1TKCA

Specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Specificity of coenzyme binding in thiamin diphosphate-dependent enzymes. Crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate.
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords TRANSKETOLASE
total genus 242
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1994-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tkcA01
3E9YA 4RJJA 3AHEA 3MOSA 3DUFB 3EA4A 3FLMA 3UPTA 1YI0A 2BFCB 3D7KA 1NGSA 2DJIA 1X7YA 3EYAA 2R5NA 2EZUA 4JUBA 5EJ4A 3M49A 2IHUA 2JI6A 2C42A 5HHTA 5ERYA 2JI9A 5HYVA 1QS0A 3AI7A 2Q5JA 1OLUA 5HGXA 1QS0B 2BFBB 5I4IA 1UMDA 4XEUA 2Y0PA 3FZNA 1TKCA 2BFDA 2IHVA 2XT6A 4QQ8A 3OOYA 2BFEB 3DV0B 1YI1A 1AY0A 3AHCA 1YNOA 2BFFB 5I5EA 1UMBB 4KXVA 3RIMA 1X7ZB 2FWNA 4GM0A 4JUCA 3AHGA 3EXIB 1YD7A 2C31A 2VBIA 4JUAA 4Q9DA 3ZHSA 2UZ1A 5AHKA 1WCIB 1KEKA 4WBXC 1IK6A 2OZLB 1PVDA 2G25A 1QPBA 1X7XA 3M6LA 2AG1A 2JI8A 2Q5QA 3HWX1 3OE1A 5DGTA 3AHJA 2BEUB 4MPJA 1U5BA 1V16B 4JU9A 3EXIA 3AHIA 2JLAA 1X7WB 3EXHC 2Q29A 1UMDB 1L8AA 3EXHB 1Q6ZA 1V11A 2BFBA 2EZTA 2JLCA 2YICA 4K9QA 1OVMA 1UMCA 1BFDA 1UPBA 2C3MA 5I5GA 2NXWA 2W93A 4JUDX 5EJ5A 3AHDA 4FEGA 4RJIA 5EXDA 1TKBA 3EXEB 1OLSA 1PI3A 1Z8NA 2EZ8A 2WVAA 4JD5A 4K9MA 4MQ5A 4COKA 3ZHRA 5HJEA 2JIBA 1TKAA 5K3SA 3ZHQA 3DUFA 1OLXB 2G28A 2VK8A 2BFCA 2O1XA 2BEWA 4GG1A 1GPUA 1X7YB 4KXUA 3HWWA 5K6TA 1V16A 4FEEA 1X7WA 3HYLA 1X80A 4K9OA 1RP7A 3L84A 2Q27A 3AHFA 1WCIA 5I51A 3M34A 5EXEA 3DVAA 4D5EA 2QTAA 2BFEA 4KGDA 1NI4B 4RJKA 1YHZA 3EY9A 1UMBA 1R9JA 4C7XA 3AHHA 4KXYA 1X7ZA 2XT9A 1ZPDA 5EJAA 3ZHTA 1OLUB 3IAEA 1JSCA 3DV0A 3LQ1A 1W88A 2BFDB 2IHTA 5K6RA 1DTWA 1YBHA 4GPEA 3ZHVA 5DGDA 1DTWB 1MCZA 2V3WA 2R8OA 2VBFA 1TRKA 3KOMA 2WVHA 3FSJX 3EXHA 4QELA 1PO7A 1Y9DA 2Q28A 1UMCB 2J9FA 5DEIA 5EJ8A 1PYDA 4JUFA 1T9DA 3UK1A 2PANA 4ZP1A 4D5GA 1V1RB 1U5BB 3EXFB 1V1MA 2BEUA 2VK1A 4K9KA 4QPZA 3LPLA 2PGOA 1V1MB 2WVGA 1V5EA 2UZAA 2J9FB 1OZGA 5EJ9A 5ESDA 2C3YA 2UZ1B 5EJ7A 4KXXA 2BEWB 2C3UA 2AG0A 2OZLA 4K9LA 4MZXA 5EJMA 2Q5LA 2O1SA 3EXFA 1T9CA 1ITZA 2BP7A 5EJ6A 1QGDA 1POXA 2BFFA 1OLSB 2PGNA 2Q5OA 2E6KA 1OZHA 1OZFA 3EXEA 4MPPA 1T9BA 2EZ9A 2X7JA 1UM9A 2FN3A 4JU8A 1OLXA 1W88B 2PDAA 3EXG2 1UM9B 3M7IA 1B0PA 3LQ2A 2R8PA 2BEVA 4K9PA 1V5GA 3ZHUA 5IMSA 2BEVB 4C7VA 2VJYA 2YIDA 4GM4A 1UPCA 4MPRA 2IEAA 1POWA 1V5FA 3F6EX 5ERXA 2C3PA 2EZ4A 2C3OA 1V11B 2VK4A 3DVAB 2BP7B 5FEMA 4K9NA 4KXWA 1T9AA 1W85A 1V1RA 1X7XB 2JI7A 3JU3A 1UPAA 1NI4A 2JGDA 2VBGA 2XTAA 1W85B 2JGDB 3EXG1 3IAFA 4GM1A 2QTCA 2G67A 3LQ4A 1X80B 5C4IA 1N0HA 1YHYA 3F6BX 5K2OA 4GP9A
chains in the Genus database with same CATH superfamily
4IZHA 2OG1A 1K7EB 4UHHA 1DXHA 2OPBA 4RDHA 3LVQE 1ZLYA 4V0RA 5ITWA 2AOTA 2Z57A 3JQ7A 5J4HA 2E4XA 1G20E 4P4TA 4AS3A 2O9JA 4KHPB 2X5JO 4NIMA 1R4NA 4MOWA 3K5IA 2H51A 1RQNA 1AS0A 1CDDA 1QGYA 2W22A 3GD7A 1OB5A 3EN0A 3WJ7A 2EIXA 4EUHA 2V6BA 1K2VN 1VKHA 3NYIA 4DQUA 4E1BA 5K7SA 2CLCX 1PTJA 1CQXA 1NRXA 3MT9A 1ODIA 1W34A 1ZUNB 4HNSA 5ECDA 5BN4A 4M1EA 4P98A 4BV9A 1RFGE 5ES3A 5KOYA 2XA1A 4GICA 2ECQA 1WCYA 4F8JA 1J5EB 2RDMA 5FR1A 4K86A 2RAUA 4EFNA 3I9FA 2QYTA 5TPZA 3L4SO 1A1SA 1OF1A 4L4YA 4MV4A 3QUQA 3PJGA 3FYSA 1A27A 1UQTA 4AT1A 5IABA 2LKCA 2JLCA 4UD6A 3HCCA 2IV7A 4HLNA 3EZ2A 3ZDQA 1VKZA 4B4UA 2EKQA 2BJWA 2C77A 3IAS1 2Q3JA 3ZE9A 4DC0A 5A4IS 3B7GA 1K4KA 1X1QA 1TO6A 3K0EA 2H31A 3RVPA 1GDDA 4CEJB 5K6AC 1S02A 1WMEA 1Y3DE 4IOLA 4MVJD 2P90A 4MCHA 5ALGA 1T2FA 3JYOA 1X19A 2XYPA 5I51A 4A0SA 3RSZA 1YDEA 1GPH1 1J20A 1MAHA 3VO1A 4ALNA 2CXQA 4YP5A 2X5KO 4PLPA 2WQ7A 2PTHA 1PTKA 3K9HA 3PFIA 1ACLA 2HJ9A 4P4NA 4Z4CA 5EXTA 2EVWX 2VNSA 5AM1A 1ESEA 1SUBA 4C7JA 3DFFA 1N5IA 5D84A 3E2IA 1VKRA 3NYQA 1YIOA 4ZQGA 4ZU3A 3L1UA 4NEHB 3S2ZA 4DARA 3NHJA 3ORFA 4HAWA 1KEVA 2I8CA 4WXYB 4FGSA 1Q14A 4D25A 1QRAA 4MQFB 4NH0A 4TMFA 5E1OA 4RPGA 2C4HA 2IXFA 2EC5A 3WYFA 3C3WA 4MQ4A 4CV2A 2VSQA 3FNFA 3K05A 1QYIA 2GI4A 1HDXA 1H8HD 4FZ3A 4HFMA 1UBMS 1V5EA 5E2IA 2HF7A 4BNHA 3UBTA 2VZLA 2D2IA 3RSSA 3AIOA 4BLOA 1CUWA 4WLFA 1E61A 1JS1X 4ZO9A 4YRCA 1H85A 2ZGVA 2X8WA 3HL0A 4R1TA 4YR7A 1E5XA 1JJVA 2DUWA 1ZK4A 3H6HA 4LZZA 4Q6WA 4KWHA 2WB2A 2G88A 3TGWA 2GCNA 3A6HA 5B3JA 3S1LA 3REGA 4R81A 1T26A 2H5LA 2VQ6A 4L4RA 4DL9A 1TD1A 4U5XA 1ML4A 4O3FA 4ENQA 5LUAA 5TF4A 2O8FB 1Z06A 2OWEA 1WVGA 3LQYA 4D9BA 3E5HA 5A3RA 3ULKA 3G2OA 1C50A 1DXQA 3GHHA 3IP5A 4UHCA 5KNBA 5L6MB 2GXAA 1KH2A 4FCCA 2VXCA 4GZ5A 2UDPA 4LQ4A 2EJWA 1ATZA 2P8JA 1M2JA 4H08A 1N6NA 4ARAA 4URXR 2CFTA 4GMDA 4PU0A 4ETWA 1T36B 4IHAA 2O3JA 3UMCA 2HCTA 3KOWA 2V7QA 4WY5A 2DQ4A 4BVEA 2DY0A 4BO7A 3HDQA 3ESDA 3UG6A 1VB5A 2I9KA 2GZ3A 2IYOA 5HDQA 1E3TA 4J91A 4QQ8A 3RARA 4F9EA 1W9HA 1YI1A 4HH0A 2GO1A 1Z6TA 1M2NA 2E18A 3GEMA 1U31A 4PYMA 1GQOA 2RI0A 3OOWA 5BOSB 1Y8QA 1WY5A 3UY4A 5LLSA 3MTIA 3VPHA 3KNZA 3ZDCA 1KK2A 4LSMA 5GIOE 3MGKA 4RVFA 5H0IA 2GCIA 4PG4A 2WE7A 2H11A 1Q2XA 4YRQA 3F2VA 2VATA 3X1XA 4ZDWA 3EQ8A 1KJJA 3A8TA 4HQKA 4AWXA 3K4HA 4YUZA 5IUJC 3U61B 3FNQA 5CHYA 4A0QA 1VKNA 1SAYA 4EF6A 1XPOA 5AJZA 3SCZA 3ZS8A 4TS3A 1WUHS 3ZI7A 1WP9A 2P65A 3O91A 3PF8A 4JVLA 3UFXA 5HKOA 1KVSA 3I12A 3MCZA 