1TKFA

Streptomyces griseus aminopeptidase complexed with d-tryptophan
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
273
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 108
structure length 273
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkfA00
4NGPA 2C6CA 3NH5A 1YSJA 4FAIA 2V8GA 4MMOA 4OC3A 1QQ9A 5LYDA 4GM5A 4EFDA 1Z8LA 2GLJA 2XEFA 2GREA 1EE3P 2BCOA 2GU2A 4OC1A 1GYTA 3JRUA 2RFHA 2QYVA 1LCPA 4NGSA 1CX8A 3ISXA 4OC0A 3SJGA 3BI1A 2XEJA 3IWWA 3I1UA 4MHNA 2PJ9A 2GLFA 4B6ZA 5LYIA 5CBMA 2JBJA 4OC5A 1ZG9A 2Q51A 4PXDA 5K8NA 3WC7A 1NSAA 2OR4A 3RAMA 1VHEA 4ZX9A 3B3VA 1CPXA 2V8DA 3S9NA 3SI0A 2PJ1A 2ANPA 1FNOA 5HXDA 1ZG8A 1CPSA 2J9AA 1M4LA 4P44A 4P4FA 1RTQA 2PJBA 3B7IA 4MXUA 4X8IA 2CTBA 4NGRA 4RUHA 3FMCA 3KR4A 4IK2A 2ZEFA 3FECA 2PJ2A 5JGFA 1IGBA 2O4HA 5IB9A 1UWYA 1F2OA 4OP4A 4PXBA 4YU9A 2RB7A 4DYOA 4TNUA 3GB0A 5LRGA 4MRIA 7CPAA 4UEEA 2EK9A 3SJFA 2PRQA 2ZEHA 1DE4C 3RZAA 4MHYA 1BPNA 4MCSA 2CF4A 4UIBA 4F9UA 4Z65A 1QMUA 2C6PA 1XFOA 4EWTA 2IQ6A 2V8HA 1XMBA 2ZEMA 3PRTA 2BOAA 4FUUA 4A38A 3NA6A 3VARA 4A37A 3IC1A 1ELLP 4G1PA 4DUKA 2PE3A 2WZNA 1HDQA 3B3WA 3QNVA 3KASA 4Q7AA 5K8OA 4IHMA 2I3CA 5HVHA 3KZWA 1ZG7A 1XJOA 3CPAA 2CTCA 5K8MA 5K8PA 2XEGA 1TKHA 2PJ6A 3KGQA 3N5FA 3V38A 3SI1A 4OC2A 5LRKA 1CP7A 6CPAA 2WYRA 5HVFA 3CPXA 3BI0A 3PBBA 4MCQA 1TF9A 2C1CA 2PCUA 2PJAA 1HDUA 4WJBA 2FVGA 2PJ7A 3PFOA 4ZI6A 2O53A 3H8EA 4F9VA 1TKJA 4NJRA 3PBEA 3S9LA 4H2KA 4ZY2A 1BLLE 1Q7LA 3PB8X 3S9MA 1IY7A 4NJQA 5CPAA 1PYTB 2QVPA 2V77A 3B3CA 3D4UA 4UEFA 2ABZA 4R8FA 2AFWA 5LRJA 4K3NA 5LYLA 4ZY0A 4FBEA 3FH4A 5HVGA 2BO9A 1PCAA 2PJ3A 5F09A 3D7HA 1HEEA 3NH4A 3FEEA 2PJCA 4ZX8A 2PIYA 3CT9A 4KSIA 3IFEA 4IAVA 1VHOA 4ZYQA 4UF4A 1R43A 4NFRA 2F7VA 3D68A 4UIAA 3K9TA 5JH9A 4YWYA 3MN8A 3SI2A 3DGVA 3FJUA 4MCRA 1AYEA 2JEWA 3IEHA 2ZEPA 1CBXA 4P6YA 4PQAA 5JM6A 3T8WA 2XEIA 3PB6X 2C6GA 1XBUA 3BXMA 4FWUA 3IO1A 4OIWA 3SJXA 4PXEA 3GUXA 4ZY1A 1ARMA 5J1QA 4EMEA 1JQGA 4OKOA 3D67A 8CPAA 3MRUA 2ZEEA 3CDXA 3KR5A 4P45A 2IJZA 2OOTA 3WC5A 1KWMA 2PJ5A 2PJ4A 1Z2LA 2ZEDA 4BD9A 2PJ0A 4O23A 1LANA 1ZLHA 3ISZA 3FVLA 2NSMA 3B2YA 1LFWA 1OBRA 2PJ8A 3KQXA 3TX8A 5LYFA 4WWVA 5DS0A 4PPZA 3RBUA 3PB9X 1CG2A 5ELYA 3D7GA 4MHPA 1F2PA 4P4EA 4X3RA 2ZEOA 4JYWA 2Q43A 2AFXA 3WT4A 4P4BA 3VH9A 2AFSA 3PEIA 3H8FA 4AXVA 4P4JA 2EK8A 4JZ0A 2EWBA 3HUVA 2NYQA 3B3TA 5D29A 1YW4A 2POKA 5I4MA 4F8ZA 1YLOA 3KI9A 4CPAA 4NGNA 4MCPA 3H8GA 1AMPA 2F8HA 1VIXA 2ZEGA 4W9YA 2CIJA 1ARLA 1TXRA 2G9DA 3DLJA 3SJEA 3B3SA 4NGTA 2AFUA 2ZENA 4OMEA 1VGYA 3B35A 3KHXA 1Y7EA 2ZOGA 2VL1A 2AFZA 1XRYA 1LOKA 4R6TA 3BHXA 1BAVA 4DJLA 2ZELA 3HLPA 4A39A 1ELMP 5THWA 1TF8A 3VATA 3FX6A 3WABA 1TKFA 3KL9A 4PXCA 3LMSA 1YMEA 4OIDA 4NGMA 1LAMA 1F57A 1YW6A 3NH8A 1CP6A 3K2KA 4TWEA 3D7FA 2PVWA 3NFZA 4LQGA 1DTDA 3V7ZA 2ZOFA 1Z5RA 4R76A 3D66A 3TC8A 2AFMA 4OC4A 3L2NA 3KQZA 4NGQA 3KHZA 3PFEA 3GLJA 3IJ3A 3IIBA 4R7MA 3FF3A 2DEAA 4ONWA 1FT7A 1H8LA 1BPMA 3FEDA 1LAPA 1Y0YA 4P10A 3PB4X 3LWUA 4P4DA 1R3NA 2QJ8A 2V8VA 3PB7X 4P4IA 2JBKA 2HB6A 2IMOA 4A94A 2HC9A 3D7DA 4UEZA 2AFOA 1ZLIA 4X2TA 5D8NA 2Q4ZA 1Y0RA 3WC6A 4MHZA 2PVVA 2PIZA
chains in the Genus database with same CATH superfamily
4B5PB 1YREA 3TT2A 4CGPA 2GFQA 2FIWA 2C6CA 3NE8A 3NH5A 4NGPA 1YSJA 4FAIA 2V8GA 4MMOA 4OC3A 3TTHA 1M4DA 1QQ9A 1YVOA 4KSAA 4FD7A 3R96A 5LYDA 4GM5A 3TOBA 4JD6A 3V8IA 4EFDA 2J8NA 2C27A 2VXKA 2PQ8A 1Z8LA 2GLJA 2XEFA 4MBUA 2GREA 4UWIA 1EE3P 2BCOA 2GU2A 4KOUA 4AVCA 3JUWA 4JWPA 4OC1A 4CRYB 4GS4A 1IB1E 2OU2A 3CXSA 1GYTA 3JRUA 2RFHA 2QYVA 5H86A 1LCPA 3DR8A 4NGSA 1ZO0A 1CX8A 3SXNA 3FB3A 4A32A 3ISXA 4LUAA 4JXQA 4MY3A 4OC0A 4EVYA 3VWDA 4E2AA 3SJGA 3BI1A 2XEJA 4UFVA 2HUZA 4UCPA 3IWWA 2D4OA 3I1UA 4MHNA 1KUVA 2PJ9A 4FD4A 2GLFA 3EY5A 2FE7A 4B6ZA 5LYIA 1Y9KA 4K30A 4CGNA 5CBMA 2PRBA 2JBJA 4OC5A 2ZW6A 1FY7A 4XNHB 1YX0A 1QSOA 1ZG9A 2B3UA 2Q51A 4PXDA 1Z9UA 4M3SA 