1TKFA

Streptomyces griseus aminopeptidase complexed with d-tryptophan
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
277
structure length
273
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIEGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
molecule tags Hydrolase
total genus 108
structure length 273
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkfA00
3PBEA 3D7GA 2PIYA 4X8IA 2ZEFA 1ZG7A 2CTBA 2F8HA 2BO9A 1EE3P 2J9AA 4ZY2A 4DUKA 1AMPA 4MCQA 2ZEOA 3KHXA 1BPNA 4IAVA 2ZOFA 1HEEA 3BI1A 3SJEA 2JBKA 5HVGA 1TKFA 2PJ2A 3KI9A 4UEZA 3PB9X 3KQXA 1GYTA 3FX6A 4F8ZA 3SJFA 4H2KA 4P4JA 5K8PA 4RUHA 1F57A 2CIJA 2AFMA 2BCOA 4R76A 3V38A 4O23A 2GU2A 2PJ9A 3HLPA 3FF3A 4NFRA 3S9LA 2FVGA 3B3TA 4NGSA 5JM6A 8CPAA 1KWMA 4OC1A 4R7MA 1M4LA 3GUXA 4A37A 3CPAA 1F2OA 4ZI6A 4NGTA 5I4MA 2NSMA 2C6CA 5LYIA 4ZX9A 1Z2LA 3V7ZA 1NSAA 2Q43A 3NA6A 4FWUA 1PYTB 1XJOA 3B2YA 3L2NA 1LOKA 4EMEA 2JEWA 2AFXA 5D29A 3B7IA 1LFWA 3WABA 4P4DA 3VARA 1CG2A 3B3WA 4PXCA 4FBEA 2PVVA 1BLLE 1TF8A 2PRQA 2HB6A 5K8MA 3B3VA 1XBUA 2O53A 2AFUA 3D7HA 4PXEA 1YW4A 3D68A 1IY7A 1ZG9A 4IHMA 4MRIA 2V77A 4R6TA 3WT4A 4ONWA 1OBRA 1ARMA 2AFOA 4OC5A 4FAIA 2XEGA 1XRYA 4TWEA 2ZENA 4OC2A 1BPMA 4UEFA 3JRUA 1Z8LA 3SJGA 4X2TA 6CPAA 3CDXA 2XEFA 2IMOA 3PBBA 2ZEPA 4NJRA 2C1CA 3RZAA 4P45A 3B3SA 1R43A 4MCPA 3DLJA 2C6PA 4NGRA 2PJCA 2QYVA 3FEDA 3HUVA 4A38A 4ZYQA 4A94A 1ARLA 1LCPA 4A39A 3KHZA 2PJ5A 2XEIA 5LRJA 2PE3A 2PVWA 2BOAA 3IC1A 5LYDA 3PRTA 1LANA 4NGQA 5CPAA 2AFZA 4NGNA 3TX8A 2ZEEA 1H8LA 1TKJA 2Q4ZA 4FUUA 4PQAA 3N5FA 3PEIA 2OR4A 3KZWA 2V8HA 3KL9A 2IJZA 4EWTA 5JH9A 4F9UA 2DEAA 1Y0YA 2ZELA 4YU9A 1CP6A 3NH8A 4GM5A 3IFEA 4LQGA 5LYFA 3PB8X 1LAPA 4ZY1A 5HVHA 4UIBA 4WJBA 4BD9A 4K3NA 5K8OA 3T8WA 2EK8A 1ZLIA 3KR4A 2EWBA 3S9MA 4DYOA 2RFHA 3H8FA 3IO1A 2PJ0A 1Y7EA 2JBJA 2POKA 2PJ8A 4MHYA 4KSIA 3BXMA 3IJ3A 1YW6A 4DJLA 1CPXA 4OKOA 2ZOGA 4PXBA 4B6ZA 3K2KA 2ZEMA 3VH9A 4UF4A 3BHXA 4MCRA 3IEHA 1ELLP 3D7FA 4UIAA 1VHEA 2F7VA 2I3CA 3NH4A 4OC0A 1YMEA 1R3NA 1QQ9A 1QMUA 2AFSA 4PXDA 3RBUA 1ELMP 2PIZA 5LYLA 1JQGA 3GLJA 2NYQA 1CX8A 1CBXA 4P10A 2AFWA 3SI1A 5J1QA 3D7DA 5ELYA 1FT7A 2CTCA 2GLFA 4F9VA 3PB7X 2G9DA 3KQZA 4Q7AA 5F09A 2ZEDA 3DGVA 3MRUA 1LAMA 3MN8A 1CPSA 1FNOA 2V8DA 4MHPA 4WWVA 2PJBA 3KASA 4R8FA 3H8GA 3H8EA 3ISZA 4IK2A 1TF9A 3PB4X 5IB9A 2GLJA 3I1UA 2Q51A 3SI0A 4AXVA 4ZY0A 2PCUA 4MMOA 2PJ7A 1TKHA 7CPAA 2O4HA 1XFOA 2VL1A 3B3CA 3D67A 3GB0A 4TNUA 1ZLHA 2OOTA 3WC6A 1VIXA 3FMCA 4NGPA 3PB6X 5JGFA 1UWYA 3FEEA 4P4BA 3NH5A 3BI0A 4UEEA 3KR5A 2QVPA 1F2PA 4YWYA 4G1PA 3IWWA 5D8NA 3FVLA 4Z65A 3SJXA 3D4UA 5K8NA 3FJUA 2PJAA 5THWA 4P4EA 2GREA 2QJ8A 1AYEA 3S9NA 5LRKA 1PCAA 3FH4A 3PFOA 2HC9A 4P44A 3PFEA 3TC8A 1YLOA 3K9TA 3WC5A 4MHZA 1BAVA 2WYRA 1HDQA 1Q7LA 4NGMA 2V8GA 1TXRA 5DS0A 4X3RA 1DE4C 3LWUA 2XEJA 1Z5RA 2PJ3A 3RAMA 3VATA 1XMBA 4P4IA 5CBMA 4CPAA 3IIBA 2ABZA 4MHNA 4PPZA 3LMSA 4OC3A 4OIDA 1DTDA 4P6YA 2ZEHA 2RB7A 3ISXA 4OP4A 1Y0RA 3KGQA 4MXUA 3WC7A 1IGBA 2PJ1A 1VHOA 2V8VA 4W9YA 4OIWA 2IQ6A 2WZNA 4OC4A 4MCSA 2C6GA 1CP7A 3QNVA 2ANPA 4ZX8A 3B35A 2PJ4A 3D66A 5HVFA 3SI2A 5HXDA 1VGYA 2PJ6A 4OMEA 2ZEGA 3CT9A 4P4FA 2CF4A 3NFZA 1YSJA 1ZG8A 3CPXA 4JYWA 4JZ0A 3FECA 4NJQA 2EK9A 1RTQA 5LRGA 4EFDA 1HDUA
chains in the Genus database with same CATH superfamily
1YR0A 4HNXB 2Z0ZA 4XPDB 3PBEA 4UCMA 3D7GA 3NE7A 4Y49C 2PIYA 4CGLA 4NEXA 4X8IA 2ZEFA 4A2ZA 1XE4A 1YVKA 1ZG7A 2CTBA 3QAHA 2QMLA 2J8RA 1S7FA 1N71A 3IGRA 2F8HA 2BO9A 1EE3P 2J9AA 4ZY2A 4DUKA 1AMPA 3QB8A 4MCQA 4KVME 4NXYA 3V8IA 2ZEOA 1U6MA 3KHXA 4YGOA 3R95A 4BMHA 4CGMA 1BPNA 1YREA 4IAVA 2Z3KA 2ZOFA 1HEEA 2PC1A 3BI1A 1YX0A 3SJEA 3VWDA 2JBKA 4QB9A 5HVGA 4UCPA 1TKFA 2YNDA 2PJ2A 5AGEA 3KI9A 2Z3OA 4U9YA 4M3SA 4UEZA 4B5PA 5H86A 4RS2A 3PB9X 4GS4A 4M6GA 4CAVA 3KQXA 3I3GA 1GYTA 3D2PA 3FX6A 2VEZA 2ZW7A 4H2KA 3SJFA 4F8ZA 4P4JA 3CXPA 3P2FA 4RUHA 1F57A 5K8PA 2CIJA 