4MW5A 2C61A 1RHJA 4MJLA 3VSAA 2WWXA 4Y6LA 5M5BA 3GCDA 2FZKA 5JY6A 1AJEA 1TYCA 5CHEA 3FWZA 4HX2A 4E07A 3CHYA 5JRJA 4YAFA 2FX3A 4CMCA 4TLDA 3UF0A 3JVIA 3BB4A 2Q5FA 4HQ6A 1T5SA 3AHFA 4L8GA 3A4LA 3LA6A 1V6CA 1AGNA 2CVZA 5COBA 1KQNA 2GXSA 1VMDA 3AF0A 4EPYA 5E2BA 3WGLA 4RH0A 5DLPA 1IC6A 2VNAA 1OXXK 1A9QA 4OP1A 4H3KB 1BOFA 1R9JA 1J22A 1FUEA 1QONA 3U31A 1CPYA 1KTIA 1GDTA 2RE8A 1O1YA 1XNQB 3GAMA 1AXGA 5AJWA 1MVLA 4AIRA 4B8ZA 2P6RA 4KW7A 3BMNB 3QVGB 3PXDA 1UBTS 3FDZB 3OQHA 1G5IA 4UNIA 4ZCQA 4C7KA 3WNCA 3PEYA 3GUUA 2V3WA 3RW9A 4BC1A 2JIMA 4I3GA 4Q1EA 4XX1A 2W4QA 1L7DA 2D4HA 1GP2A 4ZO6A 3PRKE 5LBUA 3L6BA 5P21A 2WMOB 2XB4A 3SSOA 4EX7A 1YVUA 5F12A 3HY6A 1LY1A 2POQX 5DBFA 3TE7A 3UT5A 3NGMA 3SX0A 1NXTA 1EQ2A 5CH8A 2DFDA 3RRYA 5CDTA 2HAEA 3DV2A 4ZOQI 1GYPA 2HXYA 4OLBA 4XTCS 5JOQA 1QH8B 2C3YA 1DNPA 1L4HA 1LDNA 3V2IA 2JASA 4AF6A 5G3ZA 4XE5A 4C88A 3BTVA 1Q7RA 1WIWA 2H07A 3H2IA 3TOSA 3ZZNA 1YR2A 3ZHXA 1OTYA 2RGCA 1NFRA 2V7WA 2R1UA 3LC0A 3M3HA 1RI5A 2NX2A 1HUQA 3KVYA 5HZMA 1E92A 2HDHA 4O2AA 1I7QB 3M9LA 1RM5A 1NVDA 3R6GA 2AXQA 2KS6A 4XGQA 1QVZA 3MD9A 4YASA 3RVKA 2Y2UA 4E21A 5B2EA 2F9MA 1B0UA 3UXEA 3OQMA 3IDAA 4M98A 4DG9A 1ZBDA 1IWOA 1LRJA 2BSXA 3C3YA 3I04A 3QMWA 3G5TA 3RLFA 4KO4S 2VDVE 2V6MA 1GAXA 2ZAGA 1AKWA 5IAKA 1OYOA 2WUFA 2YOFA 4ZQCB 3D1VA 2D7JA 3R7FA 3H7AA 3GFRA 1G9XA 1U0TA 2X0RA 4NOKA 2EGUA 1ZD8A 4EL0A 1BGXT 1JE1A 1QVAA 1R0WA 1CLUA 2HK9A 3CMCO 2AFRA 3S2FA 3VTZA 3Q8XB 4GLBA 3RK4A 3ZUGA 4DRZA 4E14A 4EPWA 4PYJA 1J2EA 2R7LA 1T3ZA 1QO0A 3D0KA 4IFIA 5HYVA 5EIXA 3DBRA 4IDGA 1P7YA 1GV1A 3V1TC 3U09A 3DL0A 2VTBB 4TKMA 2R00A 3NEYA 4ID3A 4HNVA 2QSJA 2ZIZA 3QW2A 4HDCA 2A0XA 2AOUB 4DJ5X 1C1YA 3DG9A 4V1CB 5KQSA 3TUZC 1A4UA 1KEZA 3CRZA 4W1RA 2X1LA 1E1MA 3FVRA 4FHCA 1U2DC 2WYVA 1KO7A 3B9QA 3G2LA 3QG1A 5IJ9A 1VGQA 2XMCA 3FDIA 4NHOA 1OI3A 3K09A 3KZMA 4CTMA 3IVXA 1XRSB 4LE2A 2JCGA 1SA0A 1U2EA 2MYUA 2ZSUA 4Q3KA 1E99A 4KQ6A 1E9CA 1BFDA 1ONOA 2EIHA 2XIJA 5KTMA 1XJ5A 1B8OA 1K98A 2H1WA 1L9XA 1T6YA 2HSWA 3FTNA 4EUSA 4JBIA 1AD2A 3HXQA 2QRHA 3FSEA 1CR4A 2G7ZA 3UUGA 4XFJA 3WZLA 1E98A 4QAQA 4KPUB 4ECAA 4XXHA 4CFZA 2H2AA 3IUPA 4ROSA 1FP4A 3OZDA 1UJCA 2N42A 2OB2A 2H57A 1T8UA 1BA2A 4KG7A 4BNGA 1VRCA 4W7IA 3SYTA 2OV6A 4QFBA 3P52A 4INAA 4AJ4A 4YJGA 2WFMA 4QXPA 3PXGA 1DRUA 4B3XA 1R6BX 1UBUS 5G1PA 1HXHA 1Z62A 4ROTA 3ESYA 1Z15A 3U3JA 4RD3A 3DMDA 3PQ3A 1XVAA 4FJ2A 4MP6A 4NYMQ 1A95A 1XYYA 1GRVA 1ZQ9A 1GQQA 4EOGA 3NM5A 3NH9A 2PBFA 1M1XB 1ONBA 2GPWA 4LXTA 5F2OA 4KO3S 1VYUA 1G7TA 4OK3A 1OU0A 3MLEA 4TWBA 5K51A 3DAYA 3AIKA 1KA9H 4P82A 3BRCA 4S2UA 3FPEA 3FSJX 3QIVA 4P86A 1SOUA 1XRNA 1Z2CA 1NXPA 1GCIA 2P9BA 2HZ7A 1PO7A 2YRWA 3HNRA 4II7A 4PC1A 1FSFA 5IBQA 4KC0A 2EBFX 1TF7A 2OHIA 5DEIA 4EZIA 2DTDA 3OBBA 4MV7A 1HE8B 1QYCA 4I9HA 4Q01A 4WFKA 1TCBA 1XF9A 5B2FA 3W3AA 1NR7A 4GOKA 1FUIA 3NOVA 5C81A 3Q3HA 1IUKA 2DPYA 2VEOA 2YW9A 4AYWA 1GAEO 2QY9A 2CUKA 2OAGA 4RVCA 5EJ7A 4H4EA 4UNPA 2NAPA 4EJSB 3BBPA 4YJDA 3A7EA 4DDTA 2NU7A 2LGJA 3MUNA 2Q3DA 3EH2A 1OSNA 2GEKA 3N39C 2QVLA 3KR0A 3QBTA 3ZCXA 4D6XA 5CA0B 4KR7A 1T8SA 2AQIA 1UXKA 2N75A 4K9PA 1AQIA 1I8TA 1N7JA 1XOIA 4ZZ2A 4D6YA 3IXMA 2ZB2A 2W70A 2XMBA 1MRZA 5L7YA 3ANSA 1U9JA 3DWIA 1Q12A 4EG1A 2J9RA 2AWOA 4EO4A 1TIPA 1M8JA 1U3GA 4A5OA 1GZ5A 4DOMA 4PC3A 1KKUA 2OD9A 5K8TA 1U2QA 3O3MB 2N9UA 2P69A 4C0KA 3OQ6A 1G6Q1 5EESA 4TMYA 4I46A 2RB4A 3LUDA 1HEUA 1LV8A 1G8MA 4E2XA 2RGDA 5LP6F 1W1IA 1EXDA 2C0CA 3BIJA 5AXCA 4B48A 3K8YA 3MTDA 1GL7A 3N86A 2FPPB 2E5LB 5LQJA 4F2PA 2H54A 5DYIA 1NGSA 3ZWOA 7ADHA 3VAAA 1GL9B 1XAIA 3Q15C 5JXHA 5DM70 2DHCA 1VE1A 2BM0A 2UUOA 2DQYA 5ESWA 3HJRA 2ZYGA 3WADA 4UTNA 4MDYA 3HZZA 3KHTA 2QTRA 4MCIA 5F51A 4F3RA 3HR4A 4AECA 1SKYB 3WLLA 3U7IA 3EW9A 5B37A 2QQFA 4BBZA 4PZZA 5CB0A 2NZ2A 2ID4A 4C43A 3UMMA 1W4AA 2XBUA 1YZYA 2GZSA 1F38A 3D02A 4K2HA 4QODA 1XRRA 2IT1A 3PFHA 4PO3X 3FFAA 5LBTA 2QQGA 1JLLB 3S4YA 3V46A 1XDGA 2ZPAA 3KOXA 2VHEA 2WTNA 1UWCA 1BU8A 2BJHA 2Z2JA 3KOYA 3HCNA 1BA3A 2NSDA 3FHJA 2IOFA 4YT5A 1KVUA 5FWXB 1MV8A 1XYGA 4HLUA 1RTTA 4RA9A 1OYWA 4CVNA 2BMWA 4AS1A 3GGSA 1QDEA 2PT5A 1JVNA 2ZT7A 3KP1A 2ESRA 1IPFA 1HFEL 3DSRA 4I1RA 5C34B 4YIKA 3TMAA 1DBQA 2JJ1A 1FS4A 3QH4A 3AM3A 4FXOA 4WZAA 4I4TB 4QGFA 4DLBA 4LC9A 3KZOA 3K9CA 4BKUA 3AR9A 4TLBA 5IAAA 2R6CA 3AT1A 1KFBB 4WQMA 5LXTF 3Q98A 4GXTA 1S5PA 5JMPA 1VC2A 3NTOA 1RQ7A 4V24A 4OB7A 3PJRA 1YUNA 2H3HA 5LZ7A 1EZ1A 3MELA 2JFOA 4P2BA 3VR6H 3VJKA 4F38A 4V02A 1SG0A 4GSKA 1NHGA 1E9RA 3MWEA 5GIPE 3OQJA 3T7RA 4WESB 3OJLA 4FOSA 2GESA 4D96A 3A26A 4UEJA 2CHUA 2FK8A 4TVKA 3U7QA 1JLSA 1Y37A 1R0SA 2R7NA 2O3QA 1NTRA 1TECE 3PGMA 4FHDA 4GVLA 4MDHA 1N2JA 4MVJM 4IG9A 4C01A 1J25A 1M2OA 2OGZA 4G5HA 2HB6A 4L08A 4O4IA 5DYYA 5IASA 1KSFX 2XYHA 3FWHA 3J7TA 3NASA 3VR5H 2ZWIA 4F4UA 1L8OA 3LK7A 1N4DA 1UDAA 4DMHA 1GN9A 5JFGA 3B36A 4YMIA 2GZDA 5DO9A 3GT0A 5IX8A 4ZT7A 1T25A 1UBGA 3HSKA 5F77A 4U0KA 3EQ7A 1GUBA 5F3WB 1XQ1A 4TM8A 2RFLA 4QGAA 2DMRA 5CDHA 2I7XA 1NP3A 4UUQA 2XCQA 5B64A 3JYHA 3MK31 3M4JA 3SIWA 3QY9A 3ILXA 3UHPA 2AFHA 5CCEA 1DP4A 4TL9A 4I1YA 3GPCA 2ERCA 4KV9A 4QG3A 2WJ6A 4LTDA 1ZH8A 3M4NA 1LJLA 2WJIA 3MBKA 