1TKCA

Specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
publication title Specificity of coenzyme binding in thiamin diphosphate-dependent enzymes. Crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 242
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1994-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA01
1V11A 4ZP1A 3ZHQA 5I4IA 2EZ8A 1TKAA 3DVAA 1YHYA 1YI1A 3EXFB 4FEGA 2Y0PA 2JI9A 2Q5LA 4Q9DA 1TKBA 1OLSA 3M49A 2G67A 2BEWA 2VBGA 1POWA 4KXVA 1WCIB 1UMBB 4KGDA 3ZHSA 5ERYA 1X80B 2XT6A 1X7XB 2J9FB 2R5NA 3M34A 2EZTA 2C3PA 1TKCA 2G25A 5HJEA 2UZ1B 3IAFA 1T9AA 1Q6ZA 5AHKA 3E9YA 2VBFA 1OLUB 4JU9A 2Q28A 4MPRA 1NI4A 1W88B 1W85B 2IHUA 2OZLB 4JD5A 3ZHUA 3OOYA 4KXYA 5K2OA 1V1MA 5K3SA 2JLCA 4JUCA 1V11B 4C7VA 1X7ZA 2Q5QA 1X7YA 3JU3A 1OLXA 4RJJA 1UPAA 3D7KA 5EJ5A 4GM4A 2Q27A 3F6BX 2FN3A 2C3UA 4D5GA 2C42A 2JI8A 3ZHVA 5FEMA 2VK4A 2O1XA 3AHCA 1UM9B 3IAEA 1T9CA 3RIMA 1PVDA 1DTWA 2V3WA 3AHHA 2R8OA 2C3YA 1V1RB 1V16B 3EY9A 1POXA 1U5BB 5EJMA 1MCZA 4RJKA 1PI3A 2VK8A 1N0HA 2AG0A 2JI7A 5K6TA 2PDAA 3EXEA 2BP7A 4MPPA 5K6RA 3F6EX 1YBHA 3OE1A 2UZAA 5DGTA 3M7IA 1JSCA 2BFEA 1OZHA 1B0PA 1UMCA 2BFBA 4K9KA 3DV0B 1X7WA 2VJYA 1UMDB 1QS0A 4XEUA 5ESDA 5I51A 3AI7A 2BEVB 3AHJA 4JU8A 2PANA 2VBIA 3EXHB 2JGDB 2W93A 3AHGA 3AHEA 3AHFA 2BFCB 2QTAA 3AHDA 3DUFB 4JUDX 2JI6A 3MOSA 2C3MA 2VK1A 3EXG2 2E6KA 3EXIA 4GPEA 4K9QA 3ZHTA 2XT9A 4K9MA 2Q5JA 2QTCA 3DVAB 3HYLA 2BEUA 5DGDA 2BFDA 4MZXA 1Y9DA 2BP7B 1KEKA 1IK6A 2EZ9A 1OLSB 2O1SA 1UPCA 5I5GA 2JLAA 2BEWB 1YD7A 3EXHC 2C3OA 3EXFA 3M6LA 1NGSA 2R8PA 3LQ4A 5HHTA 5DEIA 1WCIA 1UMBA 3EA4A 3LQ1A 4QPZA 4COKA 1X7XA 4D5EA 2J9FA 3LPLA 4JUFA 4K9PA 1R9JA 1NI4B 4KXXA 1OZGA 1YNOA 2UZ1A 5I5EA 2C31A 1PO7A 1V1MB 4K9NA 5EJ6A 1X7ZB 2G28A 1QPBA 1X7YB 1OLXB 3UPTA 2BEUB 3ZHRA 4K9OA 2BFDB 4KXWA 3HWX1 1AY0A 2XTAA 2YIDA 4GM1A 2BFFA 3KOMA 2NXWA 1GPUA 5IMSA 1V5FA 2IHVA 2JIBA 4WBXC 1L8AA 4GG1A 2Q5OA 5HGXA 1DTWB 3HWWA 4MPJA 1QGDA 1OVMA 1UM9A 4GP9A 4JUAA 2WVHA 1V1RA 1V16A 5ERXA 5C4IA 1U5BA 5EJ8A 2EZUA 3LQ2A 1UPBA 3UK1A 4KXUA 4FEEA 3EXEB 1V5EA 2X7JA 1T9BA 3EYAA 4MQ5A 5EJ9A 5EXEA 5EJ4A 1ITZA 2IHTA 1T9DA 3EXG1 4C7XA 4GM0A 2BFEB 1UMCB 2BFBB 2Q29A 1X7WB 2BFFB 2FWNA 1QS0B 2EZ4A 4K9LA 1Z8NA 2IEAA 2WVGA 1V5GA 4QELA 2PGNA 1YHZA 1RP7A 3DV0A 5HYVA 1X80A 2PGOA 2DJIA 1UMDA 1BFDA 1ZPDA 2BEVA 3L84A 4RJIA 1PYDA 3EXHA 2JGDA 3FLMA 5EXDA 1YI0A 5EJ7A 2BFCA 3FSJX 3FZNA 1OLUA 2YICA 3EXIB 3AHIA 1W88A 1W85A 3DUFA 1OZFA 4QQ8A 4JUBA 2AG1A 2OZLA 5EJAA 1TRKA 2WVAA
chains in the Genus database with same CATH superfamily
1DEAA 4DLAA 1IAQA 3I1FA 4ZP1A 4J0CA 4YT4A 2OV1A 1I7NA 2C4WA 2C61A 4MKXA 3WA7A 2GXSA 3LUHA 1V41E 2ZSBA 3RJ5A 4BNNA 1MV5A 1KQGA 1UAAA 1RWQA 3GA7A 2CCGA 1F4LA 3CLSD 1PFUA 2H0AA 3QMWA 4UPEA 3GEGA 3PBKA 2A9VA 1XPRA 1G1MA 1NPTO 5GIPE 5LP6B 3A3KA 5F78A 4MVJH 2CY0A 2HQ1A 3NKVA 5C9ZA 2RBKA 3ZZMA 2CXRA 3C2QA 5LOVB 1Y8AA 3B36A 3V7YA 4UVHA 1DC3A 1EXVA 1GCGA 1PS9A 2IPXA 5JO0A 2OFXA 1GRQA 1Z26A 3ZYCA 2A5LA 2X3UA 3F5QA 3LCRA 3D1VA 4G5GA 4KXVA 1O6GA 1NQXA 1RHMA 4ME6A 4D9IA 1SG0A 2WQ7A 2V7XA 2F43B 5DLEA 4LRTB 1BXRA 4NATA 1KOLA 1NYTA 2PPLA 2ODAA 3HA7A 4WOKA 4UQPA 1F20A 5FAXA 5CBPB 3PWSA 3VZQA 5D5PA 3IMKA 4W6ZA 5FDFA 3IDFA 4HV4A 1NJSA 1GZVA 4IZIA 1LBIA 1EHIA 3E9MA 1JYEA 4MW4A 4R0NA 4LTDA 3U7GA 3VYWA 2ORED 3L4BC 1WV1A 1DJOA 4XZ3A 2OQIA 3NBMA 5AJTA 5JH7B 4O1MA 4UXIA 5DI3B 4EYEA 5AHKA 3QE2A 1EX1A 2KI5A 3LUDA 3WFIA 2C94A 3ENKA 3GLIB 3ICCA 1YDHA 3LX5A 1EMDA 1DCMA 2P2SA 3ACCA 2V0GA 3DKIA 4CV1A 4LV6A 5JRDS 1Z45A 3IAM6 3NYRA 3FB4A 3U3MA 2VDVE 1W88B 4OHBA 3ZD9A 1H2RS 2A2ZA 5B57C 3MRSA 3JARB 3RS0A 2CK3A 4QQFA 2MTBA 2TMDA 4G5RA 4LVUA 4UDOA 1YS9A 3ROGA 2WTNA 1X7GA 2C07A 4GUAA 4B17A 1Z4KA 5IJZA 2FVYA 2ZJAA 4FCWA 1MXFA 2F62A 3HKBA 1AK2A 1JE0A 1V1MA 2BFMA 2MYTA 3ENWA 2GPWA 4C4RA 1JZSA 1ZM3A 3HS3A 1SKYE 1YU9A 3E81A 1AZSC 1HLGA 3NOOA 1KI4A 2QI9F 1L5KA 5K9ZA 1O97D 3WGIA 2LIPA 3M8KA 3QA9A 2VK2A 2RBEA 3OCWA 4F9TA 5JPDA 2H65A 1UKZA 2B37A 3L6UA 3ZWCA 2NT3A 4W5WA 1HRKA 1N7IA 2O3QA 2H1CA 3MC1A 2BM8A 1BMFD 3DL4A 4Q1AA 1CEXA 1CWUA 3RFUA 2GAIA 1G3UA 2WIBA 2Q27A 3IAAA 3TR6A 3S5JA 3V46A 4CKBB 3N0VA 5DLQC 4N48A 5F73A 5B4VA 2DY1A 4F38A 3H13A 3HEBA 3N7AA 1AQNA 1X14A 3CVOA 4NHOA 3FFTA 1KAQA 3MQ4A 3UJ8A 4A2QA 1R7RA 3C3BA 1QYIA 2AA3A 1U4NA 3BXEA 4QXRA 3QPBA 4IJVA 3WJAA 1O3YA 4AI6A 1XLTA 3QF7A 5IH7A 4FINA 2IDJA 2O8FB 3NVAA 5B2ZA 3OD5A 2HRCA 1M0SA 3AEZA 2C4KA 4BFUA 1OPXA 2O1XA 3EWNA 3OBBA 4P4TA 3PXDA 1PSZA 3MPUA 1XTZA 1KKMA 1SVMA 2OG2A 3BMXA 3LQKA 3R9IA 3RAJA 4ENRA 3V97A 2JFNA 3BE8A 1ZA1A 3LNTA 2V1UA 2OBLA 4RTLA 1TTQB 2CLIB 1KR2A 1TK9A 1JMKC 5LU9A 5CEEA 1TC2A 1PX2A 2P2ZA 4QFBA 3K3PA 4IEFB 1D4OA 1TMYA 4U7FA 4CCYA 3DBRB 2FI1A 2OZVA 5F76A 3KOYA 3LYHA 1XUOA 3IAXA 5A6SA 1Z0JA 1MH1A 4QPPA 2FDRA 4GMDA 1QQBA 1JHOA 1K66A 1DKLA 5KNDD 2AOUB 4LRWA 3WSWA 1H2BA 4DR7B 5K6AA 2GPBA 2OCBA 4M36A 2HPVA 4UUAA 1W49A 4GX2A 1DWOA 2VNSA 3K0HA 4AURA 3ZCSA 1BJTA 1E2LA 2AG0A 4GPD1 1DC8A 2QNBA 2KS6A 1Y9JA 2I67A 2FPIB 3FX2A 2R25B 1BYIA 4I4LA 2OHFA 5E2BA 1TZ2A 3ZK7A 1PTJC 4FOOA 3SS8A 3DM9B 3IJEB 1TC1A 2AFIB 2QU8A 