1M44A 4MHDA 2AFMA 2BCOA 1NMTA 4R76A 3V38A 4O23A 2CNMA 2GU2A 2PJ9A 1ZO0A 3FF3A 3HLPA 1XIXA 2FVGA 4NFRA 4BBHA 3S9LA 3B3TA 1IICA 4NGSA 5JM6A 2BEIA 1I21A 4F0XA 3TO6A 5A28A 8CPAA 1Q2DA 3OWCA 1KWMA 4C2YA 4OC1A 4R7MA 1M4LA 3F5BA 4U9ZA 3GUXA 2B5GB 4A37A 1R57A 1CM0A 3TFYA 3CPAA 5G22A 1F2OA 4L8AA 4ZI6A 4NGTA 5I4MA 2NSMA 1S7NA 2C6CA 4KS9A 4UFXA 5LYIA 4ZX9A 1Z2LA 4CAFA 2C27A 3V7ZA 4A30A 2B4DB 4YRHA 1NSAA 4CGPA 2FE7A 5G20A 4L89A 2Q43A 1RO5A 2ZPAA 3LACA 3NA6A 4FWUA 1PYTB 2J8NA 1XJOA 2FS5A 3GKRA 4CRZB 1Z8XA 3B2YA 3L2NA 1LOKA 1MK4A 5FVJA 5J8FA 2GANA 4PK3A 2B4BA 3FYNA 4MFZA 4EMEA 4XPKA 2JEWA 2AFXA 5D29A 3R1KA 1XEBA 4LUAA 4LX9A 4OADA 5F47A 3B7IA 3R96A 1LFWA 2REEA 3WABA 2WUUA 4P4DA 2OH1A 4MFKA 3TO7A 1WK4A 3VARA 2I79A 1CG2A 3B3WA 4PXCA 4FBEA 2PVVA 1BLLE 1SQHA 4Y49B 5JQ4A 1TIQA 2JLMA 3BJ8A 4XPLA 1TF8A 5H84A 4AB7A 2PRQA 1Z8WA 2HB6A 2CNTA 5K8MA 2Z10A 3B3VA 4Q38A 1XBUA 5AG4A 4KSAA 3TT2A 2AJ6A 2ODFA 3PGPA 2O53A 3H5ZA 3LODA 2AFUA 3D7HA 4PXEA 1YW4A 5IV0A 2ZXVA 1IOIA 3D68A 3FBUA 1IY7A 3SXOA 2PR1A 4B13A 2R1IA 1ZG9A 4IHMA 3RYOA 4C68A 5I0CA 4MRIA 1XF8A 1YLEA 1ON0A 2V77A 4R6TA 3WT4A 2JEVA 2DPTA 4KOSA 4ONWA 1OBRA 2ZW5A 5DWNA 1IYKA 2OZGA 3FIXA 4B10A 1Y7RA 1P0HA 1KUYA 2WSAA 1ARMA 3BJ7A 1VHSA 4AVAA 2AFOA 4JXQA 4MBUA 3SHPA 1QSOA 3TOAA 4OC5A 1YQEA 5EBVA 1YK3A 4B11A 4FAIA 2XEGA 1XRYA 4TWEA 4RN7A 3JVNA 2ZENA 1VKCA 4OC2A 4KZTA 4E0AA 2B3UA 4CS0B 1BPMA 4UEFA 3JRUA 1Z8LA 3SJGA 4X2TA 6CPAA 2Q44A 3CDXA 3FNCA 2XEFA 2IMOA 4KLVA 3PBBA 4IUSA 2ZEPA 4NJRA 2C1CA 1QSTA 4C2XA 4I49A 2Y0MA 3RZAA 2B3VA 4M6IA 4P45A 3B3SA 1KZFA 1R43A 2HUZA 2Q7SA 4EVYA 4MCPA 1BO4A 3DLJA 4ONUA 2C6PA 4MJ8A 4B5PB 4NGRA 1QSRA 2PJCA 2QYVA 3FEDA 3HUVA 4NCZA 4A38A 4ZYQA 1M4DA 4UFVA 4A94A 1M4GA 2G3TA 5F48A 1ARLA 1NE9A 3H4QA 1LCPA 5DWMA 4KOXA 2AE6A 4KVOE 2PQ8A 4A39A 3KHZA 1Q2CA 5AG5A 2PJ5A 2Z3MA 2XEIA 5LRJA 3S6HA 4F0YA 5BWAB 2PE3A 2PVWA 2BOAA 1S7LA 4ORFA 3IC1A 5LYDA 3PRTA 1LANA 4U5YA 4NGQA 2D4PA 5CPAA 2HQYA 2AFZA 3DR6A 4JWPA 4NGNA 3TX8A 2VZZA 2ZEEA 1LRZA 3GIUA 1H8LA 1TKJA 2Q4ZA 2Q4YA 4FUUA 4PQAA 3N5FA 3K9UA 2PSWA 3PEIA 4XNHC 1M4IA 2FCKA 3GYAA 4UCNA 2OR4A 3ZZIA 4YFJA 1FY7A 3KZWA 2V8HA 3KL9A 4B12A 3FRMA 3QAYA 5KTCA 2IJZA 4EWTA 5A27A 5JH9A 2VZYA 4F9UA 2DEAA 4UA3A 3P2HA 1Y0YA 2EO8A 2PDOA 2ZELA 4YU9A 1CP6A 3NH8A 4CRYB 2OZUA 4MFJA 3UY5A 3KKWA 4BINA 4GM5A 3IFEA 1IOFA 2EVNA 4LQGA 3PB8X 4HPSA 1LAPA 5LYFA 4ZY1A 5HVHA 1XOVA 2R98A 1Z8TA 4UIBA 4WJBA 4BD9A 4K3NA 3W91A 5K8OA 3T8WA 2EK8A 4HNWB 4A95A 1ZLIA 4UFWA 2YNCA 3KR4A 2EWBA 3JUWA 3S9MA 4DYOA 4C7HA 2VQYA 2RFHA 4KOYA 3H8FA 4AVCA 4AG9A 3EFAA 4FD4A 4JD6A 3IO1A 3BLNA 2PJ0A 2Z3PA 3F0AA 1Y7EA 2CY2A 2H5MA 4RI1A 2JBJA 2POKA 3VWEA 5J8CA 4X5KA 2QECA 2D4OA 1MJBA 3MGDA 2Z3NA 4UBRA 2PJ8A 4MHYA 4KSIA 4KVXA 3R9EA 3BXMA 3IJ3A 1YW6A 4DJLA 1B87A 2YNCC 1S3ZA 1CPXA 4OKOA 2ZOGA 4PXBA 4ZBGA 2DF5A 4B6ZA 2VXKA 2ZEMA 3K2KA 4IF5A 5AG7A 2X7BA 3VH9A 1X10A 2Q0YA 4UF4A 3BHXA 4MCRA 3EY5A 3IEHA 1ELLP 5EMIA 5JPHA 3S6KA 3D7FA 4UIAA 1VHEA 2F7VA 2I3CA 3NH4A 4H89A 4MY0A 2CXAA 4Q36A 4OC0A 2BUEA 4M85A 3W6XA 5IB0A 3WR7A 3JTKA 4B14A 2O28A 1YMEA 1R3NA 4DNCA 1QQ9A 4AVBA 1QMUA 2AFSA 2EUIA 5HMNA 4PXDA 3RBUA 2G0BA 2PRBA 4CYNA 3DNSA 1Z9UA 2Q7BA 1ELMP 2PIZA 3D2MA 3NE8A 1NSLA 5C82A 5LYLA 4QUSA 1JQGA 4PV6A 3EO4A 3N7ZA 1CJWA 3GLJA 2GE3A 2NYQA 1CX8A 2WPWA 1CBXA 1RXTA 4P10A 1S5KA 2AFWA 5EC4A 3SI1A 5J1QA 1L0CA 3D7DA 5ELYA 1FT7A 2CTCA 2GLFA 3TCVA 4FD6A 3F8KA 3PZJA 4JJXA 4F9VA 4OAEA 2ZW6A 3PB7X 2G9DA 1S60A 3KQZA 3B8GA 4Q7AA 3C26A 5F09A 4II9A 1V0CA 2REFA 2ZEDA 1I1DA 4XNHB 1P4NA 3DGVA 3MRUA 1MJAA 2F5IA 4KORA 1LAMA 4KLWA 4KSFA 4R3KA 3MN8A 2EBJA 1B6BA 1QSNA 1CPSA 2HV2A 2JDDA 1FNOA 4A33A 3TO9A 2V8DA 2P6EA 3G3SA 3RNZA 4MHPA 2BSWA 3DDDA 1JWQA 2PJBA 3KASA 4MFQA 4R8FA 4WWVA 3H8GA 3H8EA 3G8WA 1IYLA 5IX3A 3TE4A 3EC4A 3ISZA 4JLYA 2YGWA 1WWZA 3IU1A 3FXTA 4CYPA 4QVTA 5GCNA 1MJ9A 2PR8A 4IK2A 1TF9A 