1LSUA 4H4CA 5IM5A 1SBHA 5DB4A 1R0YA 1NQTA 1JG3A 3DVLA 4B40A 1BMDA 2MCFA 1K89A 5KYYB 1ILWA 1CHNA 4JR0A 1RKVA 2WFZA 2RHRA 4BVFA 5J2UA 2HWUA 4LMPA 3H11A 4D9GA 2YV2A 3C6BA 3C45A 3EWNA 4BJHB 1SPBS 1V11B 1RWMA 2QG9A 4MS3B 1SKBA 3C8ZA 4TTSA 4BQSA 4LGVA 1EMDA 2WNHA 4EW3A 5K0ZA 3EEBA 1UZAA 2NNLD 3LTEA 5CA1A 3LUJA 1XXHE 1BXKA 2ODWA 5THKA 3WLRA 5ITVA 4D8UA 3QWIA 1PLJA 1I7DA 1USWA 4CM8B 1E5QA 2BI4A 2VP9A 3N1UA 4FD3A 4Q21A 3LHDA 2DECA 1BXGB 2FRDC 3BVPA 4EG6A 3LY9A 4DMRA 5C51B 3VMMA 2LD4A 1SULA 3D4LA 3TQQA 1RJGA 1X86B 3B51X 3S8MA 3SE0A 4TKLA 4D56A 5GONF 4MVCA 5HQJA 3UMYA 1X0VA 4S2EA 4C4TA 2AC7A 5D3MA 3HHPA 5IEJA 2OM6A 1Z45A 3L6EA 3AX6A 2PBRA 2FMXA 3UENA 4GKBA 4A8PA 4URZR 5HZKA 2QROA 4JEMA 3R9XB 4Q7JB 3EVBA 1NSTA 4B6QA 2NV0A 3O1IC 4BFLA 1DXOA 1IXSB 1XTRA 1KBOA 2OLKA 1IHDA 2Y9MB 3FNBA 4F2HA 5CFRA 2MSDB 2GM3A 4CUKA 2A3RA 4ZOCA 1YB6A 3OFND 2C96A 1XK6A 4IDDA 3P5SA 4QICA 2VPIA 1AQYA 5CB4F 5BUZA 4HMQA 3M5PA 3L41A 5CBPB 3ITDA 3O3OB 4R2WA 3RBAA 3H16A 1BRMA 1TKBA 4IHKA 3IP9A 5LZ5A 2P4QA 5L7WA 1QF7A 1L4YA 2PT7A 4FE3A 3MWGA 3LJKA 1KOGA 1IPEA 1NBHA 4ZZ0A 4E11A 1FMTA 1QK4A 1QOPB 2NYUA 4MVYA 5KYWB 3WG9A 3DQPA 4A4DA 1XZDA 3DZFA 4P0PB 2OV3A 5FBWB 3T3OA 1FVOA 5ECGC 3MWEB 2PS1A 4M87A 3LO5A 2NO7A 4KE6A 5IK2A 4FQ8A 3Q4GA 4J0CA 4OHYA 3TOZA 1CJKC 1MT3A 2CXOA 1L5VA 1RPNA 2IUEA 5ALDA 2YJTD 4A8JC 4KAXA 1HOXA 2QTFA 3NC0C 2OWDA 1EFRA 1X7ZA 2WHPA 3AHHA 3MQFA 3GGJA 2I76A 1N7IA 3RADC 1YUBA 3OZCA 1CUCA 3HCOA 5I9SA 4B4DA 1KZYC 2ZJZA 1CEYA 3PIIA 1J8MF 1QORA 3GP5A 4C06A 4ZMBA 2JBAA 1JBQA 2ZAIA 1CUVA 3W90A 2SNIE 3ON5A 4HRYA 1BDIA 1GUYA 3ENWA 3L7IA 2FW6A 1UOEA 5F1KA 2WAXA 2RH9B 2M2IA 2PA0A 1ZM4A 3ITKA 4I0WB 3TLGA 3TO5A 4AY2A 1KXZA 2QLBA 1NN1A 4P0TA 2AXPA 2H7VA 3F9IA 5LOVF 1MHPA 5A2GA 4LFAB 1DPGA 1YZVA 4KVZA 3K2EA 3D1JA 5LQDA 3RAEC 2D0DA 4JI8B 4P38A 4RNDB 3ASVA 4RYLA 4EVSA 4EGFA 5TR9A 5KWEA 4Z1MD 1OW3B 3PTAA 3K92A 1X2BA 1AQLA 1VIMA 2B5WA 2YHBA 3BCUA 3IT3A 4HDSA 1NLZA 2BEVA 1MB3A 1WXDA 3GJ6A 4OLJA 4O08A 3OQBA 2JJQA 3RRJA 4QSHA 1QIHA 1FVFA 2ODTX 3OBIA 4BP9A 5IXJA 1FLAA 4M8SA 2BGMA 1E7YA 1TVKB 2EERA 4KIWA 5LKAA 1JT2A 1ULTA 1CXZA 5FIUA 3ILVA 3HEMA 5U4QA 4HNHA 2ZJ3A 1FTNA 1W5EA 1XP5A 1SCKA 1P1RA 1XCMA 3ZY4A 4ILEA 2O05A 1EFVB 3U7RA 3TLAA 3I9MA 1Y6ZA 4RH1A 5EE0A 5LA6F 3AY0A 4KLRA 5K0BA 2JFYA 3MXOA 4OLAA 4NV1A 4ZAXA 4AY3A 3JWJA 1TTTA 1V3VA 3HYTA 2H1RA 1G21A 3CVYA 2H3EA 5FWNA 4ZN6A 3KTOA 2RK3A 3NX4A 4Q9NA 3S0JA 3OP1A 4P36A 1BFKA 4NTZA 1BX1A 4HEJA 4AP6A 4EHIA 3AWIA 1J0CA 4UCXA 4RTQA 1RTKA 2BF4A 2NWQA 3FVWA 5I45A 5I4IA 1X3LA 4ASUD 2OXTA 5HP4A 4NBSA 1IHXA 1X70A 2IS4A 3OTGA 1PT5A 1JG6A 2ZJ5A 1NMSA 1PSZA 1VG8A 3DZBA 3OZRA 3ORYA 3DQZA 4O4JB 5E4FA 1M34E 4JGGA 1H1LA 2GGSA 2OILA 3U7JA 3RM3A 5KYNA 2YWJA 4JWKA 4EVRA 3HXOA 4BRWA 5HRCA 3AI3A 2XEXA 1AKQA 4UE3S 2ZYVX 2PUJA 3O83A 4YHHB 2G4CA 3BB3A 2EBHX 4YAOA 2I33A 2B7BA 2EGGA 3I42A 3U16A 2P3OA 4A6DA 1L8AA 3CN7A 1SZCA 4YBZA 4G0WA 4M7RA 5T7BA 4CT0A 2CVFA 5IJAA 4IIJA 3ZWCA 2FSHA 4R8KA 5EGNA 1W49A 4RV4A 1YZUA 1W59A 3PD7A 4BUCA 3T7EA 3LYHA 4G4SO 4KFRA 3E9CA 3H13A 4H17A 2FPLA 2I6FA 2G28A 1VPTA 2WV9A 3VRHA 5CH3A 2QL7A 3LC2O 1U2TA 2QY6A 1KJ9A 3OJWA 3P2IA 3EJ6A 4WCFC 1WKBA 2Z9BA 4A0HA 2R6AA 2Q0SA 2ACVA 3KQYA 1MQAA 3EGWA 3LCCA 4KLNA 4G97A 4MW7A 5AW4A 1Z2PX 4X94A 5HUQA 3PKIA 1EFCA 4HN2A 4NICA 2KYRA 3U44B 5FTWA 3HO1A 2R00C 4ATNA 1WZNA 2HRCA 4ZHQA 3OLXA 2YASA 2IX9A 1XLUA 3ZWDA 4XWKA 4CIAA 4DR5B 1KJZA 4CV0A 1XXLA 3H19A 2R6R1 4QL3A 2XE6A 1L3CA 1TVKA 2A0WA 4P6VF 2HRZA 1PV2A 3RPEA 4XGNA 4YRSA 4B3MB 4QIHA 3C16C 1DXYA 4PVDA 2PFKA 4BNXA 1J1IA 1QYDA 1F1BA 4P7JA 4YJ3B 2VSFA 2Q2NA 1GN8A 1TVMA 1YA4A 3QVXA 4JQSA 1N0UA 3EZ9A 5HF8A 5DF1A 3K09C 4LNHA 3RSQA 1RAGA 5T41A 1VHWA 5BVGB 1ZNWA 4RUKA 4PRYA 4GP6A 4HJXA 4BMOB 5CNMA 1XZKA 1DTEA 5FBKA 1M1YA 5JCJD 2JD0A 2WRZA 1Y3HA 2B20A 3PHGA 5IG2A 5EFZA 2XIQA 2VYCA 1DCTA 4W1PA 2O06A 4BDSA 3OQPA 2C3UA 5JD6A 3I6QA 4DBVO 5JU6A 3CBGA 5EJIA 3UWSA 2NU6B 1PCXA 3AJDA 1E3SA 3IUJA 4V1CA 1C1DA 3I6MA 4FS8A 1AK9A 1QTIA 2A86A 3QK7A 4HYEA 1LVUA 5DP1A 3SR3A 4AY5A 4C7OA 5HEKA 1W9MA 4R7GA 1AHIA 3HR8A 4ZKEA 2ODPA 2DSNA 3GB9A 4UZSA 3QX3A 2W2QA 2Z5FA 5HCIA 2JJ2D 3GP8A 2D5LA 1SB8A 3MTBA 3BWMA 4UW9A 3IAXA 3AEQA 3WNBA 3PPXA 2II6A 1RLOA 1MG5A 2QUBA 4S1NA 4ZEXA 1I6KA 1OA1A 2QIOA 3RS3A 1K9SA 3MMXA 1J4AA 5JR3A 1N2CE 3Q10A 4OHFA 4ANFA 3H9JA 2ETXA 4EW1A 1Q0UA 2ERXA 5FD8A 1OI4A 5CYOA 3HM9A 1TQHA 3A1TA 2JIPA 1RI2A 1PR9A 3GVHA 4G6ZA 1U3TA 3VPFA 3E23A 1J42A 4FSHA 4I08A 2VOEA 4B09A 3PYMA 3IEUA 4H7DA 4HEQA 4NYMR 5KHAA 1EIWA 3OC6A 1SCUA 4RFSA 3OESA 5E7QA 1SC1A 4CQJA 1JIVA 2PT9A 2ZRGA 4DUPA 3ZQUA 2XNDA 1A4IA 2GJ4A 4YK7A 4BMYA 3RIMA 3KEFA 3HCWA 1KQPA 4RIFA 5ALTA 2R6DA 3V4OA 5JBNA 5AOAA 4Q9DA 2XGOA 2ATEA 5CYGA 2YHIB 4F4JA 3ZGZA 2QZPA 3KB2A 4GYJA 2WWHA 3RYCB 1FVHA 2GPYA 1ZICA 4JJKA 4J07A 4M76B 3HO6A 4CL0A 2RGUA 1DKOA 2PU5A 1DS6A 2OFOA 2QKYA 4YCNA 2VT6A 2Q7DA 4KR0A 5CT9A 3WZMA 3ZV7A 2EHJA 3CRRA 3BMQA 5LXTA 1E18A 2BL4A 4INJA 5D3MB 4UVDA 1NPDA 5HKKA 2Q41A 4JV5B 3A4VA 4PQFA 3LUHA 2D59A 2FWRA 4FYMA 3UXYA 3PX7A 1RPAA 1R18A 4MXDA 3DUFA 2J5XA 3BCSA 3P9CA 4CMHA 5GQSA 1RM4A 