1TKKA

The structure of a substrate-liganded complex of the l-ala-d/l-glu epimerase from bacillus subtilis
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
359
structure length
359
Chain Sequence
MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVITGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYRDTLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAGLGIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGITYSGSTISMPGKPGLGIIGAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Enolase Superfamily: Structure of a Substrate-Liganded Complex of the l-Ala-d/l-Glu Epimerase from Bacillus subtilis(,).
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords similar to chloromuconate cycloisomerase
total genus 131
structure length 359
sequence length 359
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1tkkA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1tkkA01
1MRAA 1F9CA 3JVAA 4KPLA 2PP3A 4IT1A 2AKZA 3DG3A 2PP0A 3DG6A 3NO1A 3N6HA 3MQTA 3UJEA 3U4FA 7ENLA 2PMQA 1XPYA 3OZYA 3CXOA 2PSNA 4ZA0A 3P0WA 5ENLA 4E8GA 4DYEA 4H2HA 2O56A 4K1WA 3R1ZA 1EC7A 3P3BA 4JN8A 2OQHA 3TWBA 3UCCA 4DHGA 3ZVHB 4HNCA 4A3RA 3BJSA 3SN0A 3VFCA 2PCEA 3NZGA 1FHVA 4HCHA 3PFRA 3GY1A 3ENLA 2HXUA 4GGHA 2PGWA 3QLDA 2PS2A 3CT2A 5BOEA 4MGGA 3SBFA 2QJNA 4GISA 2AKMA 1KCZA 3CK5A 3VA8A 4G8TA 3H12A 2ZC8A 2OZTA 2XH7A 4ENLA 3VDGA 1R6WA 2QDDA 4KEMA 1JPDX 3R10A 4DXKA 2POZA 3DFHA 4K2SA 4IHCA 5EU9A 3SN1A 4GIRA 3SQSA 1JPMA 4G7FA 1PDZA 4E5TA 3S47A 4IP4A 2OZ8A 2GGIA 3GC2A 5FJOA 1ECQA 2FYMA 3RITA 1KKRA 3SJNA 2GGGA 3R25A 3DDMA 1JDFA 3N6JA 4YWSA 4DN1A 1TE6A 1JCTA 3H70A 2PU1A 4M0XA 3TQPA 3NFUA 1E9IA 2PTXA 3I6EA 3THUA 3OP2A 3R0UA 4ROPA 4MMWA 3TCSA 1NELA 2P3ZA 3RRAA 4M6UA 3RGTA 2HXTA 4E4UA 2PP1A 2PPGA 3TOYA 4HYRA 3T4WA 1NU5A 2DW6A 3CAWA 3ES7A 4GGBA 3IK4A 2RDXA 3IJIA 3K1GA 3TW9A 1EC8A 3OZMA 3UJSA 4K8GA 4IZGA 2XSXA 4IL2A 3EEZA 1EBHA 3UCDA 2GSHA 3MZNA 5J04A 3DIPA 3DERA 2OQYA 3FCPA 2PTZA 3S5SA 3IJLA 4KT2A 1DTNA 2DW7A 4H1ZA 2QJJA 3V4BA 3ES8A 3V5FA 4FP1A 3FYYA 2OLAA 4J3ZA 2OG9A 3VC5A 1RVKA 3MSYA 3H7VA 4IL0A 1R0MA 2AL2B 1BQGA 1MDRA 3SSZA 1EC9A 2HZGA 1BKHA 3OTRA 3RO6A 3UXKA 1FHUA 4H83A 1SJCA 5FJRA 3OW1A 3VC6A 1P43A 3CB3A 2QGYA 3MY9A 4F4RA 1W6TA 2XH2A 2NQLA 3PK7A 4A6GA 2OO6A 3RR1A 1IYXA 4JHMA 3TJ4A 1KKOA 4HCDA 3QTPA 3N4EA 4IP5A 2OPJA 3SN4A 5IDZA 3FVDA 3ZVHA 3MUCA 3V5CA 3T6CA 3TTEA 2QJMA 2P88A 3ZLHA 3P93A 1MNSA 3UJFA 4E6MA 1YEYA 5FJPA 1KD0A 3I4KA 3N4FA 3FV9A 1ONEA 2GDQA 1XS2A 2PTYA 4EWJA 1TZZA 3DESA 2AL1A 1EBGA 4MKSA 2PODA 3PWGA 3GD6A 2FKPA 2PGEA 3CYJA 3DEQA 4E4FA 1SJDA 2GL5A 3EKGA 2GGHA 3FJ4A 4GMEA 4FI4A 3BSMA 4Z17A 1WUEA 3I6TA 3DFYA 5FJUA 4HCLA 2P0IA 3R0KA 3OPSA 1TKKA 3ZLGA 3D46A 2ZADA 2OZ3A 3UXLA 3STPA 5BOFA 3Q45A 3TJIA 2CHRA 3T8QA 3UJ2A 6ENLA 2MUCA 2P8CA 3GO2A 3JW7A 4GYPC 1P48A 2HNEA 3ZLFA 4Z1YA 2OVLA 4HN8A 3BOXA 4HNLA 4J1OA 4GYPA 3KUMA 2AL2A 3T9PA 2I5QA 3NXLA 4A35A 1PDYA 3H8AA 4KWSA 4GFIA 3MWCA 1SJAA 2PTWA 1SJBA 3DG7A 3UGVA 3JZUA 2MNRA 3R11A 3D47A 3HPFA 2GGEA 2QQ6A 2PU0A 3VCCA 1OEPA 3Q4DA 2OKTA 2ONEA 4JN7A 3MKCA 2XGZA 3PWIA 1ELSA 2PA6A 2OX4A 4X2PA 4DX3A 4HPNA 2OFJA 3RCYA 2QVHA 3DGBA 1WUFA 3FXGA 4H19A 3B97A 5FJTA 2XH4A 3VCNA 1MUCA 2QDEA 4ZCWA 1MDLA 4DWDA 3IJQA 1L8PA 2GGJA 3ZVIA 2XH0A 3TWAA 3QKEA 3V3WA 3QPEA 3U9IA 3UJRA 3QN3A 2P8BA
chains in the Genus database with same CATH superfamily
4P7OA 4WGHA 3LENA 4H6RA 4H41A 1TPDA 3TSDA 2F7FA 3JUGA 3G0UA 4ONVA 4JTTA 3VXGA 4GH3A 1S5MA 3B05A 3EDKA 4G6CA 2H6RA 2A3HA 2I1OA 1VS1A 3TXZA 4BF9A 1DWFM 2DFAA 3NSMA 4JPGA 1J5SA 3V0SA 2XG9A 2FGZA 2NX3A 4FOUA 1EJSC 2Q02A 2QJGA 3GH7A 3QQ0A 3LTYA 2O56A 3R1ZA 4QG6A 1E6QM 3W74A 4JN8A 2YXXA 4DUXA 3I4EA 4E2DA 4NU7A 1S5TA 2BS9A 1PEZA 1QW7A 4KWUA 1TPUA 2QUUA 4XTIA 4LQ1A 1Q6LA 2X41A 2B7OA 3S42A 1XDJA 3A5VA 3E1F1 3TR9A 4DZAA 4NY2A 2WPGA 1H63A 3O6CA 1WX0A 4GVIA 3CC1A 4UB9A 4F2UA 4DBUA 4AF0A 1O5RA 3UNTA 2OEMA 3RU8X 1CXFA 1VFFA 3CU2A 2OYMA 5IOBA 1GUVA 1OVDA 2EBNA 5A8QA 4JS3A 4B3ZA 1XH1A 4A2RA 4G8TA 4XZBA 1NDVA 3TQKA 1BVZA 4UQCA 1EGVA 3T44A 2NZLA 5D9PA 4A3QA 4LCSA 1VH7A 2HDJA 3BTNA 1W3JA 4H9TA 1ZGDA 1XD0A 3OQ8A 2ZUMA 3MCMA 1TV3A 2DT1A 3VE7A 4B2DA 3VYLA 5B7YA 2OO0A 5CGTA 4AD1A 4QSHA 2PF8A 3K8LA 5C2XA 1EF3A 4O1FA 3EPNA 3HGJA 1RPKA 4QDMA 1TJ1A 1D9EA 4HA0A 1FQ0A 3GXNA 5HMEA 3EWYA 3P14A 4LUTA 3REQA 4LGXA 4PL1A 2YBVA 1O60A 5FS8A 4QQ3A 2VFFA 1QAPA 1K8CA 4ZE4A 4UQBA 4F2BA 5KITA 2R1LA 4Z2KA 1GRFA 1Q6EA 1ECEA 2Z2UA 1YQ2A 4CN4A 2GQAA 4MDPA 3GNOA 1LQ2A 3UERA 5LKYA 3GAKA 2UY5A 5E9AA 1TYPA 4WKHA 2DZAA 3MUXA 4GJ1A 5C6MA 4KRTA 1BXCA 1AMKA 3BK0A 4IUGA 5HJXA 2HVNA 4HD5A 1XDMA 4L65A 1ADOA 5D04C 4RNIA 1W5QA 4A05A 2WW5A 3FSTA 2J66A 2J7EA 3BURA 3WDPP 5CAKA 1OFDA 1UWRA 3B0XA 4Q33A 3NAVA 1TRIA 1XBYA 1ZJBA 2CW6A 1XBVA 3AYSA 4JKKA 1AOGA 1EWEA 3A4XA 3TIMA 3NR0A 3ARYA 4JYFA 4HOWA 1E40A 3VC5A 4PULA 1SR0A 4FF5A 4Q4OA 1R0MA 2AL2B 4H9YA 3VZZA 3U7VA 1SZNA 2OSXA 4DZ5A 3WQPA 1VP5A 5FS7A 1K6WA 4MADA 4C7DA 1F8WA 2QCEA 4RX0A 1BRLA 1W5PA 4RLIA 3SUTA 4JDBA 1GETA 3IJ7A 4PN2A 3ZJ6A 3S2CA 2XIQA 4L80A 2A8XA 1F3WA 3LPFA 1A5OC 5LZLA 4PUJA 2ANUA 2GK1B 1Z89A 1KKOA 3VGDA 4HNTA 3DYMA 1AQHA 