1TKFA

Streptomyces griseus aminopeptidase complexed with d-tryptophan
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
273
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 108
structure length 273
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkfA00
4KSIA 2PJ1A 4ZX9A 2XEIA 4P4BA 5D8NA 4FWUA 3BI0A 1YSJA 1LANA 1QMUA 3GB0A 3NH5A 3FEDA 2AFUA 2PJ0A 4LQGA 3I1UA 4MHPA 2F8HA 3CPXA 4X2TA 3IWWA 4X3RA 4R76A 4R8FA 3D7HA 1RTQA 2Q51A 2JBKA 2ZEFA 1XBUA 4UEFA 2BCOA 1M4LA 1VHOA 1PCAA 3N5FA 4EFDA 1IGBA 2V8HA 5IB9A 3PB7X 1Y7EA 4OC0A 2WZNA 4Z65A 3IJ3A 4PXDA 3JRUA 5K8PA 4MCPA 2NSMA 3FJUA 1LAMA 3PB6X 3HUVA 4P4JA 4PXBA 1Z5RA 4TWEA 2PJ3A 4P4IA 1EE3P 4UF4A 2F7VA 5ELYA 1XMBA 3D7FA 2C6PA 4PQAA 1H8LA 3PRTA 3S9NA 4WWVA 2OOTA 1XJOA 2PJ5A 3PEIA 4P6YA 2GLJA 2EWBA 1BAVA 4DYOA 3NH4A 1ZG7A 2GU2A 1TXRA 4NGSA 3T8WA 2ZOGA 5J1QA 2PJ4A 3ISXA 1ZLIA 3V7ZA 4OC2A 3PB4X 2GREA 2PJCA 2O53A 2C1CA 4ZY0A 1ARLA 1LFWA 2EK9A 4NGPA 2Q4ZA 5CBMA 3V38A 3TC8A 2NYQA 4K3NA 3H8EA 3GLJA 4ZY1A 4YWYA 2RB7A 1TF8A 3ISZA 4CPAA 1Y0YA 4P4DA 1VIXA 3PFEA 4TNUA 3TX8A 1CBXA 2GLFA 1Z8LA 1VGYA 3B3WA 4A37A 1UWYA 1ZG8A 3KR5A 4MMOA 3K2KA 3SJXA 3B2YA 3IO1A 2PJ2A 1R43A 1LAPA 3KQZA 1BPNA 2JBJA 1QQ9A 3D4UA 4F9VA 3FEEA 2PIZA 4ZY2A 4A94A 5JH9A 4A39A 2HC9A 3WC6A 4OIDA 3KQXA 1F2OA 4ZI6A 4MCSA 3HLPA 1FT7A 2PJAA 2FVGA 4OC4A 2XEJA 4P10A 3D68A 3NH8A 1AYEA 2G9DA 2PJ6A 4FUUA 2JEWA 4UIAA 1CPXA 4OC5A 3BXMA 1TKFA 3SI2A 1ARMA 4ZX8A 4OMEA 4ONWA 2CTBA 2ABZA 3MRUA 3PB8X 4UEZA 3FF3A 4A38A 3WABA 3NFZA 4GM5A 3VH9A 3CT9A 3D66A 5D29A 3H8FA 2ZEEA 3FMCA 2HB6A 2IJZA 4IK2A 3FH4A 1YLOA 2IMOA 1DTDA 3VARA 3B35A 1HDQA 3PFOA 2CTCA 5I4MA 3MN8A 2PVVA 5THWA 4NGTA 1JQGA 3B3VA 4NFRA 4MCQA 2V8VA 2RFHA 2AFSA 1ZG9A 4FBEA 2ZEOA 4P45A 3B7IA 4F8ZA 1YMEA 3LMSA 2V77A 1CP6A 4FAIA 4Q7AA 2CF4A 2V8DA 4UEEA 4MXUA 2VL1A 2AFWA 4P44A 4RUHA 4MHZA 3KL9A 4EMEA 2AFMA 2QJ8A 2AFOA 2OR4A 1Q7LA 3LWUA 2POKA 3GUXA 1R3NA 3RBUA 2EK8A 3WT4A 3NA6A 4MHNA 1CP7A 1ELMP 1ELLP 3IC1A 3FECA 4R6TA 4PXCA 1IY7A 3IEHA 1ZLHA 2AFXA 3BHXA 3KI9A 3S9MA 5LYLA 4BD9A 2PRQA 4NJRA 2ZENA 3IIBA 2ZEDA 2J9AA 4YU9A 1F57A 2CIJA 4NGNA 1XRYA 1DE4C 4OP4A 2C6CA 5LRKA 1BPMA 4WJBA 3SJGA 1CX8A 2V8GA 3D7DA 5HXDA 4IHMA 3SI0A 2XEGA 3KGQA 2I3CA 4JYWA 3SI1A 2PE3A 3KHXA 1CPSA 5K8MA 5F09A 3S9LA 2ZELA 1BLLE 3VATA 4PXEA 5K8NA 3IFEA 5DS0A 3SJEA 4ZYQA 1XFOA 4W9YA 4OIWA 5K8OA 1LOKA 2IQ6A 2C6GA 4UIBA 8CPAA 1KWMA 2Q43A 3KHZA 5LYDA 5CPAA 3QNVA 2BOAA 1AMPA 2QVPA 3PB9X 5JM6A 5HVGA 1TKJA 2PCUA 5LYFA 2PVWA 5HVFA 2XEFA 4OC1A 3SJFA 1TF9A 2PJBA 1YW4A 3DLJA 1HDUA 4O23A 4R7MA 3WC7A 6CPAA 1CG2A 3KR4A 1PYTB 2ZEHA 1YW6A 4X8IA 2ZEPA 3CDXA 4P4FA 3DGVA 3L2NA 3K9TA 2BO9A 4MCRA 2ZEMA 2PJ9A 5JGFA 3D67A 1Z2LA 4NGMA 2PJ8A 2ZOFA 3B3TA 4MHYA 3PBEA 4MRIA 3RAMA 1HEEA 1OBRA 1FNOA 1Y0RA 4H2KA 4OKOA 4G1PA 4NJQA 2PJ7A 3WC5A 4IAVA 1F2PA 4EWTA 1GYTA 3PBBA 4NGQA 1TKHA 2AFZA 2QYVA 3B3SA 2ZEGA 5LRJA 4OC3A 2O4HA 4DJLA 1VHEA 3RZAA 4P4EA 3B3CA 3FVLA 3KASA 4F9UA 3BI1A 1LCPA 3H8GA 3KZWA 7CPAA 4PPZA 2WYRA 4B6ZA 3CPAA 3D7GA 4AXVA 5LYIA 4DUKA 5LRGA 2ANPA 2PIYA 2DEAA 4NGRA 3FX6A 4JZ0A 1NSAA 5HVHA
chains in the Genus database with same CATH superfamily
4KSIA 4B14A 3D2PA 3JTKA 2PJ1A 4UA3A 4QB9A 1CJWA 2DXQA 1IU8A 3D8PA 4ZX9A 1BO4A 2XEIA 4P4BA 5D8NA 1KUVA 4FWUA 3BI0A 4U9YA 5AG4A 1YSJA 2O28A 2BEIA 4CAXA 1IOFA 1LANA 2Q44A 3B8GA 3NE8A 1QMUA 3GB0A 3NH5A 1MJAA 3FEDA 1UFHA 4YFJA 4H6ZA 5C82A 4IF5A 2AFUA 1NSLA 4YGOA 4C7IA 5IX3A 4OLLA 2PJ0A 2QECA 4LQGA 2B5GB 4CAVA 3W6SA 3I1UA 4MHPA 2F8HA 5C88A 3CPXA 4X2TA 3IWWA 5H84A 4X3RA 1YLEA 4R76A 4R8FA 3D7HA 1RTQA 2Q51A 4A95A 4MBUA 5F46A 2JBKA 2ZEFA 1BOBA 4MFPA 4Q38A 2JDCA 1XBUA 4UEFA 5AGEA 2BCOA 5J8FA 2DPSA 2QMLA 1WK4A 4Y49B 4UWJA 4UCNA 1M4LA 2EUIA 4KOYA 1VHOA 5EMIA 1PCAA 1PUAA 3OWCA 2DF5A 3N5FA 2Y0MA 4PSXA 4EFDA 2Z3PA 1IGBA 2QIRA 4KOTA 4PK3A 4C2XA 1QSNA 5E96A 