1KUXA 3PB4X 5IB9A 2ZW4A 3R9GA 3DSBA 2IL4A 4MFPA 2GLJA 3I1UA 2Q51A 3SI0A 3E0KA 4AXVA 4ZY0A 4E8OA 2FSRA 2PCUA 4MMOA 5ISVA 2PJ7A 2KCWA 3T90A 4A32A 4J3GA 1PUAA 3PP9A 1Q2YA 1TKHA 4C2ZA 3I9SA 2O4HA 1XFOA 2VL1A 3B3CA 3D67A 7CPAA 1PU9A 3GB0A 4UWJA 2RC4A 2P6GA 4TNUA 1ZLHA 4CAEA 4CYQA 2Z11A 4JXRA 2OOTA 3WC6A 4FD7A 1VIXA 4H6UA 4CGNA 3FMCA 4NGPA 3FB3A 4KOVA 3IWEA 4MY3A 3PB6X 4KUBA 5JGFA 4ZGYB 1UWYA 1S7KA 3FEEA 3NH5A 4P4BA 3R9FA 3BI0A 3A9LA 4UEEA 2Q4VA 2R7HA 2DPSA 3KR5A 2QVPA 1F2PA 4HNYB 4XPDC 4YWYA 3DR8A 4R9MA 4G1PA 3IWWA 2FIAA 4UWIA 5D8NA 3FVLA 4PSWA 4Z65A 3SJXA 3SXNA 3D4UA 5CBMA 5K8NA 3FJUA 5KTDA 4K30A 2PJAA 5THWA 4AG7A 2QIRA 4P4EA 4FD5A 5AG6A 2GREA 2QJ8A 5F49A 1AYEA 2FIWA 1IU8A 3IWGA 3S9NA 1IB1E 4E2AA 3CXQA 5LRKA 1PCAA 1Z4RA 3D3SA 3FH4A 2OZHA 3PFOA 2ARHA 4KUAA 1GHEA 4PSXA 3TTHA 2HC9A 4QC6A 5KTAA 3W6SA 4P44A 3PFEA 4H6ZA 3TC8A 2Z3LA 3TOBA 1YLOA 4QBJA 3K9TA 1KUVA 4KOTA 3WC5A 4MHZA 4B5OA 2FXFA 1BAVA 2VI7A 1Y9WA 1HDQA 2VBQA 2WYRA 1IIDA 4CAWA 3CXSA 1Q7LA 4NGMA 1Y9KA 2V8GA 1TXRA 5CNPA 5DS0A 4X3RA 1DE4C 3LWUA 2Q04A 2XEJA 4GXHA 4R57A 4OLLA 1Z5RA 2PJ3A 3RAMA 4F6AA 2B5GA 4KOWA 3VATA 2OB0A 1XMBA 2A4NA 1AUGA 3CZXA 3IIBA 2ABZA 3IU2A 4P4IA 4C7IA 4CPAA 4MHNA 4PPZA 2P0WA 3LMSA 4HKFA 4OC3A 2I00A 1I12A 4MI4A 2GIVA 4OIDA 4PK2A 4R87A 3GY9A 1DTDA 1Z4EA 2B4DA 1J4JA 2RB7A 2ZEHA 3EXNA 3ISXA 4P6YA 2ATRA 1Y0RA 3KGQA 4MXUA 4OP4A 1IGBA 3WC7A 2PJ1A 1VHOA 1BOBA 2V8VA 4W9YA 4OIWA 2P6FA 2IQ6A 2WZNA 4OC4A 4CGOA 2B58A 2K5TA 4MCSA 4CAXA 5E96A 5C88A 2JDCA 2C6GA 1CP7A 5G1ZA 2NMTA 3QNVA 4MFLA 3T9YA 2ANPA 2FT0A 1OZPA 4ZX8A 1K4JA 1UFHA 3B35A 3LD2A 2BL1A 2PJ4A 3D66A 5HVFA 3SI2A 5HXDA 1VGYA 2CNSA 2PJ6A 4M6HA 2G3AA 1YVOA 5F46A 1M1DA 2DXQA 4NSQA 1XMTA 4OMEA 5HH1A 4KOUA 2ZEGA 2R8VA 3CT9A 4P4FA 2CF4A 3NFZA 2YNEA 4LQ6A 1YSJA 1ZG8A 2GFQA 3D8PA 3CPXA 4JYWA 4JZ0A 1X12A 3FECA 4R3LA 3ZJ0A 4NJQA 2WPXA 4CYOA 5G21A 3S6FA 2EK9A 2FL4A 4A31A 1A2ZA 2OU2A 1RTQA 5LRGA 3RO0A 1QSMA 1YGHA 3S6GA 4EFDA 2J8MA 1HDUA 4NF1A
chains in the Genus database with same CATH topology
3PBEA 3D7GA 2PIYA 4X8IA 2ZEFA 1ZG7A 2CTBA 2F8HA 2BO9A 1EE3P 2J9AA 4ZY2A 4DUKA 1AMPA 4MCQA 2ZEOA 3KHXA 1BPNA 4IAVA 2ZOFA 1HEEA 3BI1A 3SJEA 2JBKA 5HVGA 1TKFA 2PJ2A 3KI9A 4UEZA 3PB9X 3KQXA 1GYTA 3FX6A 4F8ZA 3SJFA 4H2KA 4P4JA 5K8PA 4RUHA 1F57A 2CIJA 2AFMA 2BCOA 4R76A 3V38A 4O23A 2GU2A 2PJ9A 3HLPA 3FF3A 4NFRA 3S9LA 2FVGA 3B3TA 4NGSA 5JM6A 8CPAA 1KWMA 4OC1A 4R7MA 1M4LA 3GUXA 4A37A 3CPAA 1F2OA 4ZI6A 4NGTA 5I4MA 2NSMA 2C6CA 5LYIA 4ZX9A 1Z2LA 3V7ZA 1NSAA 2Q43A 3NA6A 4FWUA 1PYTB 1XJOA 3B2YA 3L2NA 1LOKA 4EMEA 2JEWA 2AFXA 5D29A 3B7IA 1LFWA 3WABA 4P4DA 3VARA 1CG2A 3B3WA 4PXCA 4FBEA 2PVVA 1BLLE 1TF8A 2PRQA 2HB6A 5K8MA 3B3VA 1XBUA 2O53A 2AFUA 3D7HA 4PXEA 1YW4A 3D68A 1IY7A 1ZG9A 4IHMA 4MRIA 2V77A 4R6TA 3WT4A 4ONWA 1OBRA 1ARMA 2AFOA 4OC5A 4FAIA 2XEGA 1XRYA 4TWEA 2ZENA 4OC2A 1BPMA 4UEFA 3JRUA 1Z8LA 3SJGA 4X2TA 6CPAA 3CDXA 2XEFA 2IMOA 3PBBA 2ZEPA 4NJRA 2C1CA 3RZAA 4P45A 3B3SA 1R43A 4MCPA 3DLJA 2C6PA 4NGRA 2PJCA 2QYVA 3FEDA 3HUVA 4A38A 4ZYQA 4A94A 1ARLA 1LCPA 4A39A 3KHZA 2PJ5A 2XEIA 5LRJA 2PE3A 2PVWA 2BOAA 3IC1A 5LYDA 3PRTA 1LANA 4NGQA 5CPAA 2AFZA 4NGNA 3TX8A 2ZEEA 1H8LA 1TKJA 2Q4ZA 4FUUA 4PQAA 3N5FA 3PEIA 2OR4A 3KZWA 2V8HA 3KL9A 2IJZA 4EWTA 5JH9A 4F9UA 2DEAA 1Y0YA 2ZELA 4YU9A 1CP6A 3NH8A 4GM5A 3IFEA 4LQGA 5LYFA 3PB8X 1LAPA 4ZY1A 5HVHA 4UIBA 4WJBA 4BD9A 4K3NA 5K8OA 3T8WA 2EK8A 1ZLIA 3KR4A 2EWBA 3S9MA 4DYOA 2RFHA 3H8FA 3IO1A 2PJ0A 1Y7EA 2JBJA 2POKA 2PJ8A 4MHYA 4KSIA 3BXMA 3IJ3A 1YW6A 4DJLA 1CPXA 4OKOA 2ZOGA 4PXBA 4B6ZA 3K2KA 2ZEMA 3VH9A 4UF4A 3BHXA 4MCRA 3IEHA 1ELLP 3D7FA 4UIAA 1VHEA 2F7VA 2I3CA 3NH4A 4OC0A 1YMEA 1R3NA 1QQ9A 1QMUA 2AFSA 4PXDA 3RBUA 1ELMP 2PIZA 5LYLA 1JQGA 3GLJA 2NYQA 1CX8A 1CBXA 4P10A 2AFWA 3SI1A 5J1QA 3D7DA 5ELYA 1FT7A 2CTCA 2GLFA 4F9VA 3PB7X 2G9DA 3KQZA 4Q7AA 5F09A 2ZEDA 3DGVA 3MRUA 1LAMA 3MN8A 