4H27A 1G18A 4QIHA 4BJ1A 4EKIA 2ZSKA 3BQMB 4Y2GA 1V7ZA 4ZIRA 1SULA 2A9KA 5C1PA 1IK4A 3DKPA 5DKFA 5F2KA 4NBTA 3I8XA 4DQUA 5JI2E 1JXOA 2BN4A 3QNUA 4QG3A 4JVLA 1GGFA 2DFDA 5BORA 1JJVA 3W2EA 4C4OA 4DYHA 4MMZB 3P8ZA 4IGAA 3RWMB 2HQSA 4GMGA 4MQMA 3LVFO 3VHXA 3I01A 4D9CA 2I3AA 3QVSA 2IXAA 2UUPA 4HNHA 3KJZA 2CHEA 2VJYA 4TLEA 5BWOA 1DINA 4G0MA 5TF4A 2ZIAA 3N2LA 3T15A 3DLAA 4OQMA 4KPUB 1TRHA 3S7TA 1LFAA 2EFGA 3F1KA 2I6FA 1HYGA 3KKLA 3LNCA 4EABA 1EM8B 2D3TA 4QA9A 4FXOA 5FO1A 4E5MA 3O7WA 2VP2A 1VHTA 2WUWE 2PH5A 3BMNA 3D7SA 3G8YA 1I8TA 4FMDB 4GI3A 3T7RA 1N2JA 3DBLA 4G1UC 4OHXA 1H85A 5DBOA 1YJQA 5CDHA 2VR1A 3LHFA 4XQ0A 3N8DA 3JD0A 2WB4A 1W6RA 4BO6A 3OI7A 1ZGZA 3F97A 1U3VA 5HSGA 3WKEA 3ZI4A 1KJIA 3C8ZA 1BQ3A 2ZSHA 2VLBA 4GVLA 1MVLA 1XZBA 4RFSB 1OB5A 2ICAA 1V7CA 1S96A 5K0NA 3GJ4A 3S68A 3GT3A 1U4OA 1T3SA 3EZNA 1F0YA 1DCTA 1K7EB 4NI5A 4OK5A 3O8QB 1E66A 2BFOA 2IWRA 4ZI3A 1HT0A 2C77A 2C2YA 1M2VA 2J0VA 3EQ7A 3ZDQA 2X8BA 1PJ8A 3UCXA 1EXWA 1YR8A 1R6UA 1PKEA 1GUYA 1PRYA 2W8ZA 3L04A 4HXEB 4PZDA 3H87A 5DV9A 1WKVA 3ANSA 2JZOA 3A4YA 1JA1A 4YGXB 2Q5JA 3ZWYA 2QVZX 3O31A 3C3KA 3PC2A 2IZ5A 4BCDA 4E09A 3ZKAA 2IH4A 1RPTA 4R9VA 4ZI7B 3MILA 1MC8A 4XGIA 1WQ4A 4ZOLA 3AF4A 1SOMA 3L4BA 2ZYVX 5AM0A 5FPKA 5SYMA 3RYTC 1QORA 1TQ2A 4HH1A 4BTVA 3L8YA 4ZZ2A 2BEUA 2C2WA 2WJ3A 2EKLA 1OMOA 2EX4A 5JW6A 3RRJA 1KY2A 3Q72A 4OQLA 2CSXA 1P5FA 3EC1A 3KXPA 3PYXA 4HNGA 3RU2A 1EBUA 3RQIA 1KVQA 1RHRA 3GU3A 2FFBA 3U62A 2X1LA 3FPAA 4B43A 2O1SA 2OAGA 4GSLA 1YJ8A 4NEGA 2YHAA 1E2JA 3BL5A 4D1YA 5ED4A 2BF7A 4G01B 3FBGA 4KFCA 6ABPA 1T2UA 3OWXA 4PLFA 5LDGA 1RD4A 2EATA 2E4YA 5IYZB 4ZOQI 2I7DA 2XE8A 4NFHA 1ESZA 4NOMA 2Q6KA 3CXUA 4YJ2F 4ALIA 1S3GA 2Z98A 1WMAA 1QCYA 2R1TB 4N0QA 2YHIA 3D54D 2YBDA 3T3PB 3TB6A 5CFPA 4YCJA 3T1OA 3AP3A 2CWWA 4JEUA 5H9VA 5U1PA 3TJRA 1NNLA 4ZU3A 1EPUA 3UK1A 2NU8B 3U4MA 2VQSA 1TYDE 1DNPA 1GTG1 3BTOA 3C45A 1A2OA 4UDYX 1D6MA 1PV4A 1KORA 2JJ1A 1S8FA 2G40A 1QFMA 1KDZA 4AD8A 4W7IA 3WIUA 4OXRA 4EB3A 4DY6A 1E4OA 3SZUA 3MIZA 1Z47A 3W7VA 4JR1A 1R64A 1P61B 2EHDA 3C3MA 1DKQA 3ZD8A 4DQXA 5HIKA 3U4QB 3AFNA 3WDKA 2C5SA 3QVMA 3ZJ5A 1OWLA 1DB3A 4Y6QA 1NZFA 3G59A 1JI0A 4QRDA 1TK3A 4U2BA 1PR3A 1IZZA 4J0FA 1A5SB 3KWMA 2FAXA 4GI2A 1MMFB 3NEYA 1U2SA 5ALEA 1HG1A 4CM3A 2VNHA 3CFYA 3KKNA 2DHDA 4NY1A 3TZEA 2WF5A 3IAS6 2XCUA 4HBZA 2MINB 2H7XA 1MV8A 2QM0A 3JQFC 3LTNC 5EWJA 2Y8EA 2CLKB 1IB0A 1I1OA 3AM3A 1YL6A 3B20A 4L76A 5SZKB 1AS2A 1BROA 4E6EA 5CLJA 1QB7A 2UZ3A 3BH0A 1DAFA 3O8DA 3KDAA 2ZVQX 4LRQA 3I9NA 3WJ2A 3A6KA 3UMVA 1MGOA 2FP4B 3DF9A 2I4MA 3E84A 1GA1A 5HMMA 2LCQA 3ZGZA 3EFEA 1SBTA 4LI3X 4KBYA 4N39A 1P29A 2YNMA 1Z8FA 2QJWA 3NBZC 5K8LA 1E2FA 1WWKA 5D86A 2QROA 4S0ZA 1N0VC 2WKWA 2JDID 2Z9BA 4MUBA 4C4AA 2RHCA 4NRDA 4S2EA 5JNUA 1ZR2A 3PKJA 3ADOA 4D42A 1XA4A 2PKXA 2VAXA 3QIVA 5DASA 4EI7A 2OD2A 4RD1A 2P1ZA 1HLFA 2PRIA 2DBZA 2IIBA 1JQ5A 3TVYA 5KNBH 1GSOA 4M83A 4BWGA 4JB8A 1W96A 1RLMA 4WA7A 2J32A 3OC0A 4FFWA 3NHKA 4HDKA 4DVGA 2QVXX 1YJBA 1B43A 1B8PA 1NVUQ 4KVAA 1AZWA 2OHXA 2B7BA 2CVFA 3C6QA 3A14A 3CZ4A 4XGNA 2HMUA 4OAQA 1M8FA 1ZGBA 3CKKA 2XYVA 4OIMA 4ZTBA 4MVJP 1ZUNB 3HJGA 3RGGA 4OI2A 1M2OA 3MK31 1P1HA 4BLOA 5E8RA 1ANKA 1OTHA 2J0SA 1FDIA 4KVZA 4BNWA 3W6PA 4K05A 5JMPA 5TPZA 4C0QC 1KF0A 3H2YA 2IYEA 1XTUA 3S70A 4EIWA 1NVEA 4O4HA 1YA4A 3PCTA 5A5DA 4LGMA 1PTJA 3SCZA 5TRTA 4FVTA 4MRMA 3ANNA 3MXOA 2FZVA 2FTKE 4KMMA 4RWEA 5EY5B 2YWGA 4OHWA 3I2GA 5HQJA 2ODEA 4TYMA 4UEWA 3ULKA 1NFQA 3N7UA 4IFBA 1L0BA 1FUEA 4R41A 1K2VN 2UDPA 1U63A 2O8CA 2YVKA 3V1UA 1FFSA 3EZ6A 2QN2A 5E2AA 3TGPA 2YJ3A 1WPQA 5HWSA 3DLBA 4E30A 1P7WA 4MJ7A 3ZGLA 1GGNA 3QKTA 2V8OA 4HUJA 4PAWA 4UBMA 2D13A 4X3CA 1BKYA 1YRLA 3JQ7B 5I9MA 2OHVA 3D3WB 1U7HA 3W77A 4L5AA 1RMTA 4BBPA 5AVQA 3N59A 2XNKA 5DVZA 2BGIA 4DM7A 2YDYA 5B3LA 3B1WA 4MAAA 9ATCA 3L92A 1IZ8A 1GGJA 4FLEA 2J07A 2Y76A 3M6FA 1TUEA 2CVPA 4X71A 4ZARA 3EPJA 3JAWB 1LLUA 3CRMA 1NJ6A 3KVRA 3SHVA 2GN9A 2JLBA 4P38A 5IJ0A 4DRXB 1F17A 4HQ6A 4XLZA 2HFJA 3SS9X 4EG6A 3F4BA 3G8CA 5EJ9A 1X8LA 2P6OA 1TQDA 2FX3A 1BOFA 1HE2A 1P8JA 4ESHA 5EJ4A 1B23P 2R6HA 2G9VA 1U8CB 1F9EA 1T9DA 2UZ4A 2ZFUA 4AUEA 1GSHA 3FDXA 1ZEMA 4C0WA 3LC0A 4OHFA 3JATA 4FLMA 4LOIA 3LWZA 1MFPA 4J0IA 4Q47A 1ZIPA 2JFFA 1CQWA 3O3CA 3SYMA 4DLWA 3S2ZA 3O1LA 4WI1A 5JATA 3AQ4A 1SKAA 2CK3D 3BAZA 4K87A 4XWOA 1KOGA 1N9ZA 3QW4B 3ZCUA 1GNPA 3PDIB 4IL5A 1NXWA 1SU7A 4B76A 1ODSA 4ALNA 3EQZA 1Y8RA 3KZCA 1UJCA 1C1DA 4QELA 1L5HA 1KL7A 3HEAA 1J7JA 3UK0A 1C8BA 1GFSA 5CUQA 4JUIA 3WGUA 2FSHA 1OILA 5IAAA 3HJUA 4WNYA 4UNRA 3KEFA 1F8YA 1JDPA 1KI1A 2OCGA 4L78A 1MDBA 4QYXA 1U65A 1QOPB 2QD1A 2PK3A 2R9VA 4FNOA 3RLIA 5LQKA 2F1KA 2MR5A 3OECA 5ECGC 3U7HB 1FDUA 4DCSA 1KYWA 3PGKA 4YRSA 1PYDA 4H17A 1A9YA 3I9V1 1N7HA 1Y8CA 4Q3LA 3KQKA 1KAHA 1L4BA 3LUFA 1WW2A 4BLUA 2ABWA 2C98A 4TYNA 1IN7A 1C1XB 5L4SA 4MLPA 2CGEA 3OOWA 3RFTA 3FBTA 1OLUA 3H9BA 4UVEA 4DWVA 5FTJA 2GD6A 1X3SA 2YJ6A 2EGGA 3GEHA 3RYIA 3F5SA 1IH8A 4QXPA 1NI5A 3DUFA 1UBKS 3IJRA 5A5EA 2OV6A 5LYJB 3HJCA 2TECE 1F5NA 3KTDA 5JCJA 5JS7A 2OZLA 3ZE8A 1K27A 3G0GA 4PG4A 3AF3A 5HJ7A 5B2EA 4CKZA 1BAPA 2X5JO 3LK6A 