2V8HA 4JXRA 5IB9A 2G3AA 4CGNA 1VKCA 3DR6A 3PB7X 1RXTA 2Z3NA 1Y7EA 2FT0A 2CXAA 3N7ZA 4OC0A 1XF8A 2PR8A 2ARHA 5IB0A 1A2ZA 4QBJA 2WZNA 4Z65A 4XPKA 2DPTA 3TE4A 3EC4A 3IJ3A 1L0CA 4LX9A 4A30A 4GS4A 2B3VA 4PXDA 3JRUA 2CNSA 1B6BA 2R7HA 5K8PA 4MCPA 4DNCA 3A9LA 4A31A 2NSMA 4JJXA 3FJUA 1LAMA 3PB6X 3HUVA 3SHPA 4P4JA 4PXBA 3G8WA 4XPLA 4A32A 1Z5RA 4TWEA 2PJ3A 4P4IA 1EE3P 4UF4A 2D4OA 2F7VA 2CY2A 5ELYA 1IYKA 1XMBA 3D7FA 2NMTA 1K4JA 2C6PA 1XOVA 4PQAA 1H8LA 3PRTA 4KS9A 3S9NA 4WWVA 4NSQA 2OOTA 1XJOA 3P2HA 2PJ5A 3NE7A 3PEIA 4P6YA 2GLJA 4R9MA 2EWBA 1BAVA 5CNPA 4MFZA 1LRZA 4RS2A 4DYOA 3NH4A 1XEBA 1ZG7A 3P2FA 4CS0B 1S7LA 2GU2A 1TXRA 3F5BA 4NGSA 2G3TA 1Z8TA 3T8WA 4CGPA 1X12A 4KLWA 4CGMA 4UCMA 4KOSA 2ZOGA 3R9EA 5J1QA 2PJ4A 4QUSA 4ZBGA 4X5KA 3JVNA 3ISXA 1ZLIA 3V7ZA 4OC2A 3PB4X 5G1ZA 2GREA 2PJCA 2O53A 1OZPA 2C1CA 3IU1A 4ZY0A 1ARLA 1LFWA 2EVNA 1Z8XA 3DSBA 5IV0A 2AJ6A 2EK9A 2P6EA 1FY7A 4MFKA 3TO6A 1S60A 4NGPA 4KLVA 2Z0ZA 2Q4ZA 5CBMA 3V38A 3TC8A 4U9ZA 2BL1A 1QSTA 2NYQA 3LODA 4KSAA 4K3NA 2FL4A 3H8EA 4HPSA 4B12A 3CXSA 4C2YA 3GLJA 4ZY1A 3DR8A 4YWYA 2RB7A 1TF8A 3ISZA 1VHSA 4CPAA 2RC4A 4KOUA 4KUAA 3R9FA 1Y0YA 4P4DA 2PRBA 4MJ8A 2PR1A 1VIXA 3PFEA 4TNUA 5G21A 3TX8A 3RYOA 1CBXA 2GLFA 1YR0A 1Q2CA 1VGYA 1Z8LA 1S7KA 3B3WA 2WSAA 4A37A 1UWYA 1Y7RA 1ZG8A 4I49A 3KR5A 4MMOA 2C27A 3K2KA 1IICA 2B4DA 3B2YA 3SJXA 1IIDA 3IO1A 2PJ2A 3RNZA 1R43A 4B11A 2YGWA 4M3SA 1M4IA 4OADA 4AG7A 1LAPA 1RO5A 2PDOA 3KQZA 1BPNA 2I00A 1JWQA 2J8NA 2OU2A 2OZGA 4CYNA 1I1DA 2JBJA 4M85A 1ON0A 1QQ9A 2JLMA 3D4UA 3FEEA 3LD2A 3WR7A 2PIZA 4F9VA 4II9A 4ZY2A 3T90A 4A94A 2Q4VA 5A27A 5JH9A 2VI7A 1R57A 2FSRA 4A39A 2HC9A 3WC6A 4OIDA 3I3GA 3KQXA 4XNHC 4CAEA 1XIXA 1F2OA 1Y9KA 4MCSA 5EBVA 4BINA 4ZI6A 3HLPA 1FT7A 5J8CA 1YX0A 2PJAA 2Q7SA 2FVGA 4OC4A 2XEJA 2FXFA 1IB1E 3D68A 3QAHA 4P10A 3FIXA 3NH8A 1AYEA 4M6GA 1AUGA 3IGRA 2G9DA 2PJ6A 4FUUA 2JEWA 2REEA 4UIAA 3CXQA 1XE4A 1CPXA 4OC5A 4A33A 4R3KA 4FD5A 3BXMA 1TKFA 2REFA 3SI2A 1ARMA 2JDDA 4ZX8A 4OMEA 3R95A 4ONWA 2CTBA 3LACA 2ABZA 3MRUA 3PB8X 2FIAA 4B10A 4CAFA 2I79A 4UEZA 3FF3A 2R98A 4RN7A 4A38A 3WABA 4OAEA 2FS5A 3NFZA 3FB3A 1SQHA 4NXYA 4ONUA 4GM5A 3VH9A 2P0WA 3CT9A 3D66A 4KOVA 5D29A 3H8FA 4L89A 4C7HA 4CAWA 3R9GA 3SXNA 1YVKA 2ZEEA 3FMCA 2HB6A 3PZJA 2ZW4A 2VXKA 3S6FA 2IJZA 4IK2A 3FH4A 4LUAA 3TO7A 1YLOA 4UWIA 2R8VA 2IMOA 5DWNA 4QC6A 1DTDA 3DNSA 3TOBA 4F6AA 2ZXVA 3B35A 1HDQA 3IWGA 3PFOA 3VARA 2CTCA 3CXPA 4KUBA 2YNCC 4ZGYB 4Y49C 3MN8A 4BMHA 5I4MA 1S5KA 2PVVA 5THWA 3D2MA 2EO8A 2ZPAA 3PP9A 1JQGA 3B3VA 4MFQA 4NGTA 2ODFA 3FXTA 4NFRA 4MCQA 4AG9A 2Q4YA 4C2ZA 3ZJ0A 2V8VA 2RFHA 2AFSA 5ISVA 3TFYA 2ZW7A 1ZG9A 1I21A 4LQ6A 3RO0A 1Q2YA 2Z3MA 1TIQA 1S3ZA 4FBEA 2ZEOA 4P45A 2OZHA 2YNDA 3B7IA 4F8ZA 3FRMA 3S6GA 4R57A 4XPDC 2Q7BA 1YMEA 3LMSA 2V77A 1CP6A 4HKFA 4FAIA 3F8KA 1Q2DA 1WWZA 4Q7AA 4R87A 1Z4RA 5H86A 4U5YA 3SXOA 2CF4A 2V8DA 1IYLA 4CYPA 4UEEA 2P6FA 4MXUA 3W6XA 2WPXA 3I9SA 2VL1A 2AFWA 3K9UA 3IWEA 4MY0A 2Z11A 5AG5A 4P44A 1U6MA 4MHZA 1M44A 3CZXA 4RUHA 3KL9A 4EMEA 2JEVA 2Z3LA 5EC4A 3H5ZA 5F48A 1M1DA 4C68A 2BSWA 2GIVA 2AFMA 2QJ8A 2AFOA 2OR4A 3GKRA 1Q7LA 3LWUA 2P6GA 2POKA 3MGDA 4UFXA 3GUXA 1R3NA 3RBUA 3EY5A 2EK8A 3FYNA 1IOIA 1NE9A 1B87A 3NA6A 4H6UA 4MHNA 3WT4A 1CP7A 2B4DB 3FNCA 1ELMP 1ELLP 2B58A 2Q0YA 3IC1A 3FECA 4UFVA 4R6TA 1IY7A 2KCWA 3IEHA 4PXCA 2Z3KA 5G22A 1ZLHA 2AFXA 3BHXA 3KI9A 3S9MA 2R1IA 5AG7A 3E0KA 5LYLA 2WUUA 4KSFA 4JWPA 4MHDA 4F0YA 4KOXA 1CM0A 2CNTA 3GIUA 4XPDB 3G3SA 2PRQA 4NJRA 4BD9A 1Z8WA 2ZENA 3IIBA 2ZEDA 4KVXA 2J9AA 1MJBA 4QVTA 3F0AA 2B4BA 4KORA 1J4JA 4AB7A 5HVHA 2VZYA 4YU9A 1F57A 2CIJA 4NGNA 1XRYA 4GXHA 3TT2A 1DE4C 4OP4A 2VQYA 3TTHA 2B3UA 3C26A 3GY9A 1MJ9A 4NF1A 4B5PA 4M6IA 3W91A 4L8AA 2GANA 2C6CA 5LRKA 1BPMA 4CRYB 2VEZA 4WJBA 3BLNA 3SJGA 4KVOE 1CX8A 4AVCA 5G20A 2OH1A 4KOWA 2V8GA 4MFLA 5F47A 3BJ8A 4AVAA 2BUEA 4HNXB 3TOAA 3D7DA 5HXDA 