSA 4OQ4A 1BQ4A 2ZYTX 1AD2A 1ZISA 2QD2A 4BBAA 2O7NA 3AK4A 1RWQA 3INGA 3FPGA 3NANA 1O6CA 1RS0A 3RU3A 3W6NA 3EGWA 4NMXB 4V3CA 1NVMB 3V33A 3BVPA 3ROTA 1DRVA 3IVXA 4JL5A 4PZCA 2X0KA 1EP3B 3LBNA 2HCTA 1ZK2A 1P75A 3GLRA 1XXHA 1PIWA 2JIRA 2PX0A 1Y8RB 4L7QA 5BR8B 3COPA 3FFTA 4TYNA 4IBOA 4MGHA 2QTRA 4IWXA 3D1LA 3C45A 4D82A 3JZDA 3UT5A 3KK0A 4FYMA 4UULA 1VC2A 2H0RA 1XQ9A 4A2CA 1JI3A 1Y1LA 2Q6OA 3D6FA 2O48X 4CT5A 2HREA 2MJLA 3GGGA 1GLVA 3GDHA 3T9EA 5AVSA 2A0UA 4E5KA 4R4JA 1R0ZA 1A5AB 3N2GA 5G1NA 3WMFA 4C0HA 2BR5A 4Q9NA 3IDSA 4C4XA 3LUFA 4E1AA 2NACA 1YIDA 1YMQA 1CUHA 1RQLA 2AN3A 2AR9A 2R8ZA 4OBEA 3WLAA 5J4YA 2PJRA 5DM0A 4AW9A 1E1CB 4MV7A 1UJNA 3HFGA 4IDHA 1AQNA 1ESNA 1PYDA 2G9VA 3C4VA 1AQUA 3CJTA 4UBLA 4DIOA 4XD2A 8MHTA 3P2KA 2Q8QA 4ESHA 1T0HB 5FOVA 4OI2A 1GRCA 2EX0A 3AP1A 4R9UC 3REFA 1UMDB 5BUSA 2CVZA 2HWXA 5D3KA 3KWMA 1CJBA 1DIGA 1H2HA 2XVAA 4M0KA 1KA9H 4WLNA 4A4DA 1AHPA 4IW3B 4Q3NA 2FUG6 3FSGA 3TLKA 5IJXA 4CDNA 1GPMA 2BGIA 3IUQA 5ALMA 2BUCA 3KTAB 1RYEA 3K70B 2PA3A 1IHOA 4BJHB 3ZXIA 4RFSB 5LQSA 1YRHA 4MKZA 4B76A 1MDBA 1BMFD 4MW5A 2AKYA 1UH5A 2XYQA 2IHYA 3L06A 1Q15A 2NXJA 3BN3A 4CMKA 1U0RA 2EJTA 3HP7A 1NW5A 1ZM3A 3GHHA 3OP4A 1X87A 2RH5A 4C4TA 1EVJA 3HWX1