4GQBA 3KKPA 3OX2A 1L5WA 4MQ6A 5CYFA 4QYSA 1BMTA 2R2AA 4B75A 3QVGA 1G63A 4IWYA 3QPAA 4WN3A 2VF5X 4DKJA 3BBLA 1FU7A 2IYYA 1DOAA 4K88A 2RE8A 2VDNB 4M9XA 1HDZA 1B8OA 1NRIA 3LP5A 3DVAA 4B7CA 4LYJA 4CIVA 2VN8A 2QD2A 2UUAB 4PQFA 3GCDA 3T3IA 4KOAA 1BH2A 3FWYA 2YVLA 3H0KA 2CLDX 1CX9B 3EXFB 3L7JA 4YBRA 3JQFA 1DKNA 3FTQA 4ND2A 1EJ6A 1KTVA 1EE1A 1P80A 2FE1A 1Y4UA 2ZJ4A 3AKCA 1D0SA 4O1HA 3RGWS 1FBTA 3C6BA 2O05A 4P0QB 2YWRA 1SEPA 1C1YA 3OP1A 3IRVA 3P2IA 4J0JA 2WABA 4TV8B 3CRRA 3ORRA 4FXPA 4CLXA 4OI0A 3K09C 3H5OA 4GHWA 4IH9A 3GRAA 5AI5A 1O08A 1W4ZA 1G2PA 3K8QA 2ZRHA 3TJMA 1QVAA 3CZMA 3W8DA 2VJBA 1NL3A 5ERYA 2PWBA 3EF1A 7AT1A 4KI7A 2ZJYA 1PFVA 1SXGA 3AK4A 2V6IA 4ZVMA 3QWAA 1GOTA 3P2YA 2NPFA 1W5SA 5B1IA 2O7SA 1SOVA 3CCCA 1E1DA 2WJIA 3BRQA 1NLMA 1P1RA 3KT8A 3QIAA 4OYRA 2RG1A 5A3VA 4CQLB 4Q4LA 2QA5A 4Z49A 2L19A 1N8NA 1KFJB 3JZFA 4MS3A 1ZO8A 4HCJA 5IARA 4ER5A 2ZBFA 4TM8A 3X1WA 2VF8A 4IAOA 2BTEA 2OCPA 4L22A 3UOAB 1QIJA 2CXPA 4WKCA 1F48A 1IN8A 2YWFA 2ZS8A 3H9EO 4HDAA 3KWLA 3PKZA 5CNKA 5BRJA 2YIVX 1GUBA 1CUHA 1NHGA 2HJSA 1PR5A 3IVXA 2PM8A 4RKRA 3G0OA 4C04A 2PL1A 4YP9A 3TSOA 1RC8A 1QRSA 5JIBA 221PA 2BKAA 1Q0UA 3MLAA 2VPYA 2H9YA 3HCAA 3RRYA 4YMLA 3BTSA 3IMCA 4CMCA 1ZCJA 3NONA 3NAQA 3OP4A 4FS8A 5HMLA 1SH7A 2FR8C 1IQPA 3F2IA 1MAAA 2BUBA 1FX0A 4FGLA 2NUPB 3N2GA 3NT5A 1KO4A 3SEFA 2O2HA 4RZHA 3VISA 4DCMA 1HE1C 2BKEA 4HADA 4KLZA 2Z3VA 3NTRA 1LKZA 1XTQA 4NE2A 3TKLA 4QOIA 1KAMA 1T24A 4ZN6A 1M83A 4I19A 4TKVA 4AN0A 4P82A 3HBJA 4N3NA 5J2UB 3VNRA 3NANA 1F3OA 4NK4A 4P8RA 5HIAA 4U2DA 4B9EA 2SECE 4K9DA 2P9FA 2R7NA 3HYCA 3ZDXB 6GPBA 2VSNA 4LZZA 1GAXA 4AM8A 4ZTZB 2HA2A 1XDSA 3CCBA 4GM4A 4U4AA 1A5AB 3AX6A 4Y2XA 4IOJA 4CKEB 2PUEA 5CA0B 1FX1A 1P18A 3G2NA 4C0KA 3CV3A 4XWAA 1U2QA 3RPEA 3SE0A 1VL8A 2B25A 3CXRA 5KQPA 5EJ2A 3HUUA 4UJ3A 5IJ9A 1UQTA 5J43A 3OZCA 1IWBB 3VOBA 3TW8B 2X19A 4GEKA 4IMJB 2FVXA 2W4IA 3K9QO 3HZZA 5AKXA 1JDBC 5GAJA 4M89A 3ZHVA 4M9QA 2G09A 3CO0S 4QT0A 3LY8A 2B69A 2ZYGA 3KPVA 4M21A 1LPOA 4PFSA 4XRRA 4PBRA 2HB6A 3USES 4JITA 7REQB 4RPGA 1JXAA 3KHTA 4HT3B 3AL3A 2BI4A 3L7IA 4LXXA 4O6VA 5DTMA 4Y9DA 4Q18A 3EMBA 2WWXA 3VYVA 2IS4A 2Q7OE 2Y2UA 4UTOA 4B6OA 2CV0A 4IDCA 4KE9A 2KE5A 2RCYA 4X97A 4DMLA 3U48A 3EY9A 3AY7A 3T0IA 2Z8YM 3PXXA 5JI3E 5IP5A 2NAFA 4NIMA 5ALIA 1EE9A 4OOEA 3K9GA 2QYOA 1VM6A 4OQDA 2NZXA 2O07A 2TYSB 1U5BB 1RRVA 3OHSX 4JX8A 4O08A 1PEAA 2GD0A 2H08A 4NCAA 4GL2A 2GEVA 4EUNA 4KSBA 2Y0EA 4JBIA 3CJRA 4ARBA 3RS3A 1TI7A 1ZI9A 2CT8A 2WDZA 3FJ1A 2EV9A 2XCLA 3I53A 2QXYA 1N25A 2DF8A 4XA8A 1PI3A 1NN0A 4RMGA 2P4QA 3HC7A 4KZPA 4ZZ3A 4YQYA 4MTCA 3FW1A 4TPKA 4EGFA 1IOLA 2EJTA 2I66A 3VNAA 2VPQA 4KIUA 3UH1A 5LMUB 4CTKA 4CM7A 2CYCA 2DPXA 1K08A 4MRVA 3JQ8A 2EJUA 2LWIA 5K6TA 4N18A 1NG1A 4C4PA 2F8MA 1MQ8B 4FYVA 3PUJA 4IDNA 2BEKA 5EKXA 5FB3A 3TVDA 4EKEA 1J8DA 3U17A 1F6WA 4QU9A 1E2MA 1VYTA 5JNTA 3DVSX 3U3ZA 4JQSA 3FYTA 2WJHA 4ZO7A 2RKWA 2JLYA 3G5MA 1M8PA 2JFYA 5DU2A 1O94C 3ND5A 3FAKA 4G1MB 3HV2A 4EY6A 1UOOA 4FBLA 2D06A 4PX9A 2Q3FA 3BIXA 3C5VA 3E8XA 3QKSA 4I9HA 2H4ZA 4MLZA 3DW3X 2HRQA 3QVTA 3GGPA 4RW0A 5BWBA 1VECA 3TNJA 4JLNA 5I7VA 1TUBB 3QBEA 4KODA 1MPTA 3PDHA 5F7JA 2WTBA 1ZK2A 3PFCA 5AW7A 3C3PA 2E4ZA 3LRXA 2JGMA 3KLMX 3LW8A 4R1QA 4WCVA 2CXOA 3REFA 3T1YB 2X6RA 5KDLA 4JJGA 1C7ZA 4EYQA 1WXGA 2YNMD 1T8WA 2JGRA 3AEXA 4Q1FA 1GKIA 5CLIA 3CF0A 2POCA 2VBIA 1M8KA 1OROA 3REQA 2VPXA 3RRFA 5BVGA 3B5IA 4A16A 1VL6A 1CG6A 5CGZA 2CMKA 2H1HA 3FTDA 4DYDA 1DCKA 1SCKA 3HPQA 3R4VA 1N34B 2IU0A 3DR3A 2QTAA 3PDJA 4DA9A 3IT3A 3C85A 3NIWA 3SVTA 1AGXA 1KKLA 2B94A 2Z3WA 3KYCB 4UU0A 4YXWA 3TLEA 4CR6A 4E46A 3K09A 1GGEA 4ISBA 2AFRA 3QJ5A 2HX1A 2M9MA 1ORTA 1X1EA 4U2KA 3V1NA 1U8ZA 5KC9A 1OBCA 4EDFA 3ZDBA 1CFJA 1P2DA 2H0RA 4L4XA 4RX1A 1FDWA 1QOZA 4RQTA 5TDHA 5TPZD 2DUMA 4MHTA 1Q15A 2JCBA 1RYYA 1XPOA 1J90A 2QN1A 1YQXA 1WMSA 4NK5A 1QIHA 2AT1A 1ENPA 2QTCA 1N2IA 1XKLA 3LW7A 5I9IA 1ZN2A 1WP9A 1SVSA 1E2EA 2GO1A 2ZW9A 3H97A 3VRHA 4DDKA 5K51A 1FSPA 2D00A 3O6VA 5ES4B 5BWLA 3JWJA 3AINA 2C4TA 2PMKA 4FYMA 4BYGA 4U5QA 1TVKB 2XD4A 5FNZA 2YC4C 2Q3JA 3CKLA 2Q45A 2O8BB 2B0CA 1WMDA 4B4OA 2J59A 4DSOA 3BXHA 3NT4A 5TQ0B 4FFNA 1MNQA 1JDSA 3KSZO 2VTVA 3GD5A 3QA3E 3OCCA 3VAAA 4PFJA 4Q3EA 4HSGA 1WZ2A 4EGCB 4O02B 4EG1A 1ZH0A 1Z68A 3GLVA 4FCTA 1LPNA 5C18A 1WPXA 4FKZA 1XL0A 1GPJA 2BGLA 2RAPA 1I30A 3FI9A 3HYSA 3QOFA 5IEBA 3WP0A 4DNOA 2HZ7A 2FR8A 2IIPA 1XJWA 1LXCA 2I4IA 1ZH6A 3L01A 4AMVA 3RJ9A 4BP3A 4Y2VA 2ZRBA 1Z5PA 3CH7A 3CEMA 3I64A 1K88A 3I5UA 2XYRA 4J0DA 4U8HA 3OZXA 3GMIA 3MMNA 1Z62A 1BH6A 2BDUA 4TRMA 3R20A 1YA6A 4OHYA 1DEOA 5A04A 2QF7A 2VTEA 1WBBA 4XDHA 1WCIA 4FZ5A 4NBRA 4B5KA 1BS2A 4JJEA 2QRZA 1T9GS 2ECOA 1M6VB 1GUDA 1JZQA 2CHUA 4PRYA 4YACA 3UMGA 4MV6A 2HK7A 4X6YA 5EJFA 2PLRA 1Y42X 5E4TA 4F3TA 1QDUA 5EP4A 1OKKA 3B82A 3RFXA 3UKDA 4HFJA 5IVPA 4RTMA 1NBMA 2E3JA 5AM4A 3EULA 1GG5A 3VO9A 1QIEA 2QUHA 3HMQA 1WETA 3K32A 4KWCA 1YVEI 1SG9A 4P7GA 3NHBA 2GK4A 2AI1A 4IRUB 5ELLA 4R7TA 2MR6A 3D6FA 2AYYA 1SXJA 2FU5C 3FOWA 4ND3A 1OBFO 1OZAA 3RUPA 3S8MA 4BP1A 4EB6B 4TV9B 1K3TA 5KWSA 4UU8A 1E79D 1N33B 4I8DA 4U6NA 3GEDA 4WX2B 4AKTA 