4IHMA 3SI0A 2XEGA 3KGQA 2I3CA 1I12A 4JYWA 3SI1A 3EXNA 2AE6A 2ZW6A 4PK2A 4UBRA 2PE3A 5KTAA 2FIWA 3KHXA 1CPSA 3DDDA 5K8MA 1QSOA 1Z4EA 2WPWA 5KTDA 1Y9WA 3JUWA 1XMTA 3ZZIA 2HQYA 3S6KA 5F09A 3S9LA 2ZELA 1BLLE 3VATA 4PXEA 5K8NA 3IFEA 2ATRA 4CGOA 2VZZA 4HNYB 5DS0A 2GE3A 4MFJA 3SJEA 4EVYA 4ZYQA 1XFOA 4W9YA 2D4PA 2YNEA 4OIWA 5K8OA 1LOKA 4B5OA 2IQ6A 4BBHA 2C6GA 4CYQA 4UIBA 8CPAA 3VWDA 1GHEA 1KWMA 1V0CA 2OB0A 2Q43A 3KHZA 5LYDA 5CPAA 4FD6A 4JXQA 3QNVA 4XNHB 3T9YA 2BOAA 4CRZB 3EFAA 5A28A 4YRHA 3BJ7A 4FD7A 4M6HA 2Z3OA 1AMPA 2QVPA 3PB9X 3QB8A 4PSWA 4FD4A 4AVBA 5JM6A 3KKWA 4UCPA 2G0BA 2HV2A 1TKJA 2YNCA 5HVGA 2IL4A 2PCUA 5LYFA 2PVWA 4RI1A 5HVFA 2XEFA 1YK3A 5GCNA 4OC1A 2EBJA 1P0HA 2VBQA 1TF9A 2PJBA 1YW4A 3DLJA 4JLYA 5HH1A 3SJFA 3V8IA 1HDUA 2X7BA 4O23A 4NEXA 3S6HA 4E2AA 2F5IA 1ZO0A 1N71A 4R7MA 3WC7A 6CPAA 2J8MA 1PU9A 1CG2A 4R3LA 3KR4A 1QSRA 4MY3A 1PYTB 2FCKA 2ZEHA 1YW6A 4X8IA 2ZEPA 4E0AA 3CDXA 4HNWB 4P4FA 3DGVA 3L2NA 4ORFA 3K9TA 2FE7A 2BO9A 4MCRA 2ZEMA 2PJ9A 5JQ4A 3EO4A 5JGFA 3D67A 1Z2LA 1P4NA 2GFQA 2PJ8A 1Z9UA 2ZOFA 3B3TA 3IU2A 1NMTA 3PBEA 3R1KA 4MHYA 4MRIA 3UY5A 4MI4A 5JPHA 3RAMA 4IUSA 1HEEA 1OBRA 4NCZA 4PV6A 1FNOA 1Y0RA 4H2KA 4H89A 5AG6A 5KTCA 4K30A 1KUYA 2K5TA 1QSMA 2OZUA 4OKOA 4B5PB 3PGPA 2PSWA 4G1PA 4NJQA 2PJ7A 3WC5A 4F0XA 4IAVA 4CGLA 3D3SA 5I0CA 2B5GA 2HUZA 3TO9A 4KZTA 2PQ8A 1KUXA 3TCVA 1F2PA 4EWTA 1GYTA 1S7FA 3FBUA 1YQEA 4E8OA 1YREA 3PBBA 4NGQA 1TKHA 2AFZA 2QYVA 3B3SA 2ZEGA 5LRJA 4Q36A 2ZW5A 4OC3A 5HMNA 2O4HA 5F49A 4DJLA 1VHEA 3RZAA 2Z10A 4UFWA 3R96A 4P4EA 1YVOA 1YGHA 3B3CA 3FVLA 4KVME 1M4GA 3KASA 3GYAA 4F9UA 3BI1A 1LCPA 3VWEA 3H8GA 4A2ZA 3KZWA 4CYOA 7CPAA 1MK4A 2J8RA 5BWAB 1KZFA 1S7NA 1M4DA 4PPZA 2WYRA 4B6ZA 1X10A 3CPAA 3D7GA 3H4QA 2Q04A 4AXVA 5LYIA 2CNMA 2PC1A 4J3GA 5LRGA 4DUKA 2ANPA 4JD6A 5DWMA 4B13A 2PIYA 2DEAA 4NGRA 3FX6A 4JZ0A 2A4NA 1NSAA 2H5MA 3QAYA 4NGMA 5FVJA
chains in the Genus database with same CATH topology
4KSIA 2PJ1A 4ZX9A 2XEIA 4P4BA 5D8NA 4FWUA 3BI0A 1YSJA 1LANA 1QMUA 3GB0A 3NH5A 3FEDA 2AFUA 2PJ0A 4LQGA 3I1UA 4MHPA 2F8HA 3CPXA 4X2TA 3IWWA 4X3RA 4R76A 4R8FA 3D7HA 1RTQA 2Q51A 2JBKA 2ZEFA 1XBUA 4UEFA 2BCOA 1M4LA 1VHOA 1PCAA 3N5FA 4EFDA 1IGBA 2V8HA 5IB9A 3PB7X 1Y7EA 4OC0A 2WZNA 4Z65A 3IJ3A 4PXDA 3JRUA 5K8PA 4MCPA 2NSMA 3FJUA 1LAMA 3PB6X 3HUVA 4P4JA 4PXBA 1Z5RA 4TWEA 2PJ3A 4P4IA 1EE3P 4UF4A 2F7VA 5ELYA 1XMBA 3D7FA 2C6PA 4PQAA 1H8LA 3PRTA 3S9NA 4WWVA 2OOTA 1XJOA 2PJ5A 3PEIA 4P6YA 2GLJA 2EWBA 1BAVA 4DYOA 3NH4A 1ZG7A 2GU2A 1TXRA 4NGSA 3T8WA 2ZOGA 5J1QA 2PJ4A 3ISXA 1ZLIA 3V7ZA 4OC2A 3PB4X 2GREA 2PJCA 2O53A 2C1CA 4ZY0A 1ARLA 1LFWA 2EK9A 4NGPA 2Q4ZA 5CBMA 3V38A 3TC8A 2NYQA 4K3NA 3H8EA 3GLJA 4ZY1A 4YWYA 2RB7A 1TF8A 3ISZA 4CPAA 1Y0YA 4P4DA 1VIXA 3PFEA 4TNUA 3TX8A 1CBXA 2GLFA 1Z8LA 1VGYA 3B3WA 4A37A 1UWYA 1ZG8A 3KR5A 4MMOA 3K2KA 3SJXA 3B2YA 3IO1A 2PJ2A 1R43A 1LAPA 3KQZA 1BPNA 2JBJA 1QQ9A 3D4UA 4F9VA 3FEEA 2PIZA 4ZY2A 4A94A 5JH9A 4A39A 2HC9A 3WC6A 4OIDA 3KQXA 1F2OA 4ZI6A 4MCSA 3HLPA 1FT7A 2PJAA 2FVGA 4OC4A 2XEJA 4P10A 3D68A 3NH8A 1AYEA 2G9DA 2PJ6A 4FUUA 2JEWA 4UIAA 1CPXA 4OC5A 3BXMA 1TKFA 3SI2A 1ARMA 4ZX8A 4OMEA 4ONWA 2CTBA 2ABZA 3MRUA 3PB8X 4UEZA 3FF3A 4A38A 3WABA 3NFZA 4GM5A 3VH9A 3CT9A 3D66A 5D29A 3H8FA 2ZEEA 3FMCA 2HB6A 2IJZA 4IK2A 3FH4A 1YLOA 2IMOA 1DTDA 3VARA 3B35A 1HDQA 3PFOA 2CTCA 5I4MA 3MN8A 2PVVA 5THWA 4NGTA 1JQGA 3B3VA 4NFRA 4MCQA 2V8VA 2RFHA 2AFSA 1ZG9A 4FBEA 2ZEOA 4P45A 3B7IA 4F8ZA 1YMEA 3LMSA 2V77A 1CP6A 4FAIA 4Q7AA 2CF4A 2V8DA 4UEEA 4MXUA 2VL1A 2AFWA 4P44A 4RUHA 4MHZA 3KL9A 4EMEA 2AFMA 2QJ8A 2AFOA 2OR4A 1Q7LA 3LWUA 2POKA 3GUXA 1R3NA 3RBUA 2EK8A 3WT4A 3NA6A 4MHNA 1CP7A 1ELMP 1ELLP 3IC1A 3FECA 4R6TA 4PXCA 1IY7A 3IEHA 1ZLHA 2AFXA 3BHXA 3KI9A 3S9MA 5LYLA 4BD9A 2PRQA 4NJRA 2ZENA 3IIBA 2ZEDA 2J9AA 4YU9A 1F57A 2CIJA 4NGNA 1XRYA 1DE4C 4OP4A 2C6CA 5LRKA 1BPMA 4WJBA 3SJGA 