1TKFA

Streptomyces griseus aminopeptidase complexed with d-tryptophan
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
273
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 108
structure length 273
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkfA00
3FF3A 4FWUA 4OC1A 2J9AA 3KGQA 1LAMA 4TNUA 4YWYA 2PJ9A 4P4DA 2ZEPA 3SJGA 4OIWA 4PXEA 2PRQA 2V77A 3IWWA 3KHXA 3D4UA 3MRUA 4MMOA 4NJQA 4ZY0A 5LYFA 4MRIA 2ZEGA 3NH8A 3FEDA 3KL9A 4OC0A 2F7VA 2F8HA 2C6PA 1LFWA 1TKJA 3D67A 2NSMA 2EK8A 1LANA 1ZLIA 2XEIA 3D68A 3S9MA 3IFEA 3LMSA 1Q7LA 2O4HA 3FEEA 4P45A 2BOAA 3FECA 3PB9X 2V8DA 2ZENA 2ZELA 1BLLE 2C6GA 5HXDA 5J1QA 1RTQA 4GM5A 4P6YA 1XBUA 4F9UA 1ZG8A 2BCOA 5K8NA 3BI1A 5JGFA 1CPXA 2PJ4A 1LOKA 1TF9A 2RB7A 4F8ZA 2JBKA 4MCRA 2PIZA 3NH5A 4MHNA 2AFOA 1ARMA 4PXDA 4JYWA 1HDQA 3D7FA 4JZ0A 4R6TA 4NGTA 4FUUA 2PJ0A 2JBJA 2V8HA 4NGMA 1F57A 4P4JA 2PJAA 3RBUA 4UEFA 3S9LA 3PRTA 4MCQA 2G9DA 4EMEA 4NGPA 4TWEA 5LYIA 2CTCA 5LRKA 5THWA 1ARLA 2PE3A 2C6CA 1TKHA 3GUXA 1LCPA 3S9NA 4G1PA 3GLJA 3HUVA 4AXVA 3N5FA 3IO1A 1BPMA 4PPZA 4P10A 1F2OA 4MXUA 1YLOA 4A39A 1QMUA 3SI0A 1VHOA 3KQXA 3PEIA 3KR5A 4IAVA 1Z5RA 3WC6A 2EK9A 4NGRA 1YMEA 4NFRA 5HVHA 2CTBA 1ELMP 1OBRA 1FT7A 2JEWA 1XFOA 4ZY2A 4NGSA 4P4BA 4RUHA 3DLJA 2HC9A 3CT9A 4FBEA 2ZEEA 2Q4ZA 4YU9A 1IY7A 2C1CA 2PIYA 1AYEA 1Z2LA 3L2NA 1UWYA 4PXBA 5HVGA 4IK2A 1Y0RA 2CF4A 5CPAA 2GLFA 4NJRA 2PVVA 3PFOA 3PBBA 4B6ZA 1XJOA 4MHZA 3B3VA 3FH4A 2NYQA 3PB7X 5D29A 5LRGA 2V8VA 3KI9A 1TKFA 2AFMA 5DS0A 2BO9A 4CPAA 5ELYA 4ZI6A 4X8IA 2HB6A 3B3TA 3D7GA 4P44A 3IIBA 3LWUA 1YW4A 4W9YA 4ZX8A 1YSJA 2EWBA 2IMOA 5K8MA 3H8EA 2WYRA 2ZOGA 4OIDA 1BAVA 1CX8A 4BD9A 3CPAA 4UIAA 4X3RA 3B3CA 4OC4A 3KZWA 4KSIA 1LAPA 3BHXA 2ZEHA 2ZEMA 4NGQA 1M4LA 3SJXA 3WABA 5F09A 1VIXA 2PJ6A 4A37A 4EWTA 3NA6A 4R8FA 4EFDA 4NGNA 2GU2A 1NSAA 3T8WA 4WJBA 2PVWA 2ZEOA 4A38A 2ABZA 4MHPA 4UEEA 3TC8A 2PJCA 1CP7A 3ISZA 1TF8A 1Z8LA 4P4FA 3I1UA 3NFZA 3FVLA 2FVGA 3B7IA 4FAIA 4PQAA 2POKA 2IJZA 2Q51A 5K8PA 4OP4A 5IB9A 1ELLP 2OR4A 5I4MA 1PCAA 1XRYA 5HVFA 1CP6A 2ZEDA 1BPNA 8CPAA 3PB8X 5LYLA 1ZG7A 4P4IA 3B35A 2V8GA 3HLPA 3IJ3A 4LQGA 4DUKA 1R3NA 3NH4A 2GLJA 1IGBA 1TXRA 4OMEA 4P4EA 3WC7A 2XEJA 4MCPA 4ZY1A 2Q43A 1CG2A 5LRJA 4R76A 3D7DA 3RAMA 3SI1A 1CBXA 2ZEFA 1DE4C 3SJEA 1AMPA 5JH9A 1ZG9A 2AFXA 3WT4A 5CBMA 1KWMA 2GREA 4OC5A 3PBEA 3B3SA 4Q7AA 1ZLHA 2QYVA 1GYTA 4DJLA 2RFHA 2I3CA 3H8FA 3BI0A 3IC1A 2AFZA 3FJUA 2AFSA 1YW6A 2AFWA 3V7ZA 4ZYQA 1R43A 3FX6A 5LYDA 3K2KA 3K9TA 4DYOA 3PB6X 1HEEA 4UIBA 3SI2A 4OC2A 3RZAA 2PJ1A 3SJFA 2ZOFA 4OC3A 2PJ8A 1Y0YA 2QVPA 3KQZA 4MCSA 7CPAA 4OKOA 2QJ8A 4ONWA 3CPXA 3D7HA 4K3NA 3KHZA 3BXMA 1DTDA 3JRUA 1CPSA 4ZX9A 2WZNA 2AFUA 2O53A 4PXCA 3WC5A 1VHEA 3B2YA 1JQGA 1XMBA 3TX8A 2PJ2A 1EE3P 2ANPA 2OOTA 1Y7EA 4R7MA 2PCUA 3FMCA 6CPAA 3QNVA 4MHYA 1H8LA 2VL1A 3KR4A 2PJBA 3GB0A 1QQ9A 5K8OA 4A94A 4UEZA 3DGVA 1FNOA 2PJ5A 2CIJA 4UF4A 3VH9A 3KASA 4X2TA 4F9VA 5JM6A 4H2KA 1VGYA 3D66A 1PYTB 2PJ7A 5D8NA 3ISXA 2XEGA 3PFEA 3PB4X 1HDUA 3H8GA 3IEHA 3VARA 4O23A 1F2PA 3V38A 4IHMA 4Z65A 2XEFA 2DEAA 4WWVA 2IQ6A 2PJ3A 3VATA 3MN8A 3B3WA 3CDXA
chains in the Genus database with same CATH superfamily
3JVNA 3IWEA 4MFJA 3FF3A 4FWUA 4NEXA 4AB7A 4OC1A 5HH1A 2J9AA 3KGQA 4JJXA 1LAMA 4TNUA 4EVYA 4YWYA 2PJ9A 4PK2A 5IV0A 4P4DA 2ZEPA 3SJGA 1IYKA 5F47A 4OIWA 5J8FA 5GCNA 1FY7A 4B5PA 4M3SA 4PXEA 2PRQA 2V77A 2YNEA 5CNPA 3IWWA 4XPLA 4CAFA 4QVTA 3R9GA 3KHXA 3D4UA 3MRUA 4MMOA 4NJQA 1X12A 3TOAA 4ZY0A 5LYFA 3BJ8A 3P2FA 4MRIA 4PSWA 2ZEGA 3NH8A 4B5OA 1XOVA 3FEDA 3KL9A 2ZW5A 4OC0A 4UCNA 1YGHA 4UWJA 3PZJA 2F7VA 4X5KA 1VKCA 4LX9A 2F8HA 4II9A 3FXTA 1IIDA 2B4DB 2C6PA 5G1ZA 1LFWA 5AGEA 2B3UA 1V0CA 1TKJA 4BBHA 3GKRA 3H4QA 3D3SA 3I3GA 3D67A 2OB0A 2NSMA 1Y9KA 2EK8A 1LANA 1ZLIA 2XEIA 3D68A 3S9MA 4XPDC 3IFEA 3LMSA 2QECA 4XPDB 1Q7LA 5EMIA 2O28A 2O4HA 3DDDA 3FEEA 4P45A 