4AD5A 4MWAC 3N2TA 2NQHA 3TTEA 3QZEA 3N19B 4IJRA 2V63A 4KCWA 1T40A 3MYPA 3B0UX 1K7FA 1TVPA 3VDAA 1JRPA 3B8IA 1FFQA 3B9EA 3EZ4A 2A3LA 3GBEA 1DQUA 1YYAA 2WV8A 1XANA 3LI0A 1W1TA 5DRIA 2V9DA 5J5DA 3PBGA 1IWBA 1WXJA 1K9TA 1QNRA 4RZ6A 4B16A 3BDKA 2WSYA 3GD6A 1BLIA 4GK8A 1TR1A 2CWXA 3URQA 1Z48A 3NQVA 3ARSA 1F6YA 4WCJA 4A3UA 2G95A 3NOEA 4GUJA 2WMHA 2P0OA 5DELA 5D9MA 2CNCA 3EDDA 1OG0A 2DV0A 1PBGA 4DO5A 3LQGA 4GH1A 2KAUC 3UR5A 5BOFA 3UWVA 5JUVA 3Q45A 5LNWA 3G1RA 3UR2A 4S3JA 1E15A 3F4VA 1G1YA 1U22A 4QIUA 2GR0A 1CLKA 1P48A 1REQB 3WNLA 1OCBA 1XLHA 4Z1YA 1FO4A 4AFYA 1EEPA 1PTDA 2X1IA 2F84A 2W9MA 4AW7A 3AUJA 2XVPA 1RK5A 2I5QA 2WWDA 2A79A 3MWCA 1RP8A 4Z2LA 1J96A 5CZJA 3EB2A 4L4PA 4X3ZA 2BFGA 4O4VA 1OC6A 4ZQOA 1D3HA 5C7HA 2X99A 1KTBA 1W5NA 2DSVA 7REQA 4IGSA 2F8QA 2WM0A 3TLQA 3PJXA 2OFJA 3FJLA 4FX6M 7PTDA 3DGRA 3W01A 1LOSA 3AN1A 3FXGA 1EXBA 5LNVA 2BXYA 4X0VA 4D6CA 1DJQA 4QE4A 3GDKA 1UP0A 1L6FA 3GBDA 2Z1KA 1N60C 5HNTA 3NS1B 3VGGA 3HN3A 1XRFA 1GJWA 1HL8A 2BVWA 1UOZA 1N8IA 1SZGA 2ON3A 4ZB0A 4HN4A 4J7RA 3M5ZA 4L1GA 4ZXOA 3EBVA 3GNNA 5TQLA 4CQDA 3WD2A 1O94A 5HJLA 1NARA 3R94A 3DFOA 3WLHA 3MQTA 4C6MA 4PC8A 1Z8AA 5REQA 2W4XA 3WUFA 2NT1A 2B7QA 5LA0A 1EC7A 1YADA 4GC3A 1FH7A 4LS2A 2BZNA 3AIQA 3VKCA 2CPUA 2XVLA 4CNOA 1QNVA 3U5UA 4J3WA 3M0XA 3R5EA 2E1DA 1ZBCA 4L9ZA 5C9UA 3AIVA 1K9DA 2E77A 3ECQA 3ENLA 5LIXX 3U57A 3QC0A 1VPYA 1QVBA 1GRTA 2VX5A 3WSUA 1GTHA 1MI3A 3VIGA 4W8BA 5BCAA 1TPWA 3ITCA 4OOZA 1BRLB 1O95A 4FOKA 3ARTA 3N2OA 3AWNA 3CK5A 3DOPA 1H7OA 4K8EA 4LRTA 4Z08A 3CEUA 1M41A 2WPBA 4AZCB 1XCWA 1YTDA 4LY8A 2DGAA 1ZS2A 1R6WA 3RILA 4DM1A 1PSCA 1KFCA 1XYCA 2PB1A 1GVEA 1UUQA 3USZA 4D8LA 1T6MA 1Y0EA 3DXIA 3MKKA 4QTGA 3T81A 3ZJ7A 5AHLA 5C7VA 1DJNA 2HNHA 1XUZA 3HMCA 3OQEA 3B9AA 2D0HA 3N4AA 1IXPA 1YXCA 1VPXA 4EMWA 4HK6A 3MZ2A 1ITUA 1TX0A 1H2JA 3BSGA 5I79A 4CD4A 3KLKA 2F2HA 1VC4A 2Y85A 1XIHA 3POHA 3V1HA 3ANVA 3L2LA 2UV8G 2HXTA 2P76A 4JQ9A 5AECA 3SUVA 3CBWA 4QITA 1KV5A 1R3WA 3HZ3A 2PDUA 2NSXA 4D8ZA 3SCNA 2E67A 1X6UA 2GUYA 4K8GA 1ZCCA 3RMEA 3WD3A 4CKQA 4YYFA 1B3ZA 4CGTA 4JX5A 4Q7BA 3JR2A 2NUWA 2J74A 3FKRA 1QNPA 2DH3A 1HP5A 5A1AA 1SZEA 3IJ8A 5I3KA 5J04A 4XD3A 1OC5A 1DJHA 2ZUNA 4PL2A 4FNSA 3RPDA 1MQRA 1P7TB 4MY1A 4HPHA 3P0XA 4NZ1A 4W8AA 3OG3A 4JZ5A 3S9IA 2BLEA 3A64A 5GRTA 2DW7A 3ARRA 5IDIA 5FAGA 4H7ZA 5EBUA 4CD6A 1BWKA 4LALA 3T09A 1KTCA 2WQDA 1YBQB 1TPVA 2I57A 5G4WA 1FDJA 4XAZA 1FWEC 5EMYA 4J5NA 3L65A 3Q58A 5JXQA 3C2RA 2HS6A 1R85A 4PYSA 1RV8A 4LAUA 5AYIA 3N1AA 3IC9A 3CPGA 4GZIA 2ZBTA 3MSYA 3BE7A 1JGMA 3SSZA 2YBUA 1EC9A 4OUIA 3MBFA 2OT0A 1NOFA 2BDQA 4Z0SA 3W7JA 4H4ZA 1TJ2A 5I3IA 1ZENA 4C6EA 4FLOA 3L4ZA 1ICQA 3KRUA 2E3TA 4Z1AA 4GVFA 5LA2A 2UBPC 1US3A 3IGSA 1A3HA 4N4PA 3MY9A 1OT1A 3L12A 2FTYA 4DXXA 4EXAA 3NDOA 4MY9A 5JH2A 4AZHA 2IMRA 1RM6B 3KFTA 4JHMA 1Q6CA 4OTKA 4IP5A 1RY8A 1VCFA 5HUOA 1OK6A 2ZRYA 3EMZA 1F8MA 2I14A 5A69A 4ZO6A 3VOFA 1D7YA 3TTQA 2NVCA 4XWUA 3HF3A 1CXKA 2G4FA 2V5CA 3N34A 5FJPA 3GU1A 2WCAA 1XM3A 3N4FA 4ZBCA 4AXNA 2PDXA 3WJSA 4DWSB 2DUAA 1N61C 1V51A 1M7JA 1A5MC 4HJFA 4LFYA 1VYPX 4QJ1A 2PDBA 3NQEA 5AC7A 1TMQA 1PB0A 1F05A 1G4EA 2BY2A 3OGSA 4CNPA 5AVHA 1PHQA 1YPXA 1A0EA 3E49A 3EB4A 3ANYA 3L67A 4HMDA 2D24A 5GNZA 5EY5A 3EA1A 5CPNA 2QLYA 1X2HA 2D2OA 4IMDA 1JNDA 3AXXA 3MO4A 1A0CA 1BYBA 4DNHA 1WDWA 5HQMA 1VR6A 4V33A 2RJGA 4FZIA 4UZSA 2V2DA 5AC6A 1GRHA 1KCLA 2VZSA 2NWSA 2W0HA 1H4PA 3HOJA 1PZ1A 3W38A 2CHOA 4LXFA 3NZRA 5TR3A 3CLWA 4NJKA 2XINA 4IPNB 3H4GA 3XINA 3BZJA 2XU2A 1A53A 3W7NA 4NUWA 4AZ5A 2WKLA 4O50A 1VD6A 2DZBA 2VX4A 3KLJA 1XR2A 1Q8AA 1CECA 5HWMA 3VTRA 3QC3A 3QFWA 4GFIA 1F8IA 5CZ0A 4JIQA 3H6OA 1PS9A 1Z69A 4J3TA 2W3SA 1GGOA 2QF8A 3VGBA 1E3ZA 2W63A 3HJZA 1ZL1A 2Y62A 1OEPA 2VDGA 2WOWA 1X97A 3CHDA 3CV1A 1K70A 2BP1A 4J40A 1EYWA 1VJIA 1XIEA 1B3VA 4CQCA 4NKCA 1V03A 1BWVA 1EXPA 5D38A 1G0CA 1IE7C 1TPFA 2WVVB 3T0DA 4MSSA 3CWNA 4Q4QA 3UWEA 1NEYA 3GDTA 4EAMA 3S1GA 3BAJA 2C91A 4C6FA 4C1NA 1L6GA 2P10A 5TF0A 3MTWA 4ZTYA 2FIQA 3U9IA 2CLIA 1X6NA 1B9ZA 2NX1A 4R7WA 2C3DA 1LRQA 3I3BA 4OBTA 3GYEA 4M19A 4RV8A 1BHGA 2DEPA 1WBJA 3OODA 3N6HA 3UJEA 2FMOA 3TZFA 5I24A 2WYSA 2XN0A 2VEKA 2GUBA 1JZ4A 4RR4A 4I3GA 1I4NA 1TELA 2IPFA 1SGJA 2VELA 4PMDA 4X2RA 4N02A 3H2MA 2FVMA 1GVRA 3KCJA 3WQWA 3FYPA 3UCCA 4X22A 1XIFA 5CJNA 3S5YA 1E9YB 1YDVA 1QR7A 1QCWA 2D20A 3WG6A 4KIRA 2ZZ6A 2OT1A 4TVDA 4LVBA 1JGIA 3YPIA 1TG7A 3SIZA 2PEVA 5JRBA 1GTEA 4HNOA 3DKLA 1DEDA 4GIAA 3DBPA 2VMFA 4OKDA 4WSJA 3QQ1A 1GJUA 4CLMA 2FDSA 3BXWA 5DCEA 2VC7A 4J2PA 4ES4A 1B31A 4FLQA 2AAQA 2Y7GA 4UFIA 1W8GA 3VDGA 1R9XA 5AC4A 1KXQA 1OFEA 5TBOA 1I8JA 5HWNA 3ZYZA 1P6BA 3CAKA 4WIWA 2EQ7A 5LHFA 1JPMA 2V5JA 1GW9A 1HJUA 2BG5A 2OZ8A 1WXZA 4Q8PA 1ECQA 2NV2A 3RITA 4UTHA 4TUFA 1W2VA 3LMZA 1RCXB 3DKJA 1RQEA 2HK1A 2E6AA 1O66A 3OOQA 1NPXA 4DN1A 1DJYA 3RDKA 2EHHA 4K7YA 1YDOA 3WDRA 3TQPA 3G24A 2J24A 2BODX 1W9UA 4PCTA 3H4WA 4O19A 3SCPA 3DC8A 4MMWA 3TKFA 2QS8A 4MTVA 2P3ZA 1H09A 1T41A 1B90A 4B91A 4RE0A 3PUEA 1AD1A 1SFSA 1DL3A 3L7RA 2XWEA 4TV6A 4J3SA 9CGTA 1V6TA 5HPOA 3NQAA 4FHAA 1HJQA 1XRSA 3W24A 3NZPA 3VMOA 3PSVA 4H9MA 2HSAA 2DZVA 1WA3A 4ZTXA 5IRPA 3EEZA 3W29A 1YBQA 4C5YA 1DORA 3PPGA 4TQTA 