3PTZA 2HXYA 4NYIQ 5DK4A 5KVAA 1EJ2A 3CH4B 3H5TA 3P20A 1LPMA 3AZOA 1QZTA 4JWKA 2AUNA 4N6OA 1NMSA 2WHPB 4MIYA 2IYNA 4NYMR 4YK7A 4ZQEA 4ZV7A 5G0TA 4AP6A 1FJ2A 2OFWA 3PFBA 4WLNA 4QC2A 2NUTB 2F1RA 1NKSA 1UDBA 2PNFA 3I39X 1C7JA 5D7NA 3I45A 2Q4TA 4X3OA 2WD7B 4DR5B 2PXHA 4E5YA 3CLUD 2G70A 3SI7A 2FJ0A 3IB6A 1PLJA 5KNCH 4XGQA 1LD3A 5IJAA 3TLCA 2HA5A 2P0YA 4R71A 1LK7A 3QUBA 3C24A 1QHSA 1HT3A 3VPDA 2J8ZA 2FJUA 1DAHA 4KX5A 4CEIB 1X38A 3C7TA 1GCOA 4MQLA 5FOUA 1NT4A 3OJLA 4TROA 3ZU5A 1KMNA 2BJVA 1JSRA 2ACWA 3KG2A 5AQEA 1FW6A 3Q88A 1XDDA 2P9EA 2QJTA 1CQJB 4PO3X 3HR8A 1XFAA 5JCJD 2V58A 1HEYA 4QUBA 3UHJA 1XMOB 1DQNA 3GN1A 4JB3A 4GBED 4D3SA 4ZQCB 2W4MA 1VKJA 4ZYTA 5G40A 5FPTA 2HCJB 5IMSA 4WXMA 1L7BA 4K3UA 4RZXA 4ZHSA 1EGMB 2IHVA 2N75A 3VR0A 5CFQA 3T3OA 4PYQA 1G9XA 3OJEA 4PGFA 1WCXA 2Z6UA 1SUIA 4TOIA 3LFHA 4TYPA 3QWHA 1RIIA 5B4UA 2OVBA 4QXQA 1YBMA 3IUSA 2E85A 2JD2A 1P7YA 2OV8A 2W2MA 5IKMA 5J5AA 4MPJA 3TPCA 1O94A 4AJJA 4F0JA 1V3UA 1FA9A 2O8EA 2AC4A 2G04A 3EMVA 1EIZA 4ZV9A 1QGDA 1T4MA 3BH6A 5DM1A 5ALMA 1XPUA 1ICIA 2H2FA 4F9GA 3K70B 2DT8A 5CFMA 5D00A 3R6LA 1PFKA 1ZUWA 4TKUB 3V1YA 4ZOAA 2YC2C 2ZLBA 3DDZX 2Z56A 1BHSA 4OUDB 1VSTA 2HJHA 3E15A 5F2EA 3UGKA 5HQ3B 4FR5A 5DXAA 1XQVA 4P54A 5T57A 5JYEA 4ZMBA 3SNHA 5BRNA 5FWYA 3DTYA 1TYAE 4ENVA 5K7SA 3KB1A 3W8NA 1VZ3A 2J3KA 3C3YA 3LXMA 1E2HA 1MABB 2YS6A 5BQ3A 4XKJA 1J8VA 1S2IA 4GSKA 3GGSA 3SDZA 1KDPA 3L0DA 1YFJA 4D4MA 1QG4A 4F60A 3AC0A 3DGEC 5KYUB 5AKEA 1YE3A 3I0MA 2J9XB 3MWGA 4RE5A 2ZRAA 2B8EA 3P4UA 1AUVA 3AEKB 1FYFA 3KOWA 3VPGA 1W7AA 3P0EA 2YV3A 1UKEA 4DOMA 3WSTA 1IQUA 4HLNA 3VPCA 3M1IA 1J2RA 1CJSA 1H23A 2AKAB 3H8SA 1FP6A 2VWHA 2QPAA 1OBHA 1ZI8A 4KFTA 1DBWA 3LX6A 4K0RA 3QY0A 1ZN9A 2BFFB 2O0KA 3BMOA 2VHTA 5WRFA 4B3HA 1OJLA 3AJ9A 3T5PA 1TIKA 1YS1X 3QKIA 4Q21A 1RAFA 1W5AA 1TVCA 1L7DA 2C97A 1KK1A 3QEJA 4REOA 4K9LA 4I5GA 3WKBA 1DEXA 3EVZA 3VUEA 1ZJJA 1ZAKA 3W2IA 3V7UA 3FCOA 2I3GA 2JKVA 3FOCA 3H9QA 1YHZA 4DXDA 1DG9A 2F43A 4PO1A 3ESXA 3L5OA 3BWEA 3HJRA 1JLLA 1R0KA 1UMDA 3HI6A 4HPJB 1UZLA 3VNVA 4MX8A 4XQ9A 2PSEA 5KTYA 1GZHB 1NZDA 1C3LA 4RCVA 2QWXA 2VP5A 3JQCA 1LDYA 2ZR0A 1L1EA 3NDIA 1JTEA 4RF3A 5TJ9A 2YN0A 2L0XA 1UBRS 1P5ZB 2XXBA 2X5KO 4YP0A 4B3TB 1VE7A 5DI3A 1IWOA 2PS0A 1NVXQ 3C48A 2WAAA 1TLTA 5EXDA 4DG8A 1OH7A 4Q0MA 2X22A 4AT1A 3GLIA 1P4JA 4W7HA 2EBHX 1JHRA 1J8YF 1YRHA 2NACA 3HP1A 1ORHA 2VHYA 2RJOA 2ZSAA 4I1OA 2C5AA 5JSYA 1K3FA 3BHIA 5THXA 1W88A 3NV7A 4FBGA 5KU7A 3ITKA 4QGAA 4RENA 1NMXA 3Q3IA 3P2KA 3BDVA 1M2NA 4TVBA 4KLAA 2YCLA 3IP8A 2WJYA 2HSDA 1UF9A 2M1ZA 1Z16A 2AG1A 4FYKA 3U3KA 3W0LB 4PRZA 2O2SA 4TLLB 4FT4A 3GB9A 3ZWWA 3TR5A 4J16A 3P0RA 3SMQA 4WLUA 4NDZA 1XTJA 3OUZA 1PUJA 2OXCA 3AWDA 3F4LA 4E03A 1FYWA 1WXDA 4JV5B 4JYAB 3CQ9A 1TYEB 5T5QA 2Q9BA 5JTUA 4XSVA 4MR9A 1ZBDA 3DPIA 3VC1A 3BJRA 4IJQA 4C9BA 4CMEA 5I48A 1JDZA 5EIAA 2Z5GA 3HA3A 1PS8A 1TVMA 1YI1A 4HUTA 4X90A 5IWCA 1U0GA 3MJFA 2XB6A 2ZJOA 2Q5LA 4LJ9A 2C8JA 1Q1GA 6CHYA 1GQQA 5GTDA 4GPZA 3EG9B 3IE1A 1NF3A 3BWDD 1SCAA 4CKBA 1S2NA 4PN7A 1ORVA 1JQLB 1GZSA 1LJLA 2G77B 1JECA 1POWA 2NW6A 3VZDA 2GF0A 1E9BA 3RNLA 3WTCA 3V8EA 4QOEA 3JPYA 1E8NA 3COYA 5B1EA 4IFTA 4FHDA 3A7DA 5L3VA 3O1HB 3ISTA 2OFOA 3EEIA 5IVDA 1I4DD 5GINE 1IVYA 1L5NA 3H1FA 3V2IA 4WPGA 1XEXA 2ORIA 3F4KA 2IF2A 3A4TA 4DV4B 1SVOA 3LXXA 4JVOA 3EWIA 4XB1A 4YYZA 5L95A 2CLEB 2AWOA 3DJYA 4G8JA 3SXJA 1OFTA 2C1XA 1O96A 3KZMA 3KR9A 3C8MA 1U3UA 3R8CA 1KWKA 4HLQB 1B0AA 1N2ZA 2DQYA 3ZDEA 4E15A 5AW3A 3L8CA 3UJBA 2G0TA 1S1CA 4LJAA 2B20A 4FDMA 4CT0A 2YWEA 1ISJA 1QNLA 2R1UA 4UHCA 5T3YA 4EENA 3O4VA 2VQDA 6AT1A 3HSKA 3HBNA 1E4EA 1A71A 1KAGA 2QKYA 3SXUA 4Q34A 5I47A 4RPLA 4G1VA 3JZDA 1U8TA 2A0YA 4OATA 4E21A 4YMGA 1JYSA 2HU8A 2VCEA 2VHXA 2ZWMA 5U4QA 2PZ8A 3QEOA 4DBVO 3WGTA 3AR6A 1D07A 4IOKA 2RBGA 5IC6A 1RBQA 4KYTA 1TT5B 3OOYA 5CITA 4MCIA 5EUCA 1YIDA 1U0LA 3DEFA 4ESEA 5B6PA 1IBMB 1VCHA 2HU5A 3TE6A 1NASA 3OTGA 3WK9A 4C3OB 5BSGA 2ZRIA 2H2WA 5LDHA 3E4DA 4DJ5X 1NONA 4EF5A 1KU0A 1GRRA 5BV2P 2I99A 2BDTA 5TIIA 4DF3A 1X7YA 2JASA 3C5WP 1K7XB 4ZT4A 4YXWD 2RGUA 5L3SA 1B3RA 4P35A 4IIYA 5CGQB 4YWHA 2CFIA 5IVIA 3I9KA 3G0HA 2P8JA 3LUGA 3TIIA 3DO6A 1XNHA 4C7MA 1NURA 5GGYA 3OKAA 2NXEA 3SM9A 1L3BA 4JL5A 3DBHB 4K6KA 1YAJA 1YU6A 3JR3A 4RFVA 1RRMA 3FMFA 4CIDA 3GJSA 2BMVA 3C8DA 1X2BA 2V7VA 4EYKA 1OT5A 1RWOA 3C1UA 4POOA 1WAMA 4D5GA 1D4AA 1ZRMA 1JJFA 4YIKA 3HJFA 1TCUA 2QR5A 5FT9A 3W3ZB 1L4HA 1NF8A 2XB9A 4E31A 3USZA 1G20E 1Y6ZA 2GSWA 3DLTA 5BP7A 4JYBA 4LXUA 2MJLA 4P9NA 4TL7A 5HCNA 3SIWA 2BSAA 2ONCA 2PZKA 3MJVA 1OX6A 2H51A 3TH5A 4B7ZA 4D97A 4QVIA 4R54A 3STTA 1G4UR 1UM9B 2I7CA 2W4QA 3DP7A 2CHGA 4L0CA 4YRTA 5E6RB 5FNVF 1PVDA 3VV3A 2CLOB 3AMVA 2PSSA 3TEFA 4B8WA 1O95C 5AKLA 4YALA 4NVRA 4RFSA 3FUUA 3MLBA 5FBRB 2B82A 4GMHA 1UT8A 2RJNA 3UK7A 4F96A 5BT8A 2F9MA 2WJVA 1NV9A 4WZAE 1J9ZA 5BO5A 3T52A 4BLPA 1UJ2A 3S1AA 2ZE5A 2GPYA 3G85A 3ANYB 2JRCA 1Z6AA 3FNIA 5JVDA 4HAIA 1CF4A 2O3RA 2IEIA 1V47A 2IF0A 3AEUA 1LLDA 1Z4NA 2O57A 4JKYA 1EGQA 1QNFA 4JJAA 3CW9A 1OKKD 1A8PA 4J07A 4RV5A 5EHIA 3ZZ0A 4KYIB 1NBMD 2H17A 3CNOA 3TNYA 3A3NA 2AN5A 5AW4A 2JI7A 