5K8NA 1M4GA 3WC7A 1XOVA 4AVAA 4B11A 1NSAA 2OR4A 2JDDA 5E96A 3RAMA 2ZW4A 4U9YA 2Z3KA 5F46A 1VHEA 1J4JA 4ZX9A 3B3VA 1WK4A 1CPXA 2V8DA 5G1ZA 3S9NA 3SI0A 2PJ1A 2ANPA 4AG7A 1Y9WA 1FNOA 4CAWA 3TO6A 2CXAA 3N7ZA 3WR7A 5HXDA 3ZJ0A 1ZG8A 1CPSA 3JVNA 2J9AA 3FXTA 1M4LA 3VWEA 4P44A 1P4NA 4XNHC 4P4FA 1RTQA 2Q44A 4KVME 2J8RA 2B5GA 2PJBA 3B7IA 4MXUA 4X8IA 2GIVA 2CTBA 4NGRA 4NF1A 4RUHA 1V0CA 3FMCA 2QIRA 4CS0B 5J8FA 3KR4A 4IK2A 5AG7A 4A33A 5HH1A 3BJ7A 2ZEFA 3FECA 2PJ2A 3ZZIA 5JGFA 3W6SA 3R1KA 2Z0ZA 1IGBA 2O4HA 5IB9A 5BWAB 3F0AA 1UWYA 5H84A 1F2OA 4NXYA 3QAHA 4OP4A 2FS5A 4PXBA 2CNTA 4YU9A 1SQHA 3D3SA 3S6GA 2RB7A 4DYOA 4TNUA 1QSNA 3GB0A 3DSBA 3TO7A 5LRGA 4U9ZA 5HMNA 4MRIA 7CPAA 4QBJA 4HKFA 1Y7RA 4UEEA 2EK9A 4RI1A 4E0AA 3SJFA 2PRQA 4OLLA 3D2MA 2ZEHA 1DE4C 1Q2YA 4Q36A 3RZAA 4MHYA 1BPNA 3RYOA 5A27A 4MCSA 2Z11A 1S7FA 2CF4A 2GANA 4UIBA 4F9UA 4ORFA 4Z65A 1QMUA 1IIDA 2C6PA 4RS2A 1Q2CA 4JJXA 1XFOA 2JLMA 4A95A 4EWTA 2IQ6A 3K9UA 2V8HA 1CM0A 1XMBA 2ZEMA 3PRTA 2BOAA 4OAEA 1K4JA 4FUUA 1BOBA 4A38A 3NA6A 2ARHA 5DWNA 3VARA 4A37A 2DPSA 3IC1A 1ELLP 4F0XA 4CYNA 4G1PA 4DUKA 2PE3A 2WZNA 1HDQA 3B3WA 2YGWA 3QNVA 2X7BA 3IGRA 3KASA 4MFJA 1IICA 4Q7AA 5K8OA 4IHMA 2I3CA 4QB9A 5HVHA 3KZWA 3TO9A 1ZG7A 1XJOA 4UA3A 3CPAA 2PSWA 4M6GA 2CTCA 2FL4A 4UFWA 2Q4YA 2P6FA 5K8MA 4FD6A 4B14A 5K8PA 1MJBA 3FYNA 3PGPA 2XEGA 1TKHA 2PJ6A 3A9LA 3F5BA 3KGQA 3N5FA 4DNCA 3V38A 3SI1A 1JWQA 4OC2A 1CP7A 6CPAA 2WYRA 5KTDA 5LRKA 5FVJA 5HVFA 2B58A 2NMTA 1IOFA 3CPXA 3EC4A 3QAYA 3BI0A 2B4DA 3PBBA 4MCQA 4QC6A 2G0BA 2AJ6A 4C68A 3TE4A 1TF9A 2C1CA 2PCUA 2PJAA 1HDUA 2Q7BA 2BL1A 1S5KA 2Q4VA 2B3VA 5AG4A 4WJBA 2FVGA 2PJ7A 3PFOA 3R95A 4Y49B 4ZI6A 2O53A 3H8EA 4F9VA 1TKJA 2P0WA 4RN7A 4NJRA 4XPDB 3PBEA 4B13A 2G3AA 2FT0A 3S9LA 4KLVA 4H2KA 3LACA 4M6IA 1S7LA 1BLLE 4ZY2A 3R9GA 1Q7LA 3PB8X 3S9MA 2O28A 4XPDC 2PR8A 1IY7A 4CAFA 2P6EA 3LODA 1KZFA 2RC4A 4NJQA 5CPAA 1Z8XA 3S6HA 1PYTB 3B8GA 2QVPA 3SXOA 3S6FA 1NMTA 2B4DB 5KTAA 3PP9A 2V77A 3B3CA 3D4UA 2AE6A 1IYKA 3IU2A 2DF5A 4UEFA 5KTCA 2PDOA 2ABZA 3I9SA 4R8FA 5C82A 1MK4A 2AFWA 2Q7SA 3MGDA 2QECA 5LRJA 4K3NA 5AGEA 5LYLA 2I00A 1IU8A 3OWCA 4ZY0A 1KUYA 4FBEA 3FH4A 2Z10A 4M6HA 5HVGA 1XMTA 2BO9A 2OZUA 1PCAA 1XEBA 2G3TA 2PJ3A 5F09A 3D7HA 1A2ZA 1HEEA 3NH4A 4PSWA 3FEEA 2PJCA 4ZX8A 4CYQA 2PIYA 2WSAA 4HNYB 3CT9A 4KSIA 4QUSA 3I3GA 4J3GA 5G20A 1NSLA 1Q2DA 4C2YA 1XIXA 2IL4A 2OZHA 3IFEA 4BMHA 1M4IA 1VHOA 4IAVA 4ZYQA 4UF4A 1R43A 4NFRA 4B5PA 2F7VA 3D68A 5ISVA 4UIAA 3FRMA 3K9TA 5JH9A 3DR6A 4H6ZA 1X10A 4YWYA 3MN8A 2WPWA 4XPLA 4YGOA 4R9MA 4QVTA 2B4BA 3SI2A 2Z3NA 3DGVA 1XF8A 3FJUA 4CAVA 4MCRA 1AYEA 2REFA 1ON0A 2VQYA 5JQ4A 2JEWA 2I79A 3IEHA 4U5YA 2R8VA 2ZEPA 3H5ZA 4CGMA 1CBXA 1I1DA 1S3ZA 3CXQA 3GKRA 4P6YA 5J8CA 4PQAA 4KSFA 5JM6A 3T8WA 5AG6A 2XEIA 1PUAA 3PB6X 2C6GA 5EC4A 1XBUA 3QB8A 3C26A 4IF5A 4C7IA 3BXMA 4FWUA 3IO1A 4OIWA 3D8PA 5IX3A 2ODFA 2OB0A 3P2FA 4PXEA 3SJXA 3NE7A 4MY0A 3S6KA 3GUXA 1MJ9A 4UWJA 4ZY1A 4UCMA 1U6MA 1ARMA 4MI4A 5J1QA 4EMEA 1JQGA 4OKOA 2QMLA 3CZXA 3D67A 4CGLA 4UFXA 1S7KA 3FIXA 3MRUA 8CPAA 2ZEEA 4AVBA 1P0HA 3EXNA 1RO5A 3EO4A 3CDXA 4MFZA 4UCNA 3KR5A 5C88A 1PU9A 4P45A 2IJZA 2OOTA 3WC5A 1KWMA 1Z4RA 2PJ5A 1M1DA 1Z2LA 2B5GB 2PJ4A 1XE4A 3DDDA 2ZEDA 4H6UA 4KOSA 3TOAA 4BD9A 4PK2A 4R3KA 4NCZA 2PJ0A 4R87A 5G21A 1KUXA 4O23A 3SHPA 1R57A 1LANA 2Q04A 2DXQA 1ZLHA 5IB0A 3ISZA 5EBVA 3FVLA 2NSMA 5EMIA 3B2YA 1LFWA 1Z4EA 2ZW5A 3IWGA 1OBRA 4B10A 1NE9A 2PJ8A 3KQXA 4LQ6A 3TX8A 2WPXA 2ATRA 4R57A 4WWVA 5DS0A 5F47A 5LYFA 4HNWB 1B87A 4PPZA 2Z3OA 4F6AA 2JDCA 1I12A 3PB9X 1CG2A 3RBUA 2R1IA 2CNMA 3TFYA 3BJ8A 5ELYA 3D7GA 3T9YA 3H4QA 4MHPA 1F2PA 3G8WA 4P4EA 4KVOE 2FSRA 2ZEOA 4JYWA 4X3RA 2Q43A 2AFXA 3WT4A 4NEXA 4I49A 4KORA 4P4BA 2EBJA 3P2HA 3VH9A 4JXRA 2AFSA 4KOYA 3W91A 3DNSA 3PEIA 3H8FA 4MJ8A 4KUBA 4Y49C 4AXVA 4UBRA 1IOIA 4P4JA 4GXHA 4AB7A 3T90A 2EK8A 4JZ0A 2EWBA 4IUSA 