1CPSA 1FNOA 2V8DA 4MHPA 4WWVA 2PJBA 3KASA 4R8FA 3H8GA 3H8EA 3ISZA 4IK2A 1TF9A 3PB4X 5IB9A 2GLJA 3I1UA 2Q51A 3SI0A 4AXVA 4ZY0A 2PCUA 4MMOA 2PJ7A 1TKHA 7CPAA 2O4HA 1XFOA 2VL1A 3B3CA 3D67A 3GB0A 4TNUA 1ZLHA 2OOTA 3WC6A 1VIXA 3FMCA 4NGPA 3PB6X 5JGFA 1UWYA 3FEEA 4P4BA 3NH5A 3BI0A 4UEEA 3KR5A 2QVPA 1F2PA 4YWYA 4G1PA 3IWWA 5D8NA 3FVLA 4Z65A 3SJXA 3D4UA 5K8NA 3FJUA 2PJAA 5THWA 4P4EA 2GREA 2QJ8A 1AYEA 3S9NA 5LRKA 1PCAA 3FH4A 3PFOA 2HC9A 4P44A 3PFEA 3TC8A 1YLOA 3K9TA 3WC5A 4MHZA 1BAVA 2WYRA 1HDQA 1Q7LA 4NGMA 2V8GA 1TXRA 5DS0A 4X3RA 1DE4C 3LWUA 2XEJA 1Z5RA 2PJ3A 3RAMA 3VATA 1XMBA 4P4IA 5CBMA 4CPAA 3IIBA 2ABZA 4MHNA 4PPZA 3LMSA 4OC3A 4OIDA 1DTDA 4P6YA 2ZEHA 2RB7A 3ISXA 4OP4A 1Y0RA 3KGQA 4MXUA 3WC7A 1IGBA 2PJ1A 1VHOA 2V8VA 4W9YA 4OIWA 2IQ6A 2WZNA 4OC4A 4MCSA 2C6GA 1CP7A 3QNVA 2ANPA 4ZX8A 3B35A 2PJ4A 3D66A 5HVFA 3SI2A 5HXDA 1VGYA 2PJ6A 4OMEA 2ZEGA 3CT9A 4P4FA 2CF4A 3NFZA 1YSJA 1ZG8A 3CPXA 4JYWA 4JZ0A 3FECA 4NJQA 2EK9A 1RTQA 5LRGA 4EFDA 1HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBE A;  3D7G A;  2PIY A;  4X8I A;  2ZEF A;  1ZG7 A;  2CTB A;  2F8H A;  2BO9 A;  1EE3 P;  2J9A A;  4ZY2 A;  4DUK A;  1AMP A;  4MCQ A;  2ZEO A;  3KHX A;  1BPN A;  4IAV A;  2ZOF A;  1HEE A;  3BI1 A;  3SJE A;  2JBK A;  5HVG A;  1TKF A;  2PJ2 A;  3KI9 A;  4UEZ A;  3PB9 X;  3KQX A;  1GYT A;  3FX6 A;  4F8Z A;  3SJF A;  4H2K A;  4P4J A;  5K8P A;  4RUH A;  1F57 A;  2CIJ A;  2AFM A;  2BCO A;  4R76 A;  3V38 A;  4O23 A;  2GU2 A;  2PJ9 A;  3HLP A;  3FF3 A;  4NFR A;  3S9L A;  2FVG A;  3B3T A;  4NGS A;  5JM6 A;  8CPA A;  1KWM A;  4OC1 A;  4R7M A;  1M4L A;  3GUX A;  4A37 A;  3CPA A;  1F2O A;  4ZI6 A;  4NGT A;  5I4M A;  2NSM A;  2C6C A;  5LYI A;  4ZX9 A;  1Z2L A;  3V7Z A;  1NSA A;  2Q43 A;  3NA6 A;  4FWU A;  1PYT B;  1XJO A;  3B2Y A;  3L2N A;  1LOK A;  4EME A;  2JEW A;  2AFX A;  5D29 A;  3B7I A;  1LFW A;  3WAB A;  4P4D A;  3VAR A;  1CG2 A;  3B3W A;  4PXC A;  4FBE A;  2PVV A;  1BLL E;  1TF8 A;  2PRQ A;  2HB6 A;  5K8M A;  3B3V A;  1XBU A;  2O53 A;  2AFU A;  3D7H A;  4PXE A;  1YW4 A;  3D68 A;  1IY7 A;  1ZG9 A;  4IHM A;  4MRI A;  2V77 A;  4R6T A;  3WT4 A;  4ONW A;  1OBR A;  1ARM A;  2AFO A;  4OC5 A;  4FAI A;  2XEG A;  1XRY A;  4TWE A;  2ZEN A;  4OC2 A;  1BPM A;  4UEF A;  3JRU A;  1Z8L A;  3SJG A;  4X2T A;  6CPA A;  3CDX A;  2XEF A;  2IMO A;  3PBB A;  2ZEP A;  4NJR A;  2C1C A;  3RZA A;  4P45 A;  3B3S A;  1R43 A;  4MCP A;  3DLJ A;  2C6P A;  4NGR A;  2PJC A;  2QYV A;  3FED A;  3HUV A;  4A38 A;  4ZYQ A;  4A94 A;  1ARL A;  1LCP A;  4A39 A;  3KHZ A;  2PJ5 A;  2XEI A;  5LRJ A;  2PE3 A;  2PVW A;  2BOA A;  3IC1 A;  5LYD A;  3PRT A;  1LAN A;  4NGQ A;  5CPA A;  2AFZ A;  4NGN A;  3TX8 A;  2ZEE A;  1H8L A;  1TKJ A;  2Q4Z A;  4FUU A;  4PQA A;  3N5F A;  3PEI A;  2OR4 A;  3KZW A;  2V8H A;  3KL9 A;  2IJZ A;  4EWT A;  5JH9 A;  4F9U A;  2DEA A;  1Y0Y A;  2ZEL A;  4YU9 A;  1CP6 A;  3NH8 A;  4GM5 A;  3IFE A;  4LQG A;  5LYF A;  3PB8 X;  1LAP A;  4ZY1 A;  5HVH A;  4UIB A;  4WJB A;  4BD9 A;  4K3N A;  5K8O A;  3T8W A;  2EK8 A;  1ZLI A;  3KR4 A;  2EWB A;  3S9M A;  4DYO A;  2RFH A;  3H8F A;  3IO1 A;  2PJ0 A;  1Y7E A;  2JBJ A;  2POK A;  2PJ8 A;  4MHY A;  4KSI A;  3BXM A;  3IJ3 A;  1YW6 A;  4DJL A;  1CPX A;  4OKO A;  2ZOG A;  4PXB A;  4B6Z A;  3K2K A;  2ZEM A;  3VH9 A;  4UF4 A;  3BHX A;  4MCR A;  3IEH A;  1ELL P;  3D7F A;  4UIA A;  1VHE A;  2F7V A;  2I3C A;  3NH4 A;  4OC0 A;  1YME A;  1R3N A;  1QQ9 A;  1QMU A;  2AFS A;  4PXD A;  3RBU A;  1ELM P;  2PIZ A;  5LYL A;  1JQG A;  3GLJ A;  2NYQ A;  1CX8 A;  1CBX A;  4P10 A;  2AFW A;  3SI1 A;  5J1Q A;  3D7D A;  5ELY A;  1FT7 A;  2CTC A;  2GLF A;  4F9V A;  3PB7 X;  2G9D A;  3KQZ A;  4Q7A A;  5F09 A;  2ZED A;  3DGV A;  3MRU A;  1LAM A;  3MN8 A;  1CPS A;  1FNO A;  2V8D A;  4MHP A;  4WWV A;  2PJB A;  3KAS A;  4R8F A;  3H8G A;  