3INPA 3EF6A 2PURA 3RR4A 4EPBC 1S39A 3MANA 2R9ZA 4WVXA 2J25A 5GVJA 5JQ9A 1EWDA 3BV4A 4DLMA 3CL6A 3S5SA 1DTNA 1QWKA 4V28A 3V1PA 2PF0A 1J12A 1M5WA 2VUNA 3B4UA 1UKSA 2OLAA 3NYDA 1K9EA 1TWZA 1KXVA 5D2VA 4AQLA 1RVGA 2INEA 1UD4A 4AYGA 4KWWA 2QPSA 1XPGA 3KOFA 5D30A 3WMLA 2EF9A 1E0VA 3WBWA 5H91A 3W4RA 2XH2A 4D6EA 2J88A 4A6GA 4UXDA 3THCA 1P0KA 1CB7B 2CCRA 2ISVA 2PFHA 3N9SA 4TX8A 5LIYX 3IJ6A 2CLFA 3TJ4A 4MKVA 3ZVHA 3EKLA 2C6QA 2TAAA 4HBKA 2YCLB 2WHLA 3M0VA 1NY1A 1TQXA 2WZHA 1GQNA 4EAYA 3Q37A 3CGBA 3TYCA 1MNSA 1ISYA 3GR7A 5DLCA 1GERA 2P3EA 3E0IA 3KBSA 3ZSTA 4PRRA 4I9AA 3B03A 3LG3A 3CWHA 2BASA 1JR1A 2GDQA 2A85A 2PTYA 1F07A 1A5BA 4V2XA 2OXNA 1I9CB 3EMQA 3CB8A 1XC6A 4LVAA 3DECA 3SFKA 3TA6A 2OOGA 3FJ4A 3FOKA 2GJNA 4PCFA 3LY0A 3VNKA 5XIMA 4HCLA 1P1MA 3SDOA 2VL4A 1W3TA 4BK9A 4K7ZA 1JDEA 1V02A 1VBJA 4F40A 5KINA 4ALDA 1FP9A 2YYTA 2CLKA 1GZJA 3U2ZA 1BG4A 2ZXQA 1HXJA 3TJIA 3F4WA 2ZRZA 1LBLA 6CGTA 6ENLA 4QJ5B 1UZDA 1UC4A 3DHUA 2G4JA 1HUVA 1CXIA 3UWQA 2DSWA 3NZ1A 3W2UA 1HTIA 3RM4A 4Y9AA 1NDAA 4AD3A 4F8XA 3N2CA 1M6JA 3VINA 3P7YA 2XHYA 5IFPA 3QFAA 1AJ2A 2VZUA 2A3AA 4WY0F 2QF7A 1KR0A 1KFJA 3GNRA 3JZUA 2MNRA 4ZOHB 1XIGA 5C0QA 2GYIA 3PZTA 1XQLA 2GH5A 2ABAA 4LA1A 4X60A 3VIHA 4IUOA 1LL4A 2YW4A 2BC0A 4LNYA 2PA6A 5CEWA 2QPUA 3OHMB 3UR7A 4AG0A 3SFWA 1ZX9A 4LH8A 3SRHA 2QVHA 3RLUA 2Q8LA 4H19A 3OJGA 1P0EA 4PUWA 4B4HA 2GQ8A 3OB8A 1UZHA 3KHJA 3IJQA 3FDKA 1AW2A 3UJRA 3K30A 1TYTA 2P8BA 2BHUA 1GV4A 3QPYA 4OVXA 5A3HA 3JVAA 2E9BA 2ZUTA 4E8DA 2JFEX 2GZXA 3FAXA 4GNVA 1H3GA 4FXRA 1QPRA 3M4HA 3V75A 5A6SA 4EX4A 1JL8A 4QG9A 3H2NA 3L4UA 3QY6A 4RE3A 3LZ5A 2PDGA 2CHNA 1YPIA 2YCEA 1XGZA 2PGRA 4WDXA 2Y7EA 3URNA 3KL3A 4AIOA 4Z2IA 4K68A 2ZWZA 1BXBA 2W91A 3HPXA 2GQ9A 2QKFA 4UUIA 4L56A 4PTXA 5EBAA 4WXZA 4XZNX 2NPXA 2HPIA 4JN6A 2O9TA 1IEIA 4R53A 4QCEA 1EBDA 3H2AA 3LCXA 3ITOA 3C2VA 1A4LA 2VR4A 3GHTA 1E6NA 1U30A 1TMHA 3COTA 1PTGA 2PGFA 3FA4A 5I3DA 4MGGA 4H4YA 1L2QA 1H7RA 2AKMA 3RHGA 2PBGA 4PTWA 3OLEA 1W9PA 2HMCA 3QHNA 3A4JA 3OBKA 4DAFA 4UFKA 1S38A 2AGTA 1L9WA 2ZQ0A 3BVJA 1PX4A 4H4QA 3TR2A 1P0DA 1E6ZA 3SN1A 1FEAA 4BF7A 1PDZA 1TVNA 3S47A 2BHYA 3THDA 3MHUA 7CGTA 1QWGA 1RJPA 4RZ5A 4QDPA 4QCFA 4DF2A 2FTPA 3E9AA 3PSWA 1IR1A 1L6WA 1X1NA 4QE1A 4RNFA 1QFEA 1X38A 2NUXA 1ITQA 4BQ5A 4HK7A 4KFPA 1N63C 4BFAA 3I6EA 4F79A 1G4PA 4K3ZA 3DJGX 2I56A 4WUIA 3CXBA 3NVYB 1S5WA 1G69A 4B3LA 2A7RA 1GOWA 3GS6A 4AH7A 2WM1A 5A6LA 1US2A 3LK6A 3MUY1 4YTSA 1YHTA 1ZK7A 1UBSA 1ZCOA 5AN7A 3O0FA 2X40A 4IG2A 1F3PA 5E5CA 4XAGA 3WLSA 2JEQA 5IM51 3DH9A 2TPSA 2CBIA 2Z6IA 3DIPA 4NEWA 3PF3A 3HGRA 1V0LA 2XN2A 2NQJA 1FCVA 3LHUA 1TX2A 5G5GB 3OGVA 3E38A 1EYEA 2VWTA 3LGGA 3LBMA 5TNVA 6TAAA 4YL2A 3CGEA 1ALDA 1AH3A 4H1ZA 3ES8A 3F5JA 3TYAA 5ECVA 1SPQA 4AWEA 5AY7A 1Q45A 1W1VA 3M64A 3KX6A 4JTSA 4LV4A 4UNKA 4IIEA 1AL7A 4J3ZA 5H6HA 1SFJA 3VE9A 3S1VA 3NNTA 4IL0A 4FLSA 4PB3A 2VTFA 1DJZA 3UXKA 4V27A 4RK8A 4UIOA 1TPEA 3MV11 4CNUA 1UC5A 3OW1A 2VXNA 2YVJA 1UA7A 3H7RA 4C6IA 3UY7A 1E6XM 1LUCA 3VOHA 1PAMA 2QT3A 3NQ6A 2D2HA 3H2FA 3WLJA 4MWAA 3WK2A 3O07A 3HQPA 3LCIA 5G4EA 5I02A 2PDMA 3N12A 4I90A 1LL6A 1N55A 1XIDA 4S1FA 5DMMA 3PR2A 1GOXA 2D23A 1NP0A 4I8YA 5EGRA 4DRSA 3DFPA 2WC3A 3M0KA 1PIIA 3AXHA 4RXGA 4HYWA 3A3HA 1WZMA 4NYUA 2VP8A 3U6WA 3HU7A 1G9HA 5C71A 4RZBA 2IQDA 3CYJA 3MMWA 3II1A 3AS1A 3RUBL 2EKCA 3EX4A 3N9KA 1CYGA 4FSAA 3UD6A 3WFZA 3TC6A 2GVEA 5C9XA 4DJFA 2YFNA 3O0KA 3W7EA 2WJZA 3C0QA 4DO7A 1UKQA 2OZ3A 3MCOA 2FHCA 1NWUA 4NZJA 3VGFA 2RDUA 3M0IA 4PTDA 3W07A 2YB1A 4QGCA 1LP6A 4AIUA 3FEQA 4DWSD 3FA3A 1V0NA 1VEOA 2G3FA 2NXHA 2J78A 2OELA 3GUGA 3UJ2A 4DPQA 4MOZA 5E6YA 1JCYA 2J62A 1VIWA 2E5AA 3K4AA 3MVIA 3ABZA 3ZLFA 4HN8A 4HSHA 3S1XA 3SRKA 2Z2AA 5LGXA 4CN6A 2HWGA 3HQNA 2C79A 1UKOA 1OINA 1MW2A 4IH3A 3WQEA 4ZB5A 4JR5A 5A2AA 5G2HA 1PDYA 5DMLA 3H8AA 3ABQA 1KTNA 3PUDA 3MP5A 3QR3A 4PGLA 2BOGX 1JYWA 5JMUA 4H4IA 3NOYA 2V5LA 3KDOA 1FY6A 2A21A 1WKEA 5BZAA 3S0CA 3IVSA 4WY0B 1BEUA 5DBTA 3DGZA 3VD4A 3SCQA 3LU2A 4NL1A 5D2WA 2FDMA 3LPPA 4UR9A 3F5KA 2OX4A 3AYTA 4YMZA 4X2PA 4HA4A 4HPNA 1STZA 3RCYA 2XGIA 1XHGA 1G5AA 4AEFA 2RGLA 3WD1A 3LSBA 2YLLA 3MHGA 4PSRA 4DWDA 3QKEA 3QPEA 1REQA 4DBEA 1U1HA 3PFMA 1A0DA 1OGGA 3VVGA 2IKIA 3O7UA 3WF4A 1YE6A 1N5XA 5C70A 2EPMX 2VX6A 1Y8BA 3OLGA 3E0LA 2FHFA 4IMFA 3TA9A 1RD6A 2CYGA 4FOJA 4L9XA 4N42A 4FA3A 2WNWA 4KGJA 1GPWA 1OJTA 1P0BA 3LQLA 2C3CA 4JOMA 4W86A 1W3LA 3RMJA 4E8GA 2ZDRA 3W22A 1GRGA 2PWUA 3IIZA 1E1CA 3K1DA 4R34A 1MVYA 4XZ9A 4YVXA 3SCSA 3ABRA 4IQLA 4GI9A 1MZHA 2VQUA 4Y9NA 1J79A 4JTGA 1OZQA 4XSMA 1LCOA 1Q65A 4EPKA 3WDHA 3FVMA 2YOCA 1WO2A 1JCLA 4QBXA 3K46A 4AX7A 1R5YA 5KZEA 9XIMA 1FWRA 4M56A 5BOEA 2BB0A 4XZIA 4ZR8A 3DX5A 2ZZ5A 3PWAA 1UJQA 2V5BA 1XGDA 4JD4A 1XJBA 3W6YA 1B30A 3WBXA 3SI9A 3UA4A 4IF2A 3D9XA 2ABBA 5BU9A 4CU8A 1KB3A 4A8IA 3EAUA 4M6VA 3AS3A 4FALA 1OIFA 3R10A 4DXKA 2POZA 3NPUA 1E72M 3SR7A 1ZXIC 4GLEA 1UWTA 1H7PA 4EOUA 4EQWA 3GLCA 3PZMA 3ITLA 3WF1A 3B40A 4NRRA 1X1OA 4L4LA 1OCNA 1YDYA 4P7NA 4F0MA 1MO9A 1H61A 2D3LA 3GIPA 1GG1A 2Y70A 3KVMA 3ZR5A 4LUSB 4JTCA 4E3TA 3M0YA 2PWVA 3I10A 3BLKA 4YCPA 4H4UA 5JCLA 3G1XA 1XLDA 3H7UA 5T8GA 3WJYA 3KZSA 2WAGA 3BOFA 3MUZ1 3QVQA 4H4TA 2ZTKA 