2YJNA 2M6SA 4YJDA 2LIVA 1ILEA 4AMBA 2ZWOA 2VEOA 3GQVA 4L9AA 3OCXA 1P3DA 3IQIX 1SBZA 2GCGA 2GN0A 1SXJD 3ETHA 3GROA 5A2QA 4L9WA 4WIAA 2WOOA 3ZDZB 2Z4TA 4C06A 5K6RA 4MYDA 2NNLD 2RKOA 2FXIA 1H66A 2JC3A 1ZC4A 1H2YA 3OPVA 3TSYA 2EW2A 4B6QA 2IGTA 2NLOA 2V5AA 2NTEA 1E63A 2GJSA 1T2VA 3LDHA 3MCUA 5YASA 4DGQA 3PIIA 1JFFB 3I28A 4LYAA 3DV0B 4H6WA 5BN5A 1X7WA 2WAOA 2R1TA 4RVDA 4WTOA 3P0IA 3T4XA 2GJ9A 4FOPA 3UGQA 2XWPA 3A3YA 3GDGA 5ESDA 4BMYA 3B70A 1UBGA 4M7OA 4PGMA 2RCNA 3I05A 3FVWA 3IS3A 4MI1A 5C46F 2PV7A 5FBQB 4B3CA 4CQMA 5CNJA 2IOQA 3FDIA 3ZQKA 1NVFA 5K0LA 3LDAA 3F3MA 1JLSA 3KAJA 1RQXA 2HYDA 2NVBA 3E5RA 4PLCA 1AHPA 1LTHR 2XV1A 2YWCA 1VA5A 5JROA 2HHHB 3QBDA 4KDFA 1E8MA 5KUTA 4H59A 4I50B 2I8LA 1ISSA 4KPFC 3O2JA 2EKZA 1E3WA 5HRAA 1CC1S 2JLXA 4NF2A 5EE1A 4M0MA 4LE1A 4JUDX 1PJ4A 1DADA 3EQ2A 1TAUA 4JEMA 1EUCA 4KWEA 1LLCA 1N57A 1CJUC 4K81B 4YP1A 1I0LA 2B21A 2C1ZA 4LRXA 4EWLA 4QFDA 4G9BA 2A6PA 3EXIA 1R15A 2Z3ZA 2HJGA 1CF2O 3GLKA 2R4UA 4PZUA 4D3FA 4I9GA 4DIFA 5KQLA 1DDGA 2NZ8A 1E5TA 2QSZA 3EMKA 3NBFA 1TJPB 2RGNC 4H1VA 5D01A 2I7XA 4MRNA 3X44A 1JQAA 5BSFA 3WYNA 2FP4A 4JEIA 4NHEA 3TIVA 4DABA 1CHDA 1R6DA 1O94D 3MINA 1G5FA 4IDFA 4UAJA 3PGXA 5EIWA 3I9FA 3UK2A 5L4LA 4CEJB 4O4LA 2YWHA 5HZMA 1HY3A 1ZOOA 4XR9A 1IUOA 2ZI6A 4FWIB 5BMOA 2C9DA 2PUGA 1GYRA 2Z8ZA 3BB3A 1KS9A 4I2NA 3PI6A 1Y3DE 5DI9A 1ZNQO 2WLTA 5LQSA 4MQ4A 4YAJA 1UPCA 1Y1RA 2D2XA 5DCUA 3ANTA 4Q05A 4BGUA 1CD5A 2H4HA 2JLAA 4ZAXA 1XN4A 3ETDA 1JFTA 4JI8B 4S1NA 4LBWA 4ZJZA 2I5PO 4K26A 4MV9A 3RODA 4BN0A 4BX9A 3U44B 1ZKMA 1UC9A 2IYOA 5JXGA 4IMPA 1EEXB 1NX9A 1TM3E 2XZPA 4R1OA 2BCJQ 1OYWA 1V71A 1VKRA 3B6IA 4M0KA 2QAIA 3LQRA 5H5JA 3TLJA 1ZUNA 1DBSA 3PP8A 3ZLTA 4U7DA 2AJDA 5HUJA 2V74B 3AR8A 3CF4A 2BGWA 3GJTA 3MD0A 4JZKA 4QEKA 2VJKA 3T61A 5CTAA 5KAMA 2DPYA 4WHMA 4UOZA 1HE8B 4YX9A 5ADHA 1E2PA 1HFJA 5DEIA 4OFBA 4EGJA 1PX0A 4AJEA 2BZSA 4TVOA 5DSTA 3HXQA 1EFRA 2H63A 4KQCA 5LP1A 2SKCA 3H7AA 3LQ1A 1RZRA 4LV5B 3TD9A 5KOYA 2KWIA 2QAGC 4X24A 1M2KA 5AIAA 3RVLA 5TJHA 2QU7A 2DBQA 4JUFA 4DARA 5AM3A 3QX8A 2WWHA 4UM9B 2XDQB 4Q3DA 3FFWA 4R2WA 1JAHA 4K8OA 3C8UA 1ABBA 1JLRA 1DFGA 3W2FA 2BZ0A 3OQBA 1JVNA 4GX1A 5T6MA 1F9AA 4CL8A 2A92A 4BB9A 2QQEA 4DJEC 2VA9A 3SS7X 2HK6A 3BERA 3WMGA 1F3LA 4RTKA 2YY5A 5K05A 1ETHA 3H9JA 1T8RA 5JG7A 1EESA 4MI6A 4JASB 1ZYUA 1NUUA 2YYZA 4NJEA 4HZGA 4K9NA 1IWPB 2I0FA 4K9SA 1WNTA 3L0ZA 2A4KA 2AX3A 3BQNB 3KEMA 3K30A 3L82B 1JIUA 1XF1A 3JAWA 5HIIA 5KYKA 1I7DA 2ST1A 2BMDA 4FSXA 1JR2A 1LWNA 4JA0A 1P75A 1Z25A 4LYHA 4M3NA 2F59A 4FK8A 2ZQ5A 2SKEA 3NDJA 1KEEB 4AMUA 3HGTA 2DCUA 4PIPA 4E11A 1G6OA 1O95A 3CNLA 4DV2B 2IX9A 4OYHA 1GUFA 4I99A 3COWA 5AJUA 3G17A 3QY9A 3EW9A 4DPMA 2QTHA 3NJ4A 2OC4A 4LYGA 2PYDA 2XTAA 3CF2A 1MO4A 2Q1SA 3D0KA 4P84A 4S24A 4DSZA 4FZ3A 4AB1A 3FHLA 4G1FA 2GPSA 3PPIA 1BCRA 3K1YA 5FUBA 4CLRA 2DWOA 4PRLA 1E20A 3T7EA 3CF6R 4D4IA 4HDCA 3DS8A 3A6ZA 2IZZA 3UJAA 4BMVA 1ZRHA 1RAHA 1V5WA 1NP7A 5AT1A 3JV7A 4RK5A 1JQDA 3L7OA 1SBYA 4QPNA 3GAMA 2HHCA 2CDBA 3IDOA 5CIWA 3OCJA 2ZYRA 1P0MA 3GG2A 3EFHA 5I9SA 3ZHXA 4BFTA 3AW8A 1Y9AA 1Z38A 1JR6A 1FVXA 4FQ7A 1V5IA 1STOA 4HWTA 2W7TA 1CT9A 5DHQA 3RRBA 3VU9B 3TECE 4GL4A 3HSYA 5EERA 2H29A 4W82A 3CM0A 1CR4A 1S2DA 1ST3A 1WY7A 4FU0A 3B1YA 1QAMA 4IQ8A 4O33A 1PAUA 3H4MA 1DPGA 1KJNA 4ANFA 5AD1A 1SCDA 4D3YA 2UZIR 3LFUA 1J2EA 1XZLA 1KEVA 5E3HA 1C1XA 1JHPA 5LC1A 4XLLA 4P4LA 2OD9A 3WLIA 1TCAA 1ZCFA 3OUTA 1NY6A 4ICIA 5GVSA 4JUAA 5JQWA 3TNLA 2O3TA 1I4WA 4IIVA 4XYGA 3BGWA 4BLQA 3OOEA 3UJDA 1V1RA 5CXXA 3X2FA 2WUEA 4RIGA 1XMIA 4UMDA 4WFIA 1PE0A 3KWFA 5IANA 5ILOA 2CVHA 1PWZA 1FMTA 1L5VA 1XZFA 4C4TA 4KQMA 3OCYA 1UAYA 1VL2A 3UJNA 3A9WA 1RCUA 3MWYW 2DHCA 4DMCA 1EFVB 1RS0A 4L85A 5DTIA 5SICE 4LSGA 1UOQA 1L5LA 1HSOA 2FZ5A 3NBYC 5SY6A 3EXEB 5AW8A 1GA4A 1YC5A 4D8TA 2Q5IA 5JPCA 5F51A 3E3OA 3GFTA 2O5CA 1YTUA 1K5GA 2VEDA 1MVNA 1OY1A 1OGIA 2J5XA 2QPLA 2OLKA 2PO7A 3L8FA 3ZOKA 2PT5A 2VUHB 4ER7A 3LY7A 4KCGA 1Y5MA 2P9ZA 1VSQA 1A8UA 1MP0A 2GLUA 2ZJ0A 3L1KA 3LG2A 4S3MA 3LX4A 4R3UC 1TLLA 5DOZA 5JJCA 4B0PA 3SGLA 1W4RA 4BU1A 4C43A 3N53A 1QM5A 2II6A 1KQOA 4NS1A 3CA8A 4NBLA 2NYRA 5PGMA 3ZGYA 4BJ5A 4NCJA 1FZTA 2PJDA 3FVRA 1VL5A 2KHZA 2WSBA 3EEQA 2VAWA 3T38A 4EBBA 2YVAA 4QUDA 4RHTA 1QHFA 1Y7TA 3DFFA 2WT8A 3K0FB 3UMRA 3L8HA 1ZW1A 2VTDA 2XZTA 1RCTE 2HBQA 4ZQBA 1WO8A 2ZI4A 4HF7A 3RVQA 4Y9TA 1FYVA 3TTYA 1FRZA 3AVOA 4CQNA 4EJ6A 2V3VA 1X7HA 2A9QA 4RGYA 1S2OA 3H0EA 3FLMA 5CH8A 1T3TA 2HM7A 3SPXA 2EFHB 4S1PA 1D8AA 2Q2WA 3A0UA 4P34A 1A50B 1B6RA 2AVDA 2PX8A 3C70A 4KACA 2NQ2C 3HUEA 4ND1A 4MR8A 1DCFA 1MJNA 1A2QA 3ZHOA 3A26A 5CP8A 2VDOB 3ZG6A 2Q6IA 1U99A 2VCYA 3B3QA 1UJ5A 4D8WA 3Q6NA 3JQ6A 4PPNA 1N1EA 2BMJA 2VL7A 4P7BA 3TRFA 1U3FA 3ER9A 4KR7A 1YDGA 3HH8A 4JUBA 2AXQA 3A7EA 3OH8A 2AMYA 4BY9E 4PONA 2X9QA 3MJRA 5DYWA 5KYXA 4HRAA 1IVSA 1DAIA 2QAGA 3N76A 4IQ0A 1I2CA 1Y7HA 4K7JA 4C2BA 1SIWA 1U7PA 2IPLA 3AERA 2JFGA 2NO4A 3T7AA 2CDRA 1RYBA 2C5EA 4OXNA 2C03A 1JAIA 2IE0A 4N49A 3S4YA 1GKLA 2YW2A 1X87A 1ZMRA 3GT4A 1QCCA 3KR2A 5TMBA 2IP1A 2ZKLA 3ESZA 4XTRA 4I3HA 3QU4A 1T5LA 1YVPA 4G56A 2VDQB 1HEUA 2VP9A 4CLEA 3UBMA 