3H8E A;  3ISZ A;  4IK2 A;  1TF9 A;  3PB4 X;  5IB9 A;  2GLJ A;  3I1U A;  2Q51 A;  3SI0 A;  4AXV A;  4ZY0 A;  2PCU A;  4MMO A;  2PJ7 A;  1TKH A;  7CPA A;  2O4H A;  1XFO A;  2VL1 A;  3B3C A;  3D67 A;  3GB0 A;  4TNU A;  1ZLH A;  2OOT A;  3WC6 A;  1VIX A;  3FMC A;  4NGP A;  3PB6 X;  5JGF A;  1UWY A;  3FEE A;  4P4B A;  3NH5 A;  3BI0 A;  4UEE A;  3KR5 A;  2QVP A;  1F2P A;  4YWY A;  4G1P A;  3IWW A;  5D8N A;  3FVL A;  4Z65 A;  3SJX A;  3D4U A;  5K8N A;  3FJU A;  2PJA A;  5THW A;  4P4E A;  2GRE A;  2QJ8 A;  1AYE A;  3S9N A;  5LRK A;  1PCA A;  3FH4 A;  3PFO A;  2HC9 A;  4P44 A;  3PFE A;  3TC8 A;  1YLO A;  3K9T A;  3WC5 A;  4MHZ A;  1BAV A;  2WYR A;  1HDQ A;  1Q7L A;  4NGM A;  2V8G A;  1TXR A;  5DS0 A;  4X3R A;  1DE4 C;  3LWU A;  2XEJ A;  1Z5R A;  2PJ3 A;  3RAM A;  3VAT A;  1XMB A;  4P4I A;  5CBM A;  4CPA A;  3IIB A;  2ABZ A;  4MHN A;  4PPZ A;  3LMS A;  4OC3 A;  4OID A;  1DTD A;  4P6Y A;  2ZEH A;  2RB7 A;  3ISX A;  4OP4 A;  1Y0R A;  3KGQ A;  4MXU A;  3WC7 A;  1IGB A;  2PJ1 A;  1VHO A;  2V8V A;  4W9Y A;  4OIW A;  2IQ6 A;  2WZN A;  4OC4 A;  4MCS A;  2C6G A;  1CP7 A;  3QNV A;  2ANP A;  4ZX8 A;  3B35 A;  2PJ4 A;  3D66 A;  5HVF A;  3SI2 A;  5HXD A;  1VGY A;  2PJ6 A;  4OME A;  2ZEG A;  3CT9 A;  4P4F A;  2CF4 A;  3NFZ A;  1YSJ A;  1ZG8 A;  3CPX A;  4JYW A;  4JZ0 A;  3FEC A;  4NJQ A;  2EK9 A;  1RTQ A;  5LRG A;  4EFD A;  1HDU A; 
#chains in the Genus database with same CATH topology
 1YR0 A;  4HNX B;  2Z0Z A;  4XPD B;  3PBE A;  4UCM A;  3D7G A;  3NE7 A;  4Y49 C;  2PIY A;  4CGL A;  4NEX A;  4X8I A;  2ZEF A;  4A2Z A;  1XE4 A;  1YVK A;  1ZG7 A;  2CTB A;  3QAH A;  2QML A;  2J8R A;  1S7F A;  1N71 A;  3IGR A;  2F8H A;  2BO9 A;  1EE3 P;  2J9A A;  4ZY2 A;  4DUK A;  1AMP A;  3QB8 A;  4MCQ A;  4KVM E;  4NXY A;  3V8I A;  2ZEO A;  1U6M A;  3KHX A;  4YGO A;  3R95 A;  4BMH A;  4CGM A;  1BPN A;  1YRE A;  4IAV A;  2Z3K A;  2ZOF A;  1HEE A;  2PC1 A;  3BI1 A;  1YX0 A;  3SJE A;  3VWD A;  2JBK A;  4QB9 A;  5HVG A;  4UCP A;  1TKF A;  2YND A;  2PJ2 A;  5AGE A;  3KI9 A;  2Z3O A;  4U9Y A;  4M3S A;  4UEZ A;  4B5P A;  5H86 A;  4RS2 A;  3PB9 X;  4GS4 A;  4M6G A;  4CAV A;  3KQX A;  3I3G A;  1GYT A;  3D2P A;  3FX6 A;  2VEZ A;  2ZW7 A;  4H2K A;  3SJF A;  4F8Z A;  4P4J A;  3CXP A;  3P2F A;  4RUH A;  1F57 A;  5K8P A;  2CIJ A;  1M44 A;  4MHD A;  2AFM A;  2BCO A;  1NMT A;  4R76 A;  3V38 A;  4O23 A;  2CNM A;  2GU2 A;  2PJ9 A;  1ZO0 A;  3FF3 A;  3HLP A;  1XIX A;  2FVG A;  4NFR A;  4BBH A;  3S9L A;  3B3T A;  1IIC A;  4NGS A;  5JM6 A;  2BEI A;  1I21 A;  4F0X A;  3TO6 A;  5A28 A;  8CPA A;  1Q2D A;  3OWC A;  1KWM A;  4C2Y A;  4OC1 A;  4R7M A;  1M4L A;  3F5B A;  4U9Z A;  3GUX A;  2B5G B;  4A37 A;  1R57 A;  1CM0 A;  3TFY A;  3CPA A;  5G22 A;  1F2O A;  4L8A A;  4ZI6 A;  4NGT A;  5I4M A;  2NSM A;  1S7N A;  2C6C A;  4KS9 A;  4UFX A;  5LYI A;  4ZX9 A;  1Z2L A;  4CAF A;  2C27 A;  3V7Z A;  4A30 A;  2B4D B;  4YRH A;  1NSA A;  4CGP A;  2FE7 A;  5G20 A;  4L89 A;  2Q43 A;  1RO5 A;  2ZPA A;  3LAC A;  3NA6 A;  4FWU A;  1PYT B;  2J8N A;  1XJO A;  2FS5 A;  3GKR A;  4CRZ B;  1Z8X A;  3B2Y A;  3L2N A;  1LOK A;  1MK4 A;  5FVJ A;  5J8F A;  2GAN A;  4PK3 A;  2B4B A;  3FYN A;  4MFZ A;  4EME A;  4XPK A;  2JEW A;  2AFX A;  5D29 A;  3R1K A;  1XEB A;  4LUA A;  4LX9 A;  4OAD A;  5F47 A;  3B7I A;  3R96 A;  1LFW A;  2REE A;  3WAB A;  2WUU A;  4P4D A;  2OH1 A;  4MFK A;  3TO7 A;  1WK4 A;  3VAR A;  2I79 A;  1CG2 A;  3B3W A;  4PXC A;  4FBE A;  2PVV A;  1BLL E;  1SQH A;  4Y49 B;  5JQ4 A;  1TIQ A;  2JLM A;  3BJ8 A;  4XPL A;  1TF8 A;  5H84 A;  4AB7 A;  2PRQ A;  1Z8W A;  2HB6 A;  2CNT A;  5K8M A;  2Z10 A;  3B3V A;  4Q38 A;  1XBU A;  5AG4 A;  4KSA A;  3TT2 A;  2AJ6 A;  2ODF A;  3PGP A;  2O53 A;  3H5Z A;  3LOD A;  2AFU A;  3D7H A;  4PXE A;  1YW4 A;  5IV0 A;  2ZXV A;  1IOI A;  3D68 