2BOAA 3FECA 4MBUA 3SXOA 3ZZIA 3PB9X 4HKFA 2V8DA 2Z3MA 3V8IA 1KZFA 2ZENA 1PU9A 1Y7RA 2ZELA 2AJ6A 3FNCA 1S5KA 2FIWA 1BLLE 4NCZA 3R9FA 2C6GA 5HXDA 1IICA 1CJWA 3MGDA 5J1QA 4KVME 1RTQA 4GM5A 4P6YA 3FYNA 1XBUA 4F9UA 1Q2YA 3R9EA 4H6ZA 1ZG8A 2BCOA 3DR6A 1NSLA 5K8NA 2A4NA 1AUGA 3JTKA 1S7KA 4JXRA 3BI1A 4CGPA 5JGFA 3R95A 1CPXA 1YX0A 2KCWA 2PJ4A 2Z3PA 1LOKA 1TF9A 2RB7A 3SXNA 4F8ZA 2JBKA 4MCRA 2PIZA 3GY9A 3NH5A 3TO7A 4A30A 4MHNA 1ARMA 2AFOA 2OU2A 3EY5A 4PXDA 4C2XA 1Z8WA 1HDQA 2R98A 3D7FA 4JZ0A 4JYWA 3EFAA 4MFPA 4MFZA 4NGTA 4R6TA 4FUUA 2PJ0A 4KORA 2Q0YA 2JBJA 2V8HA 4NGMA 1B87A 1F57A 4P4JA 2PJAA 3RBUA 4UEFA 3S9LA 2I79A 3PRTA 2Q04A 4MCQA 2FS5A 2G9DA 1OZPA 4EMEA 1ZO0A 4NGPA 4TWEA 5LYIA 2P6EA 4MJ8A 2CTCA 5C88A 5LRKA 5THWA 4BMHA 1ARLA 1YR0A 2K5TA 2PE3A 5EC4A 2C6CA 1TKHA 4LUAA 3GUXA 3TFYA 3VWEA 3FB3A 1LCPA 3S9NA 4JWPA 4G1PA 2VQYA 1Q2CA 3GLJA 3HUVA 4AXVA 3N5FA 3WR7A 4U5YA 2FXFA 3IO1A 4R3KA 1BPMA 1MK4A 4E8OA 4PPZA 4P10A 1CM0A 1F2OA 3GIUA 4MXUA 2OZUA 4BINA 2J8RA 4CS0B 1LRZA 1YLOA 4A39A 1BO4A 4KOUA 2EBJA 2OH1A 3W6XA 1QMUA 1NE9A 3SI0A 4HNWB 1VHOA 4MFKA 1UFHA 4XNHB 3KQXA 4FD7A 4KLWA 3PEIA 3KR5A 4IAVA 1Z5RA 3WC6A 1M4DA 4UFVA 2Z3OA 1Q2DA 2EK9A 2YNCA 4GS4A 4NGRA 3S6GA 1YMEA 3G3SA 4C2ZA 4QBJA 2G0BA 4NFRA 4A95A 4IF5A 5HVHA 2JLMA 2CTBA 1ELMP 3QAYA 4KSAA 4KOXA 1OBRA 1FT7A 3ZJ0A 2JEWA 5H84A 2BUEA 4KOTA 1XFOA 4KS9A 4ZY2A 1XE4A 5FVJA 5AG7A 4NGSA 3RO0A 4Q38A 4JXQA 4HNXB 4P4BA 4UCMA 4RUHA 3DLJA 1Z4RA 2J8NA 2HC9A 2R1IA 4J3GA 3N7ZA 3CT9A 3UY5A 5AG6A 2ZEEA 4XPKA 4FBEA 2Q4ZA 1I12A 4B14A 4YU9A 3TOBA 4PK3A 1IY7A 4H6UA 2C1CA 5KTCA 4YFJA 2PIYA 1AYEA 2DPTA 4KOWA 1Z2LA 3L2NA 1UWYA 2IL4A 4PXBA 4R9MA 4CYOA 5A27A 4IK2A 4NSQA 5HVGA 4A2ZA 4E2AA 1Y0RA 2FL4A 2GFQA 5E96A 1Z8XA 2BSWA 2CF4A 5CPAA 2GLFA 4NJRA 2PVVA 2PC1A 2Z3NA 3PFOA 3BLNA 4OLLA 4CYPA 3PBBA 2OZHA 4KOYA 4F0XA 4B6ZA 1XJOA 4MHZA 2B5GA 3B3VA 2R7HA 3FH4A 2NYQA 3PB7X 5D29A 5LRGA 3R1KA 2V8VA 3PP9A 2FT0A 3CZXA 3KI9A 1M4GA 1TKFA 2AFMA 3OWCA 2BO9A 5DS0A 4CPAA 5ELYA 3RYOA 3PGPA 2Z3KA 4A32A 5JQ4A 2JDCA 4ZI6A 2EVNA 4X8IA 2HB6A 3D2PA 4M6HA 3B3TA 3D7GA 4P44A 2GIVA 1SQHA 3IIBA 3LWUA 1N71A 1QSRA 1YW4A 2YNCC 3F8KA 4MY0A 3CXSA 5IX3A 4W9YA 4ZX8A 2G3AA 4R3LA 1XIXA 4CGMA 1YSJA 2Q44A 2Q4YA 1M4IA 2EWBA 1BOBA 1L0CA 2REFA 2IMOA 4Y49C 3TO9A 5K8MA 3H8EA 2WYRA 3QB8A 2ZOGA 5JPHA 4OIDA 1BAVA 2ARHA 2GANA 2P6FA 1CX8A 4MI4A 1TIQA 2P0WA 4BD9A 3CPAA 4UIAA 4X3RA 2VBQA 4F6AA 5G21A 3B3CA 4OC4A 1IOIA 4CAVA 3KZWA 4KSIA 3K9UA 1LAPA 2BEIA 3BHXA 1A2ZA 2Q7SA 1MJ9A 3BJ7A 4FD4A 4AVAA 2Z0ZA 5C82A 2ZEHA 2ZEMA 2CNMA 4NGQA 1B6BA 4QB9A 2ZPAA 2P6GA 1M4LA 4KOSA 3SJXA 4UFXA 3WABA 5F09A 1VIXA 2PJ6A 1IB1E 4A37A 4EWTA 3NA6A 4R8FA 2JEVA 4EFDA 2GE3A 4ZBGA 4NGNA 4B10A 5G22A 4HPSA 3NE7A 2ZXVA 2GU2A 1NSAA 5AG4A 3FBUA 1VHSA 3T8WA 4WJBA 2C27A 2PVWA 4CAEA 2ZEOA 4A38A 1QSMA 4M6GA 2ABZA 4MHPA 4UEEA 3TC8A 2PJCA 1CP7A 2OZGA 3ISZA 1I1DA 2AE6A 4UCPA 5EBVA 1TF8A 3H5ZA 4ONUA 4AG7A 1S7NA 1Z8LA 4P4FA 1IU8A 3I1UA 3NFZA 1YLEA 3FVLA 3VWDA 3GYAA 1YQEA 4U9ZA 1JWQA 2RC4A 2VEZA 2FVGA 2QIRA 4JLYA 4K30A 3R96A 2B5GB 1S7LA 3G8WA 3B7IA 2HV2A 4FAIA 4UA3A 4PQAA 3JUWA 5KTAA 2ZW7A 4L8AA 2POKA 4R87A 4DNCA 1YVOA 4PSXA 1I21A 2IJZA 2Q51A 5K8PA 4OP4A 4CGLA 5IB9A 4NXYA 4YGOA 1ELLP 2OR4A 2VZYA 4QUSA 2CNTA 5I4MA 1PCAA 2I00A 2Q4VA 3TE4A 2B4DA 1XRYA 5HVFA 1CP6A 2ZEDA 2D4PA 1BPNA 8CPAA 4CYNA 2PR1A 3PB8X 5BWAB 5LYLA 2REEA 4KZTA 3IWGA 4KUBA 1ZG7A 4P4IA 3B35A 1MJAA 1KUYA 2V8GA 5H86A 3HLPA 3IJ3A 4LQGA 3EXNA 2B4BA 4A31A 2DPSA 3TCVA 4QC6A 1GHEA 4DUKA 4AG9A 1R3NA 4CAXA 3NH4A 2GLJA 2D4OA 4JD6A 4F0YA 1IYLA 4C7IA 2H5MA 1IGBA 1TXRA 5G20A 1X10A 4OMEA 4P4EA 4FD6A 3WC7A 3LODA 2XEJA 3A9LA 4KVOE 4MCPA 3S6FA 4B11A 2ATRA 4LQ6A 4UBRA 1Y9WA 4ZY1A 2Q43A 3CXQA 1CG2A 5LRJA 2PDOA 4KVXA 4R76A 4CGNA 3D7DA 1QSTA 3RAMA 3SI1A 1CBXA 1MJBA 2ODFA 2ZEFA 2ZW6A 3LACA 2WPXA 4C2YA 1DE4C 5F49A 3S6HA 3SJEA 