2J3QA 4CW7A 3F9CA 3HA2A 2AQ8A 4MP8A 3SFVA 4QGGA 4LOLA 3R7LA 3B7GA 5JMWA 2FFQA 2IS6A 3T95A 4A8HA 2QX6A 4ITRC 1US8A 4KUHA 5JS1A 5JQGB 3LI2A 3K16A 4Q1CA 1EP2B 1I13A 2ROQA 4XM1A 4B48A 4EEKA 2R60A 1PJQA 2FPRA 4QPDA 5DTEA 5JCOC 2YKGA 2LBPA 1DUSA 1UFQA 1VJTA 4R8KA 2I4OA 3E2IA 3LGXA 5JISA 4WXPA 3LT1A 2AN4A 4P3NA 3SIRA 1PV1A 2E49A 3O91A 2NV2B 3V42A 1IU9A 2AN1A 3H6GA 4TTIA 4Y2QA 1VMDA 4BO0A 4RAOA 4A8PA 4C6SA 2V6JA 1Q12A 2DWCA 2R65A 7REQA 2Y1EA 3L40A 4M86A 1MU0A 3CN7A 3E7PA 3O2QB 4KE6A 3JYHA 2QUAA 1YQGA 2M2IA 1GPAA 3JWGA 4IH4A 4II3A 4MVWA 4HXYA 3ZN2A 1BSVA 6REQA 5K4AA 3N9IA 1G2QA 1XK6A 3EUAA 4L5YA 4QUHA 5BNTA 2RB4A 5FWXB 3RD5A 3NIBA 1M34E 3IULA 1P7ZA 4L0MA 2WLSA 3SJAA 1OLOA 2J3MA 1GSIA 2FRDC 1QB8A 4DV6B 1IDOA 2D2FA 1Z6ZA 2A1IA 3I3SR 3L49A 2Y3IA 5IKEA 1SA0A 4LF7B 4I4TA 2W0MA 1FRQA 1YVUA 1W581 1QQ5A 1LRJA 1MG5A 2AF3C 2YZ2A 1U9CA 3KWJA 3EIFA 2DU8A 3K8OE 3IVRA 4NCHA 1KK3A 2Y4OA 4YCBA 3UJHA 2XKAA 5AVVA 2GXQA 2JFUA 1YR9A 2AOTB 4H77A 5CW1A 5C8DA 4CQMD 1SPBS 4URYR 3THRA 5I9LA 3E9RA 3Q87B 3NB0A 1XNRB 1X86B 4FDAA 5EWMB 3GI1A 2ZETA 1IN4A 3IQDB 4C7VA 3PFNA 4FN4A 2CNKA 3EGCA 3PZBA 1QH8A 1ZONA 2R6R1 2QHXA 1XDBA 3ROTA 3WL4A 4PSKA 2GEUA 4ZYVA 1XJCA 1K63A 1P5RA 5KVQA 8OHMA 1JHVA 3L0OA 3U3OA 5JYBA 1XVUA 2EX1A 2HADA 5TE9A 3NHWA 2O1EA 3FPGA 3HZRA 1U0JA 1X94A 4GU5A 1KTIA 1BQ4A 1W93A 1OWOA 3VI3B 1W44A 2A58A 3WIEA 1KJ8A 1XYGA 4Y2JA 1X1TA 1FE8A 1O5TA 4E33A 3TM4A 3IALA 3FPFA 5ALOA 3LCUA 4QTTB 1XCJA 3V2HA 1MTOA 2V1XA 1T9GR 2YIJA 5HOQA 4J7CA 2O23A 5E9JA 4KR6A 3D7NA 2C3UA 2W2NA 3GVXA 5JVDF 1RXEA 4RVSA 2M6KA 2IUEA 3Q7QA 4O4JF 1C50A 5LZ4A 4EBFA 1XEAA 4OHUA 4Q02A 2NXNA 3ZQJA 2Q62A 2V9PA 1AURA 1AQYA 3I32A 3BD6A 3H17A 1Q19A 1WHSB 4WESA 4NU6A 5K45A 1OWNA 1WSAA 3IUBA 1Z36A 2CXNA 5HEKA 5IN4A 2ZIUB 4X1KB 1DI0A 1EBBA 2C4MA 2GN6A 4GMXA 4Z0NA 4ZDWA 3WHKA 2PUTA 2QT0A 2LDXA 3NHMA 2B5VA 3UXMA 3UWPA 1C0PA 2ID9A 2OV2A 2R8OA 2O6LA 2WYIA 5D1HA 1XLWA 1RVV1 5KQSA 3EVEA 3RCBA 2FN9A 5CU7A 2HWYA 3R7DA 2FETA 4LA4A 4E2ZA 5B3AA 3RKSA 2JIRA 1MC4A 4ON9A 3W04A 1JPNA 1P31A 5C5IA 4CM5A 3PEEA 5C52B 4DJDC 3S6JA 5G0SA 1SGWA 5ITZA 1YO6A 4L2IB 1AB6A 1M5UA 1YJXA 3E48A 1FW8A 1JQKA 4XIIA 4AW9A 4BX3A 3VKHA 5H3HA 1EFRD 4TMTA 3U3RA 1LCIA 2A84A 4BS9A 1RZRD 2DE0X 1OXTA 4ZFNA 2COUA 4PZZA 4MQEB 1MKYA 2EFEB 1UADA 3HCWA 1V7QA 5FWDA 5KJ6A 3JX9A 1BCSA 1VI6A 4QAQA 3DEIA 3FLEA 3GJ0A 2B9VA 4TT3A 2DVMA 3KEGA 4HLDA 3OLVA 1HDCA 4G41A 4DG9A 3W06A 4B87A 3WI7A 1KYYA 2Q49A 3CRW1 1PW5A 2OKCA 2C5HA 2HA7A 3F6EX 1B41A 3GRPA 3KXIA 4V0QA 5CCBA 4R2HA 2ZUDA 1CDEA 3U39A 3M7IA 1ZWKA 2B3DA 1CUCA 1NVVQ 2GN2A 3KJNA 3L02A 1CUXA 1KO8A 1J0XO 1RLOA 2IP2A 2Q3EA 4MWDA 1C9KA 4K9KA 3UA4A 3BSYA 1B6TA 4Z4QA 3DHYA 2QMYA 1H9AA 1NWCA 1XDZA 1Y4SA 2B98A 2HXGA 4GOKA 1NVTA 1ODTC 3BSSA 4RS3A 4ND4A 5HJ2A 4BQFA 4DLZA 1VPLA 4IIFA 3CWZA 1R0LA 3HXLA 4C6TB 4ZJUA 3ST7A 4DWJA 1E7RA 4XFDA 5LZ2A 3S1SA 5TVKA 1O95D 1Z9BA 4O2LA 4KVGA 4I6JA 1IZ0A 4Z4IA 3HN2A 2H2IA 2SNIE 3AHGA 4L51A 4MUNA 1NW8A 4NAHA 2GD1O 1L4YA 4KU4A 2L17A 4O4LF 4A2PA 1I14A 4BEJA 4ZZIA 1WHTA 4B8YA 1PVVA 4D9GA 4DEVA 4OLBA 4RIEA 1WLYA 2BAGA 1ENYA 1DHTA 3ILYA 1N6KA 3QG5A 4JWTA 4MI3A 2PZBA 2QRGA 3IOCA 2NU7B 5KQRA 2ATXA 5KTPA 1A1VA 4RKYA 4KWIA 3INRA 4PWZA 2DPMA 4R4JA 3LOQA 4BB5A 1O6ZA 3MCTA 3S28A 1FDSA 4CQJA 3BIJA 1PJTA 1Z18A 1G5IA 2P91A 4G2TA 5FCDA 3H19A 4ZHQF 3R2JA 4ATNA 3FOFC 1L9XA 5KYTA 2FWIA 4DCVA 4OXQA 5CLQA 1H22A 1AHNA 1NFRA 1KY3A 1GZ7A 3EXG2 3GYGA 4S05A 3B8HA 4I9FA 4TS9A 3TZLA 1FOEB 1R8SA 3N07A 1XCMA 4LTMA 1D2MA 5F5XA 1XMJA 3A2KA 3IOYA 3VBEA 2ZU0C 3ER6A 3LHIA 3R6WA 4LF5B 3GPLA 2QGFA 3H84A 2ET6A 3A8TA 2HU2A 5CJ2A 5ULLA 4C0AC 4V1CB 1T4BA 1QHHA 1F7VA 1DBPA 1KZGB 4GZ6A 1NUTA 3BUSA 2YZKA 4CWAA 1DWQA 2BMAA 3A9VA 1N5RA 3RSQA 5DGDA 4KE8A 3OVMA 2V7BA 4ZO9A 1R8QA 2FRDA 1QP8A 2G0AA 3IDAA 4PQRA 3RM3A 4D8YA 2WYWA 3NQ41 3VZCA 2XKBA 2GBIA 1ZIOA 2GYWA 1G0OA 2ZREA 3ASUA 4M1KA 4TTSA 2NUAA 4E2FA 4V0MA 1KE1A 1HTBA 1QIDA 1THZA 2BEWB 2J46A 3V3KA 1Q7EA 5J40A 4YRQA 1M1NB 4Y30A 3R9WA 1CQJA 4MWGA 2CHFA 4YRKA 4WFQA 4OP1A 1GL9B 3ZXYA 3ND9A 4FEYA 4M87A 4P3OA 4ZANA 4UD6A 3WNQA 1OXXK 4KPEC 4AUNA 1VG9B 2PL3A 5KSZA 3WYGA 1ODCA 3QI7A 1R74A 2EU8A 1LF0A 2CE2X 3OFJA 4ILEA 1ORWA 3RFCA 1AGNA 1QKJA 3MUNA 4MDHA 4A8JC 1L5RA 1KEZA 1TU4A 3DMNA 1SUFA 3PQ8A 1WD7A 3D8BA 4G1EB 4LWPA 4NZNA 1Z0UA 4L3WA 4OP2A 2QGZA 1GPKA 4FYIA 3W3AH 1KYTA 1NVAA 1CJVC 1ZJYA 3AV0B 3JZAA 1JFVA 3OIWA 4Z3KA 5CVDA 3ZVLA 2J9FA 4AY5A 3SC3A 4RU1A 3VMFA 5ES3A 1F6BA 1GDDA 3M6MD 3RYHA 4CODB 5BR8B 2JJQA 3TOVA 1Z6XA 5FBZA 3WXBA 1AMOA 1XD8A 4KXXA 4TKUA 3MJDA 4OQNA 2FYTA 2UZ1A 5H7XA 4G5FA 2EW1A 4F9FA 3RAPR 3M6IA 3KJFA 3IA2A 4YHBA 2CHVA 1ZAYA 3WLQA 3IR7A 1T9HA 2NSDA 1AKMA 3SF0A 2OPHA 2KW5A 8ATCA 1KFEB 5DX0A 1A72A 1BMQA 2PMFA 2WIGA 4U63A 3TSAA 1GLVA 1PNTA 1E7SA 3LYLA 3CVVA 3E22A 2ZT8A 2RDMA 3IERA 3WGJA 1BFKA 2XWJI 4K0KB 1ZCBA 5DLYA 3V7NA 1G20B 3KLBA 2OM6A 2V4MA 4P08A 3IUQA 3ROXA 3INYA 4C1BA 2AG8A 4K1XA 2YXBA 2VHVA 2WE8A 4YLEA 1VFPA 3N8KA 5DSXA 1R37A 1ZW6A 1JKFA 5ALDA 3X2SA 4D0NA 2P6NA 4MUGA 2PSDA 3NOVA 4RNDB 5AVTA 1I24A 1TCBA 2N46A 3AEKA 3EZXA 3JQRA 4MIOA 