1TKCA

Specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
publication title Specificity of coenzyme binding in thiamin diphosphate-dependent enzymes. Crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 242
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1994-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA01
2BEVA 1UMBA 1NGSA 3FSJX 3FLMA 3HYLA 2VBGA 1UPAA 5EXEA 2G28A 2Q5OA 5EJ7A 5EXDA 2O1SA 2BFEB 2JLCA 2YICA 1X7ZB 3UK1A 1W88A 3EXFB 2JI8A 1UPCA 5EJ5A 3EY9A 5HGXA 5K3SA 1W85A 2VBFA 2PANA 2C3OA 4Q9DA 2BEWA 2R5NA 5I51A 1V1MA 2PGOA 4MPJA 4QELA 1UMCB 2Q5JA 3AI7A 1WCIB 2UZ1A 2BFFB 2Y0PA 3EA4A 1Y9DA 3RIMA 2Q27A 4JUCA 4RJIA 1NI4B 3M49A 1OVMA 3IAEA 1N0HA 1V1RB 3AHDA 5I4IA 3L84A 3AHEA 3EXHB 3AHIA 1QGDA 4JUAA 2XT6A 1U5BB 1YBHA 1UPBA 1TRKA 2Q5LA 4ZP1A 1YHYA 1UMBB 4KXYA 2VK4A 3EXG1 2J9FB 3ZHRA 1V11A 1QS0A 1PO7A 1T9BA 3LQ2A 3DUFA 2OZLA 1OZHA 1W88B 1OLXA 2BFCA 3AHFA 2C3UA 2PDAA 5ESDA 1TKAA 5EJAA 1UM9A 1W85B 5ERYA 1OLSA 2Q29A 3LQ4A 1YI0A 2BEWB 1DTWA 1V1MB 2WVGA 2UZ1B 4GM0A 3F6EX 2IEAA 1OZGA 4K9LA 2VK1A 1X7XA 2XT9A 5AHKA 5FEMA 2BP7A 2EZ9A 5HJEA 2JLAA 2DJIA 5K6TA 3AHHA 2Q28A 2VK8A 3DV0A 3AHCA 4KXWA 1V16A 2JGDA 4MZXA 4COKA 2FN3A 4MPRA 3LPLA 5K6RA 4RJKA 2X7JA 1X7YA 5EJ9A 1V11B 3M6LA 4GM1A 1YD7A 1ITZA 3DUFB 2OZLB 2E6KA 1AY0A 3MOSA 1OLXB 2BFCB 2QTCA 1KEKA 3D7KA 1X7WA 4K9KA 1OLSB 2NXWA 4QPZA 2W93A 4MQ5A 4K9PA 2AG1A 3LQ1A 2R8OA 1T9DA 4GG1A 4JU8A 4C7VA 1OLUA 2JI7A 5EJ6A 5EJMA 1QPBA 5C4IA 2BFDB 5DEIA 1X7XB 2BEVB 1IK6A 2BP7B 4JD5A 4FEGA 3M7IA 1R9JA 4MPPA 2YIDA 4JUDX 1PI3A 1V16B 4GM4A 2JGDB 1ZPDA 3EXFA 5HYVA 2EZTA 4KXVA 1X80A 3FZNA 2WVHA 2C42A 4XEUA 1V5FA 3JU3A 1UMCA 1V5GA 4FEEA 1T9AA 3ZHSA 2EZ8A 1OZFA 4K9MA 1L8AA 1X7WB 3ZHVA 3F6BX 5DGDA 2BEUA 3DVAA 2G25A 4K9QA 2UZAA 5I5GA 3HWWA 4JUFA 2Q5QA 1PVDA 2BFBA 1OLUB 1GPUA 5EJ8A 4D5EA 1UMDA 4RJJA 1POWA 2JI6A 2VBIA 2J9FA 3UPTA 4K9NA 4JU9A 2XTAA 3E9YA 1QS0B 2AG0A 1YNOA 1TKCA 4KXUA 3EXEA 1X80B 1UM9B 2C3MA 1MCZA 1DTWB 1T9CA 3EXIA 3OOYA 5ERXA 3AHJA 3KOMA 2JI9A 2FWNA 2QTAA 2VJYA 3EYAA 5K2OA 4GP9A 2BEUB 4JUBA 1YI1A 3DVAB 3M34A 4KGDA 2R8PA 2PGNA 3HWX1 2EZ4A 1B0PA 2BFBB 1PYDA 4C7XA 3DV0B 2BFEA 1Z8NA 4GPEA 1X7ZA 3IAFA 1POXA 3OE1A 2IHUA 1UMDB 3ZHTA 2V3WA 5HHTA 1BFDA 1TKBA 2JIBA 1X7YB 4QQ8A 3EXG2 2C31A 2G67A 1WCIA 5IMSA 2IHTA 2BFFA 5DGTA 1YHZA 2WVAA 3ZHUA 2IHVA 4KXXA 3EXEB 1Q6ZA 3EXHC 5I5EA 2C3YA 4K9OA 1NI4A 1V1RA 1RP7A 3EXIB 1JSCA 3EXHA 2O1XA 3AHGA 2EZUA 4D5GA 2C3PA 1U5BA 5EJ4A 4WBXC 1V5EA 2BFDA 3ZHQA
chains in the Genus database with same CATH superfamily
2C4NA 2GWRA 2BEVA 4K86A 2H59A 4FW8A 1MB2A 2BM9A 1LPNA 4QUAA 2ZIXA 3U81A 2I2XB 3WLMA 4K1XA 1KEUA 4HH3C 4R8KA 5JNVA 2ZRDA 5ARDA 8LDHA 3M4ZA 1X9IA 3W2GA 5E7IA 1CEEA 3PCTA 1XQXA 1JJBA 2AVNA 4JFRA 2DFLA 2ORED 2AD5A 1VP9A 2BFEB 1TF7A 1IBLB 5F7XA 1C1XB 1C3OB 4IEEA 2JLXA 4R4JA 3T99A 5A0VA 4CR6A 4L75A 3W7BA 3SIXA 3GXBA 3FNRA 4G41A 1PEYA 1V8OA 3FFAA 4WRRA 4ZVQA 3Q72A 3SLRA 4DR3B 3RRYA 3RYCA 4GLBA 1JQLB 1FJHA 3P2KA 5B1EA 5K8CA 2BBTA 2XVXA 3C8MA 4JYBA 2XEXA 2GM3A 4QVGA 5ES3A 1ACMA 5T6MA 3I6YA 4UNPA 3RCBA 4PZZA 4O02B 2P6PA 1L5WA 1P1RA 2NUPA 5CFPA 1QGYA 2CMGA 2PBZA 5AFSA 5GJBA 3SU8A 2ID9A 1KNQA 1XIVA 4LCJA 5CCDA 4ZO7A 2V8OA 3CF4G 4X8HA 3AV3A 4V0MA 3RLFA 4ENSA 4QEZA 2VWGA 4NBTA 4HDRA 3VPCA 4CM8A 1GLVA 1PD0A 3E7PA 4FINA 3K9FC 1VBFA 4L7QA 2QUAA 1V25A 4KGXA 1T1SA 3LH5A 5COQA 4WZAB 4BO3A 1P0CA 1YR8A 2Y0CA 3EG5A 3R6LA 4G1EB 4IIYA 4LQCA 3DE5X 1X7DA 5GM2A 3VMFA 5J23A 4MDFA 1NRWA 2IS1A 3M49A 3FUTA 4WKGA 4XD7D 1NG1A 2UKDA 3DKRA 4HO1X 3R74A 1WSWA 4ALKA 1BEEA 2FJ0A 2EX0A 2ZI6A 4R54A 3SZLA 1YJ5A 3IEKA 1QQBA 3MT7A 2RCNA 3RF6A 3R7LA 3FOEC 2VH1A 2HNKA 5KSOA 2BCGY 2I6SA 3TZ6A 3CG4A 4YH1A 1CUBA 4J0EA 4MLZA 3CZAA 1BWQA 4BPRA 4XX0B 1ZK1A 4X7BA 5PGMA 2YBDA 5EKUA 4XDGA 1SBTA 1DDGA 1U5BB 2RHWA 2R6CA 2VA8A 1RCFA 3Q1LA 2QN3A 3FYDA 4PHCA 1GQFA 1JIUA 1IZ8A 4BNKA 1U7OA 1BKDR 1Q5PA 4HWSA 4MGEA 4DSAA 4LZWA 1I4EB 3FGPA 3BQ9A 4RMIA 1GPKA 3SR4A 2JBHA 1EIWA 2J9FB 3KOUA 4FFWA 4FUQA 2E85A 1Y3AA 1YSCA 1XE3A 3LP5A 4W7IA 3MJRA 1XZPA 1R5OA 3EXAA 2PNJA 2H2FA 4WNIA 4AMGA 1TK2A 3A6KA 3WHPA 2ONKA 3PD1A 4QOEA 1SQSA 1IRXA 4ZN6A 5J5VA 1SELA 1KETA 1SUAA 2PJDA 4JKIA 2YRFA 4KO1S 1JQKA 2F1RA 1M6VB 2VJPA 5TX7A 1LW7A 2R8EA 5CXUA 4ZCPA 5A3VA 4MUHA 4KOAA 3IJ5A 5EXSA 4DJDC 3UKJA 1INLA 1YQQA 2WD7A 4W8GA 1EGHA 2YJNA 1XRRA 1YMVA 3DAFA 5EIFA 3DE1X 3SVZA 1KJZA 1ZC3A 4DAEA 1ZY2A 1SCAA 2JJ2A 3OF5A 4HNRA 1UC8A 1I7NA 3OLCX 3T1TA 5EIXA 2CDRA 3PVZA 1P1BA 3BXGA 5FOXA 4YYEA 1J8DA 5FF9A 4FHFA 2ZCJA 2O6HA 5CG2A 3R76A 3LECA 5EWJB 4OAOA 4EL5A 2A9VA 1RZVA 2AMJA 3GEGA 2H18A 1W52X 1CJCA 2KS6A 4W8HA 2QVLA 1ZO8A 4DXDA 1THMA 3GGGA 5AVQA 4Z51A 1QZZA 1OGJA 1AK1A 1MG5A 1MO4A 1Y9AA 2ARKA 1ZVJA 3AL2A 5JH7F 2O8DA 4HAWA 2O19A 1W0KD 1VGQA 4PRYA 4L22A 3BGWA 1DELA 5I9BA 1XYVA 1K6JA 1XDBA 3KQVA 3W6ZA 3HP4A 4N5NA 4ND6A 1JL3A 3HO1A 4HTAA 4LNAA 3SEAA 1FL9A 2BOVA 4H4DA 2XT9A 4EG7A 3G49A 4RDCA 4P58A 4MIEA 3SQNA 4DPLA 1QONA 4UM9D 4ZYLA 3GFBA 1T4MA 3LXRA 4P4TA 4ED9A 5A3JA 1GFWA 4PIMA 5HZKA 5DGXA 3PNPA 3PNLA 3BGOS 4DCUA 4B0PA 2DJIA 2HMUA 