1TKYA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with seryl-3'-aminoadenosine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
224
structure length
224
Chain Sequence
b'MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 75
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkyA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkyA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkyA02
4JWSC 1E7PB 2FBWB 1N63A 1RWSA 1ZUD2 1XLNA 4N58A 1OQQA 1V8CA 5H8YE 3SFDB 1F0ZA 1TJEA 3W9CB 1DOIA 4YSZB 1SF0A 4US8A 2WDQB 1OQRA 1WNUA 4C80A 1AWDA 2CJOA 3HUIA 3B2GA 3P4SB 1J7CA 3SFEB 1VLBA 1TKYA 3AEGB 3DWGC 1PDXA 2Y5CA 3LXFA 1XLOA 2N0SB 3HVZA 4C7ZA 1QOBA 1FXAA 3AE6B 1IUEA 1QOGA 1RM6C 1NYRA 1N5XA 1VJKA 4USAA 1JWBD 4HROA 3W5UB 2K22A 3B2FA 3CWIA 1FM0D 4ZHOA 2DWQA 2PKOA 2W55A 2WDRB 3FAHA 1WGKA 4IDIA 1XLPA 2PVGC 2WS3B 3LB8C 1FFVA 4JX1C 1V4PA 2ZZGA 1WXOA 1OFFA 1NI3A 1N62A 3W5VB 3NVVA 1FXIA 1SIJA 3BIID 3L4PA 5G5HA 3ETRA 3RHUA 3AN1A 2HTME 3NVZA 3ZYYX 4KX6B 1WXQA 1NYQA 2CJNA 3B9JA 5AUKA 2E1BA 1EWYC 4P6VF 1R7SA 5AUIA 3VR9B 5EE3A 2WU5B 1YJIA 1QOFA 4C7YA 3AE1B 1N61A 1J7AA 1QOAA 1FRDA 3NS1A 1PUTA 2BS4B 2AX5A 1ROEA 4N59A 1XLQA 1J7BA 2H88B 2QIEB 4US9A 5MPOA 2W54A 3AEAB 1JQ4A 1NENB 3AV8A 3P63A 3NVYA 2ZZFA 1E6EB 1N5WA 4LTUA 1PFDA 2WP9B 4ITKA 2JQRB 3P4QB 5EE1A 1GPXA 2WQYB 2E3TA 1DOXA 4YT0B 2M19A 5EE0A 2L52A 1A70A 3EUB2 2WLBA 3ABVB 3AEDB 1WWTA 1WYGA 2G1EA 2H89B 2B76B 4YTPB 4HRSA 2ZZEA 1GAQB 1RFKA 4WWMA 2W3RA 2BS3B 4ZOHC 3FC4A 5GXGB 3AE5B 4WQMA 3WCQA 3P1MA 3AECB 1L0VB 1YJJA 1L5PA 4YTNB 3P4PB 5G5GA 3RPFC 2PVOD 4YXDB 1E10A 1NVID 3AEBB 1DOYA 1FFUA 2L83A 3NRZA 3AE9B 1E0ZA 2LEKA 5EE9A 3HRDD 5C3JB 1CJEA 2DBYA 1KF6B 1V97A 1QF6A 3VRAB 1FRRA 2M56B 1WRIA 4FXCA 1V7OA 3KEWA 5H92C 1SB3C 1UWMA 2KMMA 2JX5A 3AEEB 2K9XA 5C2TB 1T3QA 4JWUC 1B9RA 3AE3B 1QLBB 3WQZA 1AYFA 1TKGA 