3I9SA 3C26A 4Q36A 2EUIA 3LD2A 1AMPA 2PR8A 2VXKA 3IGRA 3T90A 5JH9A 1ZG9A 4B12A 2AFXA 3WT4A 4AVBA 1KWMA 5CBMA 2GREA 2Y0MA 2X7BA 3D2MA 3PBEA 4OC5A 3B3SA 4Q7AA 1ZLHA 3KKWA 2QYVA 2PSWA 1GYTA 4DJLA 2RFHA 2I3CA 3H8FA 4RN7A 3BI0A 3IC1A 2DF5A 4UWIA 4MFLA 3CXPA 2B58A 5ISVA 4KUAA 2AFZA 5HMNA 4CRZB 3F5BA 3FJUA 2AFSA 3TT2A 1YW6A 2AFWA 1QSOA 1YVKA 3SHPA 3V7ZA 4ZYQA 1R43A 3FX6A 4RS2A 4Y49B 3EC4A 5LYDA 4H89A 3DSBA 2HQYA 3K2KA 2HUZA 4AVCA 4YRHA 2DXQA 3K9TA 3T9YA 3PB6X 4DYOA 2R8VA 4IUSA 3TTHA 1HEEA 4UIBA 3SI2A 5DWMA 1Z9UA 4GXHA 2CNSA 4C68A 3TO6A 4OC2A 1IOFA 3RZAA 2PJ1A 3QAHA 3SJFA 2ZOFA 4PV6A 2B3VA 1WWZA 4OC3A 1RO5A 2ZW4A 1XEBA 2PJ8A 1KUXA 3NE8A 1Y0YA 2J8MA 3W91A 2QVPA 3KQZA 4MCSA 4MHDA 7CPAA 1R57A 3EO4A 4OKOA 2QJ8A 4MY3A 4ONWA 2VI7A 3CPXA 3D7HA 4K3NA 3KHZA 3BXMA 1DTDA 3JRUA 1CPSA 2F5IA 4C7HA 2WSAA 4ZX9A 2WZNA 2CY2A 1WK4A 4XNHC 3S6KA 2AFUA 2O53A 4PXCA 1Z8TA 2NMTA 1YREA 3WC5A 1VHEA 2QMLA 3F0AA 2Z3LA 3B2YA 1KUVA 4U9YA 1JQGA 4KOVA 5F46A 1XMBA 3TX8A 1J4JA 4I49A 2PJ2A 4R57A 1K4JA 1EE3P 2ANPA 1P0HA 1PUAA 3DNSA 2FCKA 2OOTA 1Y7EA 3E0KA 4R7MA 2PCUA 1M1DA 4M85A 4UFWA 4ZGYB 2PQ8A 3FMCA 6CPAA 2BL1A 3QNVA 4MHYA 2WUUA 1H8LA 2VL1A 1S60A 3KR4A 2PJBA 3GB0A 1QQ9A 4CGOA 2FSRA 5K8OA 4A94A 2YGWA 4UEZA 3DGVA 1FNOA 2PJ5A 3FRMA 2CIJA 1S7FA 4A33A 4HNYB 4CRYB 4UF4A 2FIAA 1Z4EA 5F48A 3VH9A 2EO8A 3KASA 3RNZA 4M6IA 4CAWA 4E0AA 5J8CA 2CXAA 5KTDA 1YK3A 4X2TA 4KSFA 4MFQA 4F9VA 5JM6A 1P4NA 2VZZA 2YNDA 1VGYA 3D66A 4FD5A 4H2KA 4B13A 1M44A 5IB0A 1PYTB 1QSNA 2PJ7A 5D8NA 3DR8A 3IU2A 2Z11A 2WPWA 3ISXA 2XEGA 4NF1A 4OAEA 2JDDA 1RXTA 2PRBA 5AG5A 3PFEA 3PB4X 1HDUA 1ON0A 3H8GA 3IEHA 3IU1A 2Q7BA 3P2HA 3VARA 4B5PB 5A28A 2Z10A 1XMTA 4CYQA 4O23A 1F2PA 2G3TA 1NMTA 3B8GA 4IHMA 2FE7A 4ORFA 3V38A 5I0CA 4Z65A 1S3ZA 1XF8A 3W6SA 3FIXA 5DWNA 2XEFA 2DEAA 4WWVA 2IQ6A 2PJ3A 1U6MA 4RI1A 3VATA 3MN8A 4KLVA 4OADA 3B3WA 3CDXA 3D8PA 4L89A
chains in the Genus database with same CATH topology
3FF3A 4FWUA 4OC1A 2J9AA 3KGQA 1LAMA 4TNUA 4YWYA 2PJ9A 4P4DA 2ZEPA 3SJGA 4OIWA 4PXEA 2PRQA 2V77A 3IWWA 3KHXA 3D4UA 3MRUA 4MMOA 4NJQA 4ZY0A 5LYFA 4MRIA 2ZEGA 3NH8A 3FEDA 3KL9A 4OC0A 2F7VA 2F8HA 2C6PA 1LFWA 1TKJA 3D67A 2NSMA 2EK8A 1LANA 1ZLIA 2XEIA 3D68A 3S9MA 3IFEA 3LMSA 1Q7LA 2O4HA 3FEEA 4P45A 2BOAA 3FECA 3PB9X 2V8DA 2ZENA 2ZELA 1BLLE 2C6GA 5HXDA 5J1QA 1RTQA 4GM5A 4P6YA 1XBUA 4F9UA 1ZG8A 2BCOA 5K8NA 3BI1A 5JGFA 1CPXA 2PJ4A 1LOKA 1TF9A 2RB7A 4F8ZA 2JBKA 4MCRA 2PIZA 3NH5A 4MHNA 2AFOA 1ARMA 4PXDA 4JYWA 1HDQA 3D7FA 4JZ0A 4R6TA 4NGTA 4FUUA 2PJ0A 2JBJA 2V8HA 4NGMA 1F57A 4P4JA 2PJAA 3RBUA 4UEFA 3S9LA 3PRTA 4MCQA 2G9DA 4EMEA 4NGPA 4TWEA 5LYIA 2CTCA 5LRKA 5THWA 1ARLA 2PE3A 2C6CA 1TKHA 3GUXA 1LCPA 3S9NA 4G1PA 3GLJA 3HUVA 4AXVA 3N5FA 3IO1A 1BPMA 4PPZA 4P10A 1F2OA 4MXUA 1YLOA 4A39A 1QMUA 3SI0A 1VHOA 3KQXA 3PEIA 3KR5A 4IAVA 1Z5RA 3WC6A 2EK9A 4NGRA 1YMEA 4NFRA 5HVHA 2CTBA 1ELMP 1OBRA 1FT7A 2JEWA 1XFOA 4ZY2A 4NGSA 4P4BA 4RUHA 3DLJA 2HC9A 3CT9A 4FBEA 2ZEEA 2Q4ZA 4YU9A 1IY7A 2C1CA 2PIYA 1AYEA 1Z2LA 3L2NA 1UWYA 4PXBA 5HVGA 4IK2A 1Y0RA 2CF4A 5CPAA 2GLFA 4NJRA 2PVVA 3PFOA 3PBBA 4B6ZA 1XJOA 4MHZA 3B3VA 3FH4A 2NYQA 3PB7X 5D29A 5LRGA 2V8VA 3KI9A 1TKFA 2AFMA 5DS0A 2BO9A 4CPAA 5ELYA 4ZI6A 4X8IA 2HB6A 3B3TA 3D7GA 4P44A 3IIBA 3LWUA 1YW4A 4W9YA 4ZX8A 1YSJA 2EWBA 2IMOA 5K8MA 3H8EA 2WYRA 2ZOGA 4OIDA 1BAVA 1CX8A 4BD9A 3CPAA 4UIAA 4X3RA 3B3CA 4OC4A 3KZWA 4KSIA 1LAPA 3BHXA 2ZEHA 2ZEMA 4NGQA 1M4LA 3SJXA 3WABA 5F09A 1VIXA 2PJ6A 4A37A 4EWTA 3NA6A 4R8FA 4EFDA 4NGNA 2GU2A 1NSAA 3T8WA 4WJBA 2PVWA 2ZEOA 4A38A 2ABZA 4MHPA 4UEEA 3TC8A 2PJCA 1CP7A 3ISZA 1TF8A 1Z8LA 4P4FA 3I1UA 3NFZA 3FVLA 2FVGA 3B7IA 4FAIA 4PQAA 2POKA 2IJZA 2Q51A 5K8PA 4OP4A 5IB9A 1ELLP 2OR4A 5I4MA 1PCAA 1XRYA 5HVFA 1CP6A 2ZEDA 1BPNA 8CPAA 3PB8X 5LYLA 1ZG7A 4P4IA 3B35A 2V8GA 3HLPA 3IJ3A 4LQGA 4DUKA 1R3NA 3NH4A 2GLJA 1IGBA 1TXRA 4OMEA 4P4EA 