1WW2A 4DWOA 4PZLA 3H1PA 5KYXB 3V55A 2Q28A 5JSZA 3JX9A 2RGNC 1Q2XA 1NZFA 4AUMA 1RQ7A 3I3SR 4RGQA 4NMWA 1R7RA 4FHDA 2HDNB 2AXNA 1M2OB 3NCHA 1ECLA 2A88A 1EX9A 3HVKA 4MMZB 4XEHA 4HVAA 4MPDA 3I2FA 3Q3IA 3HU2A 4HHEA 3WKAA 1BGWA 4MPRA 1ESZA 4HWPA 4MGZR 4HQFA 2ZI4A 3PGJA 3S5JA 2YH2A 1NKTA 3OOSA 3UGQA 3F5FA 1H2XA 3EC1A 3GMDA 1C3XA 4IO1A 4OY3A 4R3WA 4F4JA 3AR3A 2QRQA 4RPJA 3G02A 1ENOA 3BJEA 4PLPA 5F1PA 1ADGA 1E4OA 4BAGA 3EMKA 5D3MB 3B6ZA 3EVTA 1B8UA 4CM4A 1FUIA 3OPYA 4NK4A 4U2CA 4O0LA 1FJGB 2Y05A 5JI3E 3GLFE 3G2IA 3V1UA 5I48A 2DR2A 3OT5A 2IIPA 2R44A 2W70A 3THWB 3ZI4A 4FFMA 5BWMA 2J4CA 5FQNA 5MDHA 1WP9A 2Q21A 3JYHA 3EQ7A 5FFNA 2BFCB 5F52A 5FNVA 3SK0A 1E3JA 3OU2A 4X7PA 5B1SA 5LYJF 3GLHE 1A2KC 4WIAA 1JSLA 4QQNA 2WDPA 4N65A 2C5EA 5A1JA 5FDFA 3A37A 2OQIA 5EIEA 4RACA 4H60A 2NPOA 2C2MA 3NWPA 4C07A 4IUBS 1AT1A 1XZBA 2Z5LA 3V2UA 4M8KA 5F73A 4RQAA 2QVBA 4G4IA 5BV1A 1EUZA 1N34B 1QRRA 2R3SA 5EWLB 3KOOA 1DTEA 1BKYA 1N75A 2R48A 4DMHA 4QDUA 2WTEA 3PYXA 1PZXA 4JQCA 1RZRA 5I8ZA 2WABA 4LF6B 1T9DA 2CXPA 3RGGA 3NWJA 4DUYB 5JQGF 2E55A 3GMSA 3VR4A 3VYUB 3OFKA 4U2DA 1T1EA 5C4IA 3G1WA 1TW2A 1LC3A 2DFPA 4FC6A 1YB4A 2AMYA 4Z2YA 2NV2B 3ZXXA 4XIYA 5A2QA 1SZCA 4RGYA 2FE1A 1CK4A 4I6GA 3FPLA 4GMDA 4BCDA 3IQXA 5FPYA 3EGXB 4RZIA 3HWRA 2QTTA 3OHSX 2PXHA 3G5LA 4HEJA 2BEVB 4WWHA 3GGOA 4MVJA 4R3UC 3PUHA 1GL7A 1RWBA 2XNDA 4Y1RB 5ELMA 3TMYA 4D6XA 1ZR4A 1FNBA 3H8WA 2I4NA 1V4VA 2CN1A 3OZRA 4BKRA 3E61A 1IZZA 1EEXB 3T3PB 2WR8A 1CQJA 1P8AA 1QGOA 5CVCA 4DCVA 2WHQA 1G66A 2I76A 1J2RA 1SCUA 1P8JA 3CFYA 3EGIA 3EODA 4P3XA 4ZJZA 2CLIB 3AFMA 4A6XA 1QKKA 1NU6A 2J9YB 3AM4A 3EXFA 3PNBA 1U7PA 1GP2A 1PP4A 3HBFA 3SN6A 4INOA 1HWYA 3PG5A 3LYUA 3UTDA 4CMAA 2Y76A 2DOKA 3U16A 3LBIA 2D3WA 1WUHS 4IHQA 1LLCA 5K0CA 3PXGA 4B7UA 3KBBA 5IU6A 2B3DA 3JWJA 4KXFB 4CKCB 2OHFA 1MO3A 1R9GA 1UWCA 4R1MA 3M70A 5JVDA 3RKSA 1AUVA 5JBQA 2C2WA 1HYGA 4UBKA 4EFMA 3RHTA 4ZYZA 5AUOB 1OAOC 4XB6B 4LYGA 1I0ZA 2IJGX 1BH6A 2DFDA 3NUZA 1B15A 2ZYRA 5LZ8A 4R9UC 4OK3A 4FR2A 3IVMA 2B6HA 3L0SA 4P33A 5K3EA 5CH5A 4UASA 3BQMB 3SKXA 2ZSUA 1NOKA 2JGKA 1PGNA 2BEUA 3Q98A 4G1CA 1NBHA 1ZXLA 2ZSJA 3DCJA 3RJ5A 2A0UA 4OXIA 2O23A 3A27A 1L5SA 2NX2A 3G2OA 4MCJA 1X8XA 3ZWMA 3WVNA 4CMEA 3GARA 4PGAA 4ZVUA 2G0TA 5LZ9A 3D6NB 3V7NA 1PZNA 3DLIA 4WKCA 3NRCA 3RF7A 1RI5A 3EZYA 1JB9A 2ZYTX 4LAFA 4LUCA 3SBEA 5L6LB 4RVGA 3AVVA 2BZSA 1U2DA 1UEXC 5HIIA 1B3RA 4HUQB 1E0SA 1LVHA 1UPFA 2Q2WA 4DQXA 3SQXA 3WIEA 1MPTA 2GK3A 2IH4A 4D6YA 4HDKB 3HU5A 3R2JA 1E9FA 2V97A 3B6KA 2OORA 3KB6A 4P92A 4BAUA 1U0GA 4MKHA 3IBYA 3P9YA 2I2DA 2VCYA 4FOPA 3D54D 1GD1O 1AS3A 2AJCA 3Q8WA 4M7WA 3LHDA 1E6UA 1PT7A 3JVIA 3B82A 5AW7A 3GJ7A 4BRUA 4IHAA 1M34E 3RFTA 1I9GA 4OCZA 4W7HA 5JH7B 4YUZA 4RMHA 3W3AD 4F6RB 5CT9A 1IB0A 2V5VA 3H2ZA 3CUSA 3M6MD 2JRCA 2YDXA 4FR5A 4FFNA 2PQ2A 4TKVB 5FPSA 3UAVA 2OMKA 1BIFA 1TPZA 3ZW8A 1E6MA 5AVRA 3EG9B 4E88A 4UNQA 5TGZA 3GFOA 4N76A 2GO7A 2ZUWA 2DHRA 1N0VC 3FLBA 4A73A 1I32A 2OK7A 3AJRA 2WD7B 4JIMA 3ZI7A 4BN4A 5AI4A 1XPRA 4L8VA 2ZDQA 1M1ZA 1V1JA 4BLPA 1IU9A 1R0YA 5DCWA 1IN7A 1V2HE 2YQZA 1SWWA 3NHBA 4FHGA 4I6EA 4HDAA 3ROTA 2W00A 4TSFD 4UBIA 2DH6A 2FUKA 1G64A 2PJZA 3IOYA 3OOYA 5KTKA 2J45A 2P11A 3CLRC 3UGKA 2PSFA 3AM5A 3V1MA 1J2EA 1QGZA 1CDDA 1ZK2A 4RSRA 4Z9BA 1R4MB 2Q9UA 2X40A 2YZKA 1YCFA 2Q50A 4N5LA 2AI2A 2W58A 3KC2A 1PJSA 4KLZA 4TL7A 2WTNA 3QLUA 3H9UA 4YIKA 1XLWA 3T7CA 2IUEA 2HI0A 4M9ZA 5DLYA 4RPLA 5AKEA 5TQ2B 3VO8A 3ZE7A 2VPXA 4MO9A 2BFMA 2ZWMA 3F6RA 2W2KA 1U65A 2CVQA 3G0IA 4Q0MA 3HU3A 5KSYA 1XTUA 4KITB 1QCYA 4LDQA 2QAJA 5JATA 2CK3D 3PP8A 5TF4A 4J7CA 1YI1A 2YZ2A 3K0AB 1D9XA 4II7A 1K6IA 1T5LA 3C6BA 2VF5X 5COAA 1L2TA 4DNPA 2BBOA 3LIPA 4DXAA 3HS3A 3UM9A 5BORA 2E1RA 2DFVA 3HWX1 3PZRA 5LYJB 5K3FB 3O9MA 3COWA 1U94A 3OCZA 4HH0A 5JSZB 1JXMA 4MWDA 3OJOA 5K6AA 4UNIA 3DVLA 3PQ3A 1VKHA 1C0IA 3VHRA 2PPVA 3IV6A 3VVLA 2PGXA 1Q1QA 2D2FA 4B35A 4MKGA 2JAUA 4PRLA 4V0QA 3ZU2A 4B8ZA 4D7AA 1EP2B 1MA0A 4RZ2A 1G4HA 4IDNA 5DJ5A 2ZQZA 1JTFA 3WO1A 1AXEA 2VDNB 3FWPA 4BL5A 1RHUA 1ZUD1 4ERXA 5JQGB 4X54A 1ZIXA 5LDDC 1WOMA 3DDSA 3F8TA 3WNBA 4DIMA 3S8EA 1CXZA 3FHTA 4U1RA 4OKNA 1AGNA 3EXG2 1OFIA 1AQ6A 2WSSD 5C52B 3ZJTA 3FETA 2GN9A 2B7CA 2ZS7A 3I76A 1TLFA 3NYQA 4YDQA 1VFNA 4H59A 3AB8A 1T2UA 1LRKA 2E4VA 3K1YA 1FRNA 3DDCA 1QLHA 1VGVA 3L0IB 3HKCA 4PC2A 3CRW1 1YZ3A 3GDOA 3NHLA 2NT4A 4OOEA 3PI6A 1EG2A 4RUKA 2XE6A 3AC0A 3EXEB 4BECA 1DO2A 2YFKA 3RT9A 3ZVNA 1TD9A 3Q41A 1ZCJA 1Y7TA 1ZM7A 1MQAA 1U2GC 2D74A 2PMEA 5I5EA 3TCXB 2VHYA 4K6FA 3TD6A 4OKIA 3ZCQA 4CRWB 4I3FA 2VJNA 4Q00A 4WK0B 4NBSA 1UWLA 3ANXA 4YACA 3ZD6A 1N6HA 3JTEA 2ET6A 3ZE1B 5LN1A 3IUQA 1ZK0A 4BVBA 4CG0A 5J40A 2FXIA 1O6BA 1DIHA 2MINA 4OUDB 3DTVD 4WXYB 3U3MA 5ECGC 5JASA 4B09A 3R9XA 2TMDA 3IQEA 3K32A 1ZD5A 1U0SY 2FPGA 2BRUA 3LY8A 3GA0A 4JNCA 1TO6A 5FO1A 3SPXA 1Z5NA 3IUNA 4OOFA 4P98A 3BILA 1J0AA 4RK4A 1YL7A 2FWAA 2JFXA 3DBHA 3EDQA 1M1YE 4IIEA 3WLEA 1F9AA 1Z4OA 3GI1A 4YX9A 3DB2A 1PSZA 2GBPA 1A50B 4KBFA 4HG2A 5KYYA 1U1EA 3IDZA 4TMKA 1Z83A 4HGOA 4ENTA 1RS0A 2HMVA 1JIKA 1AB5A 2G70A 3NLLA 3U5TA 4IG4A 5M7EA 4YMGA 3H8VA 4ZMRA 1XNJA 