4DUGA 2A7XA 4GLJA 1Y8AA 4G0XA 1K7CA 4IVPA 1H2WA 3DCJA 4TXJA 1CNEA 3IAS6 3RHSA 1CKEA 3HV0A 1G8YA 4RHTA 3VR5D 3DVRX 1C80A 3KDAA 2TECE 3ZHBA 3ZIUA 1FP4B 1WOMA 4CLOB 5LDDC 3I9JA 1DO8A 1EQAA 4UUOA 2C5GA 1BN7A 1DKPA 2OBYA 4UMFA 2WA2A 3LDHA 4B32A 3GLIE 2OCYC 3DTVD 4Y7CA 4Y2SA 2AA3A 2ISSD 3OKAA 1GPDG 3KU4A 5L9AA 3I01A 1MA3A 3G8BA 1E4EB 3KZ1E 2RKBA 4O6VA 5FWDA 5K3BA 1CIJA 1JIQA 1XCBA 3JS5A 3NDRA 2VP5A 1B2LA 3GUZA 3A1WA 4KDFA 5DNWA 5HZGA 3RG2A 2X1HA 1RYZA 4HO1X 1MNQA 1U5BB 3T06B 3U4DA 1YZNA 3QBEA 1DV2A 3DMRA 3K6SB 10MHA 2O1WA 2IPNA 2ZU6A 3EPRA 3GYBA 1Y6GA 1KS2A 1D8TA 4E2ZA 5FV4A 3HBLA 4XQGA 2P9GA 1EUCB 1OAOC 2BI8A 2V6FA 4C3ZA 2X15A 3V4FA 3G0BA 1K8ZB 3FWPA 1VHLA 1KEEB 2ZRCA 3BXFA 3N2GB 3PFWO 4WKOA 4BQOA 3IBFA 9GPBA 3ADDA 1VP9A 3LWBA 2R7AA 2VHQA 2FPKA 1E9EA 5DE3A 3ASUA 5IUNC 3KOZA 1YJAA 5KZMB 4XD7A 3O1LA 4YDHB 3FETA 4YACA 5IMSA 2HI0A 3Q0EA 3GLUA 4ZI2A 2ZROA 4QVGA 1CDEA 1UDWA 4QT4A 3ROXA 3T5AA 3AEYA 4KQXA 3IJPA 1UEIA 1N9KA 3KSZO 3RKSA 1A9SA 3F5MA 2CW5A 4N8SA 4JP2A 4WI1A 3I0ZA 1PWEA 3NM4A 2C2OA 1XLVA 4TL8A 2KI5A 1ZUHA 3Q7PA 4CKZA 1X8LA 3HKEB 2E9SA 1UZLA 2IVFA 2BTQB 3HKCA 1PGJA 2H0RA 1DMSA 3AUSA 1NF9A 4J1NA 3LBAA 4ADSG 1REQB 2GJAA 4L9AA 4LHEA 5JYDA 4BJ3A 4MUYA 1RVDA 2Z43A 4QULA 5KOHB 2EJUA 2PRSA 3GEDA 4KODA 5EE1A 5KNBD 1QS0B 2P9QA 1YK1A 4MUMA 1Q77A 3FZNA 2WM8A 1L9KA 4PW0A 4QYIB 1NUHA 4GRIA 2BY4A 4YWJA 3ZVRA 4QQNA 4RVSA 2CKDA 5KX5A 4L8YA 4EYSA 1I1OA 3IOEA 5DCWA 4ZVSA 2I2CA 1LH0A 2ZCVA 4IDEA 2YHIA 5DM0A 2IIVA 2FPUA 2QMZA 3LDUA 3EUEA 2B7CA 1ULBA 5ECYA 1Y8ZA 3QYFA 3JAKB 4UCFA 2GKSA 3GGGA 2J4FA 3QU2A 5AHWA 3UXMA 3ZNQA 3WAJA 1I4TD 2HYDA 3L8MA 1DO2A 2QEQA 4NKRA 4ZDJA 5EVJA 2LZ0A 2XCSB 4S35A 5E4YA 3PHHA 3ZGLA 4AY6A 1H9CA 2G1JA 2AMFA 4FLFA 4LAFA 4YH1A 4H7PA 2ZBVA 5CU7A 2LIPA 2OB1A 2VUSA 3JARB 2IKQA 4H18A 4L22A 3TW8A 4JITA 121PA 4EHNA 3G2QA 4NHEA 2NSLA 2XUIA 3CF2A 4RWEA 2SKCA 3QKSA 1C29B 1ZLXA 5DTEA 5JTTA 1FUUA 1ZO8A 1LEHA 2OG2A 3HWWA 3VMFA 5U9CA 1V41E 4N4AA 2GBPA 3ZCQA 4K3VA 3QVLA 5K2MA 2D2FA 2ZVJA 3DHEA 4G5SA 2OOKA 3QQPA 1H69A 3CZ4A 2AHRA 4R40A 4RGYA 4WJKB 4HDOB 2Q5HA 3EOBI 3I8OA 3SOZA 3JQ9C 5JZ9A 2FMHA 1LX7A 3LAWA 2V1XA 4HGRA 4L57A 1QZXA 1BE1A 3EZ6A 1SBNE 2VPTA 4KYTA 4OAPA 5E6SB 4FLEA 5EEHA 2VDJA 4M1TA 2YQZA 3LRPA 1NQVA 4BVKA 1SOWA 2YUTA 1YJBA 5CEEA 4FILA 1Z47A 2XITA 1O58A 1W0JA 3W5BA 1Y48E 4BFSA 5JQGF 1RAHA 1L5HA 2O20A 2G76A 4RZ2A 3FCOA 3RFVA 5LMUB 5DULA 5TMEA 4PIMA 3NBAA 1T2AA 1UJ6A 4NAVA 4DUGD 3EZYA 1OXMA 1SHLA 2JVKA 1IVSA 1ZAYA 1PL0A 4YO8A 3ZGXA 1LSSA 3IIJA 4IKOA 5D3QA 3HC7A 4KNWA 4NNJA 4QTUB 2C1XA 1TEXA 1W44A 1Y8QB 4UU8A 1Y4ZA 4MZXA 3U4CA 2NG1A 1DKUA 4HLCA 4I4LA 3MQ2A 1I4EB 4HZGA 4DKJA 3DTVA 1MEEA 3EULA 3R3UA 4ALIA 5K45A 2A9RA 5BN4B 1JN0A 7ABPA 4O2RA 7MDHA 5IP5A 2ADMA 2J9GA 1RHQA 2HHJA 4Q24A 3W6ZA 2OBFA 2Y1DA 3QLUC 3W8EA 3WB1A 4KQKA 3ZHUA 3CLUD 5JASA 4HCJA 1KI3A 4EEZA 5JS8A 2ILVA 3OSUA 2IKSA 2MWMA 3VU0A 5DT2A 2AKYA 1GCOA 3QVVA 4RS4A 5DSTA 4YPOA 5CEJA 1E1QD 3FVVA 4BB0A 3GO4A 1BC5A 1JDVA 4OHKA 3T3EA 4ZVOA 5I4KA 1DDOA 1R8XA 2PMKA 1W19A 4G0MA 3NHUA 4X90A 1UJMA 4DNXA 1UPAA 5DHRA 4M9RA 2X76A 3R9KA 1JQKA 2G67A 1DG9A 2QMUA 2R25B 3KJNA 3R5HA 5A3VA 1FDRA 3ZJ5A 3LPMA 4HDQB 1ZRSA 5L3VA 2QP3A 3N3BC 3DE0X 4IYRA 2H2HA 4ZCIA 2I7TA 4JBGA 2PQ0A 5KYWA 4GRAA 5AKZA 4MRMA 4RV9A 1THGA 2XKAA 1L3IA 2WJHA 2IXAA 3FVTA 1VQ1A 4XCQA 2XXAB 4XR4A 3HO8A 1UJ5A 4XD7D 4W8GA 2OFPA 4ITUA 2VQDA 2PJDA 3AG5A 3FJYA 3GZ4A 4KIUA 5DN9A 5JMTA 2FR8C 3QFSA 4GYKA 2BFEB 5LU8A 4NCXA 3VJMA 2FUKA 4OGGA 2QSZA 4OFZA 3SDZA 3UYKA 1QE3A 3AERB 4RO0A 5AYVA 4EUEA 3MD0A 4X1YA 1HLDA 4HWKA 1RVV1 3RGGA 3SC2B 3U9LA 3RE1A 1IUNA 1LB1B 1QO0D 3TW0A 3ZDDA 4O2BF 5FPHA 1Z12A 3IJRA 4ZCMA 2R0QC 2X5OA 4QTXA 1P45A 5E6RA 2NUTA 3ZWXA 1GY8A 1GYRA 4KSBA 5CVJA 3ANLA 4CMAA 3TZKA 5E6RB 5BQXA 1ZD1A 1UIMA 1RYFA 4KIJA 3TZ6A 3FHTA 4QU0A 2PUTA 2VDLB 1I32A 4G5FA 1F8FA 1AHNA 5CFMA 1N2IA 5LP6C 4MQ5A 2CFCA 4J76A 3WGYA 3ZCPA 3DFMA 4JD5A 4F92B 3NFYA 1PWXA 1JEQA 2QG4A 2BFCA 4OJYA 1D2GA 4L28A 3EDQA 4WCFB 2XUQA 5HJ2A 5BSTA 3WZ2A 1RCFA 4CIVA 1T4DA 4AU1A 3CX6A 5JQGB 2R9VA 5BYJA 1XO1A 3GJTA 3ZWAA 5MGBA 3QF7A 7GPBA 1L7EA 3BH7A 2REQA 3ONVA 3ZY5A 2P7HA 3ER9A 3TLEA 2FSFA 3VO8A 5CEFA 2GPSA 1Y9JA 4LTMA 5EJFA 2ZXUA 1P7ZA 5JPIA 3M81A 4LWOA 3NV7A 4LI3X 1JJBA 3RHZA 2X1VA 2ZJYA 1Q7CA 1VB3A 2I54A 3MJSA 3R0QA 4L1KA 4L5IA 4PFJA 1FZTA 4B2IA 3RR2A 4H9GA 5DHFA 3PE6A 4DIBA 2YVAA 1PUIA 4BLRA 2IBTA 1JIJA 2ZQ5A 1L1RA 2AEMA 3LKZA 4J7AA 3ZWPA 1A7JA 5A4MS 2CHVA 1V5IA 1G2IA 1DC6A 1VJ5A 4TSKA 3VZRA 1EB8A 5IS2A 1L5FA 4OTZA 5JISA 1Y5RA 5JZOA 2DR2A 1U1FA 2J31A 2K2WA 2Z2IA 4JC4A 3LGAA 1BX0A 1V1RB 4KYVA 5BV0A 4KYUA 1UFQA 5AHXA 5F21A 3VYTB 1DBRA 3UKOA 1ZW1A 3LQQA 2ZSDA 3RTGA 1FJXA 2XB2A 4QFDA 3A4NA 4ZOBA 3TM5A 1NY5A 1C8KA 4LF4B 3DM9B 3LX4A 1C30A 3NJ4A 4FQ5A 2J3DA 3WGNA 5J47A 1T0IA 3RAPR 4IIEA 2IC5A 4J2HA 2ZSEA 3KAJA 1OZHA 4ZYUA 4CF5A 3QE0A 1QIMA 2VA9A 3W9UA 4KWIA 4LXIA 1QIGA 4DJAA 2QHXA 1V9CA 2P62A 1ES9A 2J48A 2OD2A 3AVXA 4DR6B 2D1QA 2P6OA 1TX4B 2A1UB 3PJEA 4WESA 2LKDA 4ZOLA 4U7TB 3ZCUA 2WDPA 5T67A 2EX4A 1P0PA 1GNRA 3A58B 1DAOA 2XUOA 5JLAA 1N7GA 4EM6A 1PL6A 