3WC7A 2XEJA 4MCPA 4ZY1A 2Q43A 1CG2A 5LRJA 4R76A 3D7DA 3RAMA 3SI1A 1CBXA 2ZEFA 1DE4C 3SJEA 1AMPA 5JH9A 1ZG9A 2AFXA 3WT4A 5CBMA 1KWMA 2GREA 4OC5A 3PBEA 3B3SA 4Q7AA 1ZLHA 2QYVA 1GYTA 4DJLA 2RFHA 2I3CA 3H8FA 3BI0A 3IC1A 2AFZA 3FJUA 2AFSA 1YW6A 2AFWA 3V7ZA 4ZYQA 1R43A 3FX6A 5LYDA 3K2KA 3K9TA 4DYOA 3PB6X 1HEEA 4UIBA 3SI2A 4OC2A 3RZAA 2PJ1A 3SJFA 2ZOFA 4OC3A 2PJ8A 1Y0YA 2QVPA 3KQZA 4MCSA 7CPAA 4OKOA 2QJ8A 4ONWA 3CPXA 3D7HA 4K3NA 3KHZA 3BXMA 1DTDA 3JRUA 1CPSA 4ZX9A 2WZNA 2AFUA 2O53A 4PXCA 3WC5A 1VHEA 3B2YA 1JQGA 1XMBA 3TX8A 2PJ2A 1EE3P 2ANPA 2OOTA 1Y7EA 4R7MA 2PCUA 3FMCA 6CPAA 3QNVA 4MHYA 1H8LA 2VL1A 3KR4A 2PJBA 3GB0A 1QQ9A 5K8OA 4A94A 4UEZA 3DGVA 1FNOA 2PJ5A 2CIJA 4UF4A 3VH9A 3KASA 4X2TA 4F9VA 5JM6A 4H2KA 1VGYA 3D66A 1PYTB 2PJ7A 5D8NA 3ISXA 2XEGA 3PFEA 3PB4X 1HDUA 3H8GA 3IEHA 3VARA 4O23A 1F2PA 3V38A 4IHMA 4Z65A 2XEFA 2DEAA 4WWVA 2IQ6A 2PJ3A 3VATA 3MN8A 3B3WA 3CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF3 A;  4FWU A;  4OC1 A;  2J9A A;  3KGQ A;  1LAM A;  4TNU A;  4YWY A;  2PJ9 A;  4P4D A;  2ZEP A;  3SJG A;  4OIW A;  4PXE A;  2PRQ A;  2V77 A;  3IWW A;  3KHX A;  3D4U A;  3MRU A;  4MMO A;  4NJQ A;  4ZY0 A;  5LYF A;  4MRI A;  2ZEG A;  3NH8 A;  3FED A;  3KL9 A;  4OC0 A;  2F7V A;  2F8H A;  2C6P A;  1LFW A;  1TKJ A;  3D67 A;  2NSM A;  2EK8 A;  1LAN A;  1ZLI A;  2XEI A;  3D68 A;  3S9M A;  3IFE A;  3LMS A;  1Q7L A;  2O4H A;  3FEE A;  4P45 A;  2BOA A;  3FEC A;  3PB9 X;  2V8D A;  2ZEN A;  2ZEL A;  1BLL E;  2C6G A;  5HXD A;  5J1Q A;  1RTQ A;  4GM5 A;  4P6Y A;  1XBU A;  4F9U A;  1ZG8 A;  2BCO A;  5K8N A;  3BI1 A;  5JGF A;  1CPX A;  2PJ4 A;  1LOK A;  1TF9 A;  2RB7 A;  4F8Z A;  2JBK A;  4MCR A;  2PIZ A;  3NH5 A;  4MHN A;  2AFO A;  1ARM A;  4PXD A;  4JYW A;  1HDQ A;  3D7F A;  4JZ0 A;  4R6T A;  4NGT A;  4FUU A;  2PJ0 A;  2JBJ A;  2V8H A;  4NGM A;  1F57 A;  4P4J A;  2PJA A;  3RBU A;  4UEF A;  3S9L A;  3PRT A;  4MCQ A;  2G9D A;  4EME A;  4NGP A;  4TWE A;  5LYI A;  2CTC A;  5LRK A;  5THW A;  1ARL A;  2PE3 A;  2C6C A;  1TKH A;  3GUX A;  1LCP A;  3S9N A;  4G1P A;  3GLJ A;  3HUV A;  4AXV A;  3N5F A;  3IO1 A;  1BPM A;  4PPZ A;  4P10 A;  1F2O A;  4MXU A;  1YLO A;  4A39 A;  1QMU A;  3SI0 A;  1VHO A;  3KQX A;  3PEI A;  3KR5 A;  4IAV A;  1Z5R A;  3WC6 A;  2EK9 A;  4NGR A;  1YME A;  4NFR A;  5HVH A;  2CTB A;  1ELM P;  1OBR A;  1FT7 A;  2JEW A;  1XFO A;  4ZY2 A;  4NGS A;  4P4B A;  4RUH A;  3DLJ A;  2HC9 A;  3CT9 A;  4FBE A;  2ZEE A;  2Q4Z A;  4YU9 A;  1IY7 A;  2C1C A;  2PIY A;  1AYE A;  1Z2L A;  3L2N A;  1UWY A;  4PXB A;  5HVG A;  4IK2 A;  1Y0R A;  2CF4 A;  5CPA A;  2GLF A;  4NJR A;  2PVV A;  3PFO A;  3PBB A;  4B6Z A;  1XJO A;  4MHZ A;  3B3V A;  3FH4 A;  2NYQ A;  3PB7 X;  5D29 A;  5LRG A;  2V8V A;  3KI9 A;  1TKF A;  2AFM A;  5DS0 A;  2BO9 A;  4CPA A;  5ELY A;  4ZI6 A;  4X8I A;  2HB6 A;  3B3T A;  3D7G A;  4P44 A;  3IIB A;  3LWU A;  1YW4 A;  4W9Y A;  4ZX8 A;  1YSJ A;  2EWB A;  2IMO A;  5K8M A;  3H8E A;  2WYR A;  2ZOG A;  4OID A;  1BAV A;  1CX8 A;  4BD9 A;  3CPA A;  4UIA A;  4X3R A;  3B3C A;  4OC4 A;  3KZW A;  4KSI A;  1LAP A;  3BHX A;  2ZEH A;  2ZEM A;  4NGQ A;  1M4L A;  3SJX A;  3WAB A;  5F09 A;  1VIX A;  2PJ6 A;  4A37 A;  4EWT A;  3NA6 A;  4R8F A;  4EFD A;  4NGN A;  2GU2 A;  1NSA A;  3T8W A;  4WJB A;  2PVW A;  2ZEO A;  4A38 A;  2ABZ A;  4MHP A;  4UEE A;  3TC8 A;  2PJC A;  1CP7 A;  3ISZ A;  1TF8 A;  1Z8L A;  4P4F A;  3I1U A;  3NFZ A;  3FVL A;  2FVG A;  3B7I A;  4FAI A;  4PQA A;  2POK A;  2IJZ A;  2Q51 A;  5K8P A;  4OP4 A;  5IB9 A;  1ELL P;  2OR4 A;  5I4M A;  1PCA A;  1XRY A;  5HVF A;  1CP6 A;  2ZED A;  1BPN A;  8CPA A;  3PB8 X;  5LYL A;  1ZG7 A;  4P4I A;  3B35 A;  2V8G A;  3HLP A;  3IJ3 A;  4LQG A;  4DUK A;  1R3N A;  3NH4 A;  2GLJ A;  1IGB A;  1TXR A;  4OME A;  4P4E A;  3WC7 A;  2XEJ A;  4MCP A;  