5HF6A 1S2MA 5CFQA 3F7MA 3NXKA 4RVHA 5FTMA 1ZGZA 4Z4QA 3OLVA 3PPIA 3C2QA 5DTQA 3OOHA 2K5UA 3BEDA 3F5DA 1SCUB 3TCKA 4IOLA 1JKMA 1P2UA 1IY2A 2A92A 2J3QA 3D4IA 3OE7D 3OJCA 3I04A 3GGDA 2DEUA 1B23P 3EXFB 4RKRA 1KSFX 5KX5B 5EZQA 3E03A 3KKZA 5JIBA 1XU4A 5P21A 4LI0A 3A3PA 1DQYA 2V65A 3BK1A 4RSMA 3P52A 1FXUA 2VUUA 2WM3A 3SC2B 3WRWA 1N2BA 1W85A 3E3AA 2VBFA 5H0IA 3RC9A 1J0BA 4D4KA 3W3ZB 1A3CA 3PD0A 2Y1DA 5AOBA 1SQ6A 2ZU6A 1K8XB 2K4MA 2OOSA 3W8EA 4BU0A 1MX3A 2IBMA 5FBLB 2AI3A 2EGGA 4Q34A 1WPGA 3B5IA 2VZ9A 4HCJA 4RK7A 3S44A 2XRYA 4HSGA 3ZY5A 4LMRA 4B2IA 1UZMA 2OGTA 2VJDA 3CU5A 1FP7A 2IELA 2GHQA 4R7GA 2NSJA 2WY2D 1PJQA 2QLLA 4BQEA 4MO2A 1Q0UA 1I4OA 1ATIA 1JT2A 3JRXA 3P5BA 4YN3A 1E2KA 4YUXA 4Q9IA 2CLCX 5IKOA 3STWA 1F17A 5DYYA 2B61A 4R05A 2BKUA 3TLZA 3VJMA 1JEOA 2BGTA 2C5BA 3ZZ1A 2IYSA 3EAGA 4PR3A 4ZCSA 1RJ9A 3WNQA 3B3QA 2WHXA 4OJYA 2PWZA 4YONB 4GR4A 4DARA 1PFYA 3SY8A 3GF4A 4GXTA 1Q6YA 3IVXA 2XHZA 3ADOA 3NIFB 1J1IA 1E1CA 4HH4A 5EUBA 5M34A 1N7HA 5JSFA 4D9FA 2AOXA 2RGDA 4MV4A 1PNTA 1EHCA 2G72A 1UBFA 3A1SA 1SFRA 3OQ1A 3UXHA 1J00A 4CV3A 1Q50A 3COPA 2X0KA 2QU7A 3FKJA 3NC0C 2AUMA 4Q9KA 5BNIA 4JYAB 3LDGA 1U9IC 2HQRA 3HUTA 1ZH8A 3UWMA 4IIGA 3AB7A 1UT8A 3D5QA 1HC7A 4D8VA 5EIAA 3LAWA 1T2EA 1W19A 4L74A 1QO0A 4R1PA 4AJ1A 1A5TA 2MIIA 1YBHA 2JGFA 5AJVB 4BNIA 1QK3A 1JI0A 1VDZA 2JBAA 1I3MA 4PBSA 2CLHB 2UUBB 3F7OA 4BFCA 3AVTA 4RZHA 4E5PA 3SQOA 4S12A 1Z3CA 5K0JA 2RK4A 5LB2A 3RBXA 1PN3A 5JWOA 3ABIA 3QLJA 5E6SB 4BYMA 1BA2A 4KAJA 3KJXA 5KAPA 5BO5A 1NXTA 2DJ5A 2N75A 5K2MA 4CGZA 1LY1A 1S8FA 3LLSA 1NVUQ 1OA1A 1LSOA 2WIJA 5JLJA 1ICEA 1C0KA 2P4HX 4FLFA 2GBLA 4TMVA 3FOZA 2DKNA 2H1RA 1B2LA 1E9EA 4DR7B 1UZNA 1OZHA 3ND8A 2Q6TA 1W88B 4ITVA 4TKMA 3ZLTA 1NN0A 1OXMA 1RJGA 1SVMA 3M6XA 2HF7A 1RQ2A 1H2BA 2GCOA 3I92A 3LLUA 1TB4A 1CEXA 1CUZA 1Y33E 2WJJA 4L15A 3FLAA 3L4BA 1RR6A 2BE7A 4JJAA 3UCEA 1JEEA 3K8OE 1N6PA 1RYMA 2HRRA 1Y5MA 3N86A 3PGLA 1E2NA 1RNLA 5DIFA 1CUGA 5EZSA 1DG1G 1KQPA 3A4YA 4I55A 2XD9A 5JJ5A 1NJ6A 3GJZA 4UNNA 3KSZO 5BRAA 1TK3A 1OFVA 1YIAA 1J99A 5T64A 1JXQA 3CX6A 4HRXA 3X1MA 3H4IA 4GM0A 4HVLA 1S2GA 3OX3A 5C8YF 2VYFA 5K0GA 1JDUA 3RV3A 1OT3A 4TTQA 4G1BA 3WDLA 3FTPA 1IUNA 3CW8X 3L7IA 2Z5VA 2H4XA 1HA3A 2BTQA 3C4VA 4FOTA 4K9LA 1H3EA 3PLAE 2QD5A 5AKGA 4A8JC 4ZDJA 5JJIA 2W2KB 1JVNA 3N2EA 4Y6RA 5CB4A 5JSHA 3SVLA 1A77A 1LSSA 3KB8A 4OAQA 5FEMA 3T7KA 3JQ7B 3I2JA 2WFZA 3VNUA 4Y2GA 2F8MA 2QR2A 3O1JC 4GEGA 2HT6A 2YFYA 4JJFA 1PSWA 2IT1A 3B9RA 2BN4A 2HADA 1DKQA 3K6JA 4XJXA 5F2EA 2IHJA 4R40A 1SK9A 4D0SA 1FFYA 1Z6ZA 5THXA 2ZCUA 2Q5FA 4GBED 1XL1A 4CNQA 1ADBA 3QKSB 2EFGA 2B1RA 2Q6IA 1XZDA 1U8AA 1VIDA 1XEXB 5F64A 1GNTA 4YQYA 5KSPA 3JQRA 4HFMA 2QRHA 3ZI0A 4Z4CA 3SQWA 3NBUA 1E2UA 2IL1A 4BEJA 1DV2A 2H2HA 3AKDA 1XMJA 4YRPA 3QY0A 4BIMA 1ADYA 2YZGA 2Y0DA 2FF7A 4D97A 3Q8LA 2AS0A 1KSGA 3ISTA 4V38A 3DP7A 1R15A 3PHBE 4ICIA 1O58A 3ODGA 2VUTA 3OD1A 4GM1A 2BLNA 4JP5A 3PEWA 4YT2A 2Z5GA 4DQVA 3TB4A 3AZQA 5CB4F 3MGCA 4RDHA 4CW7A 2O57A 3QK7A 5ITZB 2QRVA 1IHPA 1QNLA 4B84A 3WGQA 5AHRA 1Z82A 4AECA 1PJAA 2M98A 4HAXA 4G0VA 1AY0A 3LA6A 3QGMA 3Q7RA 3HKCB 4HMOA 3HC7A 3ESQA 1SUBA 1T8UA 1LPMA 4XYBA 3SLKA 3ZWQA 8OHMA 5CEFA 1JH9A 5IC5A 4RVDA 1IPFA 4K9KA 4M21A 5B6IA 5L7TA 4PG4A 2JZNA 4RZXA 2H54A 2VDJA 1L8XA 5JADA 5CMLA 5B4UA 1BHQ1 2B3TA 4LG1A 5DNWA 3QBJA 1J2UA 2O0LA 1XTPA 3K7EA 1EXMA 3LK6A 3DPSA 1W1IA 3LO5A 4Q9LA 3IP8A 3MB8A 4HZUA 1HT1E 2OM6A 3TRKA 5F7ZA 2JGEA 1A2BA 3MCTA 1PJ3A 3DR3A 1UK8A 4EI8A 2FPMA 1Y7IA 2G07A 1RYFA 2PKYX 2GFHA 1HFWA 2WI8A 3AIOA 3WGJA 1P81A 1MXHA 4DMCA 4HLNA 3EGDA 5ENVA 3KSBC 3PEEA 1KJYA 1OGIA 2OCBA 4O08A 2X42A 4D98A 2GB4A 2D3TA 1U4NA 2RH8A 3OFND 3PPXA 4Y2XA 2FQ1A 4P4GA 4YRCA 1BU8A 3EJWA 2CSXA 3DJFA 5B3AA 3TYXA 3E1GA 2A14A 2G08A 4DDVA 1JEQB 1KY5A 1OJ7A 1H0SA 3DC7A 3LUHA 3NO4A 3IQIX 1L3IA 2J9ZB 2NZ8A 4AZTA 4NBNA 1ZOLA 2A8YA 1BJKA 1N0UA 4QYMA 3H5TA 4KIFA 1OFGA 2X5XA 4OHPA 1XMQB 3LC7O 2PRZA 4MARA 3IP6A 1G2QA 2P35A 1M0TA 4KLAA 3SOPA 2MR5A 5JNRA 6ADHA 1V3TA 3RC8A 3BXFA 1ST2A 1VHLA 1O8BA 2JHCA 2ZROA 3THRA 1CR6A 1WVMA 4ETIA 4WNYA 5HYVA 4JC8A 1KK1A 2KYRA 4ZQHA 3EK2A 2M9MA 4BNWA 1V5WA 4JZYA 1YU6A 2CNWA 3PE6A 4K81B 1E5DA 3LZ6A 4LXUA 5DI3A 3L8ZA 1D7OA 5C31A 4XEUA 1FTWA 4GQBA 4UM9B 1YS1X 2HWUA 1Y5RA 2H92A 3RABA 1JG1A 2IBSA 1PT5A 3OJEA 3I53A 4K6KA 4EDHA 4E5YA 4ZAZA 4IJ5A 1FP2A 1C4WA 3AY7A 1FDSA 3K20A 3K6RA 1N2CA 1JG7A 3F6YA 3QPUA 4ME6A 1CWUA 1G0NA 2BW0A 1CC1S 2Y4NA 1SBNE 3AVPA 3GCDA 4ZU1X 1IN5A 5JWRA 2EJBA 2PTHA 5BYJA 5IBPA 1S4MA 4MWOA 1E2FA 3EIFA 4X71A 2X0NA 2W2XA 3HCAA 3OT1A 3RROA 3ZJ5A 3U1BA 1LLFA 1B43A 5LZ4A 4MW6A 1TU0A 4ZCQA 1F2UB 4EW1A 1RJ9B 3PNVA 4ARAA 3PEVA 4TYPA 4WXMA 4LDPA 1DQZA 1GQOA 3CPJB 1J09A 4JLNA 4JSTA 3IBCA 5E1OA 4GWGA 4QC2A 3U2QA 4IJKA 1U04A 4EX6A 4ZQFA 1OILA 3CRNA 4XCQA 2A59A 621PA 3O6VA 1O96B 4HGYA 5F21A 2ZYDA 3UJ3X 1U7HA 5FB3A 1BE6A 2XTJA 1JIQA 3FY4A 1YRHA 2FFQA 2FPUA 3JPYA 4H7JA 2BUBA 1SKAA 4K8OA 2GDJA 3A3KA 3RYIB 3UWDA 4TXMA 2VIIA 4MEAA 3ZVLA 4BFVA 4L9SA 1H6AA 3LMKA 4L3WA 5LDGA 1ESCA 4JL6A 3NHFA 4U9UA 3DL2A 1IWBB 2OCKA 2ZAOA 2D0OB 1IQPA 1PYOA 2CCKA 4W7SA 5IAJA 4EI9A 