1COWA 1AURA 3CR8A 3ABSB 3FLMA 4U2FA 4YUXA 4GUDA 3RJ5A 4HX5A 3QPUA 2OV2A 1YQQA 1KKMA 2GBCA 4B7ZA 1YONA 1RM0A 1ZUD1 3D54D 2WHXA 3GCGA 3GROA 1VG9B 3GZNA 4GZ6A 4PONA 3I62A 3RIYA 3DEFA 1G2PA 1SUDA 3JD2A 4O2AB 1DLIA 2PKYX 3EYAA 5K6AA 3PB3A 4A92A 1EDZA 1SK8A 4H35A 4MWBA 3PDIA 5CLLA 2ZRLA 5D6NA 3ZLJA 1H3EA 2C03A 4WZAB 1L5QA 1WMSA 4PGGA 4OUDA 5T6MA 3P2OA 4QLOA 4R2JA 4RU1A 5DBIA 2OXEA 5GP1A 1QGUA 3M83A 1ZH0A 1GUDA 4IZIA 4B43A 5JAMA 2AW3A 4DWJA 5BY2A 4F7WA 5LVAA 4Q4CA 2BTQA 1KO4A 3E4DA 3F2IA 3W5IA 4L5AA 4D9MA 2BHSA 4UE6A 4F1WA 2PUHA 1SIBE 3GGPA 5BN1A 2PKWA 3AHIA 4OI4A 3TNYA 4HZUA 1KVTA 2XA9A 3MMPA 4DDKA 1D6SA 3BTSA 4YALA 1D2AA 1WTCA 1P61B 3D31A 3ZLUA 2RCNA 1BXGA 2F55A 1UMKA 4Y6OA 3V3TA 4ABYA 4XD2A 1ABEA 1Q1BA 2PGAA 3F6SA 5FP0A 4F84A 1VYTA 3V2HA 4R7ZA 4AMGA 4P4SB 3GIDA 1UDBA 5TJ9A 2OO5A 4KRGA 5BQ5A 3HMQA 1W6RA 3A6ZA 4N82A 1J00A 3AW9A 1M73E 4GRDA 1CJCA 3GMDA 1VL0A 1Q22A 4XDGA 2XB8A 1B42A 4X85A 1C7IA 3NUGA 4OQFA 5KUTA 1BMFD 3ADBA 2IDJA 4OU4A 5TMDA 2HDNB 1WEKA 3EY9A 3NLLA 2B21A 2ZETA 5KKCA 2QPLA 1UP4A 2QJWA 2XV1A 3RRZA 1M83A 4ZVNA 1MTZA 1OI2A 3I45A 3ZJ4A 5JIBA 5AKXA 4TWZA 1A9RA 3THSA 3SIPA 2CLDX 4O0MA 3CF6R 1OQAA 2AOXA 2RHBA 3B38A 3EC1A 2ZB7A 2EP7A 3OUZA 3VZBA 3B9PA 2P9EA 1UZMA 5K05A 1IY8A 3NVMB 5E9AA 1T3LA 1X15A 4IWNA 4AVYA 2CGEA 1Y9DA 2A14A 2CF6A 4LJ6A 2PSEA 4N47A 3CEMA 4EHLA 2PANA 4Q9HA 3UK1A 3GLVA 4HJRA 4JI3B 5BR4A 1JL3A 1M6VB 1UFVA 1FX0B 2B37A 2GUWA 3VU3A 2B25A 1ZINA 3P2YA 1KDZA 1GRQA 1RIFA 1Z34A 2C92A 3GQVA 3RFTA 2BN4A 3DKPA 2Y1XA 2FH5B 2PX6A 4LJKA 2HYIC 1JR6A 3L8HA 1AGRA 1M74A 3SM3A 1F4VA 2GZRA 4TLMB 4OJNA 2X5XA 1WA5A 2ZR0A 1GM5A 4BNKA 5KSOA 1CY4A 3B85A 5FULA 5ADVA 1JV2B 1WXEA 2WF8A 4UHBA 2WWVD 3WR5A 2FZ4A 4MYCA 1CZHA 3I6ZA 1M66A 3FGNA 4QDOA 3VQTA 1OUMA 1CZUA 1OH7A 3TLBA 2ZJ6A 4BHTA 1IYZA 2X5NA 3K30A 3KLMX 5C0OE 3FPJA 4QOJA 5BN3B 3NOOA 1QHEA 2G36A 2LXNA 2OVFA 3AI2A 3JQCA 4EYGA 3NHMA 5B4VA 5MF6A 4HOYA 4DLZA 1OU4A 5DMHA 3MT8A 4L78A 3TAHA 4BP1A 2JAOA 1LZKA 2PJZA 1EBBA 4IGIA 1LI5A 4AY4A 1QV9A 4L6CA 3QOFA 4UPDA 2WJGA 1FQJA 4WZBB 5EIEA 2NQ8A 2NZVG 4E12A 1E79D 4R8VA 4A91A 1GUFA 2GILA 3WDSA 1GQFA 1U9YA 3R75A 4JP8A 2PNFA 5HGXA 3WY9A 3SNKA 3DFUA 3ZK7A 2Q7XA 2HY7A 2XMQA 4Q4AA 2NZ8A 3DDOA 4YRMA 2COKA 1AZWA 3H7IA 4O4HF 2ONYA 3PP8A 3ZDXB 3R7WA 3RUCA 1OCEA 1ZONA 3K0CC 4JLDA 4QZVA 1B8VA 1G42A 2VBIA 1AKMA 3LLMA 1PJTA 3ODGA 4GQBA 3THRA 3W9BA 1QQ7A 1KEKA 2R8EA 4UOEA 1I94B 1UFKA 1GO2A 1HDYA 1VLMA 2OCPA 3C6XA 2Q7OE 4ZI7A 1CX9B 5HSGA 1Z4OA 3M6VA 1YC2A 1XL0A 2QTGA 1QHXA 3RSOA 4IFBA 2QZ9A 4MUGA 1IRIA 4NF2A 4YAJA 1PFGA 1IDN1 1ZXXA 3KJZA 4YBRA 4KO2S 5MFPA 2PGXA 5IH7A 2W93A 3NHFA 3ZD7A 4MKIA 2NVUB 1T5DX 5TDHA 2Z83A 2I2FA 4MR7B 3TVYA 1C1DB 3EDRA 2QAIA 3H5AA 4GR5A 5B1YA 3IIIA 1XEAA 3B1FA 3M5CA 3G59A 3OC0A 2P9HA 2O1XA 1B8NA 2QD3A 3BXZA 1HORA 4U7GA 3DEJA 4BO0A 3HM2A 4B33A 1V9SA 2UXBB 1Z63A 5IC4A 4YI3A 4RHFA 3G6WA 3AY6A 2F48A 4LQDA 1ORDA 1SHKA 3FCXA 3B9BA 3ZQJA 4D43A 3MILA 3JTEA 4H27A 4R3NA 2PEYA 4M9UA 1XNHA 4NBTA 3LDFA 4DCPA 2OHFA 4ZC8A 1NUTA 3IXQA 3DFKA 3K6KA 2DH5A 4HFRA 3RKRA 1COZA 2EF1A 1TZMA 1OGYA 1DRJA 3IBYA 2Q45A 2NIPA 4BP3A 4ZJYA 3WISA 1NX6A 3CX8A 5MHTA 4I5DA 4A0RA 4B6SA 4WEQA 2J30A 4Q16A 3VTKA 3OT1A 3EGCA 3OI7A 1XKQA 3FLBA 1NVBA 2QE6A 5AXBA 3WIEA 2R1TB 1VTKA 3RASA 2WWTA 4S0ZA 3HVUA 1MX1A 2Q21A 1MG0A 4YMUA 1OBHA 3NT2A 1TM7E 5K0CA 3KDPA 3PLAE 4N7RA 3PHBE 4AC9A 4MAFA 4X6LA 3UPUA 1MUUA 2EFCB 4RVHA 4YFVA 3R20A 2ETVA 5FTMA 5ALMA 5TRTA 5BUQA 4PYNA 3WRXA 1GPWB 2R48A 1G8HA 3OMLA 4B7AA 4NCBA 1L7MA 1DUSA 5KVQA 4B84A 3DKVA 1CVRA 4F5YA 1GFIA 4BFXA 521PA 1RKBA 4PZAA 4M21A 5BNTA 1UM9B 1TU0A 1QM5A 4IRMA 2Q3CA 4IIJB 3TQRA 4EFDA 1WV0A 1QQ6A 3PUJA 3U1BA 4YUYA 2EP5A 1ZEMA 1G8FA 3TS1A 2G8LA 3GRUA 1LBTA 1DJNA 3WTBA 1OXUA 3OX1A 2BV3A 3SYLA 1K3TA 1IXKA 1X7GA 1KP3A 3GGCA 4NZYA 4Z51A 1HLGA 5KSPA 4OQ4A 3WNZA 2BZGA 4FBGA 3WLFA 2QRUA 4Y2HA 1QQAA 3SZ3A 1H2AS 3IE2A 2R66A 2XMSA 3M4ZA 2BHLA 1M54A 4C0AC 4D4HA 2IZ1A 2CVQA 3CT4A 3OTOB 1C81A 2JARA 3A4IA 1N3LA 3GRPA 1GTVA 1G8KA 5DLDA 3WJ2A 3ZNNA 3NOXA 5H83A 3DHYA 1ZU4A 2J07A 5JVDF 3HPQA 1NLUA 1IE3A 3BD6A 1QV6A 4UBJA 5J1SB 3OJ0A 4CF7A 4OI0A 2XUHA 3G1UA 4HVCA 1EFHA 2BR4A 4KUHA 2HA0A 3O82A 1PE0A 1NNUA 1I6MA 1EPUA 4GDFA 4O1MA 2AJTA 1Q3KA 1BH2A 5TSDA 4CPDA 3Q12A 1WKVA 3BMXA 4KFTA 4OVKA 4PR0A 4BJ6A 5IT4A 3DXZA 2VPYA 5TX7A 4JP5A 4KQ9A 3U4HA 3GDGA 4JT4A 3M6LA 4ZV9A 1KPGA 2JFPA 2DB3A 2YZGA 2FPWA 4OXRA 3UAOA 5KREA 3DE7X 2F64A 2QDKA 2WAYA 1TJ4A 3AEQB 5BV8A 1MJNA 4RBNA 3GLQA 3MS2A 4BLUA 1EGHA 5AK4A 5AW3A 4QXRA 2DTXA 4C87A 5L3SA 3Q8LA 3HFJA 2ZYSA 4PYQA 1GR0A 3F1KA 5C9ZA 1YKGA 4A03A 5MN6A 1XTIA 3N2GA 3TGPA 5DK6A 4P81A 1JEDA 3ZD8A 3CLUC 1PD0A 1GWNA 1O96A 1DCMA 2QMOA 4E08A 3P1JA 5KHLB 1CE8A 3RUIA 4AWAA 1RJWA 1N0IA 4DBLC 2JKYA 5ERGB 4RV5A 5E7JA 1EAYA 5L3QB 4K9OA 1HDGO 2YJ4A 3PC2A 3DEZA 4TQ9A 3NNSA 3PWZA 2Q99A 1DL5A 3NBUA 3IBCA 4IV8A 4PAOA 5FFMA 2RAFA 3B3QA 1IUPA 2NO1A 3FTCA 4NZNA 3WLPA 1XI2A 4DMUB 1E9BA 3QNWA 1W2GA 1FUYB 4BNJA 1O0CA 5IBCA 4B85A 1ZKMA 1GPKA 2XVYA 3CTPA 3JRNA 4PPNA 1LPOA 4R9RA 4P0QB 3IOCA 4QOHA 4WOPA 1U3VA 1ZMOA 4EGAA 3FAKA 3EVAA 