4ZY1 A;  2Q43 A;  1CG2 A;  5LRJ A;  4R76 A;  3D7D A;  3RAM A;  3SI1 A;  1CBX A;  2ZEF A;  1DE4 C;  3SJE A;  1AMP A;  5JH9 A;  1ZG9 A;  2AFX A;  3WT4 A;  5CBM A;  1KWM A;  2GRE A;  4OC5 A;  3PBE A;  3B3S A;  4Q7A A;  1ZLH A;  2QYV A;  1GYT A;  4DJL A;  2RFH A;  2I3C A;  3H8F A;  3BI0 A;  3IC1 A;  2AFZ A;  3FJU A;  2AFS A;  1YW6 A;  2AFW A;  3V7Z A;  4ZYQ A;  1R43 A;  3FX6 A;  5LYD A;  3K2K A;  3K9T A;  4DYO A;  3PB6 X;  1HEE A;  4UIB A;  3SI2 A;  4OC2 A;  3RZA A;  2PJ1 A;  3SJF A;  2ZOF A;  4OC3 A;  2PJ8 A;  1Y0Y A;  2QVP A;  3KQZ A;  4MCS A;  7CPA A;  4OKO A;  2QJ8 A;  4ONW A;  3CPX A;  3D7H A;  4K3N A;  3KHZ A;  3BXM A;  1DTD A;  3JRU A;  1CPS A;  4ZX9 A;  2WZN A;  2AFU A;  2O53 A;  4PXC A;  3WC5 A;  1VHE A;  3B2Y A;  1JQG A;  1XMB A;  3TX8 A;  2PJ2 A;  1EE3 P;  2ANP A;  2OOT A;  1Y7E A;  4R7M A;  2PCU A;  3FMC A;  6CPA A;  3QNV A;  4MHY A;  1H8L A;  2VL1 A;  3KR4 A;  2PJB A;  3GB0 A;  1QQ9 A;  5K8O A;  4A94 A;  4UEZ A;  3DGV A;  1FNO A;  2PJ5 A;  2CIJ A;  4UF4 A;  3VH9 A;  3KAS A;  4X2T A;  4F9V A;  5JM6 A;  4H2K A;  1VGY A;  3D66 A;  1PYT B;  2PJ7 A;  5D8N A;  3ISX A;  2XEG A;  3PFE A;  3PB4 X;  1HDU A;  3H8G A;  3IEH A;  3VAR A;  4O23 A;  1F2P A;  3V38 A;  4IHM A;  4Z65 A;  2XEF A;  2DEA A;  4WWV A;  2IQ6 A;  2PJ3 A;  3VAT A;  3MN8 A;  3B3W A;  3CDX A; 
#chains in the Genus database with same CATH topology
 3JVN A;  3IWE A;  4MFJ A;  3FF3 A;  4FWU A;  4NEX A;  4AB7 A;  4OC1 A;  5HH1 A;  2J9A A;  3KGQ A;  4JJX A;  1LAM A;  4TNU A;  4EVY A;  4YWY A;  2PJ9 A;  4PK2 A;  5IV0 A;  4P4D A;  2ZEP A;  3SJG A;  1IYK A;  5F47 A;  4OIW A;  5J8F A;  5GCN A;  1FY7 A;  4B5P A;  4M3S A;  4PXE A;  2PRQ A;  2V77 A;  2YNE A;  5CNP A;  3IWW A;  4XPL A;  4CAF A;  4QVT A;  3R9G A;  3KHX A;  3D4U A;  3MRU A;  4MMO A;  4NJQ A;  1X12 A;  3TOA A;  4ZY0 A;  5LYF A;  3BJ8 A;  3P2F A;  4MRI A;  4PSW A;  2ZEG A;  3NH8 A;  4B5O A;  1XOV A;  3FED A;  3KL9 A;  2ZW5 A;  4OC0 A;  4UCN A;  1YGH A;  4UWJ A;  3PZJ A;  2F7V A;  4X5K A;  1VKC A;  4LX9 A;  2F8H A;  4II9 A;  3FXT A;  1IID A;  2B4D B;  2C6P A;  5G1Z A;  1LFW A;  5AGE A;  2B3U A;  1V0C A;  1TKJ A;  4BBH A;  3GKR A;  3H4Q A;  3D3S A;  3I3G A;  3D67 A;  2OB0 A;  2NSM A;  1Y9K A;  2EK8 A;  1LAN A;  1ZLI A;  2XEI A;  3D68 A;  3S9M A;  4XPD C;  3IFE A;  3LMS A;  2QEC A;  4XPD B;  1Q7L A;  5EMI A;  2O28 A;  2O4H A;  3DDD A;  3FEE A;  4P45 A;  2BOA A;  3FEC A;  4MBU A;  3SXO A;  3ZZI A;  3PB9 X;  4HKF A;  2V8D A;  2Z3M A;  3V8I A;  1KZF A;  2ZEN A;  1PU9 A;  1Y7R A;  2ZEL A;  2AJ6 A;  3FNC A;  1S5K A;  2FIW A;  1BLL E;  4NCZ A;  3R9F A;  2C6G A;  5HXD A;  1IIC A;  1CJW A;  3MGD A;  5J1Q A;  4KVM E;  1RTQ A;  4GM5 A;  4P6Y A;  3FYN A;  1XBU A;  4F9U A;  1Q2Y A;  3R9E A;  4H6Z A;  1ZG8 A;  2BCO A;  3DR6 A;  1NSL A;  5K8N A;  2A4N A;  1AUG A;  3JTK A;  1S7K A;  4JXR A;  3BI1 A;  4CGP A;  5JGF A;  3R95 A;  1CPX A;  1YX0 A;  2KCW A;  2PJ4 A;  2Z3P A;  1LOK A;  1TF9 A;  2RB7 A;  3SXN A;  4F8Z A;  2JBK A;  4MCR A;  2PIZ A;  3GY9 A;  3NH5 A;  3TO7 A;  4A30 A;  4MHN A;  1ARM A;  2AFO A;  2OU2 A;  3EY5 A;  4PXD A;  4C2X A;  1Z8W A;  1HDQ A;  2R98 A;  3D7F A;  4JZ0 A;  4JYW A;  3EFA A;  4MFP A;  4MFZ A;  4NGT A;  4R6T A;  4FUU A;  2PJ0 A;  4KOR A;  2Q0Y A;  2JBJ A;  2V8H A;  4NGM A;  1B87 A;  1F57 A;  4P4J A;  2PJA A;  3RBU A;  4UEF A;  3S9L A;  2I79 A;  3PRT A;  2Q04 A;  4MCQ A;  2FS5 A;  2G9D A;  1OZP A;  4EME A;  1ZO0 A;  4NGP A;  4TWE A;  5LYI A;  2P6E A;  4MJ8 A;  2CTC A;  5C88 A;  5LRK A;  5THW A;  4BMH A;  1ARL A;  1YR0 A;  2K5T A;  2PE3 A;  5EC4 A;  2C6C A;  1TKH A;  4LUA A;  3GUX A;  3TFY A;  3VWE A;  3FB3 A;  1LCP A;  3S9N A;  4JWP A;  4G1P A;  2VQY A;  1Q2C A;  3GLJ A;  3HUV A;  4AXV A;  3N5F A;  3WR7 A;  4U5Y A;  2FXF A;  3IO1 A;  4R3K A;  1BPM A;  