2NZ2A 4KAAA 3KSAC 4LSGA 1LSJA 5CFRA 2APJA 4UU0A 5H5JA 5JYBA 1I5OA 4XIIA 1YZVA 3FWYA 1WHTA 5F9FA 1B8VA 2JK1A 1YQXA 1YHNA 5C8YB 3PXCX 4AULA 5KI6A 3C3YA 5DSTA 3HACA 3U7JA 4WLVA 4G1MB 5EHIA 3V4PB 4KPYA 4P0PB 1EVQA 1OD6A 2D8AA 1Z68A 2J32A 1D04A 1M8PA 4ZO6A 2QY9A 5GONA 4GT1A 1TQ4A 2HDWA 2NO9A 2PX3A 1DBIA 3DGEC 1BAPA 2I1VB 2R1TA 3PXAA 4KFTA 3E8XA 5FAKA 2R68A 1V37A 2W48A 3N2ZB 4BTLA 4EKGA 5DMHA 2IOFK 2ESRA 1UBTS 2HRDA 2VPZA 3EFEA 1RBMA 3F6SA 2P68A 2R8RA 3E23A 4YFVA 2B35A 3VGPA 1FA9A 3OCJA 4G0MA 2PQ6A 1F0KA 3HG7A 2HK7A 4UDOA 1WNFA 5A0TA 4GH5A 4DMLA 3AHJA 4BP9A 3WWOA 1FLVA 1FNSA 5IC4A 1NW9B 1SJ9A 3QUQA 1DPGA 5T67A 4ZCTA 1GEEA 5CLJA 5SZIA 1H8ED 2Q99A 3C7KA 3M2PA 1KQNA 3ZTWA 3UMFA 2BMEA 2QUJA 3NT5A 4C7OA 4LX8A 2OCLA 1XVVA 1X2BA 1ZINA 5HFAA 4PONA 1ORVA 4FBLA 2BGUA 4D9CA 5JSKA 5CB4B 1KDTA 2Z30A 1MX1A 3TSWA 2ZRAA 2EKBA 4GX2A 4I7EA 4CIWA 3EARA 2PUCA 1TQ8A 1KY2A 2VQDA 3Q7TA 4WDRA 4BV3A 3OLXA 2NU9A 1HT2E 3NHZA 1RW4A 2VHVA 1Z25A 1P77A 3QVGA 4NPHA 5K09A 5L3VA 4ZKEA 2CD7A 4IDEA 1R12A 4L7VA 1AGXA 1MPXA 1YR9A 2EWMA 5C18A 3H2JA 3AF0A 1PGPA 3IQFA 3LNTA 2PZLA 5IXSA 3VR6H 1WHSB 3QM1A 3W05A 3AP1A 5EEGA 4QLBA 1A69A 1X7ZA 3IAFA 2ID4A 3FBGA 4RPHA 3ZXIA 1U3UA 2C95A 4AY3A 4BNXA 2ZUCA 2CWWA 2O8CB 5D87A 3T9DA 2N1BA 2I55A 3EA0A 4U63A 2QT9A 2ZRMA 2VF7A 3GLSA 3DBOB 4FUTA 1W4ZA 4WLOA 2OFXA 3L7NA 1EBBA 2I0FA 2I9PA 3TTWA 2QSYA 5D85A 5J47A 2UUCB 1KI8A 2ECFA 2F90A 1CRQA 3OD5A 2Q7XA 4BO1A 1IBCA 3IAAA 2QQFA 3NKVA 1MB0A 1XTJA 3FCOA 2P2SA 3D2CA 5AK4A 1PQWA 2PLNA 1JLLB 1R0CA 4NICA 1DT3A 1SWVA 1P60A 1CUHA 1VE1A 2VSFA 3OKPA 1Y7LA 5U4XA 5B58T 5G4LA 3DZDA 2PUJA 2HWWA 1UPUA 2QRPA 3C74A 3L8HA 3KT6A 2C4MA 4LYDA 2FK8A 4MV5A 5CK4A 3CNHA 4BWVA 2AFHB 1LS6A 5H68A 4HLCA 2XMBA 4I9GA 4S04A 4IQGA 3AOGA 1EWRA 3F2VA 4JROA 2QP4A 3TTYA 2ZBDA 2NZXA 3F3MA 3HJHA 4FOOA 4PLZA 1KEPA 3HMQA 5EI5A 4XGNA 1TEVA 4DMMA 3DYVA 1JDZA 1CULC 3LX4A 2BSQA 2ZEJA 3QJYA 5LZ5A 1RP7A 3EXIB 4W5JA 1JAYA 3VKWA 2B5OA 5JAPA 3JVVA 1WVGA 4G1FA 1WUTA 1L9KA 2NLOA 4L5IA 3CXRA 2PU5A 2OLKA 3NU1A 3TQRA 4ER0A 3DQQA 1WXHA 4Z0HO 1A9XA 4MUGA 1ZQ1A 4WBNF 1XA3A 3NGMA 3C85A 1E63A 5EJ2A 5KJCA 1S96A 4WACA 1TJ3A 2O2GA 1JSXA 2CCJA 1SPBS 1NMXA 2HD4A 1F9EA 2FZVA 4G5HA 4Z0NA 3DP9A 3EGDB 5LIRA 1OXKB 4JI3B 4C3UA 3GYGA 4FYWA 1H1TA 3PRHA 1RMTA 3R8XA 1OWOA 3RNLA 3ROQA 2CJWA 4E94A 3HNRA 3I1IA 1EK1A 3HA5A 2QV7A 3NUGA 3PQFA 5TY0A 1EDZA 3FSJX 2CXUA 4ISCA 4JQOA 1XCPA 5KTSA 4OQ4A 3WJ2A 4FYVA 3K6SA 4TZ0A 2AI1A 3KLOA 4Q03A 3DVRX 2VBGA 1JA1A 4MXDA 1T29A 2JIOA 2E5LB 2QM8A 2V54A 2IFTA 2CNOA 4JSYA 1DKUA 3W8NA 3CRMA 3GNQA 4BQRA 2O3RA 3PTLA 1GKKA 1NBIA 3HPQA 1AOXA 2QNBA 1Y9ZA 3G7UA 4I4TA 2I8AA 4HWOA 5EXDA 3SDZA 3W5UA 1SVSA 3ZZNA 3DFUA 3GQBB 1F7VA 4ZVRA 1DXQA 1EVKA 4NFYA 2PA3A 2XUFA 2EJUA 1P1KA 3OZXA 1TIKA 2WG1A 5AVZA 3ABRB 5KHOC 1N2ZA 2R4QA 3EY9A 4EGSA 4C88A 4ZV4A 5KOJA 2OG1A 4LECA 4CTKA 1WEKA 1W73A 3EW9A 4MUYA 1EKXA 2RONA 4Q9DA 5DI3B 5SYAA 3VHLB 3B1FA 1HEIA 1XCBA 4EJFA 5T5QA 1I13A 4LDJA 2ZUVA 3BB4A 4LPKA 1ISFA 2C4WA 2VZ8A 3OZUA 4IDFA 1MB9A 1O95C 4NC9A 4URXR 5JOQA 3RU2A 2R8BA 2R87A 1N2CB 4LZNA 4D4JA 1NPYA 4RNCA 2ZYSA 5BSHA 4IIDA 3FMOB 3R41A 3ICWA 5EQDA 5KSZA 1Q19A 5EMJA 3UQYS 5F33A 1NJFA 2ENWA 4MR9A 5A4KA 4UUNA 1EX7A 1E4VA 2UVPA 3DOUA 4I4TF 4IV0A 4N01A 5KTOA 4DIOA 1R00A 8MHTA 5ICEA 2AJTA 2DETA 1X8JA 2JKYA 3KWFA 5JS2A 5LJLA 4XSHA 1QZUA 1IVYA 4XI9A 4ZIRB 4CETA 4MA0A 4ESVA 3A2NA 4DIEA 5KTRA 3USZA 4OMFG 4OB6A 2IYUA 4D9HA 5FEUA 2MU1A 3OZFA 3CN9A 3VZCA 4BUZA 3IFSA 3CH5A 5JEEA 3K9NA 1CQZA 1H2YA 1XWIA 1G8PA 1W49A 3ZX4A 4N7RA 4BKUA 3EB9A 1GO2A 5AI0A 3RT7A 1JMYA 2LZ0A 2B94A 5HUQA 1CNEA 4LVUA 3TXAA 4IEFB 1F8UA 2WD9A 3ZVKA 1A8UA 2VT2A 3D6MA 1M2WA 3HFJA 1YJ8A 4QSHA 2ZP1A 5TRTA 3UKDA 1VBNA 3KVVA 3E82A 5T4EA 4PINA 1PW7A 1ZNQO 3PQDA 2Z4SA 1L5QA 4G5OA 1CLUA 2WHPB 3ZJUA 3A9TA 4GOJA 3D4PA 4QXAA 2NUAB 4LFAB 3P9QA 2FEPA 4BVGA 4R16A 3UXEA 1QTQA 2F17A 4JMLA 1M2JA 3KJQA 3V9PA 1Z4LA 3ULKA 2BJWA 3AF1A 3QQ5A 2N47A 3EZLA 4I50A 5BW4A 1RBZA 3ORFA 3QU2A 1U0NA 3LQ2A 5KYVA 1P5FA 1TNDA 3NW9A 4G8CA 1F51E 2E89A 3EWNA 3OSZA 1IULA 1TFRA 4IDQA 1TU4A 3FJOA 1NUAA 5C5IA 2WIGA 2O06A 3C6ZA 4B74A 3AHFA 3K0SA 3G8YA 2GPAA 5EIBC 4PX2A 3DFFA 1EWKA 4YAJA 4EEZA 3ZUPA 1ZQ9A 4Z9YA 3DDUA 1N57A 3WADA 4ENVA 1PK8A 2XE7A 4YUWA 3G85A 3S81A 4JOBA 5JAMA 1K2WA 4PAQA 4QDJA 2CHUA 4B3DA 5CDSA 3HBMA 1KP9A 3CZ5A 3TH5A 5TMPA 2FSHA 4H3KB 4KGVA 3WRXC 4I1UA 1KI6A 1CRPA 3JQBA 2ZZKA 3ERCA 2B7LA 1ZXBA 2GBGA 2XMRA 1AURA 3C3DA 1JP7A 1KI1A 5B36A 5L9AA 4KSCA 4RBNA 3KEGA 4DT1A 1K8QA 4HNVA 2VWPA 5D00A 4BBAA 4WCFA 2ZJ2A 4RIIA 5FBZA 1NQTA 2EDAA 3UB2A 4H7KA 2PH7A 2YRXA 3ZXSA 6GPBA 4XFDA 1DCTA 2CXSA 4MIOA 4R9NA 4TVKA 4EGQA 5LQDA 5EKXA 1MHTA 4OBWA 2OPHA 5DM70 3DC2A 4C7OB 1WV1A 2Q3LA 4WUVA 2BKXA 1U7XA 3EA5A 4L8WB 2XBUA 3BH0A 4LDZA 4LYAA 3BB3A 1JLKA 3W5HA 1HOXA 1UBJS 2AWNA 1IAQA 5DTEA 3U4QA 3IMGA 3GFFA 1C1DB 3EEQA 4ABTA 1I6WA 1X0VA 2BGIA 2G5PA 1SGWA 3UJBA 4P3PA 3QVGB 1BDJA 1TUGA 2AK3A 4PNPA 5BQXA 2JLZA 2OQ2A 3T7DA 1HNZB 4HNHA 4K87A 2OFOA 1PGJA 3IQGX 2Z09A 4RENA 3VZPA 4EB8A 4F12A 5KDOA 3AHCA 1NF8A 1X8KA 2O7NA 3E9RA 1Z6QA 