1CX8A 2V8GA 3D7DA 5HXDA 4IHMA 3SI0A 2XEGA 3KGQA 2I3CA 4JYWA 3SI1A 2PE3A 3KHXA 1CPSA 5K8MA 5F09A 3S9LA 2ZELA 1BLLE 3VATA 4PXEA 5K8NA 3IFEA 5DS0A 3SJEA 4ZYQA 1XFOA 4W9YA 4OIWA 5K8OA 1LOKA 2IQ6A 2C6GA 4UIBA 8CPAA 1KWMA 2Q43A 3KHZA 5LYDA 5CPAA 3QNVA 2BOAA 1AMPA 2QVPA 3PB9X 5JM6A 5HVGA 1TKJA 2PCUA 5LYFA 2PVWA 5HVFA 2XEFA 4OC1A 3SJFA 1TF9A 2PJBA 1YW4A 3DLJA 1HDUA 4O23A 4R7MA 3WC7A 6CPAA 1CG2A 3KR4A 1PYTB 2ZEHA 1YW6A 4X8IA 2ZEPA 3CDXA 4P4FA 3DGVA 3L2NA 3K9TA 2BO9A 4MCRA 2ZEMA 2PJ9A 5JGFA 3D67A 1Z2LA 4NGMA 2PJ8A 2ZOFA 3B3TA 4MHYA 3PBEA 4MRIA 3RAMA 1HEEA 1OBRA 1FNOA 1Y0RA 4H2KA 4OKOA 4G1PA 4NJQA 2PJ7A 3WC5A 4IAVA 1F2PA 4EWTA 1GYTA 3PBBA 4NGQA 1TKHA 2AFZA 2QYVA 3B3SA 2ZEGA 5LRJA 4OC3A 2O4HA 4DJLA 1VHEA 3RZAA 4P4EA 3B3CA 3FVLA 3KASA 4F9UA 3BI1A 1LCPA 3H8GA 3KZWA 7CPAA 4PPZA 2WYRA 4B6ZA 3CPAA 3D7GA 4AXVA 5LYIA 4DUKA 5LRGA 2ANPA 2PIYA 2DEAA 4NGRA 3FX6A 4JZ0A 1NSAA 5HVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSI A;  2PJ1 A;  4ZX9 A;  2XEI A;  4P4B A;  5D8N A;  4FWU A;  3BI0 A;  1YSJ A;  1LAN A;  1QMU A;  3GB0 A;  3NH5 A;  3FED A;  2AFU A;  2PJ0 A;  4LQG A;  3I1U A;  4MHP A;  2F8H A;  3CPX A;  4X2T A;  3IWW A;  4X3R A;  4R76 A;  4R8F A;  3D7H A;  1RTQ A;  2Q51 A;  2JBK A;  2ZEF A;  1XBU A;  4UEF A;  2BCO A;  1M4L A;  1VHO A;  1PCA A;  3N5F A;  4EFD A;  1IGB A;  2V8H A;  5IB9 A;  3PB7 X;  1Y7E A;  4OC0 A;  2WZN A;  4Z65 A;  3IJ3 A;  4PXD A;  3JRU A;  5K8P A;  4MCP A;  2NSM A;  3FJU A;  1LAM A;  3PB6 X;  3HUV A;  4P4J A;  4PXB A;  1Z5R A;  4TWE A;  2PJ3 A;  4P4I A;  1EE3 P;  4UF4 A;  2F7V A;  5ELY A;  1XMB A;  3D7F A;  2C6P A;  4PQA A;  1H8L A;  3PRT A;  3S9N A;  4WWV A;  2OOT A;  1XJO A;  2PJ5 A;  3PEI A;  4P6Y A;  2GLJ A;  2EWB A;  1BAV A;  4DYO A;  3NH4 A;  1ZG7 A;  2GU2 A;  1TXR A;  4NGS A;  3T8W A;  2ZOG A;  5J1Q A;  2PJ4 A;  3ISX A;  1ZLI A;  3V7Z A;  4OC2 A;  3PB4 X;  2GRE A;  2PJC A;  2O53 A;  2C1C A;  4ZY0 A;  1ARL A;  1LFW A;  2EK9 A;  4NGP A;  2Q4Z A;  5CBM A;  3V38 A;  3TC8 A;  2NYQ A;  4K3N A;  3H8E A;  3GLJ A;  4ZY1 A;  4YWY A;  2RB7 A;  1TF8 A;  3ISZ A;  4CPA A;  1Y0Y A;  4P4D A;  1VIX A;  3PFE A;  4TNU A;  3TX8 A;  1CBX A;  2GLF A;  1Z8L A;  1VGY A;  3B3W A;  4A37 A;  1UWY A;  1ZG8 A;  3KR5 A;  4MMO A;  3K2K A;  3SJX A;  3B2Y A;  3IO1 A;  2PJ2 A;  1R43 A;  1LAP A;  3KQZ A;  1BPN A;  2JBJ A;  1QQ9 A;  3D4U A;  4F9V A;  3FEE A;  2PIZ A;  4ZY2 A;  4A94 A;  5JH9 A;  4A39 A;  2HC9 A;  3WC6 A;  4OID A;  3KQX A;  1F2O A;  4ZI6 A;  4MCS A;  3HLP A;  1FT7 A;  2PJA A;  2FVG A;  4OC4 A;  2XEJ A;  4P10 A;  3D68 A;  3NH8 A;  1AYE A;  2G9D A;  2PJ6 A;  4FUU A;  2JEW A;  4UIA A;  1CPX A;  4OC5 A;  3BXM A;  1TKF A;  3SI2 A;  1ARM A;  4ZX8 A;  4OME A;  4ONW A;  2CTB A;  2ABZ A;  3MRU A;  3PB8 X;  4UEZ A;  3FF3 A;  4A38 A;  3WAB A;  3NFZ A;  4GM5 A;  3VH9 A;  3CT9 A;  3D66 A;  5D29 A;  3H8F A;  2ZEE A;  3FMC A;  2HB6 A;  2IJZ A;  4IK2 A;  3FH4 A;  1YLO A;  2IMO A;  1DTD A;  3VAR A;  3B35 A;  1HDQ A;  3PFO A;  2CTC A;  5I4M A;  3MN8 A;  2PVV A;  5THW A;  4NGT A;  1JQG A;  3B3V A;  4NFR A;  4MCQ A;  2V8V A;  2RFH A;  2AFS A;  1ZG9 A;  4FBE A;  2ZEO A;  4P45 A;  3B7I A;  4F8Z A;  1YME A;  3LMS A;  2V77 A;  1CP6 A;  4FAI A;  4Q7A A;  2CF4 A;  2V8D A;  4UEE A;  4MXU A;  2VL1 A;  2AFW A;  4P44 A;  4RUH A;  4MHZ A;  3KL9 A;  4EME A;  2AFM A;  2QJ8 A;  2AFO A;  2OR4 A;  1Q7L A;  3LWU A;  2POK A;  3GUX A;  1R3N A;  3RBU A;  2EK8 A;  3WT4 A;  3NA6 A;  4MHN A;  1CP7 A;  1ELM P;  1ELL P;  3IC1 A;  3FEC A;  4R6T A;  4PXC A;  1IY7 A;  3IEH A;  1ZLH A;  2AFX A;  3BHX A;  3KI9 A;  3S9M A;  5LYL A;  4BD9 A;  2PRQ A;  4NJR A;  2ZEN A;  3IIB A;  2ZED A;  2J9A A;  4YU9 A;  1F57 A;  2CIJ A;  4NGN A;  1XRY A;  1DE4 C;  4OP4 A;  2C6C A;  5LRK A;  1BPM A;  4WJB A;  3SJG A;  1CX8 A;  2V8G A;  3D7D A;  