2ZXVA 3HUVA 4FD5A 2DPTA 2EVNA 2NYQA 3B3TA 4KVXA 3FNCA 4MFQA 5D29A 1YW4A 2POKA 5I4MA 4F8ZA 1YLOA 3KI9A 4CPAA 4NGNA 4MCPA 3H8GA 3BLNA 1AMPA 1GHEA 2F8HA 1VIXA 3GIUA 2YNCC 2ZEGA 4W9YA 2CIJA 1ARLA 5F49A 1RXTA 1TXRA 4YFJA 3E0KA 4KLWA 2G9DA 2D4PA 3DLJA 1YR0A 3SJEA 3B3SA 4NGTA 1MJAA 2AFUA 2ZENA 2EUIA 4OMEA 1VGYA 3F8KA 3B35A 2OH1A 3KHXA 5A28A 3TCVA 1Y7EA 4B5OA 3KKWA 2ZOGA 2VL1A 3FBUA 4BINA 2AFZA 1XRYA 1LOKA 2VZYA 3IWEA 3GYAA 4R6TA 1YVKA 2PC1A 3BHXA 3G3SA 4MHDA 1BAVA 4CAXA 1Z8TA 3RNZA 3W6XA 2OZGA 4DJLA 2ZELA 4CYPA 2K5TA 3HLPA 2CY2A 2R98A 2Y0MA 4A39A 1ELMP 1YGHA 2EO8A 4NSQA 3PZJA 2REEA 5THWA 1TF8A 4KZTA 3VATA 3FX6A 4ZBGA 3WABA 4C2ZA 1QSTA 2Z3MA 4LX9A 1TKFA 3KL9A 4PXCA 2VI7A 3LMSA 4AG9A 2JEVA 2HV2A 4A2ZA 1YMEA 4OIDA 4NGMA 1LAMA 1F57A 1YW6A 2KCWA 2YNDA 3D2PA 3NH8A 2F5IA 4OADA 1CP6A 1YK3A 3K2KA 2PR1A 4MFPA 2VBQA 2PVWA 1YQEA 3D7FA 4TWEA 2R7HA 4XPKA 2VZZA 1AUGA 1LRZA 3NFZA 4MFLA 4LQGA 4HNXB 3JTKA 1DTDA 1M44A 1S60A 2HQYA 1X12A 2ZPAA 4HPSA 4KS9A 5F48A 2ZOFA 3V7ZA 4CRZB 1L0CA 1N71A 3LD2A 2Z3PA 1Z5RA 2Q0YA 4R76A 5G22A 5GCNA 1BO4A 3D66A 3TC8A 3UY5A 2AFMA 4OC4A 1UFHA 2YNEA 3L2NA 3KQZA 2CNSA 4NGQA 5CNPA 4KOWA 3KHZA 2FXFA 3PFEA 3GLJA 3IJ3A 4Q38A 3IIBA 4E8OA 4R7MA 4B12A 2P6GA 4X5KA 2FCKA 1WWZA 4L89A 3FF3A 4A30A 4ONUA 2DEAA 4ONWA 4PV6A 4BBHA 5DWMA 4ZGYB 2ZW7A 5AG5A 4H89A 3RO0A 4R3LA 4F0YA 1QSRA 1FT7A 4CYOA 1H8LA 4YRHA 2YNCA 1VHSA 5I0CA 1BPMA 1I21A 3IU1A 1QSMA 2BSWA 4II9A 3FEDA 1LAPA 1Y0YA 4CAEA 1TIQA 4P10A 2H5MA 1YLEA 4KOTA 4JLYA 4L8AA 2J8MA 1CJWA 2BUEA 5JPHA 3CXPA 3PB4X 3LWUA 4P4DA 1R3NA 4M85A 3GY9A 2GE3A 2QJ8A 2V8VA 3PB7X 2BEIA 4P4IA 2JBKA 4KOXA 1VKCA 2HB6A 2IMOA 4A94A 2WUUA 2A4NA 4KOVA 4KUAA 3R9FA 2FIAA 4PK3A 1OZPA 2HC9A 1S7NA 4C2XA 1Z8WA 3D7DA 4UEZA 2AFOA 3R9EA 3EFAA 4A31A 1ZLIA 4MFKA 4CGOA 4X2TA 5D8NA 5IV0A 4C7HA 2Q4ZA 1B6BA 2VEZA 1Y0RA 2Z3LA 3WC6A 1IYLA 4MHZA 2PVVA 2PIZA 4PSXA
chains in the Genus database with same CATH topology
4NGPA 2C6CA 3NH5A 1YSJA 4FAIA 2V8GA 4MMOA 4OC3A 1QQ9A 5LYDA 4GM5A 4EFDA 1Z8LA 2GLJA 2XEFA 2GREA 1EE3P 2BCOA 2GU2A 4OC1A 1GYTA 3JRUA 2RFHA 2QYVA 1LCPA 4NGSA 1CX8A 3ISXA 4OC0A 3SJGA 3BI1A 2XEJA 3IWWA 3I1UA 4MHNA 2PJ9A 2GLFA 4B6ZA 5LYIA 5CBMA 2JBJA 4OC5A 1ZG9A 2Q51A 4PXDA 5K8NA 3WC7A 1NSAA 2OR4A 3RAMA 1VHEA 4ZX9A 3B3VA 1CPXA 2V8DA 3S9NA 3SI0A 2PJ1A 2ANPA 1FNOA 5HXDA 1ZG8A 1CPSA 2J9AA 1M4LA 4P44A 4P4FA 1RTQA 2PJBA 3B7IA 4MXUA 4X8IA 2CTBA 4NGRA 4RUHA 3FMCA 3KR4A 4IK2A 2ZEFA 3FECA 2PJ2A 5JGFA 1IGBA 2O4HA 5IB9A 1UWYA 1F2OA 4OP4A 4PXBA 4YU9A 2RB7A 4DYOA 4TNUA 3GB0A 5LRGA 4MRIA 7CPAA 4UEEA 2EK9A 3SJFA 2PRQA 2ZEHA 1DE4C 3RZAA 4MHYA 1BPNA 4MCSA 2CF4A 4UIBA 4F9UA 4Z65A 1QMUA 2C6PA 1XFOA 4EWTA 2IQ6A 2V8HA 1XMBA 2ZEMA 3PRTA 2BOAA 4FUUA 4A38A 3NA6A 3VARA 4A37A 3IC1A 1ELLP 4G1PA 4DUKA 2PE3A 2WZNA 1HDQA 3B3WA 3QNVA 3KASA 4Q7AA 5K8OA 4IHMA 2I3CA 5HVHA 3KZWA 1ZG7A 1XJOA 3CPAA 2CTCA 5K8MA 5K8PA 2XEGA 1TKHA 2PJ6A 3KGQA 3N5FA 3V38A 3SI1A 4OC2A 5LRKA 1CP7A 6CPAA 2WYRA 5HVFA 3CPXA 3BI0A 3PBBA 4MCQA 1TF9A 2C1CA 2PCUA 2PJAA 1HDUA 4WJBA 2FVGA 2PJ7A 3PFOA 4ZI6A 2O53A 3H8EA 4F9VA 1TKJA 4NJRA 3PBEA 3S9LA 4H2KA 4ZY2A 1BLLE 1Q7LA 3PB8X 3S9MA 1IY7A 4NJQA 5CPAA 1PYTB 2QVPA 2V77A 3B3CA 3D4UA 4UEFA 2ABZA 4R8FA 2AFWA 5LRJA 4K3NA 5LYLA 4ZY0A 4FBEA 3FH4A 5HVGA 2BO9A 1PCAA 2PJ3A 5F09A 3D7HA 1HEEA 3NH4A 3FEEA 2PJCA 4ZX8A 2PIYA 3CT9A 4KSIA 3IFEA 4IAVA 1VHOA 4ZYQA 4UF4A 1R43A 4NFRA 2F7VA 3D68A 4UIAA 3K9TA 5JH9A 4YWYA 3MN8A 3SI2A 3DGVA 3FJUA 4MCRA 1AYEA 2JEWA 3IEHA 2ZEPA 1CBXA 4P6YA 4PQAA 5JM6A 3T8WA 2XEIA 3PB6X 2C6GA 1XBUA 3BXMA 4FWUA 3IO1A 4OIWA 3SJXA 4PXEA 3GUXA 4ZY1A 1ARMA 5J1QA 4EMEA 1JQGA 4OKOA 3D67A 8CPAA 3MRUA 2ZEEA 3CDXA 3KR5A 4P45A 2IJZA 2OOTA 3WC5A 1KWMA 2PJ5A 2PJ4A 1Z2LA 2ZEDA 4BD9A 2PJ0A 4O23A 1LANA 1ZLHA 3ISZA 3FVLA 2NSMA 3B2YA 1LFWA 1OBRA 2PJ8A 3KQXA 3TX8A 5LYFA 4WWVA 5DS0A 4PPZA 3RBUA 3PB9X 