4GPEA 4L5BA 3T3PB 1IAQA 2JZCA 3A2MA 3GNSA 1XEFA 2FW8A 4MW1A 5EWMA 5BWLA 3S81A 2ENUA 4E0BA 3PQEA 2GAOA 1PBNA 3L8ZA 2J9FA 1U7XA 2QQ5A 2PU7A 2FGJA 1ZNXA 2FSSA 3FUTA 3QTTA 4BBAA 1EEXB 1E1CA 3VR1A 5ENVA 2O8EB 2XODA 2EG5A 1VIAA 3L8YA 3LPDA 3PD1A 1ZN7A 4QUIA 1DAIA 1W4CA 1JYSA 2RKOA 4AJHA 1K75A 1FSGA 1XCOA 1ZM9A 1E1RA 2PRYA 2JL1A 4JLSA 3EQ6A 5EQTA 1OXKB 2V7QD 4OFBA 4OBWA 3EFBA 3IMGA 3LXRA 3LCJA 4MS4A 3HE3A 3D6NB 4WY2A 1XZIA 4I5IA 1PJQA 4CBVA 1KVQA 2ZRBA 3BWEA 6AT1A 1TPYA 4R8RA 3CB4A 2GYVA 3PGJA 3H04A 4GF5A 1Z22A 3LD9A 3LBNA 4TRJA 4WASA 2GLUA 4ZALA 3IERA 1S8OA 3CG4A 5JSKA 4C2TA 4MGKR 4UNSA 1JDNA 1FK8A 2FY8A 3GCZA 4KE9A 3N07A 2X0EA 1P1KA 3HRKA 3I9V1 2TRSB 3L7JA 5E1BA 2NUBA 4X6UA 1JU3A 2I55A 2I4NA 3OEYA 1QIFA 4TPKA 1YI0A 3DTTA 3ZDFA 2EP8A 4D74A 1IZZA 1NT4A 1H23A 3SYMA 4F4CA 2XGGA 4ED9A 4Q00A 3PC3A 3U4IA 1I7LA 1N2GA 3O8RA 4H77A 3MCWA 4CW7A 4J0FA 3UANA 2W2MA 3LRTA 4IUCS 1W46A 1RACA 3TLMA 4WK4B 3MB5A 3OKPA 4IYJA 4Y9RA 2HWWA 4M8NE 4F5WA 1QYRA 4GE0A 4A10A 1EFAA 2EL7A 3UAZA 5DASA 4Q0MA 2X0FA 5EUCA 4LJ7A 1GZHB 5GPBA 5JYCA 3PGLA 3H4MA 3M1LA 2BGIA 2Q4DA 3EAGA 4FYWA 5GV8A 4EITA 1ECFA 3PCTA 1JG2A 2XJ9A 2DBQA 4DHWA 1P2SA 4V0QA 1O5TA 2AC2A 2W7TA 1WXGA 1Y6QA 1MD9A 2ZB4A 3IPCA 3KKKA 4P9NA 3RROA 2NGRA 5A4DA 5C7YA 4Z3OA 1C4KA 4P3KA 2FLWA 3VR3D 1LVHA 5AM0A 1QGAA 2NXEA 4JT9A 1GFSA 1EAMA 1U2ZA 2E48A 2DZDA 4YRNA 2PYDA 4DY4A 3GF4A 1SBZA 2R6JA 3CNQS 4KQIA 1YL6A 4PICA 2BT4A 1EGVB 2H08A 3LF2A 3E1KA 1TZCA 3WGTA 2VK8A 3DNFA 4W99A 1RQPA 1VRWA 4YP6A 1C3VA 3FG9A 5D85A 5B3KA 3SR4A 3O8BA 9MHTA 5CFOA 1P1FA 3ORSA 2RGBA 3V4VB 5LLTA 3E5RA 3DPSA 2VQSA 1SRRA 4AJJA 1CUBA 1L5OA 2ORVA 3BYZA 3CNHA 3LPNA 1O2DA 5HOQA 4UZFA 5CLQA 1E2BA 2RHHA 1XAHA 2GWHA 1CY1A 1HQCA 3H8WA 3IMFA 3LHIA 3OU2A 5CT6A 5EHZA 1KAGA 3A6PC 2XCUA 3O31A 2PMFA 2Z1NA 4XTRA 3IC5A 1OYVA 4QJBA 4XPIA 5CGQB 4CR8A 1FS6A 2NU9A 3VR5A 1PUJA 5GV7A 3O7WA 6PFKA 4B2YA 3LBYA 1AF7A 1F6WA 3DGFC 1DX4A 3GAAA 2ZRPA 4ZAFA 1HQKA 2AI2A 4YRRA 2BFPA 3NNDA 3FN4A 4EEKA 3OJCA 2OXIA 3PZBA 4AUMA 1J8QA 2ZSHA 3R4VA 3DMNA 1U2RA 2ZUVA 1NE2A 1P31A 1AXEA 3NRJA 4NONA 5DNAA 1M9NA 1DAMA 2QXYA 5G1NA 3E3LA 1ZJYA 4C21A 3OZBA 3AJEA 4G5XA 4N54A 1B43A 3C3DA 1M0EA 4L6IA 3WYGA 4MUEA 2YZ7A 1KE1A 1Y81A 5KCZA 1DPFA 3K0CA 1MX5A 1CR0A 3NBZC 4C3OB 3PXXA 5DNUA 1GLGA 1TW3A 3GJZA 3CUWA 1CIPA 2R8YA 2W90A 4TYYA 4LWQA 3L7DA 1KU6A 1BWPA 1FU8A 1JECA 1RW4A 4UDOA 2VYFA 3I2KA 3L77A 5CCBA 5CNIA 1WUIS 2A5LA 5FH9A 1A1VA 1TMGE 1G7SA 1Q7EA 1P5JA 1YIAA 2OCLA 4FEAA 4I1OA 5TQ2A 4DBLE 4EY6A 5I3CA 1A5BB 3MFYA 4OIMA 1OWOA 4WNAA 3VX4A 3OPXA 4WN3A 1QYVA 3U9TA 4IJMA 2C2GA 5JLJA 4NXMB 2UV8A 2AN3A 3M2PA 3NHLA 4QOSA 3TRFA 4EPVA 5AUNB 1KOJA 2ZAMA 3FKQA 3G9ZA 4FNOA 4DZZA 2ZM5A 3KK0A 2YYAA 2X8AA 1N6RA 4PGAA 1SIOA 1L8QA 1NR1A 2PS9A 5EIAA 2V65A 5A71A 2FHSA 3CZ5A 3RUFA 4BRUA 1XPRA 2F59A 5CXSA 2XOEA 2AT1A 3DLCA 1ISHA 4BQIA 1OFUX 5CG1A 4G07A 3KD3A 4QBIA 4MJ7A 4R84A 2QT9A 4JELA 1ZD5A 2QGNA 3AOEA 4D9KA 3CYFA 2NYRA 2GK7A 1I36A 1E6CA 4MQEB 3MPUA 2B1RA 1X7ZB 1PX2A 2WHPB 4HXEB 4JT2A 3T3IA 2DQZA 1EE9A 3ANMA 2IX3A 4RX1A 1JFTA 1U1EA 4OHXA 3TD2A 4WBXC 3C8DA 1KEWA 4UNNA 1N2OA 2HCBA 3ZDZB 1E2FA 3VSCA 5JD3A 1U3CA 2AL7A 3H1BA 2JC3A 1KP9A 3O8QB 4Q1AA 2EKZA 1ZGHA 4U7DA 1UQRA 2HLNA 2X86A 2XDWA 2WZDA 4FHEA 3A3YA 2HWKA 4U9UA 4XOUA 5ILGA 4CV1A 1JDUA 3EGXB 3DUWA 1MZVA 2BZ0A 3GXOA 4NMHA 5CTAA 1MO3A 2B3DA 1DB3A 4X6XA 3RTDA 3V1LA 1KS9A 3W2FA 1YMVA 2AVNA 1U8FO 2N1BA 4RCYA 4B3IA 4LZNA 1DZ3A 1JQDA 3SHWA 4DNQA 1NSFA 1U80A 3C1AA 2GHIA 1ORRA 1GDHA 2IPLA 2EFGA 3RV4A 3OIVA 4MX8A 4LOJA 2WWWA 3GLFE 4DM4A 4E2WA 1IXRC 2CE7A 1BN6A 5EP4A 3Q7QA 3TSWA 4WOJA 5C1OA 5DJ5A 2PPVA 4Q3LA 5M04A 3CF4A 3D0QA 4M1KA 2AXNA 3L0PA 3KSAC 4RK5A 2H0QA 2XUJA 2IHNA 3IVRA 3OZAA 2FW7A 1PZMA 4AMYA 5CLFA 4Q7KA 2B30A 3X2EA 5ALSA 3FDZA 4FT4A 4RJKA 3OCZA 4RIIA 5J1TB 2FF5A 4D9FA 2Z6UA 2QMYA 4TZKA 5ALWA 5CG2A 1MEOA 2BM1A 2O7NA 2BUBA 2QSUA 2O8DB 3JWEA 1OPRA 3L6DA 1N57A 5KYUB 1Z18A 3O92A 3Q7SA 4BUZA 3QU4A 2A9FA 2GVNA 2LIVA 4HG2A 4MA0A 3W5VA 3D3JA 4OATA 3WMGA 2VP2A 3P0HA 1RSZA 3N8NA 1V1JA 4D02A 3P0RA 4C4YA 4LYAA 1DCKA 5EJ2A 1JWLA 2WU0A 2V8OA 1G16A 2BP7A 3F47A 2F7SA 3CS3A 3WL3A 3HA5A 3UMGA 4IHJF 3HVKA 1MA0A 1I5EA 4HUQA 4FLMA 3L6OO 3VSBA 1M6EX 4C4ZA 3S8YA 1H3NA 2PV0A 3BZBA 2DHEA 4B75A 5DN6D 3IKLA 4IDFA 1TJYA 4PHGA 4Z0NA 5CDSA 1QPZA 4DWVA 4A8JA 2RHWA 3RU3A 4Z0HO 8MHTA 1VRVA 2QN8A 4G0PA 1VJ1A 3UN1A 1G5RA 4PBRA 4TZ0A 3HJCA 2MSEB 1M1NA 1E2KA 1SKMA 4U0JA 4E6EA 1FTGA 4Y2YA 4H2DA 5K3SA 3FPKA 5JHGB 3HVIA 4IZOA 5JC1A 3DTNA 1I3MA 4DSZA 4J16A 3GLTA 1E9DA 3MJDA 4I5EA 1WQ4A 4DABA 3MJ4A 2AW5A 1BHQ1 4Q3EA 5KU1A 1XA0A 3KKZA 2FGKA 1HTTA 1RWVA 5HIJA 1ECJA 2Q5JA 1QRUA 5F2NA 2VZ9A 3RS5A 5J59A 3TR5A 4XEUA 2CLFB 2V7UA 4YAKA 4QPNA 1GA4A 2OHXA 1UKAA 4ZRMA 3TQCA 2WSMA 2VJCA 1AY0A 3AHCA 5JWHA 1ZN2A 1S8FA 2H4WA 1JJ7A 4MR8A 1I4OA 4KI7A 1FRVA 3G2MA 4G2NA 1V7ZA 2DCMA 3HBFA 1AIPA 2ZK7A 1ECCA 4GI3A 5DFAA 4XWGA 1PT9A 1IHYA 3MSCA 1D9XA 2J6BA 4GXQA 2ZYRA 1PZFA 5F35A 5KTNA 3K0AB 1NFQA 1VOTA 4IHJB 1A9OA 2IITA 2J6IA 1YS4A 3PSHA 4M7OA 1DX6A 3RHTA 5E7MA 4PNPA 1MB2A 2W42A 3OCWA 4O63O 5FL7D 1YT5A 