5KZDA 1ITCA 3WLPA 1BQCA 3W2JA 1UR2A 2QHAA 1UQZA 1VCGA 3VD3A 4UR8A 4A21A 3OG2A 1NU5A 1W0MA 2GR3A 2H8ZA 2FZ8A 3MBDA 3UPBA 3TJLA 3K1GA 4QDWA 1LVLA 2WPCA 3HG2A 1R3RA 1YXYA 4H4VA 4ZOBA 1TTIA 5FEWA 1JCNA 1R9YA 1PWMA 1K4QA 4D6HA 3NEHA 3ME3A 2XVKA 1TTJA 3VKJA 2F9RA 3T42A 2X05A 1NM9A 1PCWA 3A9IA 3A4AA 5F1VA 5I3JA 2V67A 4GZJA 3CZKA 4G7EB 4C6QA 2YW3A 5FJJA 3RM8A 4UWMA 3B06A 2QCNA 3U2OA 3IVTA 3EDEA 4REQB 1Q4NX 4ERIA 4WSHA 3UFYA 3DYOA 1VRXA 4ZXLA 1VFSA 2HS8A 1UJPA 3EA3A 4N9DA 4Q6JA 2Z1XA 2ZZBA 1GOOA 4K36A 3CZJA 1Y5WA 5M1TA 3A23A 3LRLA 1HKMA 4RE4A 1Q5MA 4WRHA 4Y90A 3POCA 3AJ7A 2AAMA 3OVRA 1CI1A 1QI5A 3L0KA 1XSIA 4GRTA 1VFUA 2F5ZA 3AZSA 4XD5A 1OM0A 1RK6A 2X1SA 3F5LA 1LWJA 1V6VA 2PDFA 4IMGA 4MF4A 3B8TA 5KVHA 1I2PA 1IT7A 1SW0A 2QCDA 1IF2A 1UH3A 3G0XA 4DJEA 4ZOAA 4B4FA 3GXFA 1WE5A 4US5D 4UFLA 2D3NA 3ABXA 2EJ1A 2E0PA 2A1YA 1QPQA 3VZXA 1UIOA 4OJYA 2P88A 3MP3A 1AMYA 5A6BA 4EVZA 3T7VA 1OWQA 5MF5A 2H9AA 3AROA 4ZENA 2CBJA 5BMXA 3B4YA 4NYYA 3MHFA 1W5OA 1XKJA 3ATZA 1QOQA 3EKZA 2C15A 3ZJKA 1MNZA 3WLRA 1KFWA 1ONEA 1VBHA 3PG6A 2ZUUA 4EWJA 1J11A 3OVQA 1V7AA 4PCSA 4FNPA 1D7FA 1S2WA 3WDIA 3L4VA 4ERAA 2WP6A 1MXSA 2X8CA 2CLPA 2GL5A 1DVJA 1RALA 4R9XA 1Z7AA 1FDYA 1ZP4A 1ESWA 2YCKX 2NW0A 3GB6A 4C90A 4MLJA 4HMEA 4LAZA 5D9OA 1E70M 2FGLA 3UEQA 1DJXA 1LORA 4Q8QA 3FXYA 3LB8A 4AVFA 4LVDA 1NFPA 1DWAM 4LIIA 1TUXA 2DDXA 4D6IA 5CPQA 3LRMA 4PUNA 1LOLA 4NT0A 3RCMA 3SAZA 2WMIA 5JIWA 4YIWA 4KBXA 4V1YA 2VVSA 3IEBA 2FJKA 2DSUA 3WX7A 2Z0IA 4EXQA 1XFCA 4C6DA 1XLJA 4AMCA 1GEHA 3OIHA 1WKYA 4NNBA 3CJPA 4W5ZA 1HKIA 3QHMA 2Y7FA 3NXLA 3AMGA 4GVGA 2OGJA 1EQCA 1JZ8A 1ODZA 1PV8A 4MM1A 1CGTA 2YXGA 1GKPA 1FWJC 3G2GA 1C3FA 3QTGA 3WNPA 1LLWA 1YX1A 3ABSA 4KF1A 4MDOA 3GVQA 4DNMA 3Q4DA 4FX7A 1KA9F 2ONEA 3TOPA 3QF0A 4AISA 2HROA 2ZRVA 3B3DA 3PWIA 3BUVA 4GY7A 1MFVA 1QMLA 3M0MA 4DX3A 4TXEA 3ONBA 3URHA 3VX1A 1FHLA 1O12A 1UR9A 1RBLA 3ELFA 1BVWA 1OCQA 3N3MA 4LNCA 1MO0A 1LPFA 3NQ7A 3NVVB 3A7AA 4FK9A 5FF7A 1OIMA 1JIBA 3R4IA 1I2NA 2E25A 1RP9A 5DQPA 3SY8A 1E0WA 2AOSA 1ME7A 3O05A 3MCNA 1THFD 2WHJA 1F9CA 2GOUA 4H6QA 1JDDA 3WNMA 1EP1A 1PKLA 3SCWA 1L0PA 3LBOA 5A6AA 4EQXA 3UZXA 5I00A 3ZXWA 4JYDA 7ENLA 2PMQA 1XPYA 4S38A 5F4XA 2PSNA 1TFVA 2XSAA 4AWUA 1EJRC 1UP3A 2ZZ2A 4LAOA 3S83A 1HQTA 4V1XA 2J77A 4AIEA 1KXHA 4HNCA 4JTFA 2YKKA 1Q1WA 1Q1RA 3KS5A 3BJSA 3NZGA 4AVOA 2FLIA 2CLLA 1L8NA 3GY1A 1FKWA 3HFTA 3BQ5A 4LW7A 3N9RA 2UY3A 3G8RA 4QFUA 1W1B1 2VC9A 2HBVA 1CGWA 1MQQA 3V36A 1XYMA 3PG9A 1OFBA 3ZM8A 2XIOA 2WMFA 3MUAA 1NHQA 3KOYA 2PBOA 2DORA 4I9TA 1AVAA 1UP2A 1BPLB 4LS0A 2XFYA 1QRQA 1HVQA 1KCZA 1GNXA 1XIJA 3HPZA 2WMIB 2W62A 4S3BA 4Q4KA 3OLIA 4LUSA 3TLLA 2Z00A 4GR1A 4KFOA 1R87A 1HP4A 1HN1A 2DQXA 2XJ7A 4MFDA 1W9DM 1GYMA 1OFOA 4GHRA 4K2SA 1FDZA 3DH7A 4IHCA 2NVKX 4G7FA 1Q3NA 1W91A 3DK4A 3CLMA 3GC2A 4P61A 5FJOA 5BXTA 1MRQA 3WH6A 3DHFA 4GNJA 3VDCA 4HQVA 4B5UA 4BURA 3K13A 3W76A 2H3BA 4P5UA 1UPPA 5EB8A 4Q7NA 1PJ9A 1Q2SA 1TCDA 3IGHX 3AM9A 3NFUA 4QNEA 3WCZA 3E0WA 2IW0A 3OA5A 1E9LA 5FF2A 1HJSA 2HCVA 5ABTA 4NJHA 5FOOA 1BTCA 4RDYA 1DWGM 3CS2A 1T8XA 2E6YA 1MZRA 3G6LA 4FDCB 2OR2A 1SSDA 3TNOA 2OX1A 3I6RA 2FQIA 3W1MA 3MS8A 4WK9A 4GI4A 1RQHA 3GZAA 2XVNA 5KEZA 2YAUA 3HO8A 2QCLA 4NASA 4TVCA 3SADA 3GDMA 4QQUA 2C71A 5I3FA 1K1DA 1H0GA 2YYUA 2QCDB 4JHOA 4TX9A 4E2VA 1A80A 2RH9A 3QV7A 2P1FA 3LADA 3CHFA 4EMIA 3Q2DA 3TH6A 1D2KA 5CPSA 4BF5A 2PUZA 5AHFA 1ISXA 3N25A 3EPMA 1ZJIA 1V77A 1KGWA 1DQWA 4K38A 1JPHA 4K39A 4C65A 3FX4A 3W71A 1J2BA 4YVPA 5DF0A 1RY0A 4QX4A 4TV5A 4H9UA 3GG7A 1XFBA 1OYAA 3W7LA 1F76A 4XVEA 3GTIA 4PODA 2WHMA 4OV9A 3A21A 1MDRA 4MJZA 4AZBA 6REQA 2HZGA 2V3DA 2OLSA 3FW6A 4G7EA 1OT2A 5PTDA 1E43A 1SMDA 2H90A 8A3HA 3L0NA 1JD7A 1XRVA 3G1AA 5AOUA 2YVFA 3CAVA 2CLOA 4PTNA 2E28A 3S5ZA 4YU1A 1R2SA 3LD5A 3T2OA 4D6GA 2QUMA 4LPCA 4CD5A 3MVTA 5LGZA 2TMDA 3V0UA 4L9YA 4O16A 2RGMA 4US6A 4IMAA 4HCDA 4IPIA 1B0IA 1J6PA 2DZUA 1Z32X 5K7JA 4JTJA 3SN4A 4YTTA 3AIUA 1BWLA 1MEHA 2BV9A 2RJHA 2PLJA 1UROA 4QE5A 2GDUA 2OU4A 4CVWA 4Q8TA 1VAHA 5D37A 4JFTA 1R47A 4F66A 4A2SA 4B15A 5CJMA 4H8HA 4UNIA 4CQ9A 4R27A 1XCXA 3U2CA 1O7AA 2O0TA 3KOXA 1NVMA 3TP4A 3DESA 1AZ2A 4NNCA 4UNLA 4JIIX 2QAFA 2VVNA 4IISA 1PYMA 1J5TA 3MDUA 2GGHA 4LCRA 4AZCA 1GVIA 3O16A 1CNVA 1GPFA 1WUEA 2CZEA 1E6RA 3FEMA 3MV01 1IZCA 1EJUC 2UY4A 3AXMA 4O52A 2BVTA 3D46A 1UKTA 4IPJA 2J13A 4DY1A 1VBUA 4B3KA 3APYA 3SQPA 1KM4A 2WMKA 3L2MA 3W1NA 3BOXA 3WQ8A 2Z2BA 4AU0A 3NM3A 5MHBA 2ATMA 1JPKA 3OBAA 4PMRA 1U1JA 2AL2A 1ONRA 1LQ0A 1U5VA 5HMFA 3R11A 2PDJA 1RXOB 1S2TA 4KESA 4PEEA 2XZ7A 3W1AA 3G77A 2GGEA 5DX7A 4W8LA 3VCCA 4DM2A 3VZYA 3AMCA 2UZ9A 3LLXA 4D6JA 2PDIA 5A8GA 1QXLA 1LJYA 1DQXA 3PN8A 2E4TA 4I6VA 3EOSA 1KGXA 1Z9AA 4Z1BA 4C1NB 3UPWA 3ZSSA 3GG1A 2G41A 5A8OA 5BWFA 1DHPA 3CNYA 3NVTA 2G3NA 2WVVA 1KLZA 1I0BA 5T9BG 3JU2A 4PMUA 5G2IA 1JZ2A 3MSRA 3TWAA 3CZ8A 4XD6A 3CO4A 1X2GA 3PS7A 4M24A 1X7IA 4O11A 1XIBA 4ZFCA 1TE1A 4NRSA 3D0CA 3ZFHA 4ACZA 3Q6JA 4JTDA 1RLCL 5DMNA 3QV9A 3WUEA 1DHKA 5I09A 1R2RA 1KFBA 2EPLX 3R8HA 3U4FA 4C7FA 2WSQA 4M3PA 4F0RA 1IQ8A 3LTSA 1N8WA 3E2VA 3EOLA 4MWAD 3W86A 1HGYA 3EWXA 2V3AA 2GRTA 1QPNA 2PDLA 3PZUA 1V6UA 1U5HA 4AY7A 1A50A 3RO8A 2OJPA 4JCLA 