3FKSA 3P27A 3Q8XB 2VRBA 5IAKA 5TEVA 2IHNA 1N7JA 2PU7A 1G8KA 4FSHA 4YV2A 4HDMA 2QX9A 1Y3FE 4BMCA 1FDUA 3ELBA 3MELA 4JLMA 3KBOA 2LD4A 2VPPA 1DS6A 3B85A 3LUJA 4PXYA 4J4BA 1VM6A 1B76A 3OWHA 4F3RA 1XZQA 4MI9A 4R2JA 1CFJA 1TZMA 4WBNB 1UBNA 1MEJA 2IHZA 4QBIA 3ZY4A 1L7RA 5FL7D 1UDWA 3PZBA 1C1YA 3SYTA 1SUFA 1TCUA 2AFIE 2NXEA 3OZIA 4L2IA 1TMYA 3MJFA 1B6SA 2BH9A 4Q1EA 3D8BA 2VHJA 1BXGB 3MHTA 4RHEA 1WW3A 2ZS8A 1PNQA 1QGED 2ZB7A 3DUFB 1OXTA 4QECA 4IGEA 5F98A 3OPXA 1LBEA 4G07A 2A3RA 2VAVA 3MNFA 3O83A 4K2AA 4JLSA 3VPSA 4B9EA 4DV7B 2C88A 3AF5A 1X7WA 3ZBQA 3LDFA 2SECE 2OY0A 1ZLXA 3R23A 4MLCA 3ZHXA 2GM5A 3BTSA 4HDOB 3MB5A 4FILA 1OLSB 1W75A 4HNAA 1THTA 3PDJA 3PIDA 1Z6YA 4WAUA 1ZVKA 4QU0A 2XWQA 3OA2A 2ASVA 3GDWA 1SBYA 2F3RA 4HPWA 2DPMA 5ALSA 3BICA 3U7GA 3TD9A 1AXGA 1VRVA 4BQIA 3MT8A 3OG9A 3E35A 4LHXA 3V9AA 3BZBA 1A9XB 4PFKA 4C7VA 4Q9AA 1RI4A 2B1QA 4WXRA 3SE7A 4FGZA 2HCRA 4U7TB 2WP0A 1RHMA 4CF6A 5JPCA 3BMXA 1NDQA 2L82A 2QTVA 4DUGA 5T4BA 1M6HA 5MGBA 4GGMX 1ATZA 2IPAB 4BQNA 1K4KA 4QDZA 4PLCA 2PIAA 2YY6A 4RESA 3UQZA 4PQFA 1FFGA 5KMGB 4YMVA 1QRAA 1WA5A 4Z4FA 4JD5A 1KR2A 2QQ5A 3A1VA 1YE3A 3L7JA 3Q7PA 2A9QA 4IQ4A 3RVKA 3WMEA 3K6SB 3H6GA 2Q62A 1D4AA 1QX3A 4KDEA 4ZOCA 3M7IA 1PZGA 1CZUA 1H3FA 5TPZA 1N8SA 1R6AA 1P3JA 2P69A 1ZN7A 1LRLA 2W43A 2W4IA 4OU4A 3UEOA 1TYZA 2C4KA 4JHXA 4Q7MB 2NN3C 3PX7A 3K94A 3FTFA 3KE9A 5GJVC 5CLGA 4I4TB 1PG5A 3SCZA 1OB2A 2WJGA 1WZNA 3CKMA 3H1AA 2AQIA 3NC4A 4KBGA 5BQ5A 1VL2A 1JU3A 1Q12A 1QHEA 1BCSA 2BF7A 2WE8A 2IH2A 4V1CA 3NDRA 5DISB 1HFKA 4EFDA 5KOJB 2QM0A 3ZGLA 1EFAA 2GKSA 1QIJA 4EH1A 2PD6A 1B0UA 3O93A 1U31A 1SQFA 5CTJA 4YMWA 3AEUA 3CNBA 3ZW7A 4ZALA 1SC6A 2B5VA 5ULLA 1TAHA 1BH2A 1RAIA 4UU8A 2FWBA 3RREA 3ND5A 1K86A 1MMFB 4A82A 4DA8A 2XE4A 2REOA 5HIJA 3S1AA 4RIEA 2VQSA 4ZHQA 3OOJA 3D6AA 4OLFA 1J0CA 1E7MA 3DHNA 5LBTA 4DYHA 4U02A 3WIDA 4ZYXA 3ZR4B 2IYPA 1EE2A 4K9MA 1CY4A 2D2EA 3QE9Y 1KZYC 2D7CA 4RSGA 4RIFA 5FPPA 4C9BA 1JJFA 5CBKA 3GLFA 3X1JA 3NMUF 3C7CB 3FZEA 4IDBA 1XXHE 3H2HA 3LJKA 3TGLA 3ACBA 4E2WA 3TDKA 5GTDA 5HRUA 5ARCA 1RC0A 4PM4A 4TMFA 4WL0A 3V2HA 1BFUA 2RAFA 3K1TA 3DD1A 1PQUA 2REBA 5C32A 1BVYF 2EKLA 3GLHA 4NYJR 1OZ0A 5TPWB 1OH7A 4JUFA 2R8XA 4PLHA 5TGTA 2VYNA 3HL0A 2YJ4A 1TGVA 5K3BA 3TPCA 1N9GB 5I7HA 1VMIA 2H4YA 3CC8A 4UD2A 1YONA 1RXIA 2FHPA 3MMZA 4UUAA 4F5EA 5CD9A 1DBQA 1BRMA 2QN8A 5DCLA 1GPUA 1Z16A 3I37X 5K3AA 1ULBA 5AW9A 3RYFB 4BWYA 4DCCA 1KQFA 4G0WA 3QWBA 3MPOA 4U6SA 1AE1A 3B1YA 2UXCB 2P1DA 5EEHA 1C50A 4QVKA 2PKWA 2DUMA 2WIAA 3K9QO 4D02A 2DYKA 4J0GA 4DV1B 3OZBA 1TVCA 4ZHQF 3KXPA 3OP1A 5FV4A 1B6TA 3IQDB 1XD8A 4B40A 3LF1A 2PG3A 1T0PA 1NTRA 3G2KA 4HY3A 4D56A 4IIJA 2HA7A 2PRIA 3GIDA 2JG3A 1Z0UA 3X0DA 2VL7A 4A2WA 2G1JA 4MVJG 1FTYA 1VL6A 4NONA 1E62A 1TPYA 4HRAA 1WR8A 5E9QA 3PE4A 4D9JA 2NPFA 2WWTA 1P80A 4S24A 1P2SA 1XBTA 1ODSA 2YXPX 1UKAA 4NZOA 3THYB 3QWAA 4LGVA 4PZ0A 3RSOA 2DB3A 3TEJA 3TTXA 2LBPA 2P0EA 3OTWA 3PC3A 5E8RA 1UP4A 1OU4A 1R8XA 3ED1A 5TQ0A 3KT3A 3K71B 1CJVC 2CNKA 1YA6A 2GCNA 1C8BA 1PR2A 5FWXA 2EL9A 1M9NA 3ZD9A 3GJ0A 3CWZA 2X6TA 5AIBA 4P38A 3MQFA 1GKLA 4LJLA 4CDRA 2EP7A 3VHXA 2XADA 3NWEA 4BZWA 4EVIA 1ZAYA 2WJYA 1LC0A 2WUFA 1YFZA 1MFPA 3HCNA 3MTEA 3RRJA 4E03A 1PG0A 3PEYA 1WE2A 1XZHA 1T9CA 1JI3A 2ON6A 1BJTA 2QTWB 3AZPA 3ZCTA 1S2NA 4P54A 4FFPA 4UTRA 4BUJA 3VX3A 5ECDA 4QQRA 3V6LA 4B6RA 2HJGA 4I1SA 4RM3A 2COKA 3TQSA 1MC1A 2GRUA 2RGBA 3G0CA 5JY6A 3A9UA 2C98A 2GKOA 3DZGA 2JAXA 5KJ6A 4YY3B 5KWIA 2B4KA 3M6UA 1F7UA 2E49A 2WF9A 3BCUA 3R4VA 3X1YA 1FZTA 2Y93A 5A7HA 1Z4IA 3D0QA 4N1AA 2H57A 1OQAA 2OPBA 2IPMA 1OI3A 3HDJA 2FFHA 1MJ5A 4OJTA 3M1IA 3ON5A 1KS9A 4PPYA 4DMUB 5EHZA 3VBEA 1EWTA 3KAPA 3M4YA 2XUKA 2IUSA 4JA0A 1IN1A 2MSKA 2BFNA 3KZVA 2IP1A 4ZJUA 2PBFA 2QVYX 4YALA 3DFKA 3KZNA 1NPDA 3HI4A 4AMVA 3LT2A 4QVIA 2OGSA 1MB4A 2HB6A 2HQ1A 5CPBA 1WOYA 3T3IA 1RWPA 3DWFA 4OV6B 1BG6A 1Y6RA 2WSMA 4A16A 5JDIC 4P6VF 1UMDB 3U19A 3FFTA 4ESHA 1IIRA 2PMCA 3B9QA 3MOIA 4DNQA 3UHAA 2DGDA 3AFGA 4JUIA 4OK5A 4BLWA 3RTAA 4P8RA 2PZJA 2V6MA 1GZHB 1BFDA 3OZAA 3ER8A 1XZ8A 3LP8A 3EASA 1U98A 4FFOA 5CUQA 1M6YA 3DZKA 3FOWA 4KXQA 4AY2A 1JWBB 1F2TA 2EGHA 1CU1A 1RWWA 3GCXA 2XB4A 3WDSA 2QVXX 4L2IB 3PGKA 3VYSB 1MVNA 2QLMA 1SXIA 2V7EA 2CV1A 5LWHA 2O8BB 4YK7A 4MQBA 3GY0A 1TCBA 3C3WA 4YB8A 5DGTA 3NNNA 4EBBA 4CMEC 1FUEA 4CM1A 2C2BA 2OESA 5KTYA 4KXXA 1LXCA 2E21A 3CH4B 2BZ0A 3VR6D 1XRPA 2CJYA 1S3FA 3P1JA 1EP1B 3ZUGA 1N6NA 1C1HA 1QIHA 1OX5A 4EJ2A 3JQAD 3HP1A 1AMUA 4YI5A 6ABPA 4Q4JB 1V1RA 3JQ6A 1XEAA 3N0RA 4GZ6A 4MB0A 2DLDA 4Y2YA 4JQYA 4Y98A 4A36A 3WBKA 4MQEA 4EB6A 4NI5A 1WNTA 4DYDA 1BC5A 3QE4A 4IH1A 3AHGA 5ALUA 1HL3A 4AJ9A 1Z6GA 2JA1A 3E2PA 1RYHA 3WDMA 4QJ3A 1NASA 1WU8A 2YNMA 1VRWA 2J3KA 3R77A 2YZMA 5HSGA 1XDZA 4YRZA 1V5EA 3K70D 3G0BA 3N53A 1GYRA 2ZRJA 1KAHA 3TFQA 4RZQA 2NACA 4UTNA 1VYTA 2C7GA 2PVSA 3HXLA 3FLMA 4YHBA 4N5MA 3IKTA 3DXXA 2NUBA 1X1QA 2ONYA 2YJ3A 2Z4TA 3B20A 4PX3A 3CT6A 4WKNA 4E5MA 4EMSA 3UJ8A 3NDPA 2CYBA 2QAGA 4NAUA 4PXSA 4B31A 5FJJA 3OZCA 1JKXA 3LD9A 4MUBA 3ABSB 2LKCA 1UH5A 4JBIA 4TKUB 4FI3F 1QG6A 4UFOA 1CZLA 4N8EA 4Z0TA 1IONA 2WB4A 1Z6AA 1KC3A 