1G0NA 4FCCA 3V9AA 2QZJA 3VZSA 2BFDB 3VTFA 3DMYA 1RE1A 4B34A 1S2MA 4HRVA 3EZ7A 3AKZA 4NQZA 4EUEA 3CX8A 4LVOA 3PD1A 3ZKWB 1VIVA 1GGHA 5G41A 3RKUA 5E4FA 1OXBB 5DLDA 1HDGO 4AJKA 4CTOA 4D26A 2W6JA 2HNAA 3AJAA 4FKMA 2WMNB 2RHLA 1RI5A 1EEHA 2OBNA 3UT6A 1PGQA 2BFFA 4UPDA 1I2BA 4OFWA 5H70A 1XP8A 4WZAB 1QAQA 4XPIB 4C01A 1VKNA 3RBXA 3T8YA 2GBLC 3HTXA 1S3FA 3PF8A 5HKBA 1IM2A 1TDJA 1GAWA 4LCJA 3LBAA 4WK0B 3MGKA 5AHRA 4E12A 1AMNA 3KR1A 4FMCF 4L7QA 1TJ3A 2R6DA 4BIMA 1L7RA 1CJTC 2ZJBA 1HM5A 5DBHX 2I80A 2C0PA 3D2AA 3E5MA 2VJDA 5ARBA 3FRJA 3LM8A 3CYFA 1DT5A 2IGBA 4E4YA 2PL5A 1GYPA 1XZJA 2PX3A 3EVBA 4NTZA 4R31A 2LP4Y 3ML1A 4WEQA 2Z6QA 3S2FA 4INPA 1L1RA 1SCQA 3PHLA 1ZZEA 4AULA 3LUKA 4HAZA 3V4FA 3P96A 2ZIXA 4RZUA 1MJ5A 4DSNA 2ZSJA 3GXOA 1JV2B 1P4GA 4OMFG 5IF3A 3S40A 4KRGA 3NATA 5KVVA 2EDAA 3PVZA 2PX6A 2FZEA 4FB5A 3CNNA 1E0KA 4RSMA 4DY4A 2OQVA 4QVGA 2JH3A 4F5EA 3AU9A 4GOXA 3WL3A 3RREA 5BYAA 2MSWA 4B8ZA 2C7QA 1M72A 1JEEA 1X6VA 4FD3A 3RIGA 2ZB3A 1L5ZA 1RZ3A 3E7WA 1EGAA 4YMVA 1YH3A 3UG7A 2AUTA 3CEAA 3ESYA 3IKTA 4C4ZA 1RJ9B 3CR8A 2FQWA 3LQ2A 3QPWA 4JBWA 1W5EA 4NJMB 5E9WA 4D7AA 1W36C 1QTQA 4RVNA 4FEEA 4O8CA 5LBIA 1W4BA 3R24A 3JQDA 4TUYB 1EGHA 4MOWA 1G9TA 4QUAA 3DGFC 4LX0A 4UAVA 2J45A 2MU1A 3KVVA 3S81A 3LQQA 1YJCA 1Y1TA 1ZK4A 4YREA 3RK4A 3RYFA 4C7XA 5BV7A 4US0R 5FQNA 5AESA 2O1WA 4INZA 1XXLA 1UMCB 1HORA 3NFYA 2WOJA 4LDJA 2Q29A 2PZMA 4D8XA 2R87A 3KUXA 4Q6BA 2TSYB 1LDEA 4F2PA 3EG9A 2ZR8A 1U90A 2GPNA 3ILXA 2VUUA 3W5HA 3UPUA 2AG6A 3GOHA 4QDKA 3TAXA 1GV0A 3TQQA 1GGVA 2HAEA 2FHPA 2FXVA 1BD3A 1UJMA 2CUTA 4PSCA 3ZU6A 5BY2A 3CRQA 2WJWA 4Z4FA 5FHRA 1ZH2A 3B3JA 3CE9A 2O50A 1KBQA 4EX7A 2G06A 4D0LB 2QMQA 1UBJS 4DL9A 3VZPA 3WLMA 1JSXA 1KMCA 1OH8A 3WR5A 2OWDA 3BTVA 5DW0A 5TV2A 1VBFA 4KYVA 1W2GA 1MXHA 2X7HA 1R8YA 3BIFA 3HCPA 1W75A 3NTUA 1KYVA 2BEVA 4L5CA 4WUTA 1AUXA 2RKBA 1WZIA 2B9EA 5KAPA 2K4MA 1DRVA 4DLYA 4E2WA 1E6UA 5HK9A 4FMPA 3TMAA 5FWAA 2FEXA 1NIPA 3OQHA 3UUFA 2HIMA 1EU1A 3PFGA 5ALKA 4P98A 1XRRA 3CWCA 3PRHA 1JHAA 4P7FA 3T0FA 3ZNPA 1UJNA 5KOJB 4R01A 4FGZA 5E7QA 1CCWA 2YH2A 4Q7LA 1T8YA 2A1TR 5FR2A 1WZUA 4ACBA 1NW9B 3BMQB 4JKIA 4BQSA 4CBVA 4RZSA 4A8JA 2NVUB 1V4NA 3AOEC 3LUBA 4ARAA 3AEQA 5EL0A 5DYNA 1QR6A 3MWFA 1OU4A 3R5HA 2I03A 2NTJA 2PX5A 3QLUC 1WBJB 2ARKA 3R3JA 5NLLA 3ZJ4A 3MRXA 3IOMA 5K3OA 4OTZA 2P3QA 1AHHA 3A3OA 1PJLA 3HO8A 3DVQX 3N2ZB 2VJMA 1PF7E 4LOJA 3P97A 1XFDA 5C2JB 1TD9A 4PO9A 2PXXA 4IS3A 4IQ4A 4E13A 1SCIA 2IBTA 1O87A 4HFNA 5KYYB 5MDHA 5A0FA 1DRWA 4WJZA 3FSGA 3F98A 3R0ZA 1TEXA 2MMGA 1WDLA 1TKAA 2MSDB 5JHGB 3WS7A 1MW9X 5F5LA 2FUNB 2R8RA 1YHYA 3LPNA 4FB4A 2LR0A 2P9CA 2VP6A 3B60A 3EBLA 4CTNA 2WTEA 2OO7A 4PZ9A 3O7MA 4X20A 2HF7A 4YROA 4A26A 1ACJA 4IXDA 3MWKA 2JW5A 2IRWA 1OYOA 5JMTA 3DBIA 4A82A 4I4TF 1LJUA 2XE4A 1TXGA 1M9NA 5F35A 4WUVA 2VPPA 3FF4A 3L1UA 4JJ8A 4AYWA 1DJMA 1SB8A 4X63A 1UZAA 1Q2UA 4P86A 5CYOA 4GPIB 4DA0A 1YQEA 3H2HA 3JQBA 4L02A 1VMKA 3GVPA 4YJHB 3W4JA 4TKZA 5FTMA 4CMKA 5IDWA 4KV7A 4TT3D 1D8TA 1IB6A 3G9XA 3LPDA 1G6Q1 2ZYSA 3IHWA 4XWKA 1XHLA 4EMUA 3K35A 1O4VA 3DT9A 1CEYA 4DB4A 1T0PA 3WDSA 1M1YA 5BN3A 4BQRA 3M34A 2JHPA 5HDQA 5CB4A 2FOXA 1BX1A 3H04A 1EP3B 2EZTA 2FPUA 1N6RA 1H5NA 3OZVA 5HJEA 1IM5A 3AM1A 4YAIA 5L53A 1OFIA 4DIOA 2WHEA 4JDUA 4JP1A 2IYTA 1WG8A 2E0IA 2GBLA 1R5BA 3CX6A 3O0TA 3L3BA 4Q03A 2Z1NA 4H7KA 4XX0A 4B7XA 1N78A 2VBFA 2I9KA 1VMAA 1KMIY 1QO9A 2G5TA 4I9UA 2XZDA 1HH4A 4URZR 1UBUS 4L72A 4HATA 4UJ5A 4YRPA 1VE9A 4UOQA 1C7FA 1RKBA 2F6RA 1E1CB 1H0SA 2P6MA 1FQKA 1RYHA 1EVYA 1XDUA 2ZRFA 4J49A 2ZRCA 3PHBE 4Y0AA 1A5TA 2PU5A 4PBSA 3T35A 5BMVF 2G9QA 4LXTA 3IPAA 4MWTA 3GW8A 1MEEA 3QHAA 4HQKA 4JC8A 3VSAA 3O26A 3DOJA 3KALA 3GF4A 4OUKX 1P81A 5K8TA 2H9AA 1H8EA 3JXEA 1JMVA 3R7BA 5K3SA 4JXXA 1P7VA 1XHEA 2PT9A 4AO8A 4B2LA 2V5UA 2Q0QA 4E4RA 1N32B 5F9HA 4LC1A 1FNCA 3D7MA 2YV5A 3OEYA 4XCXA 5I01A 2B1JA 5MHTA 2C9CA 2X8AA 1XKTA 1TAGA 2PLAA 2C99A 2Z1MA 3MTQA 4DCUA 4RV9A 3RVBA 1GPDG 2G80A 2JFPA 2A88A 1E2KA 3W8RA 3RO7A 1XQ1A 4B82A 3ZHCA 3NWEA 1W2WB 4LZOA 4YCLA 1I5RA 3P26A 4HDRA 3QTTA 1Z5UA 3DZIA 4WCFB 4RETA 2W11A 4YMSA 3ZWOA 4DLVA 3KQLA 1JLHA 2XQGA 3F5DA 2WMDA 3GJ8A 3M4NA 4L7VA 3V1TC 1JFFA 1JR3A 1SD5A 3G7UA 3H0CA 4K6MA 2AOVA 3A1EA 1J7KA 2AOWA 4HYTA 3F6BX 4GWGA 4WBSA 4ZT7A 4C21A 2BSXA 2FN3A 2C7RA 1DHRA 2HV8A 1FS6A 5JWOA 5FF9A 4NXMB 4KHPB 1THMA 3OU2A 1ECPA 3HJTA 1WUTA 4F1JA 5CDFE 5ALTA 3D4BA 3D3NA 3DO8A 2X4IA 3T1HB 2ZTVA 3IP1A 1XBTA 4P4SA 4ZREA 1IG0A 4Z5XA 4OL0A 1VIDA 4IGFA 4UHKA 3UFXB 1QV9A 3LCVB 3W8EA 2A7QA 3OPYB 1G6KA 1I36A 3IPLA 3FYUC 3H1GA 4D3XA 1XV5A 3AF5A 2D1YA 2I1WA 4PBTA 3PNOA 4V39A 5DHFA 3IBTA 5SZHB 4BKOA 4QJ3A 3K5PA 2HJWA 2AHOA 5EI5A 3T9AA 4DAOA 2GEFA 2Z0MA 4DV3B 4QOFA 2BE7A 2HLPA 3G7NA 1HMPA 1B14A 3NC1C 4JOCA 5H59A 4KIFA 3GLSA 3T94A 1DRJA 2B4AA 4POAA 2HTFA 1YIAA 4ARUA 4QZVA 3IDQA 1I33A 4Z9XA 4IHJF 1O8CA 2ADMA 2BF4A 5IX8A 1P9RA 3V8PA 5DWQA 3NBQA 4GKAA 4MA5A 2EC5A 4L5JA 1JA9A 3A36A 4H7JA 1ZN7A 3PQ3A 5EUBA 2HQBA 3NIGB 2CXQA 2JLQA 3CLTC 3KL2A 4MW5A 2NZ2A 2ZPUA 4G23A 1WX1A 2BR3A 3KZVA 1M2WA 3KSRA 4BV8A 3O4JA 2GXAA 4N82A 1Z39A 1G59A 4H4CA 