4IGMA 1P4CA 4UTWA 1UD2A 3S4TA 1JYXA 3FLUA 2FZDA 2BSLA 3CL8A 1ZY9A 2XDFA 2OLHA 3UGRA 1SFLA 1K7XA 4PFHA 3D6NA 3HFYA 4FXFA 1TPC1 2VWSA 4JIHA 2J79A 3R2GA 1G4TA 4JDYA 4C5ZA 2PDQA 4HHPA 3VKDA 1ZB5A 4CNNA 1KRCC 2EJAA 2WNZA 2WO5A 4HMCA 1PPIA 4GBUA 5F7UA 1GHSA 2Y8UA 1FHDA 1QU4A 4P8XA 1QJWA 3GC4A 3K5XA 4JTEA 1QNQA 2GVGA 1I1XA 1EUAA 5AZ0A 3SM0A 3ZMRA 1L2UA 1JDAA 1W3NA 4LEQA 1T99A 3R07C 4U5IA 4NILA 1Y5XA 3LX9A 1W9XA 3QZAA 1KKRA 3IIPA 4OIFA 3R25A 3C8FA 3UG8A 1SO3A 5HQLA 4AZGA 1AW1A 2VFIA 3W7HA 2XUCA 3ZJ8A 4LYRA 4M0XA 1FTXA 1V6XA 1SR9A 1WDQA 4G9PA 3RPTA 3E3HA 1ZRQA 4B90A 3VFLA 4D1JA 3PNZA 5CGMA 2OYLA 4WR3A 3RX4A 3A12A 3RRAA 3UNDA 1N62C 1W8SA 4XUYA 2QXWA 4Y9OA 2PP1A 3ITGA 3TQ0A 2WC7A 4E4UA 2FVKA 4HYRA 3MB9A 3E0VA 4OUEA 4CCDA 1G67A 2X30A 4MYAA 4B9ZA 2OTDA 2FH8A 4QP0A 4CQBA 1EC8A 4UBPC 4KKXA 4OHQA 4IZGA 3KBJA 3GVVA 3MI2A 1XLGA 1B3OA 1RJQA 3MDWA 2GQWA 3SECA 3MZNA 4H50A 1OHLA 1HIZA 2Z7KA 3OU8A 5T9CE 3LHZA 4UOZA 1F74A 1AODA 1Q85A 3FCPA 3VNJA 1K7EA 4I7UA 2DZXA 2QJJA 5FMHA 2WJEA 4PRWA 2CIPA 3BGGA 1CENA 5H8MA 4FAMA 5DBUA 4E4PA 3R6IA 4FP1A 2AQWA 3CQ0A 1GT8A 3E2SA 3C0JA 3WUGA 3AYVA 1O5QA 1OX5A 1EQPA 4OECA 3TDFA 5ABFB 1UR8A 2W61A 1CGXA 1FCQA 3PZ9A 3S6DA 2AMGA 4K37A 3ZO9A 1WPCA 3HV8A 1NDZA 3RLGA 1FHUA 5BU6A 4H83A 1S5VA 2H3DA 5HJYA 3VNDA 3MJMA 3GXIA 2QNEA 5MKGB 1XYLA 4F4RA 1EEXA 1KW1A 3W81A 1MWOA 2NQLA 1CCWB 3BCJA 1Q6FA 1TWIA 3BV7A 1EZ2A 2Q6ZA 3QSRA 3S5OA 2P50A 5IDZA 1VDVA 1QO5A 4H6EA 4JAWA 2WNNA 3TFXA 2R6OA 1EIXA 1IGSA 1WAWA 3ZLHA 4GXMA 4JQAA 1NAL1 3RLHA 1JUKA 2BVDA 2BMBA 3F03K 3NG3A 1YEYA 3A9BA 2NV9A 3SGGA 1R7AA 1Q63A 3W83A 1EOKA 3AMZA 3G1VA 2G50A 2ZXDA 3CUXA 3K4WA 5I2UA 4OT7A 4LUYA 5CC7A 1SVDA 5HPCA 3W1RA 3STFA 3LBCA 3WMSA 1DXEA 3I6TA 3OIXA 1GEQA 4JTUA 3FHQA 4GZ7A 1VENA 2J8TA 4OWGA 2PD5A 1GCYA 3QGKC 5FA5A 1KC7A 3R0KA 3BICA 4LWWA 3IIXA 3WJWA 4MY8A 3HW2A 1UPMB 2D69A 3SEPA 5FS9A 1A49A 3GG0A 4NZFA 4DJDC 1AW5A 4IXXA 3EEGA 3HGSA 3ARQA 4IFRA 1WNOA 4YLWA 3BAKA 5FEZA 1IV8A 5A94A 1I6NA 5K4ZA 1A3XA 1A3WA 3AMLA 1XQKA 5EMMA 4DBSA 3UWUA 5EPDA 4U33A 1HL2A 3TK7A 2X16A 1NOUA 3AU6A 4XG1A 2E09A 3W2NA 3WENA 5K3VA 1HZYA 3M07A 2A3EA 1SJBA 2IS7A 4G2DA 3S46A 1Q7MA 5EMKA 3GW3A 4PBEA 4MJMA 2E7FA 2R1KA 1IT8A 4IICA 4ICMA 2C0AA 4L1WA 1Y7VA 2XIMA 3H54A 5HOSA 2G3IA 1E1CB 5CZTA 4E38A 2V82A 4NXKA 2CEQA 1FWHC 4P8VA 1XICA 4KQNA 1I60A 2WBAA 4Q32A 4FR6A 3TYBA 4AVNA 2H8XA 1L8PA 3EX2A 4BCEA 2R82A 2WCGA 3EWCA 3ITTA 5BYWA 1JEHA 5CBJA 1Z6KA 5AYZA 5I3HA 1SFTA 1ODUA 5LIUX 3AMDA 3QYQA 4CEXC 4OGZA 3HJEA 2QEZA 1EB3A 2VKZG 4N6EA 2J4GA 3IIOA 4ACZB 1XYAA 4EM3A 4ASTA 4N6FA 5EMLA 2VUYA 1AJ0A 3GUWA 4M80A 3VPLA 1CXEA 2VHLA 5U1OA 1IEVA 3HG4A 3KRSA 4QR6A 5SWUA 5HNNA 4K1WA 1XUUA 4DJED 3APGA 1H7NA 4HZ7A 1H1YA 3G0SA 3VIKA 2ZX8A 1PZ3A 1RZMA 3QW4B 3H2EA 1TSIA 1H49A 1KM3A 1FWIC 4Y9PA 3T07A 4REQA 1V79A 3PZOA 2Z25A 3QM3A 3SN0A 4M6PA 2ALRA 2PCEA 3MSDA 1LYXA 2NUYA 1QI3A 2ZZ0A 3GFXA 3VD5A 2HXUA 3UG5A 3WK3A 3GKAA 4U31A 4GOAA 3AHVA 1BAGA 4ZO8A 1UYQA 3WLOA 4R9OA 4GA8A 2OQLA 4XUGA 1J0JA 4O10A 3CL7A 1B3YA 2IKHA 4GCXA 5ABFA 4O8AA 5E93A 2JGQA 3U48A 2RHGA 1QBBA 3P8IA 1F3TA 1PO9A 3NA8A 3UU0A 5CBBA 1J0YA 4LC8A 1RBOB 2V8ZA 3F7JA 4DO6A 3AMKA 1EPVA 4BQ4A 1QI4A 4PMZA 3W7GA 3NUKA 3EANA 4ADWA 1V6WA 2JKPA 4UTTC 3VDBA 4YWIA 3IGXA 1JDFA 3N6JA 4C6KA 4QM1A 3UY8A 2YA1A 1F4HA 1QNSA 2DU2A 3OVGA 1BSIA 4R88A 1ZSXA 5FL0A 1JCTA 3IAQA 2PWHA 3L21A 5EFDA 3TQVA 4P7RA 4PMVA 4IOTA 3E96A 2DSKA 4JEJA 1KM0A 4GPNA 3TCSA 3DFNA 4F0LA 1JROA 2CLEA 2G0WA 3RGTA 5EMJA 1ZUAX 1RAKA 1XLLA 3CAWA 1XG3A 1R46A 2G37A 5EA9A 4HNNA 2NQ5A 1AQ0A 2WP5A 3CGTA 2Q8ZA 1M68A 5A6JA 3M0ZA 2TYSA 4CCZA 2W92A 2CZDA 3UCDA 4BS0A 4PE8A 4X0NA 4FXJA 5F2IA 1J0KA 4Q4RA 4S3KA 3H4KA 2QIIA 3LZ3A 3O3RA 3GHSA 1ZDLA 2VFHA 4KEUA 1GQKA 3GXDA 4IIGA 3WO8A 4C6JA 4DO4A 4J3UA 1OFQA 3RPMA 2ZZ3A 4L4OA 4I9JA 3GFYA 3GNPA 2REQA 4AD0A 4WJXA 4P8UA 1ITXA 5I3GA 1P6CA 4UTMA 2C7FA 1DTUA 4J9JA 4EP8C 3NXFA 3BLFA 2ZE0A 3PG8A 3E5BA 5HQEA 2ODOA 1NJJA 1BKHA 1XW8A 1BGGA 1R3SA 3DFQA 2GJLA 4JTIA 3O0HA 3G1SA 1OABA 5TIMA 4S23A 3KXQA 1NDYA 1P43A 2QGYA 3PVFA 4A3HA 2GVLA 2Q8XA 3QOMA 2EQ9A 4X9SA 3VKBA 3VD9A 3M44A 3W27A 4YCOA 4ICCX 4K1GA 3VNLA 3CGDA 1VRDA 1E1FA 1A5LC 3KE0A 4GQGA 4GZEA 5FJIA 3WQ6A 3FVDA 3MA8A 4JTRA 4DJEC 4Q8UA 1FWGC 3B8WA 3DBNA 3AISA 3IUHA 4GXWA 4WHBA 1PUDA 3W7MA 2EXOA 2YGYA 5FAJA 3APTA 3SCVA 3VAVA 2PDHA 2O4MA 4PUDA 3D3AA 1MMFA 4QLKA 3W87A 3O2LA 1NIUA 1SM9A 4LB3A 4JEQA 3TAOA 1XS2A 5CPLA 3BAWA 1QDSA 3QR0A 2C3ZA 4Q4MA 1TA3B 3ZT6A 2CITA 4E4FA 1GVYA 3EKGA 3GW0A 3GG8A 3SGZA 2QDGA 4MNLA 2XIIA 4GUHA 3K8MA 2G8ZA 2V3GA 3M7SA 1JXKA 4XZWA 2MANA 3HG3A 4JX6A 2X8RA 2DQWA 4AF0B 3W1PA 3W6MA 4ZO9A 3GX9A 2YDQA 4W85A 2BY3A 4LAMA 1QT1A 3T0AA 5AFDA 3QV8A 4WJEA 1ZP3A 2MUCA 3BLDA 3SW6A 2HNEA 1G7VA 2XISA 3VUSA 1YNQA 3UPMA 2YX0A 1JDCA 1HKVA 1F3EA 5XINA 4JIEA 3UGVA 2Y7DA 5C9WA 1IIHA 4O15A 1MEWA 2PWGA 2YXOA 1W1YA 3MSGA 4PUUA 3NVDA 3QZ6A 5C9RA 2OWCA 3BZGA 1C92A 2DP3A 5AB3A 3UZ5A 4A8LA 4E3VA 1UR1A 3IPWA 5E70A 3CUIA 4GO9A 3M1ZA 1EH9A 3W1TA 4KW2A 1SB3B 3H4XA 4FX9A 3W7PA 4EE9A 3MI6A 2CU0A 1XD1A 1KLYA 2CZFA 4XZLX 1YKWA 2GR1A 1JNEA 1AUSL 4IJCA 3KP1A 4BQ3A 4Y2WA 2OB3A 3KVLA 1T96A 3ZVIA 