5F5XA 3H4IA 1S89A 3JVUA 2FW1A 5LQRA 3T3NA 1PWYE 1NZFA 2LW7A 4WFIA 1NQ5A 2EJVA 3KBOA 4XYGA 4BXOA 3K94A 4CMEA 5ALIA 2O2SA 4IR7A 3D4IA 1O0BA 5F4BA 4XOIA 2NO0A 3U4QB 3ENZA 2ZRKA 4HEA6 2VLBA 3NWOA 5FA8A 3HG7A 2ZATA 4NZPA 3M34A 1RCUA 1UJNA 3BQNB 4XLLA 3QXSA 2ILTA 2XBMA 3BOSA 3AR4A 3IEXA 2V97A 3QZUA 1UMBA 5LYJF 1H0KA 2VQEB 4RZXA 3F7OA 1JWAB 1K86A 4HWOA 1WLYA 4CKBB 3BWVA 1Y82A 4EAAA 3W7VA 1ZJ5A 3G0CA 2HSGA 2P78A 4M4SA 3A6GA 3NR2A 3L8DA 1B1AA 2EL9A 1G3RA 1V26A 1N2EA 2ZQYA 1X1BA 3R9IA 4D82A 1NBME 2PGDA 3MWJA 2WABA 4PR3A 4WKNA 2BGGA 3PNVA 1BCSB 2XKBA 3E7FA 1U0OC 2ANCA 3FYUB 4LKOA 1UXHA 1SC6A 4R4JA 1R0LA 3T5PA 4WKGA 1A5SB 3Q7RA 4HXGA 4EA7A 3CPJB 1WBJB 1CJBA 3P2MA 4AO6A 1F3LA 1I4LD 1Z5PA 1B8UA 1XXHB 1QG6A 4LTNA 4HADA 2ASEA 3TW4A 4B6EA 1I0ZA 2OCAA 4DNOA 3AWDA 1KPHA 2LDXA 3THOA 3ZDBA 1AH2A 1CZNA 5JCPA 1FMCA 1H2EA 1ZK3A 1UBSB 4FYXA 4LG1A 4YLGA 1KFKB 1LPSA 2RSLA 4HDSB 1VI5A 4OB6A 1FMFA 3T35A 3OJFA 3ZKWB 2DWPA 2AK2A 1G291 2X3YA 3K5HA 4RHCA 1G4HA 3WDKA 3G8CA 3G2PA 4D0NA 4OQEA 5LOVA 5TF0A 1X94A 1WMAA 3QFCA 2NSHA 2JLUA 2JLYA 4EPRA 5SYAA 2C7PA 4JQOA 1AGYA 4C30A 3EXG1 3NALA 4IIVA 2HPHA 4N5HX 3FNHA 4M1SA 2Z5GA 2ON6A 3B6ZA 2C8VA 1HFJA 4OFWA 4YT2A 2RHDA 2QR2A 1AKTA 3MJVA 4TQUS 3U5TA 2F1RA 2VR1A 4DWWA 2QN2A 2PKCA 4KAFA 1E4EA 1YMQA 1L5LA 3EPJA 3IHTA 5LMCA 1UC4B 2JIQA 3T7KA 2OGUA 3TNFA 2IXGA 4MRRA 2H1VA 1KZHA 2X8JA 2XX3A 2GUGA 2XTJA 3EMKA 1T1SA 3GLRA 3E1SA 5KCMA 2Y27A 1KHTA 1TKCA 4G8CA 1EZZA 1CY7A 1EFKA 1GGVA 2C5HA 2MYTA 3W4IA 4R41A 2YYYA 2ZIXB 4B5KA 2ORIA 4BMNA 2NZYA 3GFFA 1OT3A 4FZRA 4RORA 4JXZA 5FBLB 4C04A 4YN3A 4K28A 3KQTA 4B31A 3R44A 2XMRA 2PZGA 3BRQA 3CRNA 1VPWA 1WB9A 2V58A 1MX3A 1XPUA 1QYWA 3H2KA 3QOXA 2J33A 1E2NA 3KSMA 4M7PA 2HO4A 4NE9A 4WLOA 5E8JA 3U13A 3WBKA 4MQUA 1F0KA 2HF9A 2HBYA 4MJXA 4ZCSA 5JANA 4EI8A 2VJDA 4C5AA 4EI9A 1T8TA 2VJPA 1OLSA 1O6BA 4RD6A 1IZ9A 1WE2A 2GK4A 4K6GA 4D4MA 4DMCA 4JOSA 5CFLA 1DIHA 4Z7NB 4ZZ3A 5HTOA 5A0TA 2FEXA 5K3OA 1XCGB 1NMXA 2NW6A 1MDBA 2WWGA 2ZVDA 3W8RA 1G8GA 1GXSB 4DDHA 4M1WA 4LZOA 4ZICA 1V39A 2R87A 3HDJA 3QMVA 2FR1A 1QK3A 4OQZA 2Q49A 3WLQA 4Q39A 4A6PA 2HW8A 1GITA 1N5MA 3DDZX 4FWBA 2D0PB 4ZHSA 2XZLA 1C9MA 2Q3HA 3UT5B 4AJKA 4HEHA 1M2FA 1W0CA 4JP1A 1IJBA 1LK5A 1KMIY 4RZIA 3SFTA 5J4VA 2A0YA 8ATCA 1RMYA 3MCUA 4W9MC 1O6CA 1Q7GA 2I1VB 2X8LA 3LQKA 3OZVA 3UGQA 1NQAO 2FSPA 3ILHA 1FSZA 3N9IA 4GWLA 4HP8A 5DU2A 3V48A 1LCIA 1KORA 3NRBA 4G9BA 4IO1A 5KNDA 1B14A 3D8HA 4B87A 3AF2A 1DIRA 2H2DA 2WHEA 2WVHA 3SNHA 4HWTA 4NZMA 3UIEA 4F1JA 3DD5A 3AR7A 1Z4MA 4L50A 3UWOA 4Q02A 4MWDA 3BL6A 5LSAA 5K4HA 3W77A 1DAEA 4NYJR 1V1MA 3CONA 6NULA 1D9ZA 3IOBA 4K9KA 4QPZA 4ZEWA 5CA1B 5ER9A 2HMAA 1SOMA 5B1DA 4I1PA 1UF9A 4J75A 3R4CA 4J0JA 1WHSB 4CEJA 1IM2A 4UAUA 3M6XA 3WK4A 2Z6QA 4DY6A 3RRNA 5KYYA 3L4BC 4E5KA 1XHLA 3HY3A 1GG9A 2PD6A 3R0JA 1CQIA 1KIAA 3IH5A 4X63A 5DVZA 5FBZA 1LDYA 4ZGGA 2IPOA 3ZPXA 2AFIB 2QW0X 2ZYDA 7YASA 2C57A 1H9BA 4L8WB 3N59A 3A9CA 3KZVA 3TUIC 3ZVMA 4LF6B 2EFHB 4M0CA 4Y6QA 821PA 2C5LA 2WT8A 3TTXA 1E79A 2WTUA 1YQUA 3FWYA 1Y42X 2ASVA 3IBSA 1D7OA 2QRVB 5CURA 2C94A 2H4XA 3O8LA 2BP7B 4QTTB 4REOA 5DGTA 3UPDA 3DE6X 5BQ3A 3LGSA 1HKUA 4AKGA 3CH5A 2D3WA 2EQBA 3KG2A 3JQFC 1X80B 4F2DA 3KXDA 4QYWA 4ZI5A 1E2PA 3K9WA 3EA4A 4WOBA 4H7IA 2GD6A 5LUBA 2TSYB 4EI2A 3HUEA 2LCFA 3KO8A 4P53A 1ARZA 1M76A 1FE8A 2EXXA 2CDNA 3T1NA 5I48A 5JROA 4LRQA 2VKQA 4RTMA 5TGZA 4UUMA 4M9XA 2GD0A 4UUBA 1T24A 3BXXA 1CUGA 2QX4A 2I7CA 2WKPA 5GJBA 2W6CX 4CQLA 2GPAA 4KZPA 4BQEA 1RYBA 3DWEX 4MV5A 3DCIA 1W94A 2IWRA 3CW8X 4G5RA 4TT3D 4Y1EA 1YD7A 2QN1A 5AHKA 2MR5A 1TXGA 2COUA 4B3GA 1C8VB 4W6ZA 1IZYA 1PL7A 4NENA 3S2EA 4PZUA 4RPJA 1XQVA 1Z0AA 1WU8A 1RC1A 1QNLA 3CWQA 1MAAA 1PQUA 5E6UA 5FJJA 2QENA 5TPWA 4EA9A 5IKOA 3PDIB 4RJIA 2QLMA 4K26A 4FFVA 2QUAA 5E1DA 2YZ2A 4DF3A 1GGKA 3INGA 2H4ZA 2WDZA 2FX2A 3D43A 4K87A 5EYPB 4WXHA 5A6VA 3QEKA 3R3ZA 5JXGA 3IQZA 4E15A 3DDWA 1OH5A 2V1UA 5ALZA 4EJFA 3PNLA 4HNTA 1ZOSA 4KJXA 2GF2A 1V45E 2JGAA 2XGMA 3PNMA 1BEEA 3WIBA 1PS0A 4GYWA 3DVSX 1GRCA 4OH1A 3KWFA 5LD2C 3ENVA 3QWBA 4U2EA 2X4DA 3T7SA 3FTDA 1IUOA 5FTLA 4P7KA 5B2ZA 2XQIA 1CB7A 3AOEC 3MTEA 3VNAA 4AF8A 2GARA 4X8HA 1F8YA 1CEQA 4IKEA 2AN4A 4F11A 2KHZA 5E38A 4A5SA 4KHZA 2OFXA 4PG7A 1S01A 4ZT6A 4AZTA 3KL2A 1Z0KA 3K1YA 3RO7A 1BDBA 221PA 4BMZA 2BDUA 5JJIA 1CT9A 2HIAA 3ZBUA 1XKXA 1TUBA 1DQSA 3TBHA 5HFNA 4BGEA 3TRIA 2JJ2A 2FKAA 4OM7A 4I4CA 4KDEA 4YA6A 5L3SB 5KNBH 5JXJA 4D81A 5IU6A 3ZEAA 3FJ1A 1C0EA 3L49A 2G3YA 2PXHA 1QXSA 1ZM2A 1JAYA 2B61A 4W8OA 5FF9A 2C1ZA 5LWQA 2C2XA 3WXBA 5EPEA 1LJUA 1N2BA 2VXOA 3IVCA 4OHRA 3E5NA 1SXJD 4N3NA 3UFBA 4ITRC 2DGDA 2X2EA 3L7YA 2GEJA 4FP9A 5EP3A 5B4TA 1ZNYA 2RHCA 2JKZA 1JDSA 2QM3A 1RBQA 3A6KA 5B5SA 3VPBA 3CZAA 4XLTA 2VG8A 1LBEA 1IEVA 4R69A 2BMJA 3E2MA 3TX2A 5BT8A 3DDSA 1FNMA 2RBKA 3ZWYA 4JLVA 2WQZA 2IRWA 1KAOA 3TM4A 5ERXA 3S5UA 3T99A 3VA7A 3K6JA 4Y2GA 3QOYA 2DVMA 1JQBA 1OBVA 2NXJA 2BEKA 1GPBA 5JC8A 1EGAA 1LW7A 1VKJA 5ALOA 1WCV1 3L0YA 3TLGB 3PNBA 2JPDA 5FT9A 4ARVA 4JLAA 4TYQA 1QTQA 3CE6A 5LQCA 3WKDA 1EXWA 4UPVA 1SJ9A 1XVVA 4GIBA 4GKJB 4DIFA 3SEAA 1NBWB 2BHNA 1J24A 2O23A 