5JSYA 1QE3A 3IIMA 3MBKA 1FXWA 4NRDA 4QDKA 3NT4A 5AM4A 5I9SA 2JLCA 4JXXA 3D02A 1SVIA 2I3BA 2X0FA 1FFAA 2P5SA 3BSYA 3ZU5A 4BO6A 2J0SA 4FEAA 3OTOB 3JQGB 3HE3A 3QBVA 3ZDZB 4GZLA 4KV7A 1WCYA 2GJKA 4UBMA 4EI7A 1KTIA 3B3AA 3PC2A 3HXQA 3ZZTA 1P1JA 1X1AA 3GEEA 3CEAA 3ZJ4A 3IODA 1BX0A 1V7ZA 1Z7BA 3CLSD 4QFDA 1VJCA 3AEUB 4WLEA 2ORVA 2VHXA 5AK6A 3EAQA 4L02A 4IPTA 5DGCA 3QLUC 5BSUA 1SKYE 2PWPA 1Y7HA 2JHAA 4M1ZA 4ZOEA 2VNSA 4DA0A 1MTZA 2DWOA 10MHA 1P1FA 4D45A 1YMQA 1E9SA 2IYQA 4W5WA 2A86A 4ZHQB 3AL0C 1WCIB 1N32B 3QF4A 3H11A 4MGKR 1R10A 3P9KA 5L3SA 4R2KA 3PRKE 4CTJA 1N7IA 1V3UA 2DPHA 2V6GA 3QVVA 2DTEA 1M7BA 2ADFA 2XT0A 4FYXA 4LF4B 3A31A 3GLFB 1PWHA 1QO9A 3RIYA 1O0CA 2Y9MB 3BIWA 3WQHA 4BYGA 3VKHA 3HFRA 2VK2A 3GJ6A 2RAVA 3DQZA 3INRA 3WLKX 2OBNA 1NW4A 3NJ4A 3RARA 5A4IS 1FSSA 3HY4A 4FFLA 4LTMA 3A6EA 3IALA 1G0OA 4D0LB 3M5WA 2YKGA 3G6WA 2ZIVB 3GLHB 3UHOA 5CNMA 3NS7A 3IOEA 1LNSA 4RD6A 4WESB 1N4AA 2ONCA 1Y5NA 3GZ4A 4DDHA 4KW7A 2E4YA 4HGQA 3VSAA 4DL9A 5F3WB 2JH3A 4UM8B 1Y1PA 2O48X 4CKWB 2XWBF 2XT6A 2H7YA 3AUFA 4HL6A 4C0AC 4JVNA 3B7PA 1BCRA 1ZONA 2DR3A 2NXCA 4MW7A 2ORIA 4P4NA 3ZV4A 4ZI7B 1QTNA 1R50A 4FSDA 4YUAA 1USGA 3N59A 5BW5A 1SHLA 1H05A 2D54A 5HKOA 2QENA 1RE0A 1WQ3A 4JFAA 2FMUA 2OBLA 3HZRA 4M9QA 3IX7A 3SM9A 4AJOA 3NEPX 1GKIA 2G9NA 1PVOA 2GN0A 3TQCA 1GZSA 3PHLA 3MZ0A 4MGHA 4MQUA 4U3JB 4BS9A 2SICE 4IIXA 1M72A 3UPUA 1JHAA 1DCMA 3OH8A 3OKFA 4PTZA 3S2UA 3KYBA 4FCTA 3EIQA 1I6MA 3EQ2A 3NIWA 4RLFA 1WLSA 1M1YA 4OHBA 3ZG6A 1VG8A 3OCYA 4M53A 4OGGA 1Q17A 4LXYA 1H5QA 5HNKA 2ZK7A 1R0KA 1UP7A 4PYJA 2FUNB 1Z7WA 3DAOA 1ZNZA 3QE3A 3QPDA 1Y6ZA 5KKNB 1UK9A 3IKMB 1Z2EA 4Z7JA 1C2YA 1NUSA 3I0ZA 3OIVA 3QVKA 3UOWA 4CV0A 4QXRA 3QEBZ 5SY6A 5FI1B 5TQ0B 3QY9A 1T5OA 2J6IA 4QNNA 2Z08A 1QRTA 4LPSA 5CM2Z 5JNTA 2UXDB 1OROA 3VHXB 4RF5A 1WF3A 3GJ5A 4RANA 1E0DA 4O1MA 2B78A 1EFPB 4E2ZA 1YR1A 4FR0A 4O4JF 5FTNA 4KVZA 4LZLA 3NWBA 3I4CA 5TMDA 1ISPA 5EHNA 3DS8A 3L7YA 5B12A 2UZ1B 3ROKA 5KJFA 2FZKA 1I3NA 3KVRA 2YASA 4L4RA 4MINA 2CXHA 1P4SA 2QN9A 5CHYA 3VTAA 4IW3B 3TG8A 1Z5GA 3WBJA 1IM8A 1U7TA 3JPWA 2Z8YM 2ZYGA 2KMLA 4XFJA 5CGZA 5FTJA 1NHWA 3Q7QA 2R5WA 2EV9A 2H0RA 3I05A 2GCGA 4J0FA 5EQJB 2BWJA 1BS9A 2AOWA 2ECKA 1FFEA 3NAMA 4EOGA 3F71A 1WB9A 1FPMA 4HB4A 1B26A 2VJOA 5EMKA 1EUYA 3D3WA 5L3ZA 5I7VA 3B8HA 3IAM6 4OB8A 1LV7A 1EA7A 1DXYA 2WJWA 2XQFA 5F5LA 4ER5A 3C7TA 2QG9A 2YW9A 5AD1A 2R7MA 3LC0A 1Y8AA 4BVLA 3SSAA 3DV0A 3GPBA 3FMPB 2EAUA 4TTPA 4KXWA 1AA6A 3MS7A 4I0WB 5IM4A 4TYMA 3VPFA 1Q7TA 1EFKA 4PYQA 2VSNA 2PS0A 2YJGA 3OFJA 1XMVA 2P4SA 4JT9A 1QHHA 2F3UA 3E7WA 3Q9LA 4C03A 1Z5PA 3FROA 2PLAA 2FZ4A 2WAMA 4BCCA 4MR8A 3N0XA 3QVMA 4PLTA 1N5JA 1NP7A 3DJYA 3OQ6A 3ZJYA 4HMPA 3CRQA 2V7QA 3D81A 3VNBA 1H9BA 4AJPA 1F2TB 1GG5A 2PL1A 4ZVOA 4M8NE 5KQPA 4R71A 2EFDB 1SMKA 3BDVA 4LSWA 3ZNOA 4AKIA 4LV5B 5HOEA 1ND5A 2C07A 4UVIA 1XTQA 4W9NA 2X22A 2GD0A 3HK2A 2UZ4A 3FPJA 3JYOA 1M2GA 1J7KA 2EF0A 4ZV7A 2IIQA 2YYZA 1DOHA 1Q84A 2OB1A 4RJ2A 1M34B 1IH8A 2OZPA 2AMLA 3L3BA 1K3UB 1JQAA 4D0GA 3LCUA 3OUZA 4Q3LA 4Q4HB 1J2YA 5TT1A 1ECBA 2CKMA 1G17A 2B2NA 1N3LA 3IO5A 4F4IA 1D1TA 2X0JA 3UGJA 2SCUA 2XX3A 1J0XO 1V47A 4QPZA 5IM4F 3DDNA 4B87A 4MVJP 4LZOA 3N8DA 3IUJA 5F23A 4GYKA 3VUFA 3DEIA 2VO1A 4JYZA 3KETA 1WF6A 3BXHA 1QHYA 3GELA 1RJWA 4U5XA 4ZCLA 4FXOA 4BQFA 4WGFA 3O2NA 2VJAA 4MQEB 4EB6B 1GR1A 1OLUA 2QK4A 3DMTA 3W5CA 1I4DD 1QPBA 2NYRA 3V4FA 3G2LA 4PRZA 4PYNA 3H2KA 1XALA 3TNLA 1MC5A 1NBEA 4WLFA 1VYUA 4BVFA 4RL4A 5EPUA 5IRCD 4FZVA 3ZK8A 2NZYA 4Z7QB 1P4HA 4DC0A 1U8YA 2X8BA 1PFWA 3FPBA 1QCZA 1IZ7A 2WKPA 1Z88A 3T12A 5F5XA 3KAJA 2GBLC 1BZYA 2RKWA 5IWAB 4K0RA 5JNUA 1G38A 1PG2A 5HBRA 5A3QA 3I5YA 4HXEB 1OY1A 1GNRA 1NQAO 5IKPA 3HUUA 4EABA 5EKDA 1I2CA 1KO7A 3Q85A 1QB8A 2CB0A 4W9RA 3ORQA 1Y4AE 3L92A 2O7QA 2X13A 3WGGA 2PX5A 4DY6A 4U7DA 4KH1A 3THYA 4FEYA 1HDEA 4I46A 2ZWPA 5FKJA 1I51A 2VCEA 5CIQA 3S29A 1GFIA 4XVUA 3ET4A 2NSYA 3PGMA 2GEBA 2Q1TA 1I1HA 1BD4A 1LWOA 4JR0A 3GOHA 3FZNA 2J09A 3SBOA 5D1HA 2XZDA 2A9FA 2C42A 1JHRA 3BXPA 2E4AA 1KDVA 1QANA 3VR5D 4QT4A 5HX7A 2UUOA 2DQ4A 4J91A 5G0VA 4KQ9A 3MWYW 5FI5A 2O8EB 4B44A 4CF4A 1C7RA 1JAZA 3PDIB 2R1UA 1O54A 1RLOA 4ROTA 4GGPA 4PHFA 3ELDA 2DHEA 4BO5A 1QPZA 4D25A 4YV0A 5SZHB 3LVBA 3OCWA 5HIAA 3ND6A 3G89A 2H2IA 2AZMA 1E77A 4Q05A 4Y1EA 3OETA 3NRBA 5JO9A 1A7AA 2WFLA 2JHGA 2HRZA 1ISMA 5CX1A 4E30A 1F4LA 1NFRA 3EGEA 1QAMA 5ARBA 4AAYA 1XZMA 4GUDA 5IVPA 4BVAA 1U8EA 3G8CA 2XXBA 2HA4A 3R0JA 3V7FA 2D1TA 1RHKA 1UXJA 2Z1DA 2ZE7A 3BRCA 1Z6PA 2GZ2A 4I2NA 2LP4Y 4B17A 1XVLA 4X6YA 5KYUB 1YTLA 2PV0A 4XGKA 8ADHA 3U5ZB 3ENKA 3HWWA 1HM5A 4TXLA 1W36D 5EERA 1NVGA 3AWDA 4DIUA 3PUKA 2WP8J 1KO1A 1P0PA 3RIGA 2CL6X 4LNHA 3IDAA 2QX7A 1E5TA 4NYMQ 3WK4A 1KKUA 4PCUA 3GAZA 5DWVA 4E07A 1XDSA 5ER6A 4N9WA 4DR6B 5AUPB 1JR2A 1D07A 4P4LA 3U9LA 1EBUA 4LVCA 2H1CA 3D59A 3HB4X 5DXJA 4C2BA 3ICQB 4BC1A 1LJLA 2AF3C 3JAWB 3OA0A 1N4DA 1GGNA 5J5AA 1COWD 1KIAA 2XA9A 1NJ1A 4IFBA 4O4JB 4P7FA 1UAYA 4X84A 2XUPA 1V8PA 3ZD8A 3DMRA 2IU4A 4F3YA 3CZ4A 5AKYA 4U5QA 3BDIA 3Q12A 4BNMA 1TL7C 1XFDA 2FZLA 3CF6R 4GZ3A 4ZMSA 2PZBA 2Q4EA 3ZE0B 1M1YB 4KQ6A 