1L6UA 1YQ4B 2MJDA 3AM9A 3SR6A 1TYGB 1NEKB 1ZXIA 3PO0A 1ZP0B 2QJLA 3VR8B 1VDVA 3AE7B 1RYJA 1ZOYB 2WU2B 1KRHA 3AE4B 2PIAA 3P4RB 3VRBB 1JW9D 3AE8B 1KFYB 2CU3A 4ZHPA 2BT6A 1QT9A 3AEFB 1FMAD 1XO3A 3KWLA 2MJEA 2KAJA 3AMZA 1DGJA 3AE2B 2EKIA 1L6VA 1FO4A 2MJ3A 2BS2B 2OHFA 3CIRB 1CZPA 1I7HA 1FIQA 2ACZB 3DWMA 1YQ3B 4A9AA 2ZTGA 4N6EB 1JROA 1JRPA 2W3SA 3NVWA 2WDVB 4YSYB 1TKEA 2Q5WD 3AH7A 1N60A 3AB5A 4YTMB 4YSXB 3RFNA 1E9MA 1JALA 2K5PA 1JWAD 2MH7A
chains in the Genus database with same CATH superfamily
1J8CA 4FJVB 1N63A 2BYTA 2GLSA 4A3PA 3UQBA 4MH0E 3T9LA 4M0WB 3B2GA 3SFEB 3LXFA 3B08A 1ZPSA 2DAJA 3RNEC 1STEA 3RZWC 5KHOA 3T3OA 4WAFA 3H7PB 1IBXA 1WXOA 4J6IA 5BMGA 5D7GA 1G6JA 4JPSA 1KLGD 3S2AA 1SXTA 1P9DU 1WM3A 4DXGA 3ZDTA 4GSWA 1V1PB 3GE3C 3NVYA 2N9PC 2KMAA 3ZJUA 2NCNA 5JH5C 5EE1A 2WXGA 1RAXA 2IO3B 4HKQA 2PE6B 2FAZA 5IOIA 3ZNGC 2WXNA 4K7UA 4YXDB 2ZW1A 3H6NA 2BYVE 3R2TA 3VTWA 4CI3A 1UBIA 2LVPA 2KOXA 1MHXA 2CHXA 1TS3A 1GNUA 3ZNID 1JWUD 4DXAB 2RSUA 2IUUA 5C2TB 4K7WA 1TTNA 1L6UA 3AM9A 2VH2A 3AULA 2PPHA 3L54A 2MWSB 4AREA 4GIVA 3ZJTA 1ZOYB 2DYMA 3U4EG 1UD7A 1WXMA 2D3BA 2KD0A 4L1BA 1FIQA 2D3CA 1WX7A 2KVRA 5T8IA 3VH4B 4FJYA 4I6NB 2BGFA 3RFNA 2K5PA 2MH7A 1GJZA 4CO7A 4E74A 3U2SC 1A5RA 1UBQA 3KYDD 4W9JA 3SFDB 3W9CB 2C5LC 3ZGZA 2MW5A 3HUIA 3OAWA 2WXPA 1FCLA 1PDXA 4KDIC 1WF9A 1V49A 1JMLA 1IGCA 4B9KA 2N9KA 1VJKA 3W5UB 4HROA 4C4VB 3AI5A 2J53A 2DHZA 2WXMA 2KJHB 3ZYYX 2JRIB 2B5MA 2WX0A 2Y6IA 3WIMA 2NMQA 3NS1A 4ICVA 1XLQA 3A9JB 3K9PB 2ZZFA 1FNUA 4M8MA 2LUMA 2MBEA 1IYFA 3TMPB 2Y3AA 3Q8CA 4W9IA 1WWTA 2G1EA 2B76B 4HRSA 2Z8LA 3Q8FA 2INPE 3QJZA 2D11A 2ZVNA 1E10A 3FILB 5DPRA 4MM3A 2QMTA 3MC0B 4MH8A 4EFOA 4ANVA 2ASQA 3X0WA 4ARFA 2XN9C 1VCBA 3ZTYA 2N9LA 4ACFA 3SR6A 2DX5B 4HK2A 2AQ3B 2BB6A 2DZJA 4KZ0A 3GS2A 4II2B 5IP4D 3QIJA 1FMAD 4A20A 4P16A 1SGHA 3AMZA 2KC2A 2MJ3A 4A9AA 2ZW0A 4IUMB 