5HXD A;  4IHM A;  3SI0 A;  2XEG A;  3KGQ A;  2I3C A;  4JYW A;  3SI1 A;  2PE3 A;  3KHX A;  1CPS A;  5K8M A;  5F09 A;  3S9L A;  2ZEL A;  1BLL E;  3VAT A;  4PXE A;  5K8N A;  3IFE A;  5DS0 A;  3SJE A;  4ZYQ A;  1XFO A;  4W9Y A;  4OIW A;  5K8O A;  1LOK A;  2IQ6 A;  2C6G A;  4UIB A;  8CPA A;  1KWM A;  2Q43 A;  3KHZ A;  5LYD A;  5CPA A;  3QNV A;  2BOA A;  1AMP A;  2QVP A;  3PB9 X;  5JM6 A;  5HVG A;  1TKJ A;  2PCU A;  5LYF A;  2PVW A;  5HVF A;  2XEF A;  4OC1 A;  3SJF A;  1TF9 A;  2PJB A;  1YW4 A;  3DLJ A;  1HDU A;  4O23 A;  4R7M A;  3WC7 A;  6CPA A;  1CG2 A;  3KR4 A;  1PYT B;  2ZEH A;  1YW6 A;  4X8I A;  2ZEP A;  3CDX A;  4P4F A;  3DGV A;  3L2N A;  3K9T A;  2BO9 A;  4MCR A;  2ZEM A;  2PJ9 A;  5JGF A;  3D67 A;  1Z2L A;  4NGM A;  2PJ8 A;  2ZOF A;  3B3T A;  4MHY A;  3PBE A;  4MRI A;  3RAM A;  1HEE A;  1OBR A;  1FNO A;  1Y0R A;  4H2K A;  4OKO A;  4G1P A;  4NJQ A;  2PJ7 A;  3WC5 A;  4IAV A;  1F2P A;  4EWT A;  1GYT A;  3PBB A;  4NGQ A;  1TKH A;  2AFZ A;  2QYV A;  3B3S A;  2ZEG A;  5LRJ A;  4OC3 A;  2O4H A;  4DJL A;  1VHE A;  3RZA A;  4P4E A;  3B3C A;  3FVL A;  3KAS A;  4F9U A;  3BI1 A;  1LCP A;  3H8G A;  3KZW A;  7CPA A;  4PPZ A;  2WYR A;  4B6Z A;  3CPA A;  3D7G A;  4AXV A;  5LYI A;  4DUK A;  5LRG A;  2ANP A;  2PIY A;  2DEA A;  4NGR A;  3FX6 A;  4JZ0 A;  1NSA A;  5HVH A; 
#chains in the Genus database with same CATH topology
 4KSI A;  4B14 A;  3D2P A;  3JTK A;  2PJ1 A;  4UA3 A;  4QB9 A;  1CJW A;  2DXQ A;  1IU8 A;  3D8P A;  4ZX9 A;  1BO4 A;  2XEI A;  4P4B A;  5D8N A;  1KUV A;  4FWU A;  3BI0 A;  4U9Y A;  5AG4 A;  1YSJ A;  2O28 A;  2BEI A;  4CAX A;  1IOF A;  1LAN A;  2Q44 A;  3B8G A;  3NE8 A;  1QMU A;  3GB0 A;  3NH5 A;  1MJA A;  3FED A;  1UFH A;  4YFJ A;  4H6Z A;  5C82 A;  4IF5 A;  2AFU A;  1NSL A;  4YGO A;  4C7I A;  5IX3 A;  4OLL A;  2PJ0 A;  2QEC A;  4LQG A;  2B5G B;  4CAV A;  3W6S A;  3I1U A;  4MHP A;  2F8H A;  5C88 A;  3CPX A;  4X2T A;  3IWW A;  5H84 A;  4X3R A;  1YLE A;  4R76 A;  4R8F A;  3D7H A;  1RTQ A;  2Q51 A;  4A95 A;  4MBU A;  5F46 A;  2JBK A;  2ZEF A;  1BOB A;  4MFP A;  4Q38 A;  2JDC A;  1XBU A;  4UEF A;  5AGE A;  2BCO A;  5J8F A;  2DPS A;  2QML A;  1WK4 A;  4Y49 B;  4UWJ A;  4UCN A;  1M4L A;  2EUI A;  4KOY A;  1VHO A;  5EMI A;  1PCA A;  1PUA A;  3OWC A;  2DF5 A;  3N5F A;  2Y0M A;  4PSX A;  4EFD A;  2Z3P A;  1IGB A;  2QIR A;  4KOT A;  4PK3 A;  4C2X A;  1QSN A;  5E96 A;  2V8H A;  4JXR A;  5IB9 A;  2G3A A;  4CGN A;  1VKC A;  3DR6 A;  3PB7 X;  1RXT A;  2Z3N A;  1Y7E A;  2FT0 A;  2CXA A;  3N7Z A;  4OC0 A;  1XF8 A;  2PR8 A;  2ARH A;  5IB0 A;  1A2Z A;  4QBJ A;  2WZN A;  4Z65 A;  4XPK A;  2DPT A;  3TE4 A;  3EC4 A;  3IJ3 A;  1L0C A;  4LX9 A;  4A30 A;  4GS4 A;  2B3V A;  4PXD A;  3JRU A;  2CNS A;  1B6B A;  2R7H A;  5K8P A;  4MCP A;  4DNC A;  3A9L A;  4A31 A;  2NSM A;  4JJX A;  3FJU A;  1LAM A;  3PB6 X;  3HUV A;  3SHP A;  4P4J A;  4PXB A;  3G8W A;  4XPL A;  4A32 A;  1Z5R A;  4TWE A;  2PJ3 A;  4P4I A;  1EE3 P;  4UF4 A;  2D4O A;  2F7V A;  2CY2 A;  5ELY A;  1IYK A;  1XMB A;  3D7F A;  2NMT A;  1K4J A;  2C6P A;  1XOV A;  4PQA A;  1H8L A;  3PRT A;  4KS9 A;  3S9N A;  4WWV A;  4NSQ A;  2OOT A;  1XJO A;  3P2H A;  2PJ5 A;  3NE7 A;  3PEI A;  4P6Y A;  2GLJ A;  4R9M A;  2EWB A;  1BAV A;  5CNP A;  4MFZ A;  1LRZ A;  4RS2 A;  4DYO A;  3NH4 A;  1XEB A;  1ZG7 A;  3P2F A;  4CS0 B;  1S7L A;  2GU2 A;  1TXR A;  3F5B A;  4NGS A;  2G3T A;  1Z8T A;  3T8W A;  4CGP A;  1X12 A;  4KLW A;  4CGM A;  4UCM A;  4KOS A;  2ZOG A;  3R9E A;  5J1Q A;  2PJ4 A;  4QUS A;  4ZBG A;  4X5K A;  3JVN A;  3ISX A;  1ZLI A;  3V7Z A;  4OC2 A;  3PB4 X;  5G1Z A;  2GRE A;  2PJC A;  2O53 A;  1OZP A;  2C1C A;  3IU1 A;  4ZY0 A;  1ARL A;  1LFW A;  2EVN A;  1Z8X A;  3DSB A;  5IV0 A;  2AJ6 A;  2EK9 A;  2P6E A;  1FY7 A;  4MFK A;  3TO6 A;  1S60 A;  