A;  3FBU A;  1IY7 A;  3SXO A;  2PR1 A;  4B13 A;  2R1I A;  1ZG9 A;  4IHM A;  3RYO A;  4C68 A;  5I0C A;  4MRI A;  1XF8 A;  1YLE A;  1ON0 A;  2V77 A;  4R6T A;  3WT4 A;  2JEV A;  2DPT A;  4KOS A;  4ONW A;  1OBR A;  2ZW5 A;  5DWN A;  1IYK A;  2OZG A;  3FIX A;  4B10 A;  1Y7R A;  1P0H A;  1KUY A;  2WSA A;  1ARM A;  3BJ7 A;  1VHS A;  4AVA A;  2AFO A;  4JXQ A;  4MBU A;  3SHP A;  1QSO A;  3TOA A;  4OC5 A;  1YQE A;  5EBV A;  1YK3 A;  4B11 A;  4FAI A;  2XEG A;  1XRY A;  4TWE A;  4RN7 A;  3JVN A;  2ZEN A;  1VKC A;  4OC2 A;  4KZT A;  4E0A A;  2B3U A;  4CS0 B;  1BPM A;  4UEF A;  3JRU A;  1Z8L A;  3SJG A;  4X2T A;  6CPA A;  2Q44 A;  3CDX A;  3FNC A;  2XEF A;  2IMO A;  4KLV A;  3PBB A;  4IUS A;  2ZEP A;  4NJR A;  2C1C A;  1QST A;  4C2X A;  4I49 A;  2Y0M A;  3RZA A;  2B3V A;  4M6I A;  4P45 A;  3B3S A;  1KZF A;  1R43 A;  2HUZ A;  2Q7S A;  4EVY A;  4MCP A;  1BO4 A;  3DLJ A;  4ONU A;  2C6P A;  4MJ8 A;  4B5P B;  4NGR A;  1QSR A;  2PJC A;  2QYV A;  3FED A;  3HUV A;  4NCZ A;  4A38 A;  4ZYQ A;  1M4D A;  4UFV A;  4A94 A;  1M4G A;  2G3T A;  5F48 A;  1ARL A;  1NE9 A;  3H4Q A;  1LCP A;  5DWM A;  4KOX A;  2AE6 A;  4KVO E;  2PQ8 A;  4A39 A;  3KHZ A;  1Q2C A;  5AG5 A;  2PJ5 A;  2Z3M A;  2XEI A;  5LRJ A;  3S6H A;  4F0Y A;  5BWA B;  2PE3 A;  2PVW A;  2BOA A;  1S7L A;  4ORF A;  3IC1 A;  5LYD A;  3PRT A;  1LAN A;  4U5Y A;  4NGQ A;  2D4P A;  5CPA A;  2HQY A;  2AFZ A;  3DR6 A;  4JWP A;  4NGN A;  3TX8 A;  2VZZ A;  2ZEE A;  1LRZ A;  3GIU A;  1H8L A;  1TKJ A;  2Q4Z A;  2Q4Y A;  4FUU A;  4PQA A;  3N5F A;  3K9U A;  2PSW A;  3PEI A;  4XNH C;  1M4I A;  2FCK A;  3GYA A;  4UCN A;  2OR4 A;  3ZZI A;  4YFJ A;  1FY7 A;  3KZW A;  2V8H A;  3KL9 A;  4B12 A;  3FRM A;  3QAY A;  5KTC A;  2IJZ A;  4EWT A;  5A27 A;  5JH9 A;  2VZY A;  4F9U A;  2DEA A;  4UA3 A;  3P2H A;  1Y0Y A;  2EO8 A;  2PDO A;  2ZEL A;  4YU9 A;  1CP6 A;  3NH8 A;  4CRY B;  2OZU A;  4MFJ A;  3UY5 A;  3KKW A;  4BIN A;  4GM5 A;  3IFE A;  1IOF A;  2EVN A;  4LQG A;  3PB8 X;  4HPS A;  1LAP A;  5LYF A;  4ZY1 A;  5HVH A;  1XOV A;  2R98 A;  1Z8T A;  4UIB A;  4WJB A;  4BD9 A;  4K3N A;  3W91 A;  5K8O A;  3T8W A;  2EK8 A;  4HNW B;  4A95 A;  1ZLI A;  4UFW A;  2YNC A;  3KR4 A;  2EWB A;  3JUW A;  3S9M A;  4DYO A;  4C7H A;  2VQY A;  2RFH A;  4KOY A;  3H8F A;  4AVC A;  4AG9 A;  3EFA A;  4FD4 A;  4JD6 A;  3IO1 A;  3BLN A;  2PJ0 A;  2Z3P A;  3F0A A;  1Y7E A;  2CY2 A;  2H5M A;  4RI1 A;  2JBJ A;  2POK A;  3VWE A;  5J8C A;  4X5K A;  2QEC A;  2D4O A;  1MJB A;  3MGD A;  2Z3N A;  4UBR A;  2PJ8 A;  4MHY A;  4KSI A;  4KVX A;  3R9E A;  3BXM A;  3IJ3 A;  1YW6 A;  4DJL A;  1B87 A;  2YNC C;  1S3Z A;  1CPX A;  4OKO A;  2ZOG A;  4PXB A;  4ZBG A;  2DF5 A;  4B6Z A;  2VXK A;  2ZEM A;  3K2K A;  4IF5 A;  5AG7 A;  2X7B A;  3VH9 A;  1X10 A;  2Q0Y A;  4UF4 A;  3BHX A;  4MCR A;  3EY5 A;  3IEH A;  1ELL P;  5EMI A;  5JPH A;  3S6K A;  3D7F A;  4UIA A;  1VHE A;  2F7V A;  2I3C A;  3NH4 A;  4H89 A;  4MY0 A;  2CXA A;  4Q36 A;  4OC0 A;  2BUE A;  4M85 A;  3W6X A;  5IB0 A;  3WR7 A;  3JTK A;  4B14 A;  2O28 A;  1YME A;  1R3N A;  4DNC A;  1QQ9 A;  4AVB A;  1QMU A;  2AFS A;  2EUI A;  5HMN A;  4PXD A;  3RBU A;  2G0B A;  2PRB A;  4CYN A;  3DNS A;  1Z9U A;  2Q7B A;  1ELM P;  2PIZ A;  3D2M A;  3NE8 A;  1NSL A;  5C82 A;  5LYL A;  4QUS A;  1JQG A;  4PV6 A;  3EO4 A;  3N7Z A;  1CJW A;  3GLJ A;  2GE3 A;  2NYQ A;  1CX8 A;  2WPW A;  1CBX A;  1RXT A;  4P10 A;  1S5K A;  2AFW A;  5EC4 A;  3SI1 A;  5J1Q A;  1L0C A;  3D7D A;  5ELY A;  1FT7 A;  2CTC A;  2GLF A;  3TCV A;  4FD6 A;  3F8K A;  3PZJ A;  4JJX A;  4F9V A;  4OAE A;  2ZW6 A;  3PB7 X;  2G9D A;  1S60 A;  3KQZ A;  3B8G A;  4Q7A A;  3C26 A;  5F09 A;  4II9 A;  1V0C A;  2REF A;  2ZED A;  1I1D A;  4XNH B;  1P4N A;  3DGV A;  3MRU A;  1MJA A;  2F5I A;  4KOR A;  1LAM A;  4KLW A;  4KSF A;  4R3K A;  