3UAYA 1X1CA 1GLGA 4RHXA 1SKBA 3LBIA 2XGOA 5ALYA 3K70D 4L5IA 1RQ7A 1EA5A 2VQ6A 2YY7A 2QL7A 3I76A 4OJTA 2K2WA 3OOHA 4UCXA 2BBWA 2C9YA 1NDUA 3ILHA 4IUBS 2H5JA 1HO3A 3B89A 2VBCA 3OE5A 4R1NA 1N4AA 4JXJA 3AOEA 2J4DA 3IO3A 2EF1A 1QHGA 3C7CB 4YA6A 1GQRA 1YBHA 3TNFA 1P1KA 3K2QA 1TZCA 4LWZA 4AZ3A 4FMBB 3V32A 1P4AA 2JAXA 3QLUA 3KFXA 4Q4JB 1JH9A 5G02A 4D9HA 3EIUA 5DN9A 2PMBA 3A28A 4H18A 1R1DA 4JI6B 2FUG6 3COSA 5I4BA 4CM4B 2B35A 3ETJA 1PR1A 5EXXA 1TZBA 1UKAA 1Z33A 4YS6A 4BO5A 4G4JA 2Z58A 4QATA 4V1CI 1JPJA 2C83A 4F8JA 1KVSA 1ZD4A 4N5LA 1JHYA 5I51A 2FDXA 4Q1EA 3HQ4O 4BU0A 3QX3A 3MYYA 3ZWAA 3WK6A 1SUDA 4ETMA 4WBNA 1N3LA 2H1LA 3ECSA 4JMLA 1FTGA 1PZNA 3FOBA 4ZVRA 3WK4A 4BCBA 4F6RA 1G5QA 3AUYA 4QUKA 1CE8B 2GB4A 5CA1B 4UCFA 3KQHA 3BWBA 1ZVMA 4HTFB 4RMHA 2BFCB 4QU5A 4OJQA 1H4TA 2PEZA 3N3BC 4ZVQA 1CNEA 2AD1A 4HAWA 1HNXB 5GZ1A 4KPGA 1IJFA 1LBHA 5KB3A 2H4YA 3DHEA 1FIUA 1GVHA 5AK6A 3TLAA 4LNUB 1EFPB 2F1IA 5KIAA 2RB5A 1BWPA 3L0CA 1P74A 5L7YA 4N8DA 2P2NA 3EGXA 5CHEA 2ZAOA 5CT9A 1SZPA 2HNKA 5LQAA 4ZVOA 3CNEA 2NV0A 4FM9A 1T43A 4P2BA 1IUKA 2ZPTX 2FG6C 1SQ5A 4KHZA 2NU9B 1PJRA 1BXKA 5HKKA 2VDUE 5HOEA 3EG5A 2CLHB 3I6YA 4R51A 4OV6B 4U0KA 1J0CA 1RPNA 2XOXA 4ZVKA 1C3OB 1ONSA 1JSLA 1XYYA 1NOJA 2OCDA 2HZBA 4MA4A 5D84A 5E6SA 4F7DA 1NTRA 1APBA 4EYGA 3GIWA 3L2OB 2OP0A 3LWBA 5FEUA 1Z5NA 2W70A 4QBIA 4WXRA 1NJFA 2P90A 3PPVA 1RAIA 3FCXA 2VPZA 4A0QA 4AS1A 5LZ5A 3SEAA 3BHJA 1D1PA 4JLSA 4QBTA 2EFJA 2BP7B 4BAGA 1IK6A 5BOSB 2XVXA 4TLDA 4J4TA 2R62A 2B30A 4M7PA 1H94A 4ARZB 3PTLA 4ALJA 3P32A 1PP4A 1FP7A 1J99A 4WD3A 1XVIA 1QRTA 2BFWA 3MHTA 4B4VA 1CK4A 3JQGB 3WNVA 1D9XA 2BGMA 3LBFA 4JBYA 3MYRA 1JWBB 4M0LA 4QQKA 4PZ0A 4CCSA 4A36A 5IN5A 3PGVA 4NPCA 5SZJA 4EYSA 5GJBA 3TTWA 4CPDA 1Z7EA 3PSAA 4D6YA 3HO6A 1WCYA 2YOFA 3DE0X 4D9BA 1DOHA 4ZYLA 1AK9A 1UXIA 3SJCA 1FFEA 4DLSA 3EDYA 4MRAA 2X0JA 2DHRA 5I7AA 9ABPA 3RYCB 3SYNA 3VR4A 1W5TA 2EKPA 1MT0A 4ZVSA 2JCVA 3VR1A 2HCBA 2I4NA 3VU9A 4DN6A 2NO9A 2VF4X 4BMCA 1U80A 5BNZA 4BLSA 1QMPA 4PXSA 1J42A 1Z06A 2A5GA 1GTZA 3HFGA 3LY9A 4X1YA 3O47A 4F1KA 1J5EB 2ZGVA 4CKWB 3IH5A 1SQFA 1NBEA 1HURA 3STUA 4RDXA 3T9FA 1MQSA 3Q9SA 1NI4B 4BZPA 1F12A 4JS0A 2YS7A 2AOXA 3BREA 3FNGA 1YNOA 4P36A 1PFYA 4WW0A 3LRPA 2ZB4A 3UENA 3CTPA 4OBEA 5DCWA 4A10A 4DMMA 3HDJA 3R6TA 2X8LA 4KRFA 1CNFA 1EYZA 3VDQA 2FPSA 3OF2A 3QEMA 3OY2A 3BA6A 2OILA 3SF8A 1LSUA 3ABQB 3EIEA 2NU6A 3MZ0A 3ZDYB 2FGKA 1YR1A 3O75A 3W8FA 1K97A 3M3PA 3OBIA 1K8XB 4LECA 1W9HA 4P31A 1THTA 2PAAA 2G28A 2B6HA 5EZYB 3FYUA 1A76A 1X9GA 2BMFA 3OZFA 5LA6B 4E94A 4XH9B 2V45A 2FFJA 4RACA 3OOJA 3PUIA 3QE3A 2PRYA 1KSGA 4YONB 3ZGOA 4DUGA 2PUDA 1OA0A 2R96A 2P3LA 3N8IA 1NN1A 4IVQA 3T06B 4A0RA 4KPYA 1TU3A 4S1WA 3NASA 1AY0A 2OO5A 3ICPA 3FMOB 1NVKA 4FYPA 3NKLA 2VQFB 4IHQA 3FNQA 3L6CA 1NKVA 1TJ5A 1M5TA 1ZN8A 1GFWA 2VT3A 2PD3A 2ANCA 3K9WA 1NBIA 4WFJA 1X9HA 4LHZA 3OWHA 1O03A 4KE7A 2GDJA 4EHKA 5KHAA 4C08A 3RH0A 3BJZA 1JNXX 4GVPA 4WN9B 4XVQA 5DYYA 5H3LA 5AW2A 2ZVDA 3WRXC 3GLFA 5LFAA 4KRXA 3NKFA 3CEHA 3Q2KA 1I7QB 4A6DA 3VR6H 5EMJA 3HEMA 1C2TA 4O1IA 4REQB 2RK6A 4B3FX 4B6GA 1TYZA 4DHWA 1KY5A 2ID8A 3BKWA 1ADCA 4HGPA 4C6RA 3K0FA 2UUBB 3C16C 2W6ZA 1IEQA 3WA6A 1JH8A 3THSA 1ZIXA 7MDHA 3FSGD 2GLXA 2YZMA 3N74A 4JI3B 3WWYA 1LNQA 2FCRA 5TS2A 4B2PA 3T3EA 1J22A 1CS0B 3GV0A 2X6TA 4FHZA 1AM4D 2OLEA 2QRPA 4UARA 5IZCC 1LDMA 5B53A 1WB9A 4F86A 1VFNA 3HR7A 4M6WB 4ETWA 2VZ9A 3OE4A 2ZANA 2R1ZA 4X93A 1J70A 4I0WB 3V4ZA 1QOQB 4BNIA 3ORFA 1IN5A 1L2TA 4LPSA 1KI6A 5HZHA 1Q5PA 3G82C 1QVRA 1Y0BA 4O3FA 2R6JA 4LBVA 3EISA 5FHQA 2E4UA 3SQXA 3UHAA 2Q6OA 2VJCA 3Q3CA 1B42A 3SVZA 3RVOA 2VDLB 5UKDA 1R18A 2A67A 3DFUA 3NWOA 2XDAA 4EJSB 3G49A 2B4KA 3OY7A 3ONEA 4YVFA 2IV7A 3R7SA 2XMRA 3EA5A 2AS0A 4FQ5A 4B6RA 2YBEA 4NBNA 1GM5A 3NEAA 1FTQA 1YHNA 4TWJA 1QMGA 3C6ZA 4FONA 5FUVA 5AVUA 1Y3CE 3S8EA 2K2QB 4YDHB 5MGBA 2FLWA 3AONB 1F8XA 1E5QA 5E2IA 1JS1X 4M9SA 4YRLA 4EGQA 3E3AA 1WDKA 2Q8QA 1E3DA 2YW9A 5AI4A 4A23A 4M0EA 4YDSA 5CDFA 4Y2YA 3N75A 1PT5A 1X70A 3UW1A 1GNVA 1QE3A 5BSWA 3KQMA 1XTPA 2ZBDA 2VT6A 4IINA 1T25A 2OQ2A 1P1BA 1BDMA 1QZZA 4N8SA 2OO3A 1N2XA 3NI2A 5C8YB 1U7XA 1USKA 3FIUA 2OHGA 5BR1A 3QMPA 1YQTA 1YDMA 3NZEA 4LISA 4CN9A 3BMCB 1U9IC 3K5WA 2Y92A 4R83A 1VYVA 1QS0B 2OMKA 3MAGA 1GNSA 4ZO6A 3TQFA 3CUKA 2VIIA 1BX0A 2ZYTX 2OBMA 3HJBA 3PCXA 3WISA 4B3RB 3VC3A 1H8ED 1OT3A 1LB1B 3OLZA 4HAVA 3OX1A 3NM5A 5FP0A 5DNCA 4QSMA 3G5TA 4CN8A 1OJ7A 4ZGWA 5HGJA 1QC5A 3K2IA 1PZGA 1OH6A 1H0KA 1ZRNA 2Q0XA 1QK5A 4DDUA 3R9XB 1XTKA 1VLLA 1B73A 1MX3A 2VYVA 2CDCA 1JF8A 2O4UX 1U0BB 1JEYB 2AN9A 1II8A 4DCCA 1CBUA 2X40A 4GH5A 5CFLA 2GTIA 3D4LA 3IVCA 3WL7A 1CQZA 4HOYA 2HO4A 1N2CE 3ZCTA 1V35A 3KFVA 5CAEA 2F3UA 2CFOA 5G4LA 2P1DA 5DYGA 1EKXA 2XMZA 5FWXA 4EHNA 1WVMA 3HBFA 3U4IA 1JR3D 1VCMA 5HFJA 1DFIA 1PNQA 4JB0A 5CYPA 2A4MA 1ECFA 2EERA 3TOSA 1W36D 3LDUA 1F2DA 1CY2A 5AVJA 4PC1A 2PJRA 4RIFA 3AYXB 2CXTA 2HRDA 3ROEA 1V26A 3VXKA 1JHZA 3AF2A 4BP9A 2C88A 1Y3AA 2FR0A 3QUTA 4OYLA 3ZWPA 3ZX5A 2G1PA 2AOTA 4JQCA 3HVUA 3TBHA 7GPBA 3DZGA 2CFRA 4OP3A 1TO2E 5ICFA 3E53A 1GV1A 3ZV7A 1VPWA 1KP3A 1YASA 2CXHA 1WQ3A 3X1MA