4NGP A;  4KLV A;  2Z0Z A;  2Q4Z A;  5CBM A;  3V38 A;  3TC8 A;  4U9Z A;  2BL1 A;  1QST A;  2NYQ A;  3LOD A;  4KSA A;  4K3N A;  2FL4 A;  3H8E A;  4HPS A;  4B12 A;  3CXS A;  4C2Y A;  3GLJ A;  4ZY1 A;  3DR8 A;  4YWY A;  2RB7 A;  1TF8 A;  3ISZ A;  1VHS A;  4CPA A;  2RC4 A;  4KOU A;  4KUA A;  3R9F A;  1Y0Y A;  4P4D A;  2PRB A;  4MJ8 A;  2PR1 A;  1VIX A;  3PFE A;  4TNU A;  5G21 A;  3TX8 A;  3RYO A;  1CBX A;  2GLF A;  1YR0 A;  1Q2C A;  1VGY A;  1Z8L A;  1S7K A;  3B3W A;  2WSA A;  4A37 A;  1UWY A;  1Y7R A;  1ZG8 A;  4I49 A;  3KR5 A;  4MMO A;  2C27 A;  3K2K A;  1IIC A;  2B4D A;  3B2Y A;  3SJX A;  1IID A;  3IO1 A;  2PJ2 A;  3RNZ A;  1R43 A;  4B11 A;  2YGW A;  4M3S A;  1M4I A;  4OAD A;  4AG7 A;  1LAP A;  1RO5 A;  2PDO A;  3KQZ A;  1BPN A;  2I00 A;  1JWQ A;  2J8N A;  2OU2 A;  2OZG A;  4CYN A;  1I1D A;  2JBJ A;  4M85 A;  1ON0 A;  1QQ9 A;  2JLM A;  3D4U A;  3FEE A;  3LD2 A;  3WR7 A;  2PIZ A;  4F9V A;  4II9 A;  4ZY2 A;  3T90 A;  4A94 A;  2Q4V A;  5A27 A;  5JH9 A;  2VI7 A;  1R57 A;  2FSR A;  4A39 A;  2HC9 A;  3WC6 A;  4OID A;  3I3G A;  3KQX A;  4XNH C;  4CAE A;  1XIX A;  1F2O A;  1Y9K A;  4MCS A;  5EBV A;  4BIN A;  4ZI6 A;  3HLP A;  1FT7 A;  5J8C A;  1YX0 A;  2PJA A;  2Q7S A;  2FVG A;  4OC4 A;  2XEJ A;  2FXF A;  1IB1 E;  3D68 A;  3QAH A;  4P10 A;  3FIX A;  3NH8 A;  1AYE A;  4M6G A;  1AUG A;  3IGR A;  2G9D A;  2PJ6 A;  4FUU A;  2JEW A;  2REE A;  4UIA A;  3CXQ A;  1XE4 A;  1CPX A;  4OC5 A;  4A33 A;  4R3K A;  4FD5 A;  3BXM A;  1TKF A;  2REF A;  3SI2 A;  1ARM A;  2JDD A;  4ZX8 A;  4OME A;  3R95 A;  4ONW A;  2CTB A;  3LAC A;  2ABZ A;  3MRU A;  3PB8 X;  2FIA A;  4B10 A;  4CAF A;  2I79 A;  4UEZ A;  3FF3 A;  2R98 A;  4RN7 A;  4A38 A;  3WAB A;  4OAE A;  2FS5 A;  3NFZ A;  3FB3 A;  1SQH A;  4NXY A;  4ONU A;  4GM5 A;  3VH9 A;  2P0W A;  3CT9 A;  3D66 A;  4KOV A;  5D29 A;  3H8F A;  4L89 A;  4C7H A;  4CAW A;  3R9G A;  3SXN A;  1YVK A;  2ZEE A;  3FMC A;  2HB6 A;  3PZJ A;  2ZW4 A;  2VXK A;  3S6F A;  2IJZ A;  4IK2 A;  3FH4 A;  4LUA A;  3TO7 A;  1YLO A;  4UWI A;  2R8V A;  2IMO A;  5DWN A;  4QC6 A;  1DTD A;  3DNS A;  3TOB A;  4F6A A;  2ZXV A;  3B35 A;  1HDQ A;  3IWG A;  3PFO A;  3VAR A;  2CTC A;  3CXP A;  4KUB A;  2YNC C;  4ZGY B;  4Y49 C;  3MN8 A;  4BMH A;  5I4M A;  1S5K A;  2PVV A;  5THW A;  3D2M A;  2EO8 A;  2ZPA A;  3PP9 A;  1JQG A;  3B3V A;  4MFQ A;  4NGT A;  2ODF A;  3FXT A;  4NFR A;  4MCQ A;  4AG9 A;  2Q4Y A;  4C2Z A;  3ZJ0 A;  2V8V A;  2RFH A;  2AFS A;  5ISV A;  3TFY A;  2ZW7 A;  1ZG9 A;  1I21 A;  4LQ6 A;  3RO0 A;  1Q2Y A;  2Z3M A;  1TIQ A;  1S3Z A;  4FBE A;  2ZEO A;  4P45 A;  2OZH A;  2YND A;  3B7I A;  4F8Z A;  3FRM A;  3S6G A;  4R57 A;  4XPD C;  2Q7B A;  1YME A;  3LMS A;  2V77 A;  1CP6 A;  4HKF A;  4FAI A;  3F8K A;  1Q2D A;  1WWZ A;  4Q7A A;  4R87 A;  1Z4R A;  5H86 A;  4U5Y A;  3SXO A;  2CF4 A;  2V8D A;  1IYL A;  4CYP A;  4UEE A;  2P6F A;  4MXU A;  3W6X A;  2WPX A;  3I9S A;  2VL1 A;  2AFW A;  3K9U A;  3IWE A;  4MY0 A;  2Z11 A;  5AG5 A;  4P44 A;  1U6M A;  4MHZ A;  1M44 A;  3CZX A;  4RUH A;  3KL9 A;  4EME A;  2JEV A;  2Z3L A;  5EC4 A;  3H5Z A;  5F48 A;  1M1D A;  4C68 A;  2BSW A;  2GIV A;  2AFM A;  2QJ8 A;  2AFO A;  2OR4 A;  3GKR A;  1Q7L A;  3LWU A;  2P6G A;  2POK A;  3MGD A;  4UFX A;  3GUX A;  1R3N A;  3RBU A;  3EY5 A;  2EK8 A;  3FYN A;  1IOI A;  1NE9 A;  1B87 A;  3NA6 A;  4H6U A;  4MHN A;  3WT4 A;  1CP7 A;  2B4D B;  3FNC A;  1ELM P;  1ELL P;  2B58 A;  2Q0Y A;  3IC1 A;  3FEC A;  4UFV A;  4R6T A;  1IY7 A;  2KCW A;  3IEH A;  4PXC A;  2Z3K A;  5G22 A;  1ZLH A;  2AFX A;  3BHX A;  3KI9 A;  3S9M A;  2R1I A;  5AG7 A;  3E0K A;  5LYL A;  2WUU A;  4KSF A;  4JWP A;  4MHD A;  4F0Y A;  4KOX A;  1CM0 A;  2CNT A;  3GIU A;  4XPD B;  3G3S A;  2PRQ A;  4NJR A;  4BD9 A;  1Z8W A;  2ZEN A;  3IIB A;  2ZED A;  4KVX A;  2J9A