3MN8 A;  2EBJ A;  1B6B A;  1QSN A;  1CPS A;  2HV2 A;  2JDD A;  1FNO A;  4A33 A;  3TO9 A;  2V8D A;  2P6E A;  3G3S A;  3RNZ A;  4MHP A;  2BSW A;  3DDD A;  1JWQ A;  2PJB A;  3KAS A;  4MFQ A;  4R8F A;  4WWV A;  3H8G A;  3H8E A;  3G8W A;  1IYL A;  5IX3 A;  3TE4 A;  3EC4 A;  3ISZ A;  4JLY A;  2YGW A;  1WWZ A;  3IU1 A;  3FXT A;  4CYP A;  4QVT A;  5GCN A;  1MJ9 A;  2PR8 A;  4IK2 A;  1TF9 A;  1KUX A;  3PB4 X;  5IB9 A;  2ZW4 A;  3R9G A;  3DSB A;  2IL4 A;  4MFP A;  2GLJ A;  3I1U A;  2Q51 A;  3SI0 A;  3E0K A;  4AXV A;  4ZY0 A;  4E8O A;  2FSR A;  2PCU A;  4MMO A;  5ISV A;  2PJ7 A;  2KCW A;  3T90 A;  4A32 A;  4J3G A;  1PUA A;  3PP9 A;  1Q2Y A;  1TKH A;  4C2Z A;  3I9S A;  2O4H A;  1XFO A;  2VL1 A;  3B3C A;  3D67 A;  7CPA A;  1PU9 A;  3GB0 A;  4UWJ A;  2RC4 A;  2P6G A;  4TNU A;  1ZLH A;  4CAE A;  4CYQ A;  2Z11 A;  4JXR A;  2OOT A;  3WC6 A;  4FD7 A;  1VIX A;  4H6U A;  4CGN A;  3FMC A;  4NGP A;  3FB3 A;  4KOV A;  3IWE A;  4MY3 A;  3PB6 X;  4KUB A;  5JGF A;  4ZGY B;  1UWY A;  1S7K A;  3FEE A;  3NH5 A;  4P4B A;  3R9F A;  3BI0 A;  3A9L A;  4UEE A;  2Q4V A;  2R7H A;  2DPS A;  3KR5 A;  2QVP A;  1F2P A;  4HNY B;  4XPD C;  4YWY A;  3DR8 A;  4R9M A;  4G1P A;  3IWW A;  2FIA A;  4UWI A;  5D8N A;  3FVL A;  4PSW A;  4Z65 A;  3SJX A;  3SXN A;  3D4U A;  5CBM A;  5K8N A;  3FJU A;  5KTD A;  4K30 A;  2PJA A;  5THW A;  4AG7 A;  2QIR A;  4P4E A;  4FD5 A;  5AG6 A;  2GRE A;  2QJ8 A;  5F49 A;  1AYE A;  2FIW A;  1IU8 A;  3IWG A;  3S9N A;  1IB1 E;  4E2A A;  3CXQ A;  5LRK A;  1PCA A;  1Z4R A;  3D3S A;  3FH4 A;  2OZH A;  3PFO A;  2ARH A;  4KUA A;  1GHE A;  4PSX A;  3TTH A;  2HC9 A;  4QC6 A;  5KTA A;  3W6S A;  4P44 A;  3PFE A;  4H6Z A;  3TC8 A;  2Z3L A;  3TOB A;  1YLO A;  4QBJ A;  3K9T A;  1KUV A;  4KOT A;  3WC5 A;  4MHZ A;  4B5O A;  2FXF A;  1BAV A;  2VI7 A;  1Y9W A;  1HDQ A;  2VBQ A;  2WYR A;  1IID A;  4CAW A;  3CXS A;  1Q7L A;  4NGM A;  1Y9K A;  2V8G A;  1TXR A;  5CNP A;  5DS0 A;  4X3R A;  1DE4 C;  3LWU A;  2Q04 A;  2XEJ A;  4GXH A;  4R57 A;  4OLL A;  1Z5R A;  2PJ3 A;  3RAM A;  4F6A A;  2B5G A;  4KOW A;  3VAT A;  2OB0 A;  1XMB A;  2A4N A;  1AUG A;  3CZX A;  3IIB A;  2ABZ A;  3IU2 A;  4P4I A;  4C7I A;  4CPA A;  4MHN A;  4PPZ A;  2P0W A;  3LMS A;  4HKF A;  4OC3 A;  2I00 A;  1I12 A;  4MI4 A;  2GIV A;  4OID A;  4PK2 A;  4R87 A;  3GY9 A;  1DTD A;  1Z4E A;  2B4D A;  1J4J A;  2RB7 A;  2ZEH A;  3EXN A;  3ISX A;  4P6Y A;  2ATR A;  1Y0R A;  3KGQ A;  4MXU A;  4OP4 A;  1IGB A;  3WC7 A;  2PJ1 A;  1VHO A;  1BOB A;  2V8V A;  4W9Y A;  4OIW A;  2P6F A;  2IQ6 A;  2WZN A;  4OC4 A;  4CGO A;  2B58 A;  2K5T A;  4MCS A;  4CAX A;  5E96 A;  5C88 A;  2JDC A;  2C6G A;  1CP7 A;  5G1Z A;  2NMT A;  3QNV A;  4MFL A;  3T9Y A;  2ANP A;  2FT0 A;  1OZP A;  4ZX8 A;  1K4J A;  1UFH A;  3B35 A;  3LD2 A;  2BL1 A;  2PJ4 A;  3D66 A;  5HVF A;  3SI2 A;  5HXD A;  1VGY A;  2CNS A;  2PJ6 A;  4M6H A;  2G3A A;  1YVO A;  5F46 A;  1M1D A;  2DXQ A;  4NSQ A;  1XMT A;  4OME A;  5HH1 A;  4KOU A;  2ZEG A;  2R8V A;  3CT9 A;  4P4F A;  2CF4 A;  3NFZ A;  2YNE A;  4LQ6 A;  1YSJ A;  1ZG8 A;  2GFQ A;  3D8P A;  3CPX A;  4JYW A;  4JZ0 A;  1X12 A;  3FEC A;  4R3L A;  3ZJ0 A;  4NJQ A;  2WPX A;  4CYO A;  5G21 A;  3S6F A;  2EK9 A;  2FL4 A;  4A31 A;  1A2Z A;  2OU2 A;  1RTQ A;  5LRG A;  3RO0 A;  1QSM A;  1YGH A;  3S6G A;  4EFD A;  2J8M A;  1HDU A;  4NF1 A; 
#chains in the Genus database with same CATH homology