3MJVA 3PT5A 1P2GA 1X2EA 1XQ1A 3KOYA 2DU8A 2G9QA 3THSA 1LNQA 2WU3A 3BCSA 5JARA 1R64A 2I03A 1JHYA 3D8HA 2HUNA 3KU4A 4KVFA 4CL0A 3LHFA 5HFNA 2J30A 4F96A 1Z47A 3DMYA 2HKIA 4ZRDA 2NO6A 3A6LA 3RG2A 2GK7A 4CKBA 2ZUFA 1X80B 3THXA 2JVIA 2P9FA 3BE4A 1WB6A 1F3OA 1VE7A 3FZQA 3W79A 3CZ9A 4F4UA 1QH0A 4M89A 1SAYA 1SUSA 3G0DA 5CNJA 4EQZA 1KNXA 5ALGA 1LBHA 1ZNXA 1OZAA 1R0SA 2QMYA 2R84A 2J67A 1C9JA 4XKJA 1J42A 1SUPA 1HTWA 3PNQA 3H2SA 3O82A 3K9LA 5G4KA 3U40A 2WOJA 2O6LA 4MS3B 1AGYA 4R83A 3TKYA 1GIAA 5CB0A 3QLVC 1P18A 1ZCFA 4L9AA 3KXLA 4Q3EA 3I9OA 3JQFA 3ZWOA 1E1DA 1DTSA 5IJZA 3PYMA 2DXIA 2YY7A 5AKJA 3M3HA 5AMXA 4WGGA 2H1OA 3UICA 1QQTA 2NZVG 4BGUA 2QW1A 4F9GA 4X1KA 2XUQA 2G77B 3CCCA 5DB4A 1QRDA 3NGLA 4BO0A 1EHYA 1EQAA 1W8IA 1YQGA 2GF0A 4H3SA 4BFXA 4G0PA 4RYLA 5JPIA 1BVUA 2FRDC 4LHZA 4E4TA 4LY9A 2WKRA 5M5BA 3LRXA 3FH0A 1UIMA 3QLEA 1JEDA 1TJNA 3D3WB 4NESA 2PGNA 2C4VA 3SFTA 2XHEA 1G6KA 3MGKA 2RAPA 4X1IA 1J2TA 2VZLA 4Z1MD 1RVDA 5AVTA 3BWBA 4UXHA 3DV0B 1OI2A 4MWCA 5DK6A 2PHZA 2I6QA 2A7QA 3VH3A 2NG1A 3GAMA 3AI2A 3L0ZA 4EIWA 3TINA 1SIUA 2C57A 2GPSA 2IHUA 4YMUA 2IDKA 4M9XA 1SU4A 4RSHA 5IJ9A 1MO6A 1UKVY 3BD8A 3JWHA 4QPPA 4RKWA 3SX2A 4BEVA 2ZETA 4NE9A 3IAS1 2NUTA 4F2PA 1XRMA 2ZAIA 3UBMA 2J5XA 4PC1A 4AJ2A 2A2ZA 3ZNQA 1EAMA 2YXEA 3QPWA 2RHOA 3GRKA 1W8DA 3KOWA 4Q9HA 1DJOA 4M0EA 2JJ1D 2YW2A 3ETNA 4GOND 4NS4A 3EPJA 3LFUA 4B76A 2DKFA 1YZLA 1XQ9A 4J4TA 1QHSA 4NXNB 1GCAA 1T9HA 3G9TA 4L07A 4UBJA 5F12A 4MROA 1QF6A 4C89A 2VAPA 3D5EA 3G68A 3LOPA 4YI3A 1UJBA 3EGCA 3KXIA 1MJHA 2VJBA 3LPAA 5M2QA 1G4AE 1J8FA 5DHQA 1F6WA 5K5EA 4TL9A 3BHJA 5C1DA 1GNPA 1A5AB 4WPGA 5LQJA 1MIOA 1H9CA 2NU6A 1YR7A 4RL6A 4EKYA 1W4LA 3DF9A 1LVGA 4J16A 3V00A 4TL8A 1E3DA 1G5QA 2SCUB 2YR0A 3L18A 4K9OA 5K0LA 4EMBA 1NW7A 4D74A 1SQ5A 2AFRA 3WBFA 1ABBA 2A3NA 1EIZA 2RHCA 1U1DA 2ST1A 3SFVA 1JJAA 1EX6A 1RRFA 4P35A 4RLSA 5CR9A 5FWAA 4RH3A 1ULZA 4NARA 1YQ9A 4RH1A 3HMKA 4F85A 3H2BA 4QTZA 5AVKA 4ZZ2A 4GZ5A 4I5EA 2EZUA 4GMHA 2IA5A 2HJHA 5H4GA 3EIWA 4RTMA 5KBYA 2PZKA 3DAGA 1BX1A 2BFDA 3IDQA 3H2IA 4JN6B 4NL4H 3M3PA 2VRNA 1LDMA 2CV2A 2WEKA 4KZKA 2FSUA 2VXCA 3HXTA 1YGYA 5C8DA 5JBNA 1KWKA 3TXYA 4FW9A 4G0YA 1TUIA 1USKA 3UB3A 3E3NA 1GN8A 1I0IA 1UPAA 4IX1A 1IOWA 1NVXQ 3ZZMA 1SOVA 2EERA 1WABA 4PGHA 1CS4C 1UDXA 4QUDA 3ROEA 3I5AA 3RYHA 5GJCA 1N5DA 5CA1F 3VUEA 4I1PA 2V7XA 1T3ZA 3H9JA 4FLMA 3VAAA 3L6EA 4DMKA 2O1SA 1FQKA 4J3JA 2HPAA 4GXNA 2C7PA 2XOKD 4FN5A 1CJKC 4X6XA 1ZJJA 1P9LA 2FMXA 4TOIA 5HGXA 4BTVA 3WV5A 1JPJA 5K0FA 2XF8A 2PUEA 3RK1A 2SNIE 2PQMA 3D2BA 4HX5A 2QNRA 5F7OA 4CODB 5BWOA 3BMQA 1KDOA 2R5NA 4P4SA 2ZM5A 1T10A 3A6FA 4WFJA 4KN8A 1GPNA 1AMOA 5TJ9A 1AKMA 1T6ZA 2RGAA 2NTVA 4Y0AA 2YVUA 1GL9B 4LKOA 5E6UA 3RJMA 2Z1NA 4DIKA 1Y34E 2J0QA 2G5GX 3JQ8A 4MITA 4M37A 4Q24A 1AXRA 2VPYA 4J75A 4QELA 5LOVA 2RE8A 1JPNA 1V8ZA 4ZK2A 5J4KA 2W6JD 3AI7A 3DEYX 3HXKA 1KQOA 2HY7A 3LE8A 3RUPA 3ZQKA 4ZI3A 1ECGA 3NG1A 2CSUA 4WHMA 4Q19A 1U8ZA 4JX9A 1GXSA 1G3MA 2JZOA 2VRCD 4IOKA 1H94A 1MJFA 4OM7A 4ZQEA 4AWAA 2WFLB 2GN6A 3UNXA 4F92B 3VSBA 1HKHA 2AOTA 3CVVA 1JJ7A 4H9GA 3BRWA 5FTKA 3VSEA 3ZQ4A 2OXEA 3QVLA 2XWJI 3OU7A 4JLOA 2F1JA 4A5OA 1A1SA 1KXZA 2CBXA 2CDAA 4DLYA 1J5XA 1FVOA 2B0CA 2DBZA 9MHTA 2J3JA 3P5SA 4TRMA 3RO7A 5AK0A 2XE8A 1NVFA 2YXLA 1VCHA 3OMWA 3KK0A 3PKZA 1DG3A 1ZEMA 2FOLA 3TIGA 2LCQA 3WBBA 4EPWA 3KB2A 5IN4A 5FUQA 1II8A 5JJKA 3IT0A 3WLTA 4BE7B 4HGNA 4DR2B 2Z95A 3OUUA 3T38A 5C53B 2PT7A 1ETUA 4JV5B 3MCWA 4CI0B 4XQ0A 9LDBA 3HHPA 4R2IA 5FR1A 5KNDD 1KMIY 1G1AA 1M33A 1DAOA 4D9IA 3H8JA 2V58A 4KRFA 2J7KA 1LTHR 3AFHA 5DN9A 2GJSA 2PX6A 1XTBA 3BJMA 4LQ4A 1C9YA 3HH8A 3AJ9A 4MMXB 1U5CA 2DPXA 4MRMA 4OQMA 3UXMA 3ZW9A 3AEKA 3F6CA 4TWJA 1Q0TA 4NCIA 3CCBA 5LP6B 3DL7A 4FGLA 4U0KA 5LKRA 5JMTA 3ZBUA 1XVAA 1ZD4A 1QHIA 2XQGA 1J4AA 3ONVA 5EESA 2EBFX 5IVIA 4RELA 2GN8A 1QS0A 2PGDA 4X6LA 3ONEA 3LLVA 4JI7B 4B3CA 4OQFA 4BB5A 3EIXA 4EK9A 2NTYC 2OO3A 1OT5A 2CHEA 3ESXA 1H8HD 3IGFA 3STYA 4HQOA 4CF5A 4K46A 2AF4C 3H0EA 2DC1A 1BXRA 1J9ZA 1UPXA 4XDYA 2ZPUA 5CFNA 3TQIA 3IHLA 2R4UA 2CXOA 3DLPX 4XDHA 2YMLA 5F2KA 5B1YA 5LQNA 3HKDA 3IVRA 2WMOB 3EC7A 1C0LA 4ZKDA 2FZGA 5ALVA 3A3YA 1RIFA 1Z0DA 4ARZA 2XZOA 4IMJB 3SMQA 3UMBA 1JKJB 3EDMA 4IUYA 1DTWA 1NC3A 1NT2A 4H7EA 3C3KA 3SZ3A 1GAXA 2A58A 2FW6A 2AR7A 3BE5A 2Q6OA 5ALPA 2JIMA 1SC4A 2QLFA 5EZ5A 4CM9D 4EZBA 4YUYA 7ABPA 3L4JA 4CLOA 1QFXA 3PIIA 4WK4B 2WVGA 3C43A 3L7OA 5G4KB 1HE5A 1KJIA 3FOAA 3FZGA 1SXJD 4MRSA 4AS2A 3D7MA 5BSMA 4BZZA 1UMKA 3TJRA 2FDCA 3KAQA 3M4JA 3ROFA 2W6ID 1JZSA 5IARA 4Y2JA 4UULA 1UBKS 2LCFA 3KFVA 5A62A 3M6VA 4H6VA 4R0NA 2PX8A 4EY5A 3L77A 4AJ4A 2X19A 3K96A 5AHKA 1YV9A 3QEJA 3EHEA 3FF4A 3RK4A 5C2JB 5AVJA 3WYGA 4GDFA 2EZ9A 2I3ZA 1M2VA 2VDWA 3MXOA 5A5EA 2IVZA 3MGBA 4JBGA 4RK1A 4AN0A 1G20E 2JLAA 1KF0A 3WL3A 3FF1A 5K6TA 1FLAA 4OO3A 1E9DA 2A84A 4IIUA 4NG4A 3IPXA 4RLQA 3RH0A 1PS8A 2QLNA 5CXXA 3UJDA 3GLIE 3M1AA 1PGQA 3CZQA 4N3AA 2YC2C 2VJMA 4KVGA 4Q1DA 4A4DA 4JZKA 4DB4A 1FYXA 4X8OA 5E3IA 5C5CA 3AP3A 3MRTA 3FCYA 1OJLA 1PZEA 3PUYA 2WYWA 1E2LA 3RS2A 1G7CA 2OO5C 3T41A 3T7AA 1LJUA 5IJ9B 2W6ZA 2ZB2A 1MLDA 3A9SA 