1CG2A 5ELYA 3D7GA 4MHPA 1F2PA 4P4EA 4X3RA 2ZEOA 4JYWA 2Q43A 2AFXA 3WT4A 4P4BA 3VH9A 2AFSA 3PEIA 3H8FA 4AXVA 4P4JA 2EK8A 4JZ0A 2EWBA 3HUVA 2NYQA 3B3TA 5D29A 1YW4A 2POKA 5I4MA 4F8ZA 1YLOA 3KI9A 4CPAA 4NGNA 4MCPA 3H8GA 1AMPA 2F8HA 1VIXA 2ZEGA 4W9YA 2CIJA 1ARLA 1TXRA 2G9DA 3DLJA 3SJEA 3B3SA 4NGTA 2AFUA 2ZENA 4OMEA 1VGYA 3B35A 3KHXA 1Y7EA 2ZOGA 2VL1A 2AFZA 1XRYA 1LOKA 4R6TA 3BHXA 1BAVA 4DJLA 2ZELA 3HLPA 4A39A 1ELMP 5THWA 1TF8A 3VATA 3FX6A 3WABA 1TKFA 3KL9A 4PXCA 3LMSA 1YMEA 4OIDA 4NGMA 1LAMA 1F57A 1YW6A 3NH8A 1CP6A 3K2KA 4TWEA 3D7FA 2PVWA 3NFZA 4LQGA 1DTDA 3V7ZA 2ZOFA 1Z5RA 4R76A 3D66A 3TC8A 2AFMA 4OC4A 3L2NA 3KQZA 4NGQA 3KHZA 3PFEA 3GLJA 3IJ3A 3IIBA 4R7MA 3FF3A 2DEAA 4ONWA 1FT7A 1H8LA 1BPMA 3FEDA 1LAPA 1Y0YA 4P10A 3PB4X 3LWUA 4P4DA 1R3NA 2QJ8A 2V8VA 3PB7X 4P4IA 2JBKA 2HB6A 2IMOA 4A94A 2HC9A 3D7DA 4UEZA 2AFOA 1ZLIA 4X2TA 5D8NA 2Q4ZA 1Y0RA 3WC6A 4MHZA 2PVVA 2PIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGP A;  2C6C A;  3NH5 A;  1YSJ A;  4FAI A;  2V8G A;  4MMO A;  4OC3 A;  1QQ9 A;  5LYD A;  4GM5 A;  4EFD A;  1Z8L A;  2GLJ A;  2XEF A;  2GRE A;  1EE3 P;  2BCO A;  2GU2 A;  4OC1 A;  1GYT A;  3JRU A;  2RFH A;  2QYV A;  1LCP A;  4NGS A;  1CX8 A;  3ISX A;  4OC0 A;  3SJG A;  3BI1 A;  2XEJ A;  3IWW A;  3I1U A;  4MHN A;  2PJ9 A;  2GLF A;  4B6Z A;  5LYI A;  5CBM A;  2JBJ A;  4OC5 A;  1ZG9 A;  2Q51 A;  4PXD A;  5K8N A;  3WC7 A;  1NSA A;  2OR4 A;  3RAM A;  1VHE A;  4ZX9 A;  3B3V A;  1CPX A;  2V8D A;  3S9N A;  3SI0 A;  2PJ1 A;  2ANP A;  1FNO A;  5HXD A;  1ZG8 A;  1CPS A;  2J9A A;  1M4L A;  4P44 A;  4P4F A;  1RTQ A;  2PJB A;  3B7I A;  4MXU A;  4X8I A;  2CTB A;  4NGR A;  4RUH A;  3FMC A;  3KR4 A;  4IK2 A;  2ZEF A;  3FEC A;  2PJ2 A;  5JGF A;  1IGB A;  2O4H A;  5IB9 A;  1UWY A;  1F2O A;  4OP4 A;  4PXB A;  4YU9 A;  2RB7 A;  4DYO A;  4TNU A;  3GB0 A;  5LRG A;  4MRI A;  7CPA A;  4UEE A;  2EK9 A;  3SJF A;  2PRQ A;  2ZEH A;  1DE4 C;  3RZA A;  4MHY A;  1BPN A;  4MCS A;  2CF4 A;  4UIB A;  4F9U A;  4Z65 A;  1QMU A;  2C6P A;  1XFO A;  4EWT A;  2IQ6 A;  2V8H A;  1XMB A;  2ZEM A;  3PRT A;  2BOA A;  4FUU A;  4A38 A;  3NA6 A;  3VAR A;  4A37 A;  3IC1 A;  1ELL P;  4G1P A;  4DUK A;  2PE3 A;  2WZN A;  1HDQ A;  3B3W A;  3QNV A;  3KAS A;  4Q7A A;  5K8O A;  4IHM A;  2I3C A;  5HVH A;  3KZW A;  1ZG7 A;  1XJO A;  3CPA A;  2CTC A;  5K8M A;  5K8P A;  2XEG A;  1TKH A;  2PJ6 A;  3KGQ A;  3N5F A;  3V38 A;  3SI1 A;  4OC2 A;  5LRK A;  1CP7 A;  6CPA A;  2WYR A;  5HVF A;  3CPX A;  3BI0 A;  3PBB A;  4MCQ A;  1TF9 A;  2C1C A;  2PCU A;  2PJA A;  1HDU A;  4WJB A;  2FVG A;  2PJ7 A;  3PFO A;  4ZI6 A;  2O53 A;  3H8E A;  4F9V A;  1TKJ A;  4NJR A;  3PBE A;  3S9L A;  4H2K A;  4ZY2 A;  1BLL E;  1Q7L A;  3PB8 X;  3S9M A;  1IY7 A;  4NJQ A;  5CPA A;  1PYT B;  2QVP A;  2V77 A;  3B3C A;  3D4U A;  4UEF A;  2ABZ A;  4R8F A;  2AFW A;  5LRJ A;  4K3N A;  5LYL A;  4ZY0 A;  4FBE A;  3FH4 A;  5HVG A;  2BO9 A;  1PCA A;  2PJ3 A;  5F09 A;  3D7H A;  1HEE A;  3NH4 A;  3FEE A;  2PJC A;  4ZX8 A;  2PIY A;  3CT9 A;  4KSI A;  3IFE A;  4IAV A;  1VHO A;  4ZYQ A;  4UF4 A;  1R43 A;  4NFR A;  2F7V A;  3D68 A;  4UIA A;  3K9T A;  5JH9 A;  4YWY A;  3MN8 A;  3SI2 A;  3DGV A;  3FJU A;  4MCR A;  1AYE A;  2JEW A;  3IEH A;  2ZEP A;  1CBX A;  4P6Y A;  4PQA A;  5JM6 A;  3T8W A;  2XEI A;  3PB6 X;  2C6G A;  1XBU A;  3BXM A;  4FWU A;  3IO1 A;  4OIW A;  3SJX A;  4PXE A;  3GUX A;  4ZY1 A;  1ARM A;  5J1Q A;  4EME A;  1JQG A;  4OKO A;  3D67 A;  8CPA A;  3MRU A;  2ZEE A;  3CDX A;  3KR5 A;  4P45 A;  2IJZ A;  2OOT A;  3WC5 A;  1KWM A;  2PJ5 A;  2PJ4 A;  1Z2L A;  2ZED A;  4BD9 A;  2PJ0 A;  4O23 A;  1LAN A;  1ZLH A;  3ISZ A;  3FVL A;  2NSM A;  3B2Y A;  1LFW A;  1OBR A;  2PJ8 A;  3KQX A;  3TX8 A;  5LYF A;  4WWV A;  5DS0 A;  4PPZ A;  3RBU A;  3PB9 X;  1CG2 A;  5ELY A;  3D7G A;  