5EYWA 3GAYA 3F4NA 2QCFA 4TIMA 4OFCA 1VYRA 3LB0A 2W0UA 5CZKA 3GDLA 3ICJA 1V93A 3VK5A 1HO4A 5CKSA 3VNMA 4ACYA 4TVYA 2AKZA 3DG3A 1LBMA 3U5YA 1KBLA 4M5PA 2ZRWA 1QOXA 1UZ4A 3XIMA 1PVNA 3WBYA 3CXOA 3N2BA 1Q8JA 3MYOA 4CQ8A 2FVLA 3NGJA 3OZPA 3PZGA 5FL1A 5G1YA 4NZ3A 4H2HA 3VILA 4GVHA 2VRKA 2I9UA 1UWIA 2Y0FA 3QV6A 4IIDA 3WH8A 1XISA 4MJ4A 5GPRA 1V3HA 3SCUA 1IXOA 1GRBA 1XLKA 2L5HA 1EJXC 1XYBA 3C2FA 1EO7A 2GLKA 4ROQA 4A3RA 5H1WA 3T40A 3WLKX 3VFCA 3E02A 3BH4A 2JF6A 1FHVA 2ZC1A 1HJVA 1UWUA 3TYEA 3REQB 2ZZ4A 4Q6XA 4B5NA 3VNYA 5DY2A 2PGWA 3QLDA 3QQWA 1W54A 3UQNA 2YL9A 2C18A 3SJ3A 1GREA 3T4CA 3IRSA 4MB5A 1DNCA 5G5IA 1UHVA 4BI5A 1ISVA 4W7UA 5E0KA 3EDJA 2A6LA 3ALGA 3HQ1A 4GO8A 4DZIA 3GQYA 2I5IA 3B8UA 1F61A 3PBWA 3L23A 1GZGA 5K9XA 2W54A 3QKZA 1JOAA 3L8KA 3ZWSA 4RNJA 5EU9A 3NQCA 3CQJA 1TREA 4XBKA 4IPLA 4DI8A 2ZA2A 3TYUA 3VD7A 3WELA 2QAEA 1EX5A 1ZNNA 3IK2A 4XZHA 5FEPA 3TROA 3LHWA 3CQKA 1FWTA 3GWQA 3UBPC 1W1IE 4YTUA 3PJWA 2X2GA 3CZEA 3T0CA 1K77A 2XZ9A 2PTXA 4GINA 3V5OA 1H41A 4EPEC 3THUA 1E6SM 4FEZA 3SGUA 2J7HA 3N15A 1O5XA 1ZMDA 1XLAA 3TW7A 3FY1A 4BJHA 2DIJA 1V3JA 4YWOA 1SO5A 2XIJA 1MW0A 1EJ7L 2DW6A 1PKMA 3A3WA 4MHBA 3WBEA 1FWSA 3ES7A 1GESA 1NQ6A 4A29A 3ARZA 1X1ZA 2Z26A 4MUZA 3F4DA 5JVLA 4W87A 3GIYA 3NDZA 5D33A 1YE4A 3ARUA 4JQ3A 4IQEA 1C90A 3HQOA 3PC0A 1WZKA 3W1XA 1KR1A 4N7QA 4AZIA 5D03A 1EIBA 4MUPA 3I68A 1B54A 2EPKX 4Z2GA 1DE5A 3FAWA 3N04A 2XFFA 2R94A 3BOLA 3C52A 5A6MA 3UCQA 4OV4A 3WNNA 1XKYA 1DJIA 4WXYA 2PZ0A 3TX9A 3KCOA 2QDHA 1JRBA 2NWRA 2NVDA 1N5WC 6TIMA 2QR6A 5KETA 4I6KA 4PMXA 2X1UA 1TO3A 4S3FA 1TA3A 2Z1WA 5CXPA 3KDNA 4CQAA 3CUJA 1FCUA 2VGFA 1POJA 3LV6A 2JBMA 1N82A 4J3VA 3P84A 5D8ZA 5LYRA 3NPWA 2RKXA 4IWWA 1VZWA 3RR1A 1NWSA 2X2YA 1K4GA 2YL5A 1AK5A 1F6PA 4BWLC 5HWJA 1KNWA 1WQ5A 4IGHA 4LX4A 1ISWA 2DT2A 3RRXA 4A4AA 3S2MA 1VQZA 1EGMA 2Y89A 5FF3A 2QJMA 3QHOA 1YMYA 3FNDA 1SO6A 2ESCA 4C60A 3WF2A 1FFVC 3QGVA 2XFWA 5G1MA 3NVZB 2ZVIA 1W2PA 4MPKA 1OJXA 1QI2A 4IX0A 3A4WA 3PAJA 3QSTA 3WMBA 1F7BA 1JCXA 4POCA 4MB1A 2HVOA 3HG5A 4ZEPA 1X39A 4MLRA 3M0HA 3MP4A 5JCMA 2QCCA 4HJWA 3WQCA 3B9OA 1XV8A 2PGEA 2NT0A 3LHTA 3AZRA 3ARWA 5H8PA 4FI4A 4Z17A 1BYDA 3I3DA 1XC4A 2GJXB 3R12A 3MT1A 2YDAA 5EMUA 3FA5A 4D1IA 4Z1CA 4O1EA 2C1IA 1US0A 2GWGA 5KZ6A 2INZA 3AS2A 3KL0A 2Y4SA 5K4XA 5KMYA 4H9XA 2JGYA 3WD0A 1JI1A 1XXXA 2DY3A 4NEVA 1GYLA 1MUMA 2OOFA 5LA1A 5CPMA 4KRUA 4LYQA 1K9FA 1J18A 1QW9A 4HNLA 4JGDA 1ZBKA 5AKQA 1XYFA 1R38A 4LF2A 3WQDA 1B57A 3THQA 5DRCA 2A3CA 4HU8A 1YTEA 4WZHA 3STCA 1QPOA 4F9DA 5FF0A 4A35A 1EF2A 5A6BD 1CT5A 4PR4A 1TZ7A 4PCNA 3GKFA 1AJZA 2QMKA 1W1A1 4JFUA 2WMJA 3BANA 4OBRA 5DMYA 3BW4A 2IXVA 2PU0A 1PIGA 1WB0A 4F2TA 3NSNA 1WOBA 4UTLA 3SUWA 3UXDA 4EM4A 1C91A 4LJ3A 3P81A 1M3UA 4XD4A 2JIWA 3WLMA 2X0YA 3PBMA 1JUEA 1DIOA 1JXJA 3ITYA 2I17A 4B5WA 3W75A 5ER0A 1P6WA 2GJXA 3ONCA 4XAPA 4KH2A 3WUBA 4RNHA 3EWUA 4IXHA 4U4MA 2YL6A 2DZSA 4ZQPA 1Z41A 4FXSA 4LVGA 1BYAA 3MW7A 3CHCA 4GYFA 4IGNA 3UT0A 3PBVA 4AHPA 3CUZA 2DVXA 4IT1A 1YDNA 3DG6A 3C2YA 1VJZA 3NO1A 3UVAA 5JBEA 3M9YA 5MKGA 5C2CA 3VOGA 3R43A 2EEXA 4FO4A 1XBZA 1UG6A 3DU0A 3UG4A 4W93A 1HJXA 2C16A 1R3VA 1OF6A 4EIVA 4RL3A 1WDSA 4M29A 1JD9A 5A8MA 1VLWA 1PHWA 3A22A 1VLIA 1UB3A 1I2OA 1FP8A 2O9PA 1FX6A 4APNA 2PWDA 1LOQA 2JK2A 2VT0A 9XIAA 2B31A 3PJUA 3NCOA 3PFRA 4QAIA 1NFBA 4BEUA 1D8CA 3WN6A 1VBRA 3EUB3 4X61A 2QULA 3WZ0E 4O4WA 3F4CA 3WJXA 3CT2A 4R7OA 1LQAA 1MYRA 4GBDA 1IXQA 1K6AA 2FZNA 1BKSA 3RG6A 4WDWA 2QJNA 1MEIA 4QS5A 4PUKA 3H12A 2RDTA 3STGA 4LANA 4MAZA 3GFZA 3I65A 2WOQA 4US5A 4DJFC 4JQ4A 3S5NA 5HULA 1ZHAA 2GVJA 2ZYFA 1OGBA 3E74A 5LIWX 2ZX9A 3WNOA 3DFHA 5HNRA 1E9ZB 3SQSA 1JPIA 3BC9A 4HHHA 3TFCA 3N2MA 1FCBA 1WYIA 2Y5JA 2JE8A 1DOSA 2D73A 3AOFA 2WC4A 3EX3A 2QW5A 5GNYA 2PZNA 1GOKA 1RD5A 4FF7A 3VIOA 3TN4A 5LXXA 1U83A 2GSEA 2A4AA 1BWCA 4WKFA 1TE6A 1TWDA 3CHEA 2PU1A 3EOOA 2E68A 1UD3A 2OWXA 1W56A 3FN9A 4ZSTA 2UWFA 1KWGA 3BAXA 1C8XA 4S2BA 3R0UA 4ROPA 2XGBA 3LLDA 5EKYA 4CVUA 3E0FA 4UOQA 4M6UA 1KM1A 2CFFA 4O28A 3LMYA 1IEQA 4GQQA 2Q71A 3CV2A 4KEZA 1MW3A 2RDXA 3TW9A 4RXFA 5F4WA 3OZMA 3KM8A 4MAVA 3RJYA 1V3KA 4B2DD 3TE9A 4IL2A 3P61A 4UR7A 3THAA 4DJDA 3FDGA 2F61A 1X7FA 2JQXA 4L6OA 2RUSA 2Y8KA 1TV5A 2NXGA 3DERA 2JALA 1VFTA 3CHVA 3WFAA 3AIWA 1O4UA 4GX8A 3NQGA 2OSWA 4IX2A 4J28A 5D9NA 3V5FA 3W7RA 4FMVA 4I5RA 2VFGA 3HBLA 4HU0A 4GCAA 3A47A 3L5MA 3TNBA 4GYJA 3UG3A 2QJIA 4MFEA 1HNYA 7ODCA 3BARA 1Y65A 4DYKA 4GYKA 1Q13A 2R9RA 4KCVA 2EG8A 4YTRA 2PRLA 4LYKA 4E8CA 1W37A 3C4UA 3DHPA 2BXZA 3RO6A 5U4NA 3WLLA 2XPKA 2J7FA 4AX6A 1FUYA 5CBIA 4O17A 2WVSA 3NEVA 1CIUA 2VEGA 3SUUA 3NDYA 3ZR4A 3PY2A 2E3ZA 3U3HA 4XAYA 4YJ5A 2CKRA 2NLIA 1IYXA 3ISIX 3N4EA 1E55A 4ZSUA 3KVKA 3MUCA 3V5CA 4XKYA 2QMJA 3IV8A 3M47A 1Q6OA 1WP6A 1TYGA 4RE2A 3SUSA 3QMRA 1LG2A 1VFOA 5E9XA 1UQYA 1JJKA 2VEFA 2E5DA 1J8VA 2VGBA 1S1PA 3GK0A 4HTBA 1M03A 3H21A 4GUIA 1EKOA 2G3MA 2O92A 2J9YA 4H8VA 3BW3A 1TZZA 4EQRA 3KP0A 2IKJA 1WOAA 1EGZA 2BGQA 3L4TA 4KEVA 4PFMA 4AHQA 2CXEA 1S2UA 4Z2JA 3N11A 2I9EA 2Z4GA 3TTYA 4MNJA 5CC3A 4U2ZA 3DFYA 5DFAA 3WLTA 3GC5A 3O06A 4B5SA 2PWFA 4A8RA 2E40A 4TU1A 5BWAA 1QNOA 1XH0A 4MB3A 1JUBA 2NQ9A 1P0NA 2VC6A 1TIMA 4GYPC 4KRZA 