1MK4 A;  4E8O A;  4PPZ A;  4P10 A;  1CM0 A;  1F2O A;  3GIU A;  4MXU A;  2OZU A;  4BIN A;  2J8R A;  4CS0 B;  1LRZ A;  1YLO A;  4A39 A;  1BO4 A;  4KOU A;  2EBJ A;  2OH1 A;  3W6X A;  1QMU A;  1NE9 A;  3SI0 A;  4HNW B;  1VHO A;  4MFK A;  1UFH A;  4XNH B;  3KQX A;  4FD7 A;  4KLW A;  3PEI A;  3KR5 A;  4IAV A;  1Z5R A;  3WC6 A;  1M4D A;  4UFV A;  2Z3O A;  1Q2D A;  2EK9 A;  2YNC A;  4GS4 A;  4NGR A;  3S6G A;  1YME A;  3G3S A;  4C2Z A;  4QBJ A;  2G0B A;  4NFR A;  4A95 A;  4IF5 A;  5HVH A;  2JLM A;  2CTB A;  1ELM P;  3QAY A;  4KSA A;  4KOX A;  1OBR A;  1FT7 A;  3ZJ0 A;  2JEW A;  5H84 A;  2BUE A;  4KOT A;  1XFO A;  4KS9 A;  4ZY2 A;  1XE4 A;  5FVJ A;  5AG7 A;  4NGS A;  3RO0 A;  4Q38 A;  4JXQ A;  4HNX B;  4P4B A;  4UCM A;  4RUH A;  3DLJ A;  1Z4R A;  2J8N A;  2HC9 A;  2R1I A;  4J3G A;  3N7Z A;  3CT9 A;  3UY5 A;  5AG6 A;  2ZEE A;  4XPK A;  4FBE A;  2Q4Z A;  1I12 A;  4B14 A;  4YU9 A;  3TOB A;  4PK3 A;  1IY7 A;  4H6U A;  2C1C A;  5KTC A;  4YFJ A;  2PIY A;  1AYE A;  2DPT A;  4KOW A;  1Z2L A;  3L2N A;  1UWY A;  2IL4 A;  4PXB A;  4R9M A;  4CYO A;  5A27 A;  4IK2 A;  4NSQ A;  5HVG A;  4A2Z A;  4E2A A;  1Y0R A;  2FL4 A;  2GFQ A;  5E96 A;  1Z8X A;  2BSW A;  2CF4 A;  5CPA A;  2GLF A;  4NJR A;  2PVV A;  2PC1 A;  2Z3N A;  3PFO A;  3BLN A;  4OLL A;  4CYP A;  3PBB A;  2OZH A;  4KOY A;  4F0X A;  4B6Z A;  1XJO A;  4MHZ A;  2B5G A;  3B3V A;  2R7H A;  3FH4 A;  2NYQ A;  3PB7 X;  5D29 A;  5LRG A;  3R1K A;  2V8V A;  3PP9 A;  2FT0 A;  3CZX A;  3KI9 A;  1M4G A;  1TKF A;  2AFM A;  3OWC A;  2BO9 A;  5DS0 A;  4CPA A;  5ELY A;  3RYO A;  3PGP A;  2Z3K A;  4A32 A;  5JQ4 A;  2JDC A;  4ZI6 A;  2EVN A;  4X8I A;  2HB6 A;  3D2P A;  4M6H A;  3B3T A;  3D7G A;  4P44 A;  2GIV A;  1SQH A;  3IIB A;  3LWU A;  1N71 A;  1QSR A;  1YW4 A;  2YNC C;  3F8K A;  4MY0 A;  3CXS A;  5IX3 A;  4W9Y A;  4ZX8 A;  2G3A A;  4R3L A;  1XIX A;  4CGM A;  1YSJ A;  2Q44 A;  2Q4Y A;  1M4I A;  2EWB A;  1BOB A;  1L0C A;  2REF A;  2IMO A;  4Y49 C;  3TO9 A;  5K8M A;  3H8E A;  2WYR A;  3QB8 A;  2ZOG A;  5JPH A;  4OID A;  1BAV A;  2ARH A;  2GAN A;  2P6F A;  1CX8 A;  4MI4 A;  1TIQ A;  2P0W A;  4BD9 A;  3CPA A;  4UIA A;  4X3R A;  2VBQ A;  4F6A A;  5G21 A;  3B3C A;  4OC4 A;  1IOI A;  4CAV A;  3KZW A;  4KSI A;  3K9U A;  1LAP A;  2BEI A;  3BHX A;  1A2Z A;  2Q7S A;  1MJ9 A;  3BJ7 A;  4FD4 A;  4AVA A;  2Z0Z A;  5C82 A;  2ZEH A;  2ZEM A;  2CNM A;  4NGQ A;  1B6B A;  4QB9 A;  2ZPA A;  2P6G A;  1M4L A;  4KOS A;  3SJX A;  4UFX A;  3WAB A;  5F09 A;  1VIX A;  2PJ6 A;  1IB1 E;  4A37 A;  4EWT A;  3NA6 A;  4R8F A;  2JEV A;  4EFD A;  2GE3 A;  4ZBG A;  4NGN A;  4B10 A;  5G22 A;  4HPS A;  3NE7 A;  2ZXV A;  2GU2 A;  1NSA A;  5AG4 A;  3FBU A;  1VHS A;  3T8W A;  4WJB A;  2C27 A;  2PVW A;  4CAE A;  2ZEO A;  4A38 A;  1QSM A;  4M6G A;  2ABZ A;  4MHP A;  4UEE A;  3TC8 A;  2PJC A;  1CP7 A;  2OZG A;  3ISZ A;  1I1D A;  2AE6 A;  4UCP A;  5EBV A;  1TF8 A;  3H5Z A;  4ONU A;  4AG7 A;  1S7N A;  1Z8L A;  4P4F A;  1IU8 A;  3I1U A;  3NFZ A;  1YLE A;  3FVL A;  3VWD A;  3GYA A;  1YQE A;  4U9Z A;  1JWQ A;  2RC4 A;  2VEZ A;  2FVG A;  2QIR A;  4JLY A;  4K30 A;  3R96 A;  2B5G B;  1S7L A;  3G8W A;  3B7I A;  2HV2 A;  4FAI A;  4UA3 A;  4PQA A;  3JUW A;  5KTA A;  2ZW7 A;  4L8A A;  2POK A;  4R87 A;  4DNC A;  1YVO A;  4PSX A;  1I21 A;  2IJZ A;  2Q51 A;  5K8P A;  4OP4 A;  4CGL A;  5IB9 A;  4NXY A;  4YGO A;  1ELL P;  2OR4 A;  2VZY A;  4QUS A;  2CNT A;  5I4M A;  1PCA A;  2I00 A;  2Q4V A;  3TE4 A;  2B4D A;  1XRY A;  5HVF A;  1CP6 A;  2ZED A;  2D4P A;  1BPN A;  8CPA A;  4CYN A;  2PR1 A;  3PB8 X;  5BWA B;  5LYL A;  2REE A;  4KZT A;  3IWG A;  4KUB A;  1ZG7 A;  4P4I A;  3B35 A;  1MJA A;  1KUY A;  2V8G A;  5H86 A;  3HLP A;  3IJ3 A;  4LQG A;  3EXN A;  2B4B A;  4A31 A;  2DPS A;  3TCV A;  4QC6 A;  1GHE A;  4DUK A;  4AG9 