3MJEA 1CNFA 2RH4A 3BMCA 3IAHA 3REQB 4KPUB 3L1VA 2XV1A 5EYPA 2IU6A 4F04A 4HFNA 5J2UA 2ZRGA 1BW9A 1BU5A 1EDOA 2VXOA 3BMOB 1G3RA 3KTDA 5JCJD 2ZIEA 1IXRC 4AKTA 4B46A 4H16A 4BATA 2KI5A 3JZIA 1ZYUA 1YD7A 3MCVA 4L16A 3RQIA 2RHRA 1R4ZA 3OLQA 4J1NA 5AXCA 1E20A 4AYTA 1GPBA 2ZBFA 1P6UA 3VMMA 2HF8A 3NORA 1WUJS 3TNJA 3CLRD 3SBDA 2Q2QA 3E7FA 2O4CA 3SDBA 1XHLA 2IU0A 4C0JA 5E95A 2GUGA 1F6BA 1VRCA 4CQMD 2BDEA 3H83A 4M6WA 1PW5A 1ZRSA 2NU6B 4IWYA 2CJFA 4DNFA 2R00A 4A0QA 1DX9A 4BO2A 1K3TA 4JEUA 4EMTA 5CA1B 1CYEA 1SZPA 2QIOA 5CM8B 4OD0A 4RD4A 3NPMA 1XLVA 1ZOSA 1AKWA 4PO3X 2II6A 4I1RA 4YJ3F 5JAUA 5LWQA 4KKXB 3WKBA 2D1YA 3AVOA 1YZYA 3L04A 3LCCA 1C9KA 1T9KA 3BKXA 3EC2A 3F7NA 4G9BA 4CM5A 5JAOA 4EG0A 5T4HA 2WPDA 1DJQA 4CT0A 1TZCA 4IGIA 4YUVA 1JIIA 2AXEA 2IUYA 1OAAA 4QGGA 1EHIA 1K5GA 4I6JA 3ZS9A 5BVHA 2B1GA 3DH0A 4BZQA 2R2GA 1SU7A 2W5UA 4ZQGA 3WMGA 4J1TC 2BFDB 3M3DA 1ULHA 2R8ZA 3NYWA 4NBRA 1TI7A 1DAKA 1DO0A 1X7XB 1Y4UA 2C2YA 3I34X 5IZ4A 2IHKA 4PF1A 3IT2A 1JMVA 3DL4A 1DPFA 3NIDB 3RODA 3QG5A 2ZRHA 1USUA 3LUPA 2J85A 1C8VB 1NVMB 4Y7DA 4Y9TA 3AINA 1KPHA 1LTKA 1C9MA 5GWXA 1DIAA 3PUVA 4HPXB 4QWMA 3B5EA 3FYCA 4HAOA 3WB1A 1N5IA 3E0QA 4LWZA 4N41A 2PLFA 2WZCA 4FOLA 3FVQA 5J3JA 1MC8A 3IEXA 3MS4A 3KHSA 1FTQA 3ILHA 1ZCZA 3L4EA 1IHUA 1Q0PA 2HU2A 4GM4A 1NXOA 4U2FA 1GL6A 1VJ0A 4ZVVA 2HRQA 3IOCA 3Q1KA 2PSJA 1YR3A 4UVDA 2BHLA 3JQBC 1T2FA 4ENRA 3ZDCA 3UCFA 5LKAA 1IY8A 4OEHA 1OYYA 2RARA 2WVHA 3HA2A 1OHHA 3AF6A 2AX3A 1IHXA 1C80A 4V0ME 5D51S 4DLLA 2AEMA 4NHEA 4XCXA 2W9XA 3D1LA 1BO6A 2IEZA 2YQ5A 1Q22A 1Z28A 5BQOA 3U3XA 4XYGA 3DT9A 1E6CA 1BROA 2AMFA 4XUDA 1H4VB 1DV1A 3JQ8B 1V5GA 1QMPA 3BVPA 3IR6A 3K0FB 4GR5A 4O4HB 1EVJA 5FLEX 3SYLA 3ZCUA 1XD2A 2P6NA 3VV3A 4IQ8A 3Q87B 3G88A 3Q3VA 4XVRA 2C8LA 5DO9A 2E82A 4R5HA 3K2IA 1S3GA 2IEIA 1RKQA 2IPLA 4CE6A 1GPYA 3C14C 4FPXA 3TAUA 4CKZA 1JIXA 5IUKC 5FPHA 4UBNA 1V0JA 4D3SA 5CLHA 3F6BX 4DUZB 2NZJA 2ZSHA 1RXUA 3O95A 2O5VA 1J33A 5TVGA 1CB0A 1AF7A 3D4BA 5GP1A 3TDMA 1I2DA 1K5DA 3IBSA 3VC1A 4ENPA 4URWR 4BNLA 3D7LA 1LBQA 5HP4A 1GUDA 1RAEA 1YOVB 1VZ3A 3K15A 4TKZA 1D2AA 3HO6A 4JJ8A 1WG8A 3LCJA 4KXNA 4M8IA 4FJ2A 3K53A 5ITSA 3AUKA 5HS4A 1T3LA 4AXBA 5DHUA 4RA6B 4QWWA 3S3TA 1ZESA 16PKA 1C29B 5KVAA 4RFSB 2NTEA 5I6DA 2J8ZA 3TQQA 1TJYA 4N82A 2JFOA 1HLDA 3RVOA 4BXOB 2PZEA 1TAUA 4F91B 2FK7A 4N47A 4MRRA 2C78A 3WK5A 4LV8B 2J48A 1Z35A 1CDZA 1CUIA 2BMWA 3GUYA 1GZUA 1HGXA 3ENWA 3AEKB 5JY1A 1MC4A 3RUHA 4JC4A 2IEYA 1NHGA 1YIDA 4XARA 2XBMA 1K4YA 1RCUA 4MP8A 4NU8X 3EPLA 1AA9A 3CH7A 2ZTHA 1QS0B 1E3QA 2VF4X 3BE8A 3I23A 1Y1QA 4GLOA 4FQ5A 3ORYA 4N4AA 1JHPA 4OU5A 3WJ1A 3QTTA 1DRKA 1SC3A 2JGNA 3LRPA 3TNDA 4DLRA 4Y2UA 5A6VA 1CZHA 5JCPA 3EPHA 3R7WB 1VLMA 5K4AA 1QAQA 2GEJA 3C8ZA 3BJRA 5L3QB 3V8PA 2OCYC 2OILA 1RI3A 3HGQA 1O6ZA 4K7JA 4ROSA 4DLUA 1PJ8A 1XDUA 2WC1A 5I9MA 1X15A 2ACWA 4JCCA 4RK5A 2OB2A 5EMHA 2GXUA 3PDHA 4KPEC 1U3TA 2RDMA 5LU8A 4ARZB 4OX9Y 1EUDA 2D2VA 4FMDF 4GOOD 3VDRA 1V35A 5F77A 5KKAA 1DTWB 3SIRA 4DWJA 4Y1GA 3NHYA 2ZT5A 5IDYA 1QYCA 4WV3A 6REQA 4BO9A 5ERXA 3L8EA 3Q2IA 4JJEA 1LPAB 1MNQA 1SCJA 1NQ5A 3GFGA 5CDUA 1DBWA 2IPNA 3ZU4A 1YIOA 2XKBA 1FFDA 4PYRA 2EQAA 1KJNA 4P81A 1Z6TA 4URHA 1UOPA 2FWRA 1NLZA 1PFUA 5LP1A 3K72B 1PNRA 4RFVA 3TUIC 2D5CA 3QKIA 1NX9A 4AT1A 4F56A 5BNZA 1NZDA 3QKRA 4G84A 2MSNA 2JFZA 2W11A 3EYAA 3HN7A 1PLKA 5I7SA 5K2OA 2P2GA 1P75A 4HAVA 1U3VA 1H3NA 2VZEA 3H04A 1FUKA 1I01A 1M73E 1U6IA 4QOGA 2VDLB 3TPFA 3G9XA 2JKZA 3K0CA 3W5IA 5GQSA 3IUBA 2VDWB 4QLOA 1JKFA 1GDDA 4REQB 2R8PA 3YASA 2ACVA 1YCHA 1N8TA 4XJSA 3ACCA 5DOVA 3H13A 2BFBB 4E51A 2BI7A 3T9CA 1L5MA 5DWQA 3QHPA 2VXBA 4F2WA 1DQPA 2VJMB 3A6ZA 3FNGA 3PPYA 5FWYA 2Q8QA 4HK4A 1NRXA 3LYLA 1YB7A 1IBRA 3KZXA 5TSDA 3HJGA 3OOWA 3S55A 5KSWB 2VSYA 4YJ3B 2P9JA 1QHNA 3NEAA 1X1RA 5DN6D 2CNDA 2ZM6B 1EX1A 2WFAA 1W9MA 3CZRA 2D4AA 1DE0A 2J0VA 4M7PA 4LVOA 1CCWA 4GD3Q 3BMNA 3WYBA 2XGOA 1XC7A 1I7QB 1U1CA 4C4SA 4O3MA 4K0KB 4R8SA 1AGPA 2PZAA 2WICA 3OY2A 4IJUA 3DHVA 3GLRA 1NG9A 2QG4A 4YDSA 4FMPA 3WQQA 4FIZA 5AI9A 2P4UA 3B3JA 3VOSA 4A6EA 3F1KA 1QQ7A 4GC5A 1Y8CA 2P8JA 2BF4A 3ITNA 2WVAA 3WNVA 3GFTA 3ZHUA 1BE0A 5G53C 5LIPA 5EG5A 3MOGA 3SZMA 1U2QA 4IJWA 3SX4A 1TCCA 1K8YB 3BT7A 3Q7SA 1Q6ZA 1JU9A 1YA8A 1RXVA 2CT8A 3LKZA 3KFLA 4O8CA 4E7PA 3AIIA 4WMLA 4KREA 2FQWA 2VNAA 4P1ZA 5EZYA 3H9GA 1JX6A 4E22A 5AWFC 1Z6XA 5IG2A 1E0AA 3V4ZA 2AHRA 4DA7A 1DIBA 5LXTA 3GJXC 3PFFA 2R6JA 1T8SA 3JRWA 4N6GA 2IWHA 1LX6A 1NF2A 1G7TA 1X9HA 3E3OA 3FAKA 3OTGA 3OURA 3TR6A 4KIJA 1L5HA 2DBVO 3JARB 1KRHA 2H07A 3WLSA 4BQSA 4C43A 4MVJE 2Y1XA 2GBFA 4NG5A 4XUEA 1RZ3A 5BVHB 1HT3A 4MYDA 1YMUA 3UENA 1P39A 3LF2A 1XF9A 4EHHA 2EXXA 2GASA 3U4AA 6CHYA 4W5TA 1AC5A 4FCCA 3DEZA 3IULA 4TM8A 3MJCA 2EFHB 5A5DA 1JDVA 1I5RA 5HDBB 4R9SA 1W4BA 3GP3A 3X2EA 3KQHA 4RWZA 5B2FA 3VHQA 1D0VA 3EY4A 4BEBA 3QXCA 4DR1B 1JH8A 1TIPA 5CBPA 5EZYF 3G2MA 3AVYA 4MULA 4WK6A 1X1TA 3DZCA 4FE7A 4GLFA 2F3QA 3AR8A 5LXTF 1YVUA 5FI0B 4D44A 4OFBA 4Y9DA 1MOSA 2OHGA 2IQ5A 2O9JA 5DFAA 1XEWX 3ZCRA 3ZWPA 4KRXA 2OCDA 3H5RA 3O4HA 2W90A 2R7LA 4H6XA 3MRVA 4Q21A 3T5DA 1T9GS 3JSAA 3ISJA 4KJXA 5I47A 1B74A