3KWVA 4WWPA 5L95C 1WFYA 4X57B 2L0TA 2ZCCA 3DBRI 3SDLC 1ZW7A 4LK0M 3NS8A 1F0ZA 2QILA 2LJ5A 4GDKB 3W1SC 2DNFA 2C9WB 3Q6BA 1L0XB 5TR5A 2M4NA 3R7QA 3PRZA 4TQ0A 4LDTD 1SBBB 4TQ1A 4XR0A 2DZKA 3Q3JA 1ZGUB 5AUIA 2MBOA 3AE1B 1WIAA 2AL3A 3DPDA 3D32A 4LNNA 1C3TA 4HDQA 2NR2A 1GOZA 3ECIA 3PZ7A 2WHIA 3IBEA 4ZRKA 2K8BA 3A4RA 2PEAA 2DLBA 2Y5PA 2WP9B 3RZFA 5BYRA 1YX6B 3URYA 3JSVB 3KVFB 5C23A 3EGRA 3AEDB 1K52A 2ZVOA 4YTPB 1T0RC 4NAWA 2YEPF 3A1QB 1EWCA 1P3QU 2MHJA 2WDTB 2EWJA 4AQ7A 1UF0A 2K39A 2O2VA 2LHEA 1HTOA 3H9DA 4W9GA 3JYUA 3SD5A 2C7HA 4LNOA 4ZRIA 3ALBA 3FKYA 1FEHA 3R8BA 4HCPB 1TKGA 2KFKA 1ET6A 2YEPB 1IBXB 2A5UA 2QJLA 3MP9A 2SEBD 1S3SG 4LLGM 1ECRA 3VRBB 2CKHB 2CU3A 4ANUA 1QT9A 1E90A 4BVUC 2O6VA 1E8YA 2EKIA 2IDYA 2JZZA 4GLSC 2ZJDA 3U7DA 2PW9A 2W3SA 3NY5A 2DZMA 1E9MA 4YSZB 5BYQA 2GOWA 5DPWA 4WWOA 1DOIA 3CF6E 2WXQA 3Q8AA 4DWFA 3M3JA 3RUIB 2WXRA 1MG8A 2AQ2B 1QOBA 3DVNU 4MDKE 2L0FA 2D10A 1SE9A 1HZ5A 1EF5A 3ZXVA 2GBRA 3B2FA 4EE2A 3K9OB 2WS3B 3E0CA 2MBHA 1NI3A 1N62A 2KDIA 3QHTA 4AR1A 2E1BA 2J7QB 3Q3OC 3R66C 1Q0WB 4FJZA 1XEEA 5EDSA 1BT0A 3A9KA 2AX5A 3Q8BA 4WJOA 3I5JC 3AEAB 1JQ4A 2K0PA 4J3OD 1FNVA 1TIFA 2M8SA 2Y3UA 2VRRB 3VDZA 2OJWA 2IGDA 4S17A 2GBJA 4ZOHC 3P1MA 5HFYA 4FA6A 2UWQA 2GBMA 1E8WA 3HRDD 2NBVB 3MJ5A 1SJED 3WA0A 4FXCA 1J0GA 2QCZA 4GOCA 1BXTA 1HA5A 2M0AA 2JX5A 3RD2A 1V1OA 4EZJA 1TYGB 5JXVA 2I05A 1UUPA 4M01A 3UIOB 2KO3A 4TV3A 2KN4A 2BT6A 2BKRB 3I8CA 1CK1A 3KWLA 3M63B 3VUXA 3AE2B 4IWOA 2FIDA 2N4FA 2JVCA 2OHFA 3CIRB 3RYTA 1N60A 4YSXB 1UWXA 1JALA 1KTKA 2JZ3B 1D4BA 3MFGA 3BYYB 2AL6A 2RPQA 5BO4B 4TKNA 4ARCA 2MBQA 1K50A 2V4LA 1AN8A 1FNWA 1N5XA 2N1WA 4F7ZA 2EKEC 2DWQA 2W55A 3GOEA 4MM3B 3LB8C 2KHWB 1YN4A 1F52A 4PYUA 4MGIE 3TEYA 3N1ZC 2I1JA 1WX8A 1NDDA 2LRWA 1R4MB 5EE3A 2D3GA 3LDZE 3TBLD 1VZ6A 2LGSA 2KXJA 3BK1A 3QC8B 4I6LB 2W54A 3MTNB 4A8XC 2MRPA 3VAWA 3ZNHB 2L1AA 