A;  1MJB A;  4QVT A;  3F0A A;  2B4B A;  4KOR A;  1J4J A;  4AB7 A;  5HVH A;  2VZY A;  4YU9 A;  1F57 A;  2CIJ A;  4NGN A;  1XRY A;  4GXH A;  3TT2 A;  1DE4 C;  4OP4 A;  2VQY A;  3TTH A;  2B3U A;  3C26 A;  3GY9 A;  1MJ9 A;  4NF1 A;  4B5P A;  4M6I A;  3W91 A;  4L8A A;  2GAN A;  2C6C A;  5LRK A;  1BPM A;  4CRY B;  2VEZ A;  4WJB A;  3BLN A;  3SJG A;  4KVO E;  1CX8 A;  4AVC A;  5G20 A;  2OH1 A;  4KOW A;  2V8G A;  4MFL A;  5F47 A;  3BJ8 A;  4AVA A;  2BUE A;  4HNX B;  3TOA A;  3D7D A;  5HXD A;  4IHM A;  3SI0 A;  2XEG A;  3KGQ A;  2I3C A;  1I12 A;  4JYW A;  3SI1 A;  3EXN A;  2AE6 A;  2ZW6 A;  4PK2 A;  4UBR A;  2PE3 A;  5KTA A;  2FIW A;  3KHX A;  1CPS A;  3DDD A;  5K8M A;  1QSO A;  1Z4E A;  2WPW A;  5KTD A;  1Y9W A;  3JUW A;  1XMT A;  3ZZI A;  2HQY A;  3S6K A;  5F09 A;  3S9L A;  2ZEL A;  1BLL E;  3VAT A;  4PXE A;  5K8N A;  3IFE A;  2ATR A;  4CGO A;  2VZZ A;  4HNY B;  5DS0 A;  2GE3 A;  4MFJ A;  3SJE A;  4EVY A;  4ZYQ A;  1XFO A;  4W9Y A;  2D4P A;  2YNE A;  4OIW A;  5K8O A;  1LOK A;  4B5O A;  2IQ6 A;  4BBH A;  2C6G A;  4CYQ A;  4UIB A;  8CPA A;  3VWD A;  1GHE A;  1KWM A;  1V0C A;  2OB0 A;  2Q43 A;  3KHZ A;  5LYD A;  5CPA A;  4FD6 A;  4JXQ A;  3QNV A;  4XNH B;  3T9Y A;  2BOA A;  4CRZ B;  3EFA A;  5A28 A;  4YRH A;  3BJ7 A;  4FD7 A;  4M6H A;  2Z3O A;  1AMP A;  2QVP A;  3PB9 X;  3QB8 A;  4PSW A;  4FD4 A;  4AVB A;  5JM6 A;  3KKW A;  4UCP A;  2G0B A;  2HV2 A;  1TKJ A;  2YNC A;  5HVG A;  2IL4 A;  2PCU A;  5LYF A;  2PVW A;  4RI1 A;  5HVF A;  2XEF A;  1YK3 A;  5GCN A;  4OC1 A;  2EBJ A;  1P0H A;  2VBQ A;  1TF9 A;  2PJB A;  1YW4 A;  3DLJ A;  4JLY A;  5HH1 A;  3SJF A;  3V8I A;  1HDU A;  2X7B A;  4O23 A;  4NEX A;  3S6H A;  4E2A A;  2F5I A;  1ZO0 A;  1N71 A;  4R7M A;  3WC7 A;  6CPA A;  2J8M A;  1PU9 A;  1CG2 A;  4R3L A;  3KR4 A;  1QSR A;  4MY3 A;  1PYT B;  2FCK A;  2ZEH A;  1YW6 A;  4X8I A;  2ZEP A;  4E0A A;  3CDX A;  4HNW B;  4P4F A;  3DGV A;  3L2N A;  4ORF A;  3K9T A;  2FE7 A;  2BO9 A;  4MCR A;  2ZEM A;  2PJ9 A;  5JQ4 A;  3EO4 A;  5JGF A;  3D67 A;  1Z2L A;  1P4N A;  2GFQ A;  2PJ8 A;  1Z9U A;  2ZOF A;  3B3T A;  3IU2 A;  1NMT A;  3PBE A;  3R1K A;  4MHY A;  4MRI A;  3UY5 A;  4MI4 A;  5JPH A;  3RAM A;  4IUS A;  1HEE A;  1OBR A;  4NCZ A;  4PV6 A;  1FNO A;  1Y0R A;  4H2K A;  4H89 A;  5AG6 A;  5KTC A;  4K30 A;  1KUY A;  2K5T A;  1QSM A;  2OZU A;  4OKO A;  4B5P B;  3PGP A;  2PSW A;  4G1P A;  4NJQ A;  2PJ7 A;  3WC5 A;  4F0X A;  4IAV A;  4CGL A;  3D3S A;  5I0C A;  2B5G A;  2HUZ A;  3TO9 A;  4KZT A;  2PQ8 A;  1KUX A;  3TCV A;  1F2P A;  4EWT A;  1GYT A;  1S7F A;  3FBU A;  1YQE A;  4E8O A;  1YRE A;  3PBB A;  4NGQ A;  1TKH A;  2AFZ A;  2QYV A;  3B3S A;  2ZEG A;  5LRJ A;  4Q36 A;  2ZW5 A;  4OC3 A;  5HMN A;  2O4H A;  5F49 A;  4DJL A;  1VHE A;  3RZA A;  2Z10 A;  4UFW A;  3R96 A;  4P4E A;  1YVO A;  1YGH A;  3B3C A;  3FVL A;  4KVM E;  1M4G A;  3KAS A;  3GYA A;  4F9U A;  3BI1 A;  1LCP A;  3VWE A;  3H8G A;  4A2Z A;  3KZW A;  4CYO A;  7CPA A;  1MK4 A;  2J8R A;  5BWA B;  1KZF A;  1S7N A;  1M4D A;  4PPZ A;  2WYR A;  4B6Z A;  1X10 A;  3CPA A;  3D7G A;  3H4Q A;  2Q04 A;  4AXV A;  5LYI A;  2CNM A;  2PC1 A;  4J3G A;  5LRG A;  4DUK A;  2ANP A;  4JD6 A;  5DWM A;  4B13 A;  2PIY A;  2DEA A;  4NGR A;  3FX6 A;  4JZ0 A;  2A4N A;  1NSA A;  2H5M A;  3QAY A;  4NGM A;  5FVJ A; 
#chains in the Genus database with same CATH homology