4MHP A;  1F2P A;  4P4E A;  4X3R A;  2ZEO A;  4JYW A;  2Q43 A;  2AFX A;  3WT4 A;  4P4B A;  3VH9 A;  2AFS A;  3PEI A;  3H8F A;  4AXV A;  4P4J A;  2EK8 A;  4JZ0 A;  2EWB A;  3HUV A;  2NYQ A;  3B3T A;  5D29 A;  1YW4 A;  2POK A;  5I4M A;  4F8Z A;  1YLO A;  3KI9 A;  4CPA A;  4NGN A;  4MCP A;  3H8G A;  1AMP A;  2F8H A;  1VIX A;  2ZEG A;  4W9Y A;  2CIJ A;  1ARL A;  1TXR A;  2G9D A;  3DLJ A;  3SJE A;  3B3S A;  4NGT A;  2AFU A;  2ZEN A;  4OME A;  1VGY A;  3B35 A;  3KHX A;  1Y7E A;  2ZOG A;  2VL1 A;  2AFZ A;  1XRY A;  1LOK A;  4R6T A;  3BHX A;  1BAV A;  4DJL A;  2ZEL A;  3HLP A;  4A39 A;  1ELM P;  5THW A;  1TF8 A;  3VAT A;  3FX6 A;  3WAB A;  1TKF A;  3KL9 A;  4PXC A;  3LMS A;  1YME A;  4OID A;  4NGM A;  1LAM A;  1F57 A;  1YW6 A;  3NH8 A;  1CP6 A;  3K2K A;  4TWE A;  3D7F A;  2PVW A;  3NFZ A;  4LQG A;  1DTD A;  3V7Z A;  2ZOF A;  1Z5R A;  4R76 A;  3D66 A;  3TC8 A;  2AFM A;  4OC4 A;  3L2N A;  3KQZ A;  4NGQ A;  3KHZ A;  3PFE A;  3GLJ A;  3IJ3 A;  3IIB A;  4R7M A;  3FF3 A;  2DEA A;  4ONW A;  1FT7 A;  1H8L A;  1BPM A;  3FED A;  1LAP A;  1Y0Y A;  4P10 A;  3PB4 X;  3LWU A;  4P4D A;  1R3N A;  2QJ8 A;  2V8V A;  3PB7 X;  4P4I A;  2JBK A;  2HB6 A;  2IMO A;  4A94 A;  2HC9 A;  3D7D A;  4UEZ A;  2AFO A;  1ZLI A;  4X2T A;  5D8N A;  2Q4Z A;  1Y0R A;  3WC6 A;  4MHZ A;  2PVV A;  2PIZ A; 
#chains in the Genus database with same CATH topology
 4B5P B;  1YRE A;  3TT2 A;  4CGP A;  2GFQ A;  2FIW A;  2C6C A;  3NE8 A;  3NH5 A;  4NGP A;  1YSJ A;  4FAI A;  2V8G A;  4MMO A;  4OC3 A;  3TTH A;  1M4D A;  1QQ9 A;  1YVO A;  4KSA A;  4FD7 A;  3R96 A;  5LYD A;  4GM5 A;  3TOB A;  4JD6 A;  3V8I A;  4EFD A;  2J8N A;  2C27 A;  2VXK A;  2PQ8 A;  1Z8L A;  2GLJ A;  2XEF A;  4MBU A;  2GRE A;  4UWI A;  1EE3 P;  2BCO A;  2GU2 A;  4KOU A;  4AVC A;  3JUW A;  4JWP A;  4OC1 A;  4CRY B;  4GS4 A;  1IB1 E;  2OU2 A;  3CXS A;  1GYT A;  3JRU A;  2RFH A;  2QYV A;  5H86 A;  1LCP A;  3DR8 A;  4NGS A;  1ZO0 A;  1CX8 A;  3SXN A;  3FB3 A;  4A32 A;  3ISX A;  4LUA A;  4JXQ A;  4MY3 A;  4OC0 A;  4EVY A;  3VWD A;  4E2A A;  3SJG A;  3BI1 A;  2XEJ A;  4UFV A;  2HUZ A;  4UCP A;  3IWW A;  2D4O A;  3I1U A;  4MHN A;  1KUV A;  2PJ9 A;  4FD4 A;  2GLF A;  3EY5 A;  2FE7 A;  4B6Z A;  5LYI A;  1Y9K A;  4K30 A;  4CGN A;  5CBM A;  2PRB A;  2JBJ A;  4OC5 A;  2ZW6 A;  1FY7 A;  4XNH B;  1YX0 A;  1QSO A;  1ZG9 A;  2B3U A;  2Q51 A;  4PXD A;  1Z9U A;  4M3S A;  5K8N A;  1M4G A;  3WC7 A;  1XOV A;  4AVA A;  4B11 A;  1NSA A;  2OR4 A;  2JDD A;  5E96 A;  3RAM A;  2ZW4 A;  4U9Y A;  2Z3K A;  5F46 A;  1VHE A;  1J4J A;  4ZX9 A;  3B3V A;  1WK4 A;  1CPX A;  2V8D A;  5G1Z A;  3S9N A;  3SI0 A;  2PJ1 A;  2ANP A;  4AG7 A;  1Y9W A;  1FNO A;  4CAW A;  3TO6 A;  2CXA A;  3N7Z A;  3WR7 A;  5HXD A;  3ZJ0 A;  1ZG8 A;  1CPS A;  3JVN A;  2J9A A;  3FXT A;  1M4L A;  3VWE A;  4P44 A;  1P4N A;  4XNH C;  4P4F A;  1RTQ A;  2Q44 A;  4KVM E;  2J8R A;  2B5G A;  2PJB A;  3B7I A;  4MXU A;  4X8I A;  2GIV A;  2CTB A;  4NGR A;  4NF1 A;  4RUH A;  1V0C A;  3FMC A;  2QIR A;  4CS0 B;  5J8F A;  3KR4 A;  4IK2 A;  5AG7 A;  4A33 A;  5HH1 A;  3BJ7 A;  2ZEF A;  3FEC A;  2PJ2 A;  3ZZI A;  5JGF A;  3W6S A;  3R1K A;  2Z0Z A;  1IGB A;  2O4H A;  5IB9 A;  5BWA B;  3F0A A;  1UWY A;  5H84 A;  1F2O A;  4NXY A;  3QAH A;  4OP4 A;  2FS5 A;  4PXB A;  2CNT A;  4YU9 A;  1SQH A;  3D3S A;  3S6G A;  2RB7 A;  4DYO A;  4TNU A;  1QSN A;  3GB0 A;  3DSB A;  3TO7 A;  5LRG A;  4U9Z A;  5HMN A;  4MRI A;  7CPA A;  4QBJ A;  4HKF A;  1Y7R A;  4UEE A;  2EK9 A;  4RI1 A;  4E0A A;  3SJF A;  2PRQ A;  4OLL A;  3D2M A;  2ZEH A;  1DE4 C;  1Q2Y A;  4Q36 A;  3RZA A;  4MHY A;  1BPN A;  3RYO A;  5A27 A;  4MCS A;  2Z11 A;  1S7F A;  2CF4 A;  2GAN A;  4UIB A;  4F9U A;  4ORF A;  4Z65 A;  1QMU A;  1IID A;  2C6P A;  4RS2 A;  1Q2C A;  4JJX A;  1XFO A;  2JLM A;  