2RMMA 2WQYB 2PE9A 2M19A 2RDGA 4II3B 2LGXA 2AYOB 3EUB2 3HK0A 4JQWC 2ZZEA 2D2QA 4WWMA 3AE5B 4MT5A 3KW5B 3J9CA 2LRUA 3GZNB 1C9FA 4K3BA 5D3DA 3RN9C 1CJEA 3WALA 1ZDXA 2BPSA 3Q69A 3VHTC 4W9HA 1WRIA 4LJOB 2IO2B 2ON8A 3DBSA 3AEEB 1EU3A 2RR9A 2NPTA 3APCA 1I4QA 1L0YB 2BYEA 2WXJA 4NY0A 3AE7B 2LUEA 3I89A 3ENEA 1E5WA 3AEFB 1YNTE 3KYCD 1V86A 1YOVB 1UELA 1XXGA 3AH7A 2R2OA 2BB5A 5EE9A 1ACCA 4JWSC 1ZUD2 3OJ3A 3ZWDA 1MFWA 2K8CA 5G55A 4CI2A 3UI3A 4ZRPA 4NNJB 3P42A 1ZXHA 4NAWB 4XYCA 2REXA 4NJCA 1IUEA 1RM6C 4KKJA 1MHHE 3VH3B 5FKAC 4O1NA 4URKA 3ZTDA 2ZOSA 4IWPA 4HJGE 2KYWA 4LNKA 4OVUA 4DHZE 2O2VB 3PPAA 1YJIA 2KFKB 1F1HA 4IOIE 3TEWA 2RDHA 4UDUC 4MGZE 4EZLA 2IY0B 3UINB 2WWZA 1YX5B 1PFDA 1LXDA 2O6VB 1DOXA 3MJWA 2LGYA 2L52A 1BMLC 2IO0B 2GBKA 4XDDA 1ENFA 3QAQA 3VUWA 3BVZA 4E5ZA 5IKCM 4MJSA 3ZX5A 2L05A 2KMCA 5E6JA 4BOZB 4IM3A 1WSPA 3ZLZA 1E8ZA 1TS4A 3PREA 4DHJD 1V5TA 5GMVA 5D3IB 2D07B 2ZZPB 1F77A 1ZDVA 3CSTA 5JHBA 2G45B 1PGXA 1QILA 2N7DA 5G2NA 3WAPA 4BAXA 4RM8A 3T8MA 3APFA 2LXCA 3KUDB 1JW9D 1KFYB 4C00A 5FK9C 5J17A 1AARA 3Q2AC 3IG3A 1C4PA 4K3CA 1YQ3B 3A9KB 3JVZX 2KX3A 3DHIC 2N9EB 1JWAD 1SEBD 3DVNV 3ZKJC 4N58A 4DDID 1OQQA 5H8YE 4OZCA 1ESFA 1TJEA 3NUHB 2MQJA 2V9HA 5FQDA 2CJOA 2LMCA 4RGTA 3CMMB 1TKYA 2Y5CA 2BKFA 1WR6E 2CHWA 4RGNA 1C77A 2HJ8A 4FADA 4WQOB 4USAA 4ZHOA 2WXHA 1WXVA 4C56C 2WX1A 1KH0A 2PVGC 4K1RB 2ZZGA 4XWTA 3TJPA 3E56A 1FXIA 2Y50A 3L4PA 2HTME 5LNK1 2KDEB 4JGHB 2N7EA 1WXSA 2V3PA 3IVFA 4HCNB 1TY2A 5JZEB 3HIZA 2Y5BB 2IY1B 1UGJA 3APDA 4W9EA 1BUIC 3P2BA 5DCNA 2VZKB 4US9A 2QIEB 2IUSA 3DQVA 4IKGA 3ZNZB 1E6EB 1N5WA 2KX0A 3BVGA 1L2NA 2JQRB 3IXSA 2NTSA 5LXHA 1A70A 4TUUA 4AWJA 3ZVVA 2EELA 4TMAB 4A11A 3WCQA 2KTFA 1NBFC 1YJJA 2FNJB 1PYWD 3IT4B 4NPNA 3Q3FA 3MC8A 4EKUA 3MHZA 3V3XA 4OZBA 2YVCA 4FHKA 2DBYA 4M02A 5KHQA 2BTEA 1V7OA 2PJHA 3IT6B 1UWMA 3L0WB 1D6EC 4R3DA 2JYTA 4IC7