3BW2A 3DYPA 4UCFA 3RXZA 5B7ZA 5A6TC 3DAQA 3E5PA 1EPXA 1UOKA 1TPB1 3CV6A 3GVGA 2V5DA 4DVOA 3DHDA 2V81A 5HNUA 4LAKA 4DWSA 5DO8A 4B5TA 1VCVA 3W53A 4N2YA 3PJTA 3VABA 1UR3M 2IXUA 3NZQA 3UXAA 1DP0A 5CJ5A 2CLHA 5FSEC 4JICA 3D47A 1GKQA 1M01A 3VO0A 1R9ZA 4LT9A 1EJVC 1DKWA 4JN7A 4GKTA 3ANUA 1CGVA 4JTLA 1YNPA 3MUIA 3W7IA 3GHUA 4NJGA 3AHTA 2FTWA 3M41A 3PUGA 4HNUA 1MUCA 3AJXA 4ML9A 3AXIA 5HDRA 3LXAA 1HF6A 4LTSA 4WX2A 3WEMA 3GH5A 4TO8A 2IQTA 3DC0A 4PEKA 3GXTA 1LZOA 4UMAA 1F5ZA 1ZQ5A 4NAFA 2DPEA 2J9ZA 4UTUA 4IP7A 2YB4A 4MVAA 2EPHA 2GUUA 3IIVA 1JFHA 3UZJA 5I06A 4TTUA 2J75A 3LCFA 4JBRA 5HBFA 2PDYA 1IT0A 1W3KA 5ENLA 3P0WA 1PXGA 2W5FA 4NAEB 2R8WA 2I5GA 1K02A 3A7UA 4NIRA 6REQB 2V2CA 3WEOA 5K9CA 3IRDA 2WOIA 5CSYA 3WDQA 3KBWA 3L2IA 4DJDD 2X7WA 5RUBA 4KETA 2QUVA 3C2EA 4UTFA 2WKGA 3SCTA 4F0KA 5FD0A 4FS9A 2ZUWA 1GEUA 5L9FA 3AYRA 2WZTA 1F3XA 3LV5A 3ORWA 1UUMA 4QS6A 1FWWA 2C14A 4KS0A 4PMOA 3B0VC 1GVSA 2PDPA 1GVFA 5EBKA 2QYGA 2BNJA 1DYSA 4M7SA 4W84A 3FSUA 4H3DA 1LM1A 2FJUB 4LBSA 4S3EA 3SBFA 3W7KA 1EP2A 2C19A 3W7CA 3CIVA 1IHIA 2J6XA 2UY2A 3L68A 3NPVA 4ENLA 1XP3A 2J7DA 4LY4A 2HV5A 3A3XA 3GD3A 2ACUA 1JULA 2RAGA 2I7GA 1FWAC 1XX1A 4PH6A 3T08A 4DF0A 3SB0A 2BOFX 4P8WA 1TTQA 1F2JA 1FWCC 1UUOA 4GIRA 1TJPA 4ZQRA 3KW3A 3AC0A 3SRFA 3C6CA 1J6OA 3GD4A 3CV7A 3GH4A 4CU6A 4KGLA 3GTXA 1QTWA 2D2JA 2GGGA 4W7WA 2ZWYA 1WDRA 2PLKA 4OU1A 4CD8A 1WDDA 2YFOA 1OZMA 1HJWA 2VI0A 1OX6A 1NWRA 1MOKA 3GE7A 4YN5A 4W4QA 1FBAA 2WNQA 3LI1A 1MW1A 4TMCA 1GK8A 1CPUA 1A5KC 2QV5A 1OQFA 2VD8A 4XISA 3S8HA 1SW7A 3NPXA 1V5XA 4QROA 1KFEA 1GYNA 3P82A 5I07A 4MKNA 1BTMA 1RLDA 1JQVA 4DXVA 5B80A 1PKYA 3NGFA 2ISFA 2R1MA 3W1LA 5D32A 2QCGA 1DIEA 3O9NA 4LSBA 1JG9A 3AU2A 2BC1A 4F0HA 3B8SA 1WCGA 3IACA 2O9RA 3ZWTA 3L66A 1CWYA 4C7GA 2C1GA 2OQYA 3H24A 3N14A 5KZMA 4ADTA 1JEZA 3WQOA 4JKLA 2ZX5A 3VM7A 3VU2A 4U3CA 3BLEA 1KGUA 4RW3A 3PTDA 2ZX6A 2CC0A 1UBPC 2ZFAA 5AYXA 2OG9A 5REQB 2Z27A 1XIIA 2INFA 4AY8A 2Y24A 4MWAB 2ZZ1A 1U5JA 1VEPA 3EXTA 3QEZA 5GNXA 1C8VA 3IS4A 1BQGA 4C91A 5G2WA 2VD9A 5FCZA 2O7QA 1JRCA 1W1PA 5ABEA 4BEQA 2R91A 3BJFA 3UZYA 3CH0A 3LTPA 4DI9A 3TCEA 1SMAA 1B3XA 2GFTA 2YBTA 3VM5A 3BL3A 3MI3A 2OO6A 2ACQA 3B8VA 3UWZA 3KTCA 2RFGA 4HK5A 4WEVX 3NQMA 2CDUA 1O1ZA 1F6KA 2YCJA 4YVVA 4NZ4A 1GJPA 1F4AA 7REQB 4QG8A 1L6SA 1QHPA 4O12A 2C8NA 4O0ZA 5CG7A 1OGSA 1W3IA 3KAOA 4C6CA 4AUBA 3MU7A 3PNUA 3KBNA 2G97A 3C56A 3P8JA 3A24A 4FIRA 3QGAC 2XTKA 2WBGA 2FFIA 5G4HC 1UMYA 1DJWA 4JY9A 5FF4A 2Z28A 3BWWA 4GY0A 3UP8A 4O53A 4LEFA 4AWTA 3HPSA 2AGKA 1U1UA 3Q67A 8RUCA 4A22A 4LB4A 5KTLA 4HZ8A 2PODA 3II4A 3MC5A 4BR1A 2QPXA 1B9BA 3WNKA 2J8GA 1Q6QA 3P67A 2F2KA 1V4YA 1S7MA 3HURA 3DI0A 1KQZA 2C0HA 4JCMA 4BV6A 1FRBA 1RHCA 2Z29A 3RNMA 4U28A 2D0GA 3A5FA 4P7LA 1JYVA 3JW7A 1X96A 2YA0A 4JDRA 2IQ0A 3M43A 4AYSA 3TXVA 4NAEA 2OVLA 2ISSA 3W1UA 2VRQA 5CSRA 4J1OA 4IFKA 2OCZA 2TRSA 4DZHA 5CAHA 2VRJA 1E4LA 4Q7IA 2ZVRA 4HP5A 2O9OA 4JL1A 2KZHA 3EMCA 3Q65A 3O6AA 4H6KA 4EANA 4L64A 1T8QA 3L9CA 5I5RA 3EOEA 4FPSA 3VIIA 5F2LA 4O57A 1V3MA 3D5HA 4DLFA 3USBA 3WH7A 3S1WA 1E3XA 3RAOA 5DXXA 3W25A 5C9ZA 2GSJA 3NL3A 3LM7A 1QUMA 1C93A 4PTVA 1RA5A 5CQ1A 2FH6A 5D4YA 1E71M 5HANA 4QRNA 1J9YA 3NO5A 1KBIA 5JU6A 1NF0A 4ZCWA 3QY8A 4JXCA 1A5UA 4JQ1A 4EACA 3NQFA 3W72A 2GOKA 1KBBA 2VGIA 2Z24A 3MMUA 1J10A 1M6IA 4MZ8A 4KPLA 3RX3A 4LUIA 4ATWA 4AZ6A 1M04A 2DH2A 1QATA 2PP3A 4GX9A 1A5NC 3LUTA 4JL2A 1KM6A 3CQIA 1AQFA 1GORA 3N17A 3SY1A 3TYDA 4XTDA 4QSFA 2GWNA 3OZYA 2ZRUA 3NJ3A 4PMYA 3LM3A 3ARVA 4ZA0A 3OZOA 3W28A 1LBFA 1MUWA 1R30A 4L4MA 2ZZ7A 4EKJA 3CH9A 3WDJA 3FGCA 1OG6A 3PULA 3ZVHB 3A13A 1NH6A 3TAKA 2HE5A 1R7OA 2EKGA 3LHYA 1QHZA 3W02A 2Z1SA 2O4QA 4TX6A 3T0BA 4ATLA 1J0HA 3U8GA 4UFMA 3WQVA 4H8NA 4RKAA 4NX5A 2E5BA 5DCBA 1OYCA 1FECA 4R33A 2W6RA 2PLMA 1OX4B 4I5UA 3WJZA 3M7WA 4ZFMA 3CTLA 3NL2A 4KEMA 2A7NA 1HX0A 3WIJA 1LRNA 4JTQA 4DB7A 4YHGA 3C86A 2YSWA 2LLEA 2VDHA 3UYIA 4MZ1A 1W1ZA 1O5KA 2QGHA 3W00A 1JZ7A 1GRAA 4AY1A 1IR2A 4GI6A 4J35A 4Z2HA 3SJNA 2ZUVA 4KFNA 4CNSA 4KIEA 4LC6A 4LBRA 5JBFA 3PTQA 5TD4A 4B9YA 4U3AA 4H9ZA 1KFKA 1CBGA 1SSGA 3KOWA 2R1NA 2FZBA 2DJLA 4I5XA 1I1WA 3AIBA 1BG9A 3EOUA 2OYKA 3WK0A 4Y9MA 2A5HA 3QMSA 2HJPA 2PPGA 1X8FA 1P1XA 3DN5A 1TCMA 5E0CA 2FPYA 2EO7A 1A5SA 4JIRA 4O0QA 3EDFA 2WSRA 4LYPA 3IJIA 3QMTA 1YLVA 3UJSA 4M1BA 3KTXA 3W7QA 2P53A 3RU6A 4F48A 5HK4A 1V0KA 2E9LA 3KVJA 1WXYA 4ORIA 3EWWA 2IPJA 2YL8A 4NJJA 1R2TA 1H11A 1TV7A 4Q4PA 1S2VA 3G18A 3DJJA 5HA7A 4UTIA 2BHZA 2PCQA 1H50A 3G22A 1GKRA 5HAOA 4WF7A 4O0KA 3T55A 4H4RA 5CSUA 3VMPA 2DT3A 4LBUA 2DJXA 3T8LA 3BGJA 4O8RA 3S3GA 4H8UA 5BXPA 1CB2A 2V30A 3FYYA 1BF2A 2XWDA 1HW6A 3EXSA 3NIYA 5IFTA 2EQ8A 2YDRA 1KV8A 2J6VA 2WLYA 1V97A 1CLXA 3OTRA 3NVWB 4PB4A 1M1BA 4AZ7A 1Q2RA 3O6DA 3HA1A 3VC6A 4JNYA 1W9VA 1E4IA 1FH8A 4W89A 3TVAA 2X42A 4RW5A 1W6TA 1E73M 2W67A 2WXDM 1DIKA 2E6DA 3IANA 4JY8A 3W88A 3H55A 2Y1HA 1J0IA 2B7NA 3WL0A 1GG0A 5I6SA 4UTKA 1AA1B 1FWBC 3TONA 3QTPA 3H23A 1GOIA 4H4XA 3LXCA 3QRHA 4N4QA 1A4MA 2FHBA 1M7OA 3T6CA 3WMCA 1N2VA 4DIAA 2QV4A 3W1QA 4M51A 3EGJA 2JIEA 3BPWA 1BZLA 5A2CA 4GUFA 3L5OA 3KRBA 3NL6A 4NZCA 4JFVA 4ZL1A 1AG1O 1KCXA 3PUOA 3UJFA 3NQ2A 1NFGA 5E1QA 4O1BA 2DUXA 4ERGA 