4A95 A;  4EWT A;  2IQ6 A;  3K9U A;  2V8H A;  1CM0 A;  1XMB A;  2ZEM A;  3PRT A;  2BOA A;  4OAE A;  1K4J A;  4FUU A;  1BOB A;  4A38 A;  3NA6 A;  2ARH A;  5DWN A;  3VAR A;  4A37 A;  2DPS A;  3IC1 A;  1ELL P;  4F0X A;  4CYN A;  4G1P A;  4DUK A;  2PE3 A;  2WZN A;  1HDQ A;  3B3W A;  2YGW A;  3QNV A;  2X7B A;  3IGR A;  3KAS A;  4MFJ A;  1IIC A;  4Q7A A;  5K8O A;  4IHM A;  2I3C A;  4QB9 A;  5HVH A;  3KZW A;  3TO9 A;  1ZG7 A;  1XJO A;  4UA3 A;  3CPA A;  2PSW A;  4M6G A;  2CTC A;  2FL4 A;  4UFW A;  2Q4Y A;  2P6F A;  5K8M A;  4FD6 A;  4B14 A;  5K8P A;  1MJB A;  3FYN A;  3PGP A;  2XEG A;  1TKH A;  2PJ6 A;  3A9L A;  3F5B A;  3KGQ A;  3N5F A;  4DNC A;  3V38 A;  3SI1 A;  1JWQ A;  4OC2 A;  1CP7 A;  6CPA A;  2WYR A;  5KTD A;  5LRK A;  5FVJ A;  5HVF A;  2B58 A;  2NMT A;  1IOF A;  3CPX A;  3EC4 A;  3QAY A;  3BI0 A;  2B4D A;  3PBB A;  4MCQ A;  4QC6 A;  2G0B A;  2AJ6 A;  4C68 A;  3TE4 A;  1TF9 A;  2C1C A;  2PCU A;  2PJA A;  1HDU A;  2Q7B A;  2BL1 A;  1S5K A;  2Q4V A;  2B3V A;  5AG4 A;  4WJB A;  2FVG A;  2PJ7 A;  3PFO A;  3R95 A;  4Y49 B;  4ZI6 A;  2O53 A;  3H8E A;  4F9V A;  1TKJ A;  2P0W A;  4RN7 A;  4NJR A;  4XPD B;  3PBE A;  4B13 A;  2G3A A;  2FT0 A;  3S9L A;  4KLV A;  4H2K A;  3LAC A;  4M6I A;  1S7L A;  1BLL E;  4ZY2 A;  3R9G A;  1Q7L A;  3PB8 X;  3S9M A;  2O28 A;  4XPD C;  2PR8 A;  1IY7 A;  4CAF A;  2P6E A;  3LOD A;  1KZF A;  2RC4 A;  4NJQ A;  5CPA A;  1Z8X A;  3S6H A;  1PYT B;  3B8G A;  2QVP A;  3SXO A;  3S6F A;  1NMT A;  2B4D B;  5KTA A;  3PP9 A;  2V77 A;  3B3C A;  3D4U A;  2AE6 A;  1IYK A;  3IU2 A;  2DF5 A;  4UEF A;  5KTC A;  2PDO A;  2ABZ A;  3I9S A;  4R8F A;  5C82 A;  1MK4 A;  2AFW A;  2Q7S A;  3MGD A;  2QEC A;  5LRJ A;  4K3N A;  5AGE A;  5LYL A;  2I00 A;  1IU8 A;  3OWC A;  4ZY0 A;  1KUY A;  4FBE A;  3FH4 A;  2Z10 A;  4M6H A;  5HVG A;  1XMT A;  2BO9 A;  2OZU A;  1PCA A;  1XEB A;  2G3T A;  2PJ3 A;  5F09 A;  3D7H A;  1A2Z A;  1HEE A;  3NH4 A;  4PSW A;  3FEE A;  2PJC A;  4ZX8 A;  4CYQ A;  2PIY A;  2WSA A;  4HNY B;  3CT9 A;  4KSI A;  4QUS A;  3I3G A;  4J3G A;  5G20 A;  1NSL A;  1Q2D A;  4C2Y A;  1XIX A;  2IL4 A;  2OZH A;  3IFE A;  4BMH A;  1M4I A;  1VHO A;  4IAV A;  4ZYQ A;  4UF4 A;  1R43 A;  4NFR A;  4B5P A;  2F7V A;  3D68 A;  5ISV A;  4UIA A;  3FRM A;  3K9T A;  5JH9 A;  3DR6 A;  4H6Z A;  1X10 A;  4YWY A;  3MN8 A;  2WPW A;  4XPL A;  4YGO A;  4R9M A;  4QVT A;  2B4B A;  3SI2 A;  2Z3N A;  3DGV A;  1XF8 A;  3FJU A;  4CAV A;  4MCR A;  1AYE A;  2REF A;  1ON0 A;  2VQY A;  5JQ4 A;  2JEW A;  2I79 A;  3IEH A;  4U5Y A;  2R8V A;  2ZEP A;  3H5Z A;  4CGM A;  1CBX A;  1I1D A;  1S3Z A;  3CXQ A;  3GKR A;  4P6Y A;  5J8C A;  4PQA A;  4KSF A;  5JM6 A;  3T8W A;  5AG6 A;  2XEI A;  1PUA A;  3PB6 X;  2C6G A;  5EC4 A;  1XBU A;  3QB8 A;  3C26 A;  4IF5 A;  4C7I A;  3BXM A;  4FWU A;  3IO1 A;  4OIW A;  3D8P A;  5IX3 A;  2ODF A;  2OB0 A;  3P2F A;  4PXE A;  3SJX A;  3NE7 A;  4MY0 A;  3S6K A;  3GUX A;  1MJ9 A;  4UWJ A;  4ZY1 A;  4UCM A;  1U6M A;  1ARM A;  4MI4 A;  5J1Q A;  4EME A;  1JQG A;  4OKO A;  2QML A;  3CZX A;  3D67 A;  4CGL A;  4UFX A;  1S7K A;  3FIX A;  3MRU A;  8CPA A;  2ZEE A;  4AVB A;  1P0H A;  3EXN A;  1RO5 A;  3EO4 A;  3CDX A;  4MFZ A;  4UCN A;  3KR5 A;  5C88 A;  1PU9 A;  4P45 A;  2IJZ A;  2OOT A;  3WC5 A;  1KWM A;  1Z4R A;  2PJ5 A;  1M1D A;  1Z2L A;  2B5G B;  2PJ4 A;  1XE4 A;  3DDD A;  2ZED A;  4H6U A;  4KOS A;  3TOA A;  4BD9 A;  4PK2 A;  4R3K A;  4NCZ A;  2PJ0 A;  4R87 A;  5G21 A;  1KUX A;  4O23 A;  3SHP A;  1R57 A;  1LAN A;  2Q04 A;  2DXQ A;  1ZLH A;  5IB0 A;  3ISZ A;  5EBV A;  3FVL A;  2NSM A;  5EMI A;  3B2Y A;  1LFW A;  1Z4E A;  2ZW5 A;  3IWG A;  1OBR A;  4B10 A;  1NE9 A;  2PJ8 A;  3KQX A;  4LQ6 A;  3TX8 A;  2WPX A;  2ATR A;  4R57 A;  4WWV A;  5DS0 A;  5F47 A;  5LYF A;  4HNW B;  1B87 A;  4PPZ A;  2Z3O