A;  1R3N A;  4CAX A;  3NH4 A;  2GLJ A;  2D4O A;  4JD6 A;  4F0Y A;  1IYL A;  4C7I A;  2H5M A;  1IGB A;  1TXR A;  5G20 A;  1X10 A;  4OME A;  4P4E A;  4FD6 A;  3WC7 A;  3LOD A;  2XEJ A;  3A9L A;  4KVO E;  4MCP A;  3S6F A;  4B11 A;  2ATR A;  4LQ6 A;  4UBR A;  1Y9W A;  4ZY1 A;  2Q43 A;  3CXQ A;  1CG2 A;  5LRJ A;  2PDO A;  4KVX A;  4R76 A;  4CGN A;  3D7D A;  1QST A;  3RAM A;  3SI1 A;  1CBX A;  1MJB A;  2ODF A;  2ZEF A;  2ZW6 A;  3LAC A;  2WPX A;  4C2Y A;  1DE4 C;  5F49 A;  3S6H A;  3SJE A;  3I9S A;  3C26 A;  4Q36 A;  2EUI A;  3LD2 A;  1AMP A;  2PR8 A;  2VXK A;  3IGR A;  3T90 A;  5JH9 A;  1ZG9 A;  4B12 A;  2AFX A;  3WT4 A;  4AVB A;  1KWM A;  5CBM A;  2GRE A;  2Y0M A;  2X7B A;  3D2M A;  3PBE A;  4OC5 A;  3B3S A;  4Q7A A;  1ZLH A;  3KKW A;  2QYV A;  2PSW A;  1GYT A;  4DJL A;  2RFH A;  2I3C A;  3H8F A;  4RN7 A;  3BI0 A;  3IC1 A;  2DF5 A;  4UWI A;  4MFL A;  3CXP A;  2B58 A;  5ISV A;  4KUA A;  2AFZ A;  5HMN A;  4CRZ B;  3F5B A;  3FJU A;  2AFS A;  3TT2 A;  1YW6 A;  2AFW A;  1QSO A;  1YVK A;  3SHP A;  3V7Z A;  4ZYQ A;  1R43 A;  3FX6 A;  4RS2 A;  4Y49 B;  3EC4 A;  5LYD A;  4H89 A;  3DSB A;  2HQY A;  3K2K A;  2HUZ A;  4AVC A;  4YRH A;  2DXQ A;  3K9T A;  3T9Y A;  3PB6 X;  4DYO A;  2R8V A;  4IUS A;  3TTH A;  1HEE A;  4UIB A;  3SI2 A;  5DWM A;  1Z9U A;  4GXH A;  2CNS A;  4C68 A;  3TO6 A;  4OC2 A;  1IOF A;  3RZA A;  2PJ1 A;  3QAH A;  3SJF A;  2ZOF A;  4PV6 A;  2B3V A;  1WWZ A;  4OC3 A;  1RO5 A;  2ZW4 A;  1XEB A;  2PJ8 A;  1KUX A;  3NE8 A;  1Y0Y A;  2J8M A;  3W91 A;  2QVP A;  3KQZ A;  4MCS A;  4MHD A;  7CPA A;  1R57 A;  3EO4 A;  4OKO A;  2QJ8 A;  4MY3 A;  4ONW A;  2VI7 A;  3CPX A;  3D7H A;  4K3N A;  3KHZ A;  3BXM A;  1DTD A;  3JRU A;  1CPS A;  2F5I A;  4C7H A;  2WSA A;  4ZX9 A;  2WZN A;  2CY2 A;  1WK4 A;  4XNH C;  3S6K A;  2AFU A;  2O53 A;  4PXC A;  1Z8T A;  2NMT A;  1YRE A;  3WC5 A;  1VHE A;  2QML A;  3F0A A;  2Z3L A;  3B2Y A;  1KUV A;  4U9Y A;  1JQG A;  4KOV A;  5F46 A;  1XMB A;  3TX8 A;  1J4J A;  4I49 A;  2PJ2 A;  4R57 A;  1K4J A;  1EE3 P;  2ANP A;  1P0H A;  1PUA A;  3DNS A;  2FCK A;  2OOT A;  1Y7E A;  3E0K A;  4R7M A;  2PCU A;  1M1D A;  4M85 A;  4UFW A;  4ZGY B;  2PQ8 A;  3FMC A;  6CPA A;  2BL1 A;  3QNV A;  4MHY A;  2WUU A;  1H8L A;  2VL1 A;  1S60 A;  3KR4 A;  2PJB A;  3GB0 A;  1QQ9 A;  4CGO A;  2FSR A;  5K8O A;  4A94 A;  2YGW A;  4UEZ A;  3DGV A;  1FNO A;  2PJ5 A;  3FRM A;  2CIJ A;  1S7F A;  4A33 A;  4HNY B;  4CRY B;  4UF4 A;  2FIA A;  1Z4E A;  5F48 A;  3VH9 A;  2EO8 A;  3KAS A;  3RNZ A;  4M6I A;  4CAW A;  4E0A A;  5J8C A;  2CXA A;  5KTD A;  1YK3 A;  4X2T A;  4KSF A;  4MFQ A;  4F9V A;  5JM6 A;  1P4N A;  2VZZ A;  2YND A;  1VGY A;  3D66 A;  4FD5 A;  4H2K A;  4B13 A;  1M44 A;  5IB0 A;  1PYT B;  1QSN A;  2PJ7 A;  5D8N A;  3DR8 A;  3IU2 A;  2Z11 A;  2WPW A;  3ISX A;  2XEG A;  4NF1 A;  4OAE A;  2JDD A;  1RXT A;  2PRB A;  5AG5 A;  3PFE A;  3PB4 X;  1HDU A;  1ON0 A;  3H8G A;  3IEH A;  3IU1 A;  2Q7B A;  3P2H A;  3VAR A;  4B5P B;  5A28 A;  2Z10 A;  1XMT A;  4CYQ A;  4O23 A;  1F2P A;  2G3T A;  1NMT A;  3B8G A;  4IHM A;  2FE7 A;  4ORF A;  3V38 A;  5I0C A;  4Z65 A;  1S3Z A;  1XF8 A;  3W6S A;  3FIX A;  5DWN A;  2XEF A;  2DEA A;  4WWV A;  2IQ6 A;  2PJ3 A;  1U6M A;  4RI1 A;  3VAT A;  3MN8 A;  4KLV A;  4OAD A;  3B3W A;  3CDX A;  3D8P A;  4L89 A; 
#chains in the Genus database with same CATH homology