2DSZA 2V68A 5BXSA 2J7CA 3FV9A 2QCMA 3R0DA 3TJXA 2Z1BA 4FIQA 4GIYA 1ZLPA 3WF3A 1CW2A 3PM6A 3RJXA 2AL1A 4ILSA 4U2YA 4MKSA 3GR4A 4RZ4A 1OCJA 3F2BA 3CZLA 4S3CA 1SJDA 1TR9A 1XLMA 4WQ6A 1VHCA 3GHRA 1H5VA 1PZ0A 4O14A 3QW3A 2X8HA 3PP7A 3AIEA 3SCRA 3VCRA 1JZ6A 1OY0A 5DN1A 3LHVA 1R8LA 3O1NA 3QH2A 4H7VA 1XLCA 1H0IA 2DZTA 4LRSA 4GUGA 3T8QA 3CGCA 5E6ZA 4HA1A 1ZY8A 2V0TA 4FX8A 1OFAA 3CUGA 2A0NA 3IAPA 4PMJA 5IBXA 3DGHA 1EZWA 2XVGA 2QIWA 1S2AA 4Y96A 4AIBA 3PZIA 4JNMA 2VZTA 3MWAA 2PTWA 1FXPA 1F73A 1HFBA 4I8DA 1Q66A 3D3FA 4NHVA 3HPFA 4CCEA 2R14A 2WJFA 2J8FA 4O1AA 3OO2A 5JCIA 1QPKA 1UWAA 5A8NA 2ZICA 3R8GA 3ALFA 5LNUA 1TMLA 3M0JA 1ZKQA 2FPVA 2GDVA 1B4KA 3T78A 2VZOA 9RUBA 3C0LA 4XQ6A 4ZQCA 4XBSA 3O8AA 1DXLA 2CFYA 3DGBA 5E0FA 3B97A 5FJTA 1A5AA 4C6LA 2Y63A 3T2PA 3QOKA 4ZB2A 1UMLA 2Z7GA 5BW6A 2JF7A 3OBEA 2PD9A 1YXDA 4C6NA 2C1HA 4O13A 1ME9A 2VM8A 3I7SA 2NSOA 3W23A 2WVUA 2ICSA 3CYVA 3LERA 1T3QC 1XLBA 4BY3A 3EAOA 1CTNA 1DXIA 4WOZA 3ZOAA 4S3GA 5G1TA 3LGDA 2WB5A 4DPPA 5C2GA 1SZRA 4DYEA 2OEJA 3L5LA 3MPGA 4GACA 4LVFA 4UMCA 3P3BA 1FA2A 1TV8A 2OQHA 3TC3A 2WMGA 1VFLA 3BAIA 5K9DA 3WLQA 4IPPA 4J3XA 5ABHA 4FLRA 2OGYA 1HVXA 4GXPA 3NO3A 4UQ9A 4K8DA 4WJ8A 4HCHA 1PX3A 2PC4A 3WQGA 2DVTA 5DCDA 1PYFA 3UR8A 4GD0A 3RK8A 1FIQB 4O18A 3BG5A 4G1KA 2V69A 5BROA 1LF1A 2V3FA 3DENA 3KOZA 4K8HA 3WY1A 1C9WA 1LG1A 2ZUSA 4HMNA 4A3YA 1KFLA 3WQ5A 2Y88A 3VA8A 3XISA 4U10A 1GQJA 5ABGA 3M46A 2XH7A 3EPOA 3WKZA 5A8PA 2FFCA 3GTHA 4XIAA 4UOJA 3B9DA 4FNUA 1QHOA 4YXGA 2D2GA 2KX9A 5T26A 3BAYA 1B4EA 1X8CA 3WYZA 1BF6A 3GXPA 3IV3A 5ECUA 4G1NA 4IP4A 3WH5A 1NSJA 1CXLA 1W32A 4Z0JA 1VJSA 3LGEA 3GYCA 3TC7A 5DY3A 2X50A 1TVLA 4UZUA 3GSMA 5DEZA 2PLCA 1ZJHA 4YWSA 1GVOA 4P2VA 1C7SA 1AH4A 3H70A 1UH4A 1XGEA 3KTSA 3KWXA 1AQMA 4ICNA 2VC5A 2VEMA 2VCAA 2WVTA 1NOWA 3OP2A 3QFEA 3SO7A 3N73A 1TWSA 2VDIA 3KCLA 3P74A 4ZOEA 2B0MA 5LXEA 2Z6JA 2ZA3A 4X63A 4BWLA 2VFDA 1UWQA 4OE7A 5C5YA 2QVNA 2V6OA 1OSEA 3CT7A 4FR1A 4AHOA 2V3EA 4IJBA 3L4XA 4GGBA 4V15A 3IK4A 4XSLA 2JKAA 2J47A 1LWIA 3CMJA 2W55A 3AALA 1EBHA 1FWFC 1M7PA 4ZQNA 3EB3A 4PZVA 1SO4A 1WAUA 3T05A 4AEEA 2G96A 3TSMA 4H4SA 3E2RA 4PSPA 1E0XA 3CZGA 2GK1A 1IWAA 3PPFA 3ITXA 4QNWA 2AQOA 1DJGA 2Q3OA 3KS6A 2G3JA 3N29A 3P6LA 1OBAA 4RDWA 3IJLA 2CETA 5JH1A 1P5BA 1T5AA 2Q3RA 4Q8NA 3LNMA 1CZ1A 1EA0A 3N18A 4DF1A 5IXEA 2XYLA 4HOXA 1EUNA 2OSYA 4GRSA 1RPXA 1FWDC 3OYZA 3CUHA 3CUFA 5CC6A 3H7VA 5D8WA 5BRPA 2J9XA 3GZ3A 1YRRA 3LA4A 2ZXAA 1V08A 2NX9A 1IEXA 3V18A 1BSLA 3STEA 3P2VA 4NJIA 3RNDA 1K8YA 5H8UA 1ZBWA 2X0HA 4HTYA 2ZA1A 3UETA 7TAAA 1VBGA 3OHIA 5BRBA 2ZOXA 3NM1A 3AXKA 1H1NA 2D1ZA 7A3HA 2VGGA 4HOZA 4JTAA 4PUMA 2FMNA 3V7PA 4XV0A 4BI6A 3VKAA 4NX0A 3VKKA 1GONA 2WLZA 4NVTA 3U4AA 3G8EA 2WOVA 2BCPA 4JTKA 8XIMA 4E6MA 2B7PA 1KD0A 4GY1A 1OF8A 5GJPA 2Q09A 3BG9A 4QJ4B 3B9NA 3MO7A 4QJ3B 4UFJA 1WYGA 4HPGA 1K03A 5CCZA 2Y61A 4HPXA 1QO2A 4NG3A 5G5HB 2WSKA 1DPMA 5FESA 4U5KA 2FKPA 3VI2A 3HV9A 1T7LA 1U2YA 3W84A 4GKLA 4JFWA 3TTOA 4KWOA 3BSMA 3NTYA 1HGWA 1N7KA 1HL9A 1S5NA 1TIWA 2X0SA 2ZDSA 3MMDA 3ZT7A 3DFTA 3S6TA 3ETRB 4KERA 3OPSA 1TKKA 5C8BB 1FWNA 1E0TA 4NP7A 1D3GA 1D7KA 3TTSA 3UXLA 1TWWA 4PMNA 3STPA 4A8NA 1C8YA 4EXBA 4AMAA 1V0MA 4FNTA 1IIGA 1WZLA 1EJTC 4RDZA 1O68A 1OB0A 1ONWA 1NF7A 3R89A 2VX7A 1PCKA 3R58A 1JQXA 4CN1A 1M65A 5U25A 2F6KA 4DELA 4C1LA 2O55A 4GYPA 5CPOA 3KUMA 1SUXA 4W7VA 2VFEA 3GDRA 3NQDA 1ME8A 4RCXA 2XFRA 4KWSA 3DFSA 3URBA 3DG7A 3O15A 2ACRA 3JZEA 3AHXA 1ZU8A 4AEOA 4ZMGA 1JCMP 1OD8A 5IHSA 1EJWC 4DJFD 1SZFA 3M5XA 1PKNA 2OKTA 5I7GA 1UR0A 1JI2A 4CCCA 2ALDA 3QLLA 3N13A 3B9JB 5GJNA 4NAFB 3LCLA 4F0SA 4H9VA 4LUJA 1IEWA 3CPRA 4Y7EA 3GNXA 4BQ2A 1M53A 3EWZA 4RV3A 1PE1A 4FNRA 4PUEA 2ADAA 2ISWA 3PANA 1WUFA 3KWSA 1XDIA 2TPRA 1ZMCA 3K8KA 2R1PA 2OKOA 4Q8OA 1VIZA 1C7TA 2A6NA 1MDLA 5BNKA 3PZNA 2FPTA 2XH0A 3DZ1A 1PX8A 8CGTA 5AHNA 3TN5A 1DE6A 1N8FA 4H00A 2CWNA 5JCNA 2YCIX 3M5VA 3T1GA 1V7YA 3EYPA 2FGBA 3P5YA 2J27A 1LDCA 1ADSA 3VGHA 1KQYA 1QK0A 4HU4A 3C0SA 4B5VA 3FHAA 1R86A 2PDNA 4AD4A 3OC4A 2HVMA 5DT5A 4DHGA 4PMQA 2ZXBA 5HMSA 4N0RA 3ITVA 5AC8A 1VGAA 4M82A 1Q6GA 1XWYA 3VDHA 5GQBA 3SIMA 1LRTA 4ZOCA 4RPPA 2WQPA 4O54A 1E56A 4GC4A 3W2LA 3TU9A 4LS1A 3LYEA 4J56A 1K3UA 1H51A 2BBFA 3FK4A 3H2CA 5M2FX 3BCFA 1A5CA 1NHPA 4TTGA 2PRHA 4L6DA 3S2LA 1H1ZA 4C1KA 4DUWA 3TN6A 1H62A 4NI8A 1W5MA 3AI0A 4DEFA 5CSSA 3JS3A 2BTMA 1FH9A 1FFUC 1J01A 4L5ZA 4D6FA 3GRIA 2EG6A 4FNQA 1MXGA 3LS9A 1J4EA 1HT6A 1KCKA 2BGSA 3PBYA 2VOMA 3CMGA 4XIMA 3W2KA 1TUFA 1J2WA 4UQEA 2W3RA 4F9JA 5CGQA 4DUOA 3FJNA 4W88A 1ZJAA 4JKMA 4Q22A 3LLFA 5M17A 1UW9A 4RUBA 1ICPA 4D72A 3SURA 1XLFA 3M6YA 1XL9A 1O1HA 3DDMA 1AZ1A 2WZEA 2WZIA 2ZKMX 2VENA 2PDCA 4UTWC 4QHRA 2GJPA 3GVRA 3TW6A 4AXKA 3I7RA 4DUVA 4LU0A 1ICSA 3L4WA 3CTTA 3TMQA 1E9IA 3HGOA 3S2NA 2YVGA 4ORMA 4EPDC 2Z1VA 1Q6DA 1H60A 2DIEA 2QAPA 4L7ZA 3CWOX 3RX2A 3HMJG 2GR2A 4ZO7A 3U0HA 1ZPTA 1VFMA 4HZ6A 4GG9A 1IGWA 3TOYA 3LNPA 4H04A 3V16A 3H53A 5F2MA 3EXRA 1R3TA 1UD6A 1VKFA 2A2IA 3G3DA 4PBGA 1X98A 2ASHA 1CXHA 3IJDA 4HSOA 3TV8A 3WFLA 3AUOA 2REQB 3LRKA 4IQDA 2GSHA 3RF9A 4EWND 3VOCA 2XM2A 2EQDA 4B92A 3KL5A 1JF6A 1MSSA 3KBMA 1PWLA 3GU2A 1S3HA 2WCSA 3JRKA 1QOPA 4Y6GA 1XDLA