A;  4F6A A;  2JDC A;  1I12 A;  3PB9 X;  1CG2 A;  3RBU A;  2R1I A;  2CNM A;  3TFY A;  3BJ8 A;  5ELY A;  3D7G A;  3T9Y A;  3H4Q A;  4MHP A;  1F2P A;  3G8W A;  4P4E A;  4KVO E;  2FSR A;  2ZEO A;  4JYW A;  4X3R A;  2Q43 A;  2AFX A;  3WT4 A;  4NEX A;  4I49 A;  4KOR A;  4P4B A;  2EBJ A;  3P2H A;  3VH9 A;  4JXR A;  2AFS A;  4KOY A;  3W91 A;  3DNS A;  3PEI A;  3H8F A;  4MJ8 A;  4KUB A;  4Y49 C;  4AXV A;  4UBR A;  1IOI A;  4P4J A;  4GXH A;  4AB7 A;  3T90 A;  2EK8 A;  4JZ0 A;  2EWB A;  4IUS A;  2ZXV A;  3HUV A;  4FD5 A;  2DPT A;  2EVN A;  2NYQ A;  3B3T A;  4KVX A;  3FNC A;  4MFQ A;  5D29 A;  1YW4 A;  2POK A;  5I4M A;  4F8Z A;  1YLO A;  3KI9 A;  4CPA A;  4NGN A;  4MCP A;  3H8G A;  3BLN A;  1AMP A;  1GHE A;  2F8H A;  1VIX A;  3GIU A;  2YNC C;  2ZEG A;  4W9Y A;  2CIJ A;  1ARL A;  5F49 A;  1RXT A;  1TXR A;  4YFJ A;  3E0K A;  4KLW A;  2G9D A;  2D4P A;  3DLJ A;  1YR0 A;  3SJE A;  3B3S A;  4NGT A;  1MJA A;  2AFU A;  2ZEN A;  2EUI A;  4OME A;  1VGY A;  3F8K A;  3B35 A;  2OH1 A;  3KHX A;  5A28 A;  3TCV A;  1Y7E A;  4B5O A;  3KKW A;  2ZOG A;  2VL1 A;  3FBU A;  4BIN A;  2AFZ A;  1XRY A;  1LOK A;  2VZY A;  3IWE A;  3GYA A;  4R6T A;  1YVK A;  2PC1 A;  3BHX A;  3G3S A;  4MHD A;  1BAV A;  4CAX A;  1Z8T A;  3RNZ A;  3W6X A;  2OZG A;  4DJL A;  2ZEL A;  4CYP A;  2K5T A;  3HLP A;  2CY2 A;  2R98 A;  2Y0M A;  4A39 A;  1ELM P;  1YGH A;  2EO8 A;  4NSQ A;  3PZJ A;  2REE A;  5THW A;  1TF8 A;  4KZT A;  3VAT A;  3FX6 A;  4ZBG A;  3WAB A;  4C2Z A;  1QST A;  2Z3M A;  4LX9 A;  1TKF A;  3KL9 A;  4PXC A;  2VI7 A;  3LMS A;  4AG9 A;  2JEV A;  2HV2 A;  4A2Z A;  1YME A;  4OID A;  4NGM A;  1LAM A;  1F57 A;  1YW6 A;  2KCW A;  2YND A;  3D2P A;  3NH8 A;  2F5I A;  4OAD A;  1CP6 A;  1YK3 A;  3K2K A;  2PR1 A;  4MFP A;  2VBQ A;  2PVW A;  1YQE A;  3D7F A;  4TWE A;  2R7H A;  4XPK A;  2VZZ A;  1AUG A;  1LRZ A;  3NFZ A;  4MFL A;  4LQG A;  4HNX B;  3JTK A;  1DTD A;  1M44 A;  1S60 A;  2HQY A;  1X12 A;  2ZPA A;  4HPS A;  4KS9 A;  5F48 A;  2ZOF A;  3V7Z A;  4CRZ B;  1L0C A;  1N71 A;  3LD2 A;  2Z3P A;  1Z5R A;  2Q0Y A;  4R76 A;  5G22 A;  5GCN A;  1BO4 A;  3D66 A;  3TC8 A;  3UY5 A;  2AFM A;  4OC4 A;  1UFH A;  2YNE A;  3L2N A;  3KQZ A;  2CNS A;  4NGQ A;  5CNP A;  4KOW A;  3KHZ A;  2FXF A;  3PFE A;  3GLJ A;  3IJ3 A;  4Q38 A;  3IIB A;  4E8O A;  4R7M A;  4B12 A;  2P6G A;  4X5K A;  2FCK A;  1WWZ A;  4L89 A;  3FF3 A;  4A30 A;  4ONU A;  2DEA A;  4ONW A;  4PV6 A;  4BBH A;  5DWM A;  4ZGY B;  2ZW7 A;  5AG5 A;  4H89 A;  3RO0 A;  4R3L A;  4F0Y A;  1QSR A;  1FT7 A;  4CYO A;  1H8L A;  4YRH A;  2YNC A;  1VHS A;  5I0C A;  1BPM A;  1I21 A;  3IU1 A;  1QSM A;  2BSW A;  4II9 A;  3FED A;  1LAP A;  1Y0Y A;  4CAE A;  1TIQ A;  4P10 A;  2H5M A;  1YLE A;  4KOT A;  4JLY A;  4L8A A;  2J8M A;  1CJW A;  2BUE A;  5JPH A;  3CXP A;  3PB4 X;  3LWU A;  4P4D A;  1R3N A;  4M85 A;  3GY9 A;  2GE3 A;  2QJ8 A;  2V8V A;  3PB7 X;  2BEI A;  4P4I A;  2JBK A;  4KOX A;  1VKC A;  2HB6 A;  2IMO A;  4A94 A;  2WUU A;  2A4N A;  4KOV A;  4KUA A;  3R9F A;  2FIA A;  4PK3 A;  1OZP A;  2HC9 A;  1S7N A;  4C2X A;  1Z8W A;  3D7D A;  4UEZ A;  2AFO A;  3R9E A;  3EFA A;  4A31 A;  1ZLI A;  4MFK A;  4CGO A;  4X2T A;  5D8N A;  5IV0 A;  4C7H A;  2Q4Z A;  1B6B A;  2VEZ A;  1Y0R A;  2Z3L A;  3WC6 A;  1IYL A;  4MHZ A;  2PVV A;  2PIZ A;  4PSX A; 
#chains in the Genus database with same CATH homology