4KRYA 1L4GA 3SXPA 1M33A 3AF5A 5JVDB 3N76A 2WP0A 3QV2A 1P4AA 3A1FA 2IIQA 2GYYA 3FHOA 3JV7A 2D5BA 2Q62A 5IJXA 3FOZA 5KNLA 3T1OA 1V2HE 5DBGA 2UZIR 5FPQA 4WKCA 1U04A 4XPIB 4N76A 3HJBA 3JWHA 3LL4A 1SVMA 3OZIA 2XE7A 4MCJA 4DRYA 5ICGA 1UMBB 3QMPA 1P74A 3GG2A 5JNSA 1IJFA 4BNLA 1QP4A 1ODCA 1JPJA 1Z28A 2UVQA 3ICWA 3LWZA 4X3CA 1E1CB 3STWA 1JPVA 3N6VA 4EL5A 4JA2A 5IDWA 2HMYB 4U3JA 4R8LA 3IQGX 3BSYA 2AZXA 3EXHB 5B6JA 2QW8A 1O97C 3H5TA 5ARCA 3H2GA 5BXQC 4PIVA 3KT6A 2LCQA 4PGFA 4AUNA 1PEDA 4CKEB 4HWSA 2XNKA 4QU5A 1XTBA 3OCCA 4UU1A 4DADA 1O9BA 2A33A 2HA6A 3FYCA 3IE0A 4HDNB 4J7XA 2NTEA 5CDFA 3TTWA 3TI9A 2MINA 4ARCA 1C41A 2HKIA 1U7DA 1J2JA 2W2LA 3ZJUA 2Z5LA 1XJQA 3BIFA 2MDTA 1RYHA 2FYTA 3JALB 1S1CA 1BD3A 3Q7EA 2FN8A 1T0BA 3PU6A 3OJOA 2DWOA 3ETLA 4M6WB 1U8CB 2RHTA 1PR5A 2RJ3A 3WGUA 1W4LA 3GNLA 5IN5A 3D7SA 1QHYA 2F43B 5IC5A 3CRQA 2O50A 1C3OA 4ODIA 4J1TC 4LBYA 4R01A 3ZHYA 1P2DA 4W5TA 4LE0A 2ONKA 5FBQB 4ZV7A 2DJ5A 4K1LA 1L6RA 2OAQ1 3IPXA 1U63A 3B3FA 1P81A 5E3HA 1Z6QA 4MR7A 3EZ7A 4RW0A 1XD8A 1AKUA 4FBMA 1JFFB 1Y80A 3FOFC 2L42A 3H86A 2XHZA 1SC3A 1OJ7A 3LXXA 4IVNA 4QM6A 4LQLA 3NATA 4D5GA 1NVAA 2CXTA 4KACA 4F2GA 2HGSA 3LOUA 2VK1A 1PFKA 2WU4A 3F8SA 4LRUA 4X93A 3CUVA 4F06A 2WTMA 5IBRA 4UJ5A 1ZCZA 1VLQA 2EW2A 2YXEA 1CUJA 2FEOA 1MB9A 1WR8A 3T34A 1FDSA 3CF0A 4PO1A 4ARZA 4D7AA 3LIPA 1MJGM 3PNPA 1GVNB 2F4NA 3ERCA 1KJQA 4PWYA 4URWR 2WFLA 4NECA 1AS3A 4D3YA 1BWRA 2GCOB 1O6FA 1TC1A 5H4HA 3SR0A 3MOGA 3BIOA 1II9A 2ATVA 1VMAA 1OIXA 3JWGA 3LXUX 3VPCA 3TECE 4YJ3F 3WQHA 1QKIA 3T94A 3R0IA 4AJ9A 3UOWA 1OFHA 4LZAA 1FTSA 1XTTA 3K73O 5FLKA 3HGMA 3V1MA 4I1VA 4LF9B 2PUAA 2XSZA 2FR0A 3U9SA 5JADA 2E6UX 2I7DA 5GZ6A 1UK6A 1H6DA 4AZ3B 2W6ZA 3K9GA 2A1TS 3TAXA 3LHKA 1DIBA 1A5ZA 5BVGA 3P9RA 2FSIA 2VUIB 1Q91A 2BFCB 2GYUA 3K0FA 4URUR 4G89A 3E7WA 1Q0ZA 2G1PA 1G3QA 8ADHA 3QWHA 1YCDA 3C5HA 1CUIA 4YP0A 4DW8A 4DUZB 3BFXA 3QIAA 1NTOA 1II8B 3EH1A 3EGEA 4DYHA 3M6UA 5ICFA 4CZ2A 5KWIA 5DOZA 1JHRA 3HK2A 4Y1GA 5D1HA 1I3NA 3HH8A 3GJ4A 4EJ6A 3DT8A 4G65A 4EZEA 5JMOA 1RABA 5CBPA 2Z08A 3B7PA 1PQYA 1ZCFA 2XOXA 4LKRA 3U40A 3TL6A 1HYGA 3IBGA 2XQKA 4Q1CA 1J90A 5ELXA 5DLEA 1DAPA 4EGJA 2Z9CA 4R83A 2Z3WA 4XJXA 5L7TA 4X1YB 2WF6A 5GGYA 3I8XA 2FUG6 1RKQA 2P79A 2QORA 3Q1LA 4OMUA 1T3SA 4HNAA 3TLXA 4F1KA 2Z09A 5CH5A 4ME6A 4P54A 1QRSA 4MVXA 5GY7A 1ADCA 4QTZA 1GGHA 3A14A 1A97A 1KHHA 1U0GA 4BDTA 1OVMA 1TO2E 1UPBA 3A6EA 4WFQA 3WKEA 4DLYA 5ALHA 2JGKA 2YNMD 3B82A 1QC5B 5AKEA 2BLNA 4LHXA 3GCWA 3M9XA 1F2VA 4X60A 4M22A 3OPNA 1AHPA 2QTVA 3KZXA 1KQ3A 1E9SA 2PBLA 3GH1A 1JHPA 3MIIA 2VSNA 1IULA 1GZVA 4KK3A 3QUSA 4QJIA 1KIMA 2X9LA 1K6JA 3VI3B 4L2IA 3IDOA 1H8EA 2HCFA 3QEJA 1C1XA 3VAZA 4BL5A 5JZVA 2GKOA 1A9TA 1EBFA 5TB5A 1LNQA 1WHTA 3PNKA 1RJ9A 4DV5B 3CISA 1G3IA 3OX3A 4RKWA 3IBTA 3LUPA 1Z6YA 4PBTA 3JWPA 1S9DA 1VSQA 3PENA 4BKMA 5JMWA 1FRFS 1E2HA 2JD1A 5G3YA 3UJCA 2TMYA 1OC4A 2B94A 3ODPA 1ESDA 1HA3A 4WLEA 3Q0TA 2JF0A 1HT3A 1XCLA 5IPFA 1FC0A 4EBBA 3A9WA 4YP9A 2HMUA 4DREA 4MK4A 2PZEA 1Z0FA 2JFHA 5KO2A 1XWWA 1NNSA 2ZG6A 1E1QA 4UCWA 4UTZA 4ER7A 3GJ3A 4NFSA 3B3JA 2QJOA 4CM1A 4XUDA 2Q4RA 3EXFB 1INLA 5EKTA 4LFBB 4R2KA 1YZFA 1IXYA 5JAIA 2M32A 5H9VA 3CO5A 3SQOA 3R9WA 2XWSA 4ENRA 3RRXA 2FP4B 4JBLA 4KVFA 5LOVB 2X0DA 2WBLC 4RPCA 4S1OA 4IIGA 2JCSA 4HBZA 2HA5A 1KH3A 3DLPX 4FFNA 1Z36A 3I53A 5K8VA 1FS5A 3DO8A 3EODA 5KYKA 2X7JA 5DMXA 1XPJA 4QDZA 1X1CA 5JJCA 3RYHB 3BIWA 3DYBA 4F4FA 1QF6A 3FHCB 3W1EA 4GYYA 4PCUA 2GVDC 4YRJA 2VWQA 4OGFA 3TSZA 3AFGA 1CCWA 3UCXA 2F1KA 5MDHA 1SUSA 2B92A 1UEXC 4J6EA 1RE0A 1J1ZA 3X1MA 4ZKDA 1P4RA 1NC3A 3AUTA 3AP1A 3C8HA 2Q9BA 3HKBB 1ENPA 1Z6ZA 3AKDA 3PUVA 4H0FA 4LBZA 2IZ6A 4LRSB 5F52A 4DJJA 4PLVA 6ABPA 5HX7A 3WXMA 4PQRA 2GSDA 3LKVA 4S0XA 3UGKA 2FA9A 3S2SA 4DIUA 1P4JA 3GYGA 1G2OA 4WRRA 2DE0X 2R4UA 1EDEA 3S1AA 3NIDB 1T91A 1F9EA 4KXMA 1TW2A 1FFWA 3OF3A 4L07A 3BJZA 3PR2B 4NMLA 2CYBA 3N7UA 3PQCA 4PPQA 4BTLA 1QKJA 3L4JA 4JJ7A 3OQIA 4RS3A 3DE5X 2R8ZA 4FIZA 3IEIA 3DNPA 3TI7A 1NW9B 3QU5A 4MGIR 1T6ZA 2BFMA 5AKLA 3GEEA 1JJAA 4WLUA 4MKRA 1PG0A 3QX8A 3TDNA 1AQUA 1EB9A 1N3YA 2I1LA 1ZXBA 3YASA 3G89A 2A7QA 3VYVA 3P94A 2JAHA 4ZAWA 4G84A 3F3MA 3L5KA 1I33A 4KR9A 2XNCA 3ESCA 3OFJA 3PFCA 5BW5A 1NVUQ 1ZI8A 3GN2A 3C98A 3OM0A 3M1YA 2I4RA 1V8PA 4IDOA 2A5YB 2P2SA 9LDBA 4NRDA 1Z35A 2I1WA 3AM1A 4X5OA 3KFVA 3IO3A 3P9SA 3RI3A 1F8GA 3I30X 2ECKA 5AVQA 2WWIA 5GONB 2PO7A 1V3QE 1G4UR 2FQ1A 1OLXB 4JMPA 3CTMA 1AV7A 1Z9BA 5DLQC 3SGLA 4Z49A 1EZ4A 5FWYA 3ONWA 3HVJA 4D4JA 4H6XA 1V16A 3PCXA 4B3DA 1C3XA 1I2BA 1CK4A 2YS7A 1CNMA 3KB1A 4XYEA 4HNUA 4B3SB 2YFHA 5A02A 1FXSA 3A1EA 3V4LA 4FJ1A 3SHVA 5J5AA 4A82A 4V2UA 2ANBA 2XDQA 3W5AA 4UBIA 4D5EA 2DPGA 2I8LA 2A30A 2ZW9A 2WI8A 4D0GA 5SICE 4A36A 3W7BA 5CDFE 3VR4A 1KZGB 1Y1LA 2I2AA 3T5DA 4BRZA 2UU9B 2B0JA 3T61A 1CP2A 4RD0A 3RSGA 3SKXA 3CNNA 4A2PA 4DTCA 2OHOA 4EJSC 5AHRA 3R5TA 2YW2A 3D2CA 1CEEA 3ECAA 2Y0EA 3UWPA 3R3SA 4JLBA 5B4UA 1VCMA 1XZGA 5EJ8A 2GCGA 1W36C 2OA0A 3NC4A 1P44A 1IJEA 1YR3A 3WA7A 1BE6A 3BFVA 3UWDA 3KJFA 3VU9B 1DEHA 1R15A 2CXUA 3P71T 3ZTTA 1NY6A 3U3MA 4MW9A 1KH1A 2R8BA 1WTAA 1W5SA 3K70C 1IZ0A 1PK7A