 3PBE A;  3D7G A;  2PIY A;  4X8I A;  2ZEF A;  1ZG7 A;  2CTB A;  2F8H A;  2BO9 A;  1EE3 P;  2J9A A;  4ZY2 A;  4DUK A;  1AMP A;  4MCQ A;  2ZEO A;  3KHX A;  1BPN A;  4IAV A;  2ZOF A;  1HEE A;  3BI1 A;  3SJE A;  2JBK A;  5HVG A;  1TKF A;  2PJ2 A;  3KI9 A;  4UEZ A;  3PB9 X;  3KQX A;  1GYT A;  3FX6 A;  4F8Z A;  3SJF A;  4H2K A;  4P4J A;  5K8P A;  4RUH A;  1F57 A;  2CIJ A;  2AFM A;  2BCO A;  4R76 A;  3V38 A;  4O23 A;  2GU2 A;  2PJ9 A;  3HLP A;  3FF3 A;  4NFR A;  3S9L A;  2FVG A;  3B3T A;  4NGS A;  5JM6 A;  8CPA A;  1KWM A;  4OC1 A;  4R7M A;  1M4L A;  3GUX A;  4A37 A;  3CPA A;  1F2O A;  4ZI6 A;  4NGT A;  5I4M A;  2NSM A;  2C6C A;  5LYI A;  4ZX9 A;  1Z2L A;  3V7Z A;  1NSA A;  2Q43 A;  3NA6 A;  4FWU A;  1PYT B;  1XJO A;  3B2Y A;  3L2N A;  1LOK A;  4EME A;  2JEW A;  2AFX A;  5D29 A;  3B7I A;  1LFW A;  3WAB A;  4P4D A;  3VAR A;  1CG2 A;  3B3W A;  4PXC A;  4FBE A;  2PVV A;  1BLL E;  1TF8 A;  2PRQ A;  2HB6 A;  5K8M A;  3B3V A;  1XBU A;  2O53 A;  2AFU A;  3D7H A;  4PXE A;  1YW4 A;  3D68 A;  1IY7 A;  1ZG9 A;  4IHM A;  4MRI A;  2V77 A;  4R6T A;  3WT4 A;  4ONW A;  1OBR A;  1ARM A;  2AFO A;  4OC5 A;  4FAI A;  2XEG A;  1XRY A;  4TWE A;  2ZEN A;  4OC2 A;  1BPM A;  4UEF A;  3JRU A;  1Z8L A;  3SJG A;  4X2T A;  6CPA A;  3CDX A;  2XEF A;  2IMO A;  3PBB A;  2ZEP A;  4NJR A;  2C1C A;  3RZA A;  4P45 A;  3B3S A;  1R43 A;  4MCP A;  3DLJ A;  2C6P A;  4NGR A;  2PJC A;  2QYV A;  3FED A;  3HUV A;  4A38 A;  4ZYQ A;  4A94 A;  1ARL A;  1LCP A;  4A39 A;  3KHZ A;  2PJ5 A;  2XEI A;  5LRJ A;  2PE3 A;  2PVW A;  2BOA A;  3IC1 A;  5LYD A;  3PRT A;  1LAN A;  4NGQ A;  5CPA A;  2AFZ A;  4NGN A;  3TX8 A;  2ZEE A;  1H8L A;  1TKJ A;  2Q4Z A;  4FUU A;  4PQA A;  3N5F A;  3PEI A;  2OR4 A;  3KZW A;  2V8H A;  3KL9 A;  2IJZ A;  4EWT A;  5JH9 A;  4F9U A;  2DEA A;  1Y0Y A;  2ZEL A;  4YU9 A;  1CP6 A;  3NH8 A;  4GM5 A;  3IFE A;  4LQG A;  5LYF A;  3PB8 X;  1LAP A;  4ZY1 A;  5HVH A;  4UIB A;  4WJB A;  4BD9 A;  4K3N A;  5K8O A;  3T8W A;  2EK8 A;  1ZLI A;  3KR4 A;  2EWB A;  3S9M A;  4DYO A;  2RFH A;  3H8F A;  3IO1 A;  2PJ0 A;  1Y7E A;  2JBJ A;  2POK A;  2PJ8 A;  4MHY A;  4KSI A;  3BXM A;  3IJ3 A;  1YW6 A;  4DJL A;  1CPX A;  4OKO A;  2ZOG A;  4PXB A;  4B6Z A;  3K2K A;  2ZEM A;  3VH9 A;  4UF4 A;  3BHX A;  4MCR A;  3IEH A;  1ELL P;  3D7F A;  4UIA A;  1VHE A;  2F7V A;  2I3C A;  3NH4 A;  4OC0 A;  1YME A;  1R3N A;  1QQ9 A;  1QMU A;  2AFS A;  4PXD A;  3RBU A;  1ELM P;  2PIZ A;  5LYL A;  1JQG A;  3GLJ A;  2NYQ A;  1CX8 A;  1CBX A;  4P10 A;  2AFW A;  3SI1 A;  5J1Q A;  3D7D A;  5ELY A;  1FT7 A;  2CTC A;  2GLF A;  4F9V A;  3PB7 X;  2G9D A;  3KQZ A;  4Q7A A;  5F09 A;  2ZED A;  3DGV A;  3MRU A;  1LAM A;  3MN8 A;  1CPS A;  1FNO A;  2V8D A;  4MHP A;  4WWV A;  2PJB A;  3KAS A;  4R8F A;  3H8G A;  3H8E A;  3ISZ A;  4IK2 A;  1TF9 A;  3PB4 X;  5IB9 A;  2GLJ A;  3I1U A;  2Q51 A;  3SI0 A;  4AXV A;  4ZY0 A;  2PCU A;  4MMO A;  2PJ7 A;  1TKH A;  7CPA A;  2O4H A;  1XFO A;  2VL1 A;  3B3C A;  3D67 A;  3GB0 A;  4TNU A;  1ZLH A;  2OOT A;  3WC6 A;  1VIX A;  3FMC A;  4NGP A;  3PB6 X;  5JGF A;  1UWY A;  3FEE A;  4P4B A;  3NH5 A;  3BI0 A;  4UEE A;  3KR5 A;  2QVP A;  1F2P A;  4YWY A;  4G1P A;  3IWW A;  5D8N A;  3FVL A;  4Z65 A;  3SJX A;  3D4U A;  5K8N A;  3FJU A;  2PJA A;  5THW A;  4P4E A;  2GRE A;  2QJ8 A;  1AYE A;  3S9N A;  5LRK A;  1PCA A;  3FH4 A;  3PFO A;  2HC9 A;  4P44 A;  3PFE A;  3TC8 A;  1YLO A;  3K9T A;  3WC5 A;  4MHZ A;  1BAV A;  2WYR A;  1HDQ A;  1Q7L A;  4NGM A;  2V8G A;  1TXR A;  5DS0 A;  4X3R A;  1DE4 C;  3LWU A;  2XEJ A;  1Z5R A;  2PJ3 A;  3RAM A;  3VAT A;  1XMB A;  4P4I A;  5CBM A;  4CPA A;  3IIB A;  2ABZ A;  4MHN A;  4PPZ A;  3LMS A;  4OC3 A;  4OID A;  1DTD A;  4P6Y A;  2ZEH A;  2RB7 A;  3ISX A;  4OP4 A;  1Y0R A;  3KGQ A;  4MXU A;  3WC7 A;  1IGB A;  2PJ1 A;  1VHO A;  2V8V A;  4W9Y A;  4OIW A;  2IQ6 A;  2WZN A;  4OC4 A;  4MCS A;  2C6G A;  1CP7 A;  3QNV A;  2ANP A;  4ZX8 A;  3B35 A;  2PJ4 A;  3D66 A;  5HVF A;  3SI2 A;  5HXD A;  1VGY A;  2PJ6 A;  4OME A;  2ZEG A;  3CT9 A;  4P4F A;  2CF4 A;  3NFZ A;  1YSJ A;  1ZG8 A;  3CPX A;  4JYW A;  4JZ0 A;  3FEC A;  4NJQ A;  2EK9 A;  1RTQ A;  5LRG A;  4EFD A;  1HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...