 3FF3 A;  4FWU A;  4OC1 A;  2J9A A;  3KGQ A;  1LAM A;  4TNU A;  4YWY A;  2PJ9 A;  4P4D A;  2ZEP A;  3SJG A;  4OIW A;  4PXE A;  2PRQ A;  2V77 A;  3IWW A;  3KHX A;  3D4U A;  3MRU A;  4MMO A;  4NJQ A;  4ZY0 A;  5LYF A;  4MRI A;  2ZEG A;  3NH8 A;  3FED A;  3KL9 A;  4OC0 A;  2F7V A;  2F8H A;  2C6P A;  1LFW A;  1TKJ A;  3D67 A;  2NSM A;  2EK8 A;  1LAN A;  1ZLI A;  2XEI A;  3D68 A;  3S9M A;  3IFE A;  3LMS A;  1Q7L A;  2O4H A;  3FEE A;  4P45 A;  2BOA A;  3FEC A;  3PB9 X;  2V8D A;  2ZEN A;  2ZEL A;  1BLL E;  2C6G A;  5HXD A;  5J1Q A;  1RTQ A;  4GM5 A;  4P6Y A;  1XBU A;  4F9U A;  1ZG8 A;  2BCO A;  5K8N A;  3BI1 A;  5JGF A;  1CPX A;  2PJ4 A;  1LOK A;  1TF9 A;  2RB7 A;  4F8Z A;  2JBK A;  4MCR A;  2PIZ A;  3NH5 A;  4MHN A;  2AFO A;  1ARM A;  4PXD A;  4JYW A;  1HDQ A;  3D7F A;  4JZ0 A;  4R6T A;  4NGT A;  4FUU A;  2PJ0 A;  2JBJ A;  2V8H A;  4NGM A;  1F57 A;  4P4J A;  2PJA A;  3RBU A;  4UEF A;  3S9L A;  3PRT A;  4MCQ A;  2G9D A;  4EME A;  4NGP A;  4TWE A;  5LYI A;  2CTC A;  5LRK A;  5THW A;  1ARL A;  2PE3 A;  2C6C A;  1TKH A;  3GUX A;  1LCP A;  3S9N A;  4G1P A;  3GLJ A;  3HUV A;  4AXV A;  3N5F A;  3IO1 A;  1BPM A;  4PPZ A;  4P10 A;  1F2O A;  4MXU A;  1YLO A;  4A39 A;  1QMU A;  3SI0 A;  1VHO A;  3KQX A;  3PEI A;  3KR5 A;  4IAV A;  1Z5R A;  3WC6 A;  2EK9 A;  4NGR A;  1YME A;  4NFR A;  5HVH A;  2CTB A;  1ELM P;  1OBR A;  1FT7 A;  2JEW A;  1XFO A;  4ZY2 A;  4NGS A;  4P4B A;  4RUH A;  3DLJ A;  2HC9 A;  3CT9 A;  4FBE A;  2ZEE A;  2Q4Z A;  4YU9 A;  1IY7 A;  2C1C A;  2PIY A;  1AYE A;  1Z2L A;  3L2N A;  1UWY A;  4PXB A;  5HVG A;  4IK2 A;  1Y0R A;  2CF4 A;  5CPA A;  2GLF A;  4NJR A;  2PVV A;  3PFO A;  3PBB A;  4B6Z A;  1XJO A;  4MHZ A;  3B3V A;  3FH4 A;  2NYQ A;  3PB7 X;  5D29 A;  5LRG A;  2V8V A;  3KI9 A;  1TKF A;  2AFM A;  5DS0 A;  2BO9 A;  4CPA A;  5ELY A;  4ZI6 A;  4X8I A;  2HB6 A;  3B3T A;  3D7G A;  4P44 A;  3IIB A;  3LWU A;  1YW4 A;  4W9Y A;  4ZX8 A;  1YSJ A;  2EWB A;  2IMO A;  5K8M A;  3H8E A;  2WYR A;  2ZOG A;  4OID A;  1BAV A;  1CX8 A;  4BD9 A;  3CPA A;  4UIA A;  4X3R A;  3B3C A;  4OC4 A;  3KZW A;  4KSI A;  1LAP A;  3BHX A;  2ZEH A;  2ZEM A;  4NGQ A;  1M4L A;  3SJX A;  3WAB A;  5F09 A;  1VIX A;  2PJ6 A;  4A37 A;  4EWT A;  3NA6 A;  4R8F A;  4EFD A;  4NGN A;  2GU2 A;  1NSA A;  3T8W A;  4WJB A;  2PVW A;  2ZEO A;  4A38 A;  2ABZ A;  4MHP A;  4UEE A;  3TC8 A;  2PJC A;  1CP7 A;  3ISZ A;  1TF8 A;  1Z8L A;  4P4F A;  3I1U A;  3NFZ A;  3FVL A;  2FVG A;  3B7I A;  4FAI A;  4PQA A;  2POK A;  2IJZ A;  2Q51 A;  5K8P A;  4OP4 A;  5IB9 A;  1ELL P;  2OR4 A;  5I4M A;  1PCA A;  1XRY A;  5HVF A;  1CP6 A;  2ZED A;  1BPN A;  8CPA A;  3PB8 X;  5LYL A;  1ZG7 A;  4P4I A;  3B35 A;  2V8G A;  3HLP A;  3IJ3 A;  4LQG A;  4DUK A;  1R3N A;  3NH4 A;  2GLJ A;  1IGB A;  1TXR A;  4OME A;  4P4E A;  3WC7 A;  2XEJ A;  4MCP A;  4ZY1 A;  2Q43 A;  1CG2 A;  5LRJ A;  4R76 A;  3D7D A;  3RAM A;  3SI1 A;  1CBX A;  2ZEF A;  1DE4 C;  3SJE A;  1AMP A;  5JH9 A;  1ZG9 A;  2AFX A;  3WT4 A;  5CBM A;  1KWM A;  2GRE A;  4OC5 A;  3PBE A;  3B3S A;  4Q7A A;  1ZLH A;  2QYV A;  1GYT A;  4DJL A;  2RFH A;  2I3C A;  3H8F A;  3BI0 A;  3IC1 A;  2AFZ A;  3FJU A;  2AFS A;  1YW6 A;  2AFW A;  3V7Z A;  4ZYQ A;  1R43 A;  3FX6 A;  5LYD A;  3K2K A;  3K9T A;  4DYO A;  3PB6 X;  1HEE A;  4UIB A;  3SI2 A;  4OC2 A;  3RZA A;  2PJ1 A;  3SJF A;  2ZOF A;  4OC3 A;  2PJ8 A;  1Y0Y A;  2QVP A;  3KQZ A;  4MCS A;  7CPA A;  4OKO A;  2QJ8 A;  4ONW A;  3CPX A;  3D7H A;  4K3N A;  3KHZ A;  3BXM A;  1DTD A;  3JRU A;  1CPS A;  4ZX9 A;  2WZN A;  2AFU A;  2O53 A;  4PXC A;  3WC5 A;  1VHE A;  3B2Y A;  1JQG A;  1XMB A;  3TX8 A;  2PJ2 A;  1EE3 P;  2ANP A;  2OOT A;  1Y7E A;  4R7M A;  2PCU A;  3FMC A;  6CPA A;  3QNV A;  4MHY A;  1H8L A;  2VL1 A;  3KR4 A;  2PJB A;  3GB0 A;  1QQ9 A;  5K8O A;  4A94 A;  4UEZ A;  3DGV A;  1FNO A;  2PJ5 A;  2CIJ A;  4UF4 A;  3VH9 A;  3KAS A;  4X2T A;  4F9V A;  5JM6 A;  4H2K A;  1VGY A;  3D66 A;  1PYT B;  2PJ7 A;  5D8N A;  3ISX A;  2XEG A;  3PFE A;  3PB4 X;  1HDU A;  3H8G A;  3IEH A;  3VAR A;  4O23 A;  1F2P A;  3V38 A;  4IHM A;  4Z65 A;  2XEF A;  2DEA A;  4WWV A;  2IQ6 A;  2PJ3 A;  3VAT A;  3MN8 A;  3B3W A;  3CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...