 4KSI A;  2PJ1 A;  4ZX9 A;  2XEI A;  4P4B A;  5D8N A;  4FWU A;  3BI0 A;  1YSJ A;  1LAN A;  1QMU A;  3GB0 A;  3NH5 A;  3FED A;  2AFU A;  2PJ0 A;  4LQG A;  3I1U A;  4MHP A;  2F8H A;  3CPX A;  4X2T A;  3IWW A;  4X3R A;  4R76 A;  4R8F A;  3D7H A;  1RTQ A;  2Q51 A;  2JBK A;  2ZEF A;  1XBU A;  4UEF A;  2BCO A;  1M4L A;  1VHO A;  1PCA A;  3N5F A;  4EFD A;  1IGB A;  2V8H A;  5IB9 A;  3PB7 X;  1Y7E A;  4OC0 A;  2WZN A;  4Z65 A;  3IJ3 A;  4PXD A;  3JRU A;  5K8P A;  4MCP A;  2NSM A;  3FJU A;  1LAM A;  3PB6 X;  3HUV A;  4P4J A;  4PXB A;  1Z5R A;  4TWE A;  2PJ3 A;  4P4I A;  1EE3 P;  4UF4 A;  2F7V A;  5ELY A;  1XMB A;  3D7F A;  2C6P A;  4PQA A;  1H8L A;  3PRT A;  3S9N A;  4WWV A;  2OOT A;  1XJO A;  2PJ5 A;  3PEI A;  4P6Y A;  2GLJ A;  2EWB A;  1BAV A;  4DYO A;  3NH4 A;  1ZG7 A;  2GU2 A;  1TXR A;  4NGS A;  3T8W A;  2ZOG A;  5J1Q A;  2PJ4 A;  3ISX A;  1ZLI A;  3V7Z A;  4OC2 A;  3PB4 X;  2GRE A;  2PJC A;  2O53 A;  2C1C A;  4ZY0 A;  1ARL A;  1LFW A;  2EK9 A;  4NGP A;  2Q4Z A;  5CBM A;  3V38 A;  3TC8 A;  2NYQ A;  4K3N A;  3H8E A;  3GLJ A;  4ZY1 A;  4YWY A;  2RB7 A;  1TF8 A;  3ISZ A;  4CPA A;  1Y0Y A;  4P4D A;  1VIX A;  3PFE A;  4TNU A;  3TX8 A;  1CBX A;  2GLF A;  1Z8L A;  1VGY A;  3B3W A;  4A37 A;  1UWY A;  1ZG8 A;  3KR5 A;  4MMO A;  3K2K A;  3SJX A;  3B2Y A;  3IO1 A;  2PJ2 A;  1R43 A;  1LAP A;  3KQZ A;  1BPN A;  2JBJ A;  1QQ9 A;  3D4U A;  4F9V A;  3FEE A;  2PIZ A;  4ZY2 A;  4A94 A;  5JH9 A;  4A39 A;  2HC9 A;  3WC6 A;  4OID A;  3KQX A;  1F2O A;  4ZI6 A;  4MCS A;  3HLP A;  1FT7 A;  2PJA A;  2FVG A;  4OC4 A;  2XEJ A;  4P10 A;  3D68 A;  3NH8 A;  1AYE A;  2G9D A;  2PJ6 A;  4FUU A;  2JEW A;  4UIA A;  1CPX A;  4OC5 A;  3BXM A;  1TKF A;  3SI2 A;  1ARM A;  4ZX8 A;  4OME A;  4ONW A;  2CTB A;  2ABZ A;  3MRU A;  3PB8 X;  4UEZ A;  3FF3 A;  4A38 A;  3WAB A;  3NFZ A;  4GM5 A;  3VH9 A;  3CT9 A;  3D66 A;  5D29 A;  3H8F A;  2ZEE A;  3FMC A;  2HB6 A;  2IJZ A;  4IK2 A;  3FH4 A;  1YLO A;  2IMO A;  1DTD A;  3VAR A;  3B35 A;  1HDQ A;  3PFO A;  2CTC A;  5I4M A;  3MN8 A;  2PVV A;  5THW A;  4NGT A;  1JQG A;  3B3V A;  4NFR A;  4MCQ A;  2V8V A;  2RFH A;  2AFS A;  1ZG9 A;  4FBE A;  2ZEO A;  4P45 A;  3B7I A;  4F8Z A;  1YME A;  3LMS A;  2V77 A;  1CP6 A;  4FAI A;  4Q7A A;  2CF4 A;  2V8D A;  4UEE A;  4MXU A;  2VL1 A;  2AFW A;  4P44 A;  4RUH A;  4MHZ A;  3KL9 A;  4EME A;  2AFM A;  2QJ8 A;  2AFO A;  2OR4 A;  1Q7L A;  3LWU A;  2POK A;  3GUX A;  1R3N A;  3RBU A;  2EK8 A;  3WT4 A;  3NA6 A;  4MHN A;  1CP7 A;  1ELM P;  1ELL P;  3IC1 A;  3FEC A;  4R6T A;  4PXC A;  1IY7 A;  3IEH A;  1ZLH A;  2AFX A;  3BHX A;  3KI9 A;  3S9M A;  5LYL A;  4BD9 A;  2PRQ A;  4NJR A;  2ZEN A;  3IIB A;  2ZED A;  2J9A A;  4YU9 A;  1F57 A;  2CIJ A;  4NGN A;  1XRY A;  1DE4 C;  4OP4 A;  2C6C A;  5LRK A;  1BPM A;  4WJB A;  3SJG A;  1CX8 A;  2V8G A;  3D7D A;  5HXD A;  4IHM A;  3SI0 A;  2XEG A;  3KGQ A;  2I3C A;  4JYW A;  3SI1 A;  2PE3 A;  3KHX A;  1CPS A;  5K8M A;  5F09 A;  3S9L A;  2ZEL A;  1BLL E;  3VAT A;  4PXE A;  5K8N A;  3IFE A;  5DS0 A;  3SJE A;  4ZYQ A;  1XFO A;  4W9Y A;  4OIW A;  5K8O A;  1LOK A;  2IQ6 A;  2C6G A;  4UIB A;  8CPA A;  1KWM A;  2Q43 A;  3KHZ A;  5LYD A;  5CPA A;  3QNV A;  2BOA A;  1AMP A;  2QVP A;  3PB9 X;  5JM6 A;  5HVG A;  1TKJ A;  2PCU A;  5LYF A;  2PVW A;  5HVF A;  2XEF A;  4OC1 A;  3SJF A;  1TF9 A;  2PJB A;  1YW4 A;  3DLJ A;  1HDU A;  4O23 A;  4R7M A;  3WC7 A;  6CPA A;  1CG2 A;  3KR4 A;  1PYT B;  2ZEH A;  1YW6 A;  4X8I A;  2ZEP A;  3CDX A;  4P4F A;  3DGV A;  3L2N A;  3K9T A;  2BO9 A;  4MCR A;  2ZEM A;  2PJ9 A;  5JGF A;  3D67 A;  1Z2L A;  4NGM A;  2PJ8 A;  2ZOF A;  3B3T A;  4MHY A;  3PBE A;  4MRI A;  3RAM A;  1HEE A;  1OBR A;  1FNO A;  1Y0R A;  4H2K A;  4OKO A;  4G1P A;  4NJQ A;  2PJ7 A;  3WC5 A;  4IAV A;  1F2P A;  4EWT A;  1GYT A;  3PBB A;  4NGQ A;  1TKH A;  2AFZ A;  2QYV A;  3B3S A;  2ZEG A;  5LRJ A;  4OC3 A;  2O4H A;  4DJL A;  1VHE A;  3RZA A;  4P4E A;  3B3C A;  3FVL A;  3KAS A;  4F9U A;  3BI1 A;  1LCP A;  3H8G A;  3KZW A;  7CPA A;  4PPZ A;  2WYR A;  4B6Z A;  3CPA A;  3D7G A;  4AXV A;  5LYI A;  4DUK A;  5LRG A;  2ANP A;  2PIY A;  2DEA A;  4NGR A;  3FX6 A;  4JZ0 A;  1NSA A;  5HVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...