 4NGP A;  2C6C A;  3NH5 A;  1YSJ A;  4FAI A;  2V8G A;  4MMO A;  4OC3 A;  1QQ9 A;  5LYD A;  4GM5 A;  4EFD A;  1Z8L A;  2GLJ A;  2XEF A;  2GRE A;  1EE3 P;  2BCO A;  2GU2 A;  4OC1 A;  1GYT A;  3JRU A;  2RFH A;  2QYV A;  1LCP A;  4NGS A;  1CX8 A;  3ISX A;  4OC0 A;  3SJG A;  3BI1 A;  2XEJ A;  3IWW A;  3I1U A;  4MHN A;  2PJ9 A;  2GLF A;  4B6Z A;  5LYI A;  5CBM A;  2JBJ A;  4OC5 A;  1ZG9 A;  2Q51 A;  4PXD A;  5K8N A;  3WC7 A;  1NSA A;  2OR4 A;  3RAM A;  1VHE A;  4ZX9 A;  3B3V A;  1CPX A;  2V8D A;  3S9N A;  3SI0 A;  2PJ1 A;  2ANP A;  1FNO A;  5HXD A;  1ZG8 A;  1CPS A;  2J9A A;  1M4L A;  4P44 A;  4P4F A;  1RTQ A;  2PJB A;  3B7I A;  4MXU A;  4X8I A;  2CTB A;  4NGR A;  4RUH A;  3FMC A;  3KR4 A;  4IK2 A;  2ZEF A;  3FEC A;  2PJ2 A;  5JGF A;  1IGB A;  2O4H A;  5IB9 A;  1UWY A;  1F2O A;  4OP4 A;  4PXB A;  4YU9 A;  2RB7 A;  4DYO A;  4TNU A;  3GB0 A;  5LRG A;  4MRI A;  7CPA A;  4UEE A;  2EK9 A;  3SJF A;  2PRQ A;  2ZEH A;  1DE4 C;  3RZA A;  4MHY A;  1BPN A;  4MCS A;  2CF4 A;  4UIB A;  4F9U A;  4Z65 A;  1QMU A;  2C6P A;  1XFO A;  4EWT A;  2IQ6 A;  2V8H A;  1XMB A;  2ZEM A;  3PRT A;  2BOA A;  4FUU A;  4A38 A;  3NA6 A;  3VAR A;  4A37 A;  3IC1 A;  1ELL P;  4G1P A;  4DUK A;  2PE3 A;  2WZN A;  1HDQ A;  3B3W A;  3QNV A;  3KAS A;  4Q7A A;  5K8O A;  4IHM A;  2I3C A;  5HVH A;  3KZW A;  1ZG7 A;  1XJO A;  3CPA A;  2CTC A;  5K8M A;  5K8P A;  2XEG A;  1TKH A;  2PJ6 A;  3KGQ A;  3N5F A;  3V38 A;  3SI1 A;  4OC2 A;  5LRK A;  1CP7 A;  6CPA A;  2WYR A;  5HVF A;  3CPX A;  3BI0 A;  3PBB A;  4MCQ A;  1TF9 A;  2C1C A;  2PCU A;  2PJA A;  1HDU A;  4WJB A;  2FVG A;  2PJ7 A;  3PFO A;  4ZI6 A;  2O53 A;  3H8E A;  4F9V A;  1TKJ A;  4NJR A;  3PBE A;  3S9L A;  4H2K A;  4ZY2 A;  1BLL E;  1Q7L A;  3PB8 X;  3S9M A;  1IY7 A;  4NJQ A;  5CPA A;  1PYT B;  2QVP A;  2V77 A;  3B3C A;  3D4U A;  4UEF A;  2ABZ A;  4R8F A;  2AFW A;  5LRJ A;  4K3N A;  5LYL A;  4ZY0 A;  4FBE A;  3FH4 A;  5HVG A;  2BO9 A;  1PCA A;  2PJ3 A;  5F09 A;  3D7H A;  1HEE A;  3NH4 A;  3FEE A;  2PJC A;  4ZX8 A;  2PIY A;  3CT9 A;  4KSI A;  3IFE A;  4IAV A;  1VHO A;  4ZYQ A;  4UF4 A;  1R43 A;  4NFR A;  2F7V A;  3D68 A;  4UIA A;  3K9T A;  5JH9 A;  4YWY A;  3MN8 A;  3SI2 A;  3DGV A;  3FJU A;  4MCR A;  1AYE A;  2JEW A;  3IEH A;  2ZEP A;  1CBX A;  4P6Y A;  4PQA A;  5JM6 A;  3T8W A;  2XEI A;  3PB6 X;  2C6G A;  1XBU A;  3BXM A;  4FWU A;  3IO1 A;  4OIW A;  3SJX A;  4PXE A;  3GUX A;  4ZY1 A;  1ARM A;  5J1Q A;  4EME A;  1JQG A;  4OKO A;  3D67 A;  8CPA A;  3MRU A;  2ZEE A;  3CDX A;  3KR5 A;  4P45 A;  2IJZ A;  2OOT A;  3WC5 A;  1KWM A;  2PJ5 A;  2PJ4 A;  1Z2L A;  2ZED A;  4BD9 A;  2PJ0 A;  4O23 A;  1LAN A;  1ZLH A;  3ISZ A;  3FVL A;  2NSM A;  3B2Y A;  1LFW A;  1OBR A;  2PJ8 A;  3KQX A;  3TX8 A;  5LYF A;  4WWV A;  5DS0 A;  4PPZ A;  3RBU A;  3PB9 X;  1CG2 A;  5ELY A;  3D7G A;  4MHP A;  1F2P A;  4P4E A;  4X3R A;  2ZEO A;  4JYW A;  2Q43 A;  2AFX A;  3WT4 A;  4P4B A;  3VH9 A;  2AFS A;  3PEI A;  3H8F A;  4AXV A;  4P4J A;  2EK8 A;  4JZ0 A;  2EWB A;  3HUV A;  2NYQ A;  3B3T A;  5D29 A;  1YW4 A;  2POK A;  5I4M A;  4F8Z A;  1YLO A;  3KI9 A;  4CPA A;  4NGN A;  4MCP A;  3H8G A;  1AMP A;  2F8H A;  1VIX A;  2ZEG A;  4W9Y A;  2CIJ A;  1ARL A;  1TXR A;  2G9D A;  3DLJ A;  3SJE A;  3B3S A;  4NGT A;  2AFU A;  2ZEN A;  4OME A;  1VGY A;  3B35 A;  3KHX A;  1Y7E A;  2ZOG A;  2VL1 A;  2AFZ A;  1XRY A;  1LOK A;  4R6T A;  3BHX A;  1BAV A;  4DJL A;  2ZEL A;  3HLP A;  4A39 A;  1ELM P;  5THW A;  1TF8 A;  3VAT A;  3FX6 A;  3WAB A;  1TKF A;  3KL9 A;  4PXC A;  3LMS A;  1YME A;  4OID A;  4NGM A;  1LAM A;  1F57 A;  1YW6 A;  3NH8 A;  1CP6 A;  3K2K A;  4TWE A;  3D7F A;  2PVW A;  3NFZ A;  4LQG A;  1DTD A;  3V7Z A;  2ZOF A;  1Z5R A;  4R76 A;  3D66 A;  3TC8 A;  2AFM A;  4OC4 A;  3L2N A;  3KQZ A;  4NGQ A;  3KHZ A;  3PFE A;  3GLJ A;  3IJ3 A;  3IIB A;  4R7M A;  3FF3 A;  2DEA A;  4ONW A;  1FT7 A;  1H8L A;  1BPM A;  3FED A;  1LAP A;  1Y0Y A;  4P10 A;  3PB4 X;  3LWU A;  4P4D A;  1R3N A;  2QJ8 A;  2V8V A;  3PB7 X;  4P4I A;  2JBK A;  2HB6 A;  2IMO A;  4A94 A;  2HC9 A;  3D7D A;  4UEZ A;  2AFO A;  1ZLI A;  4X2T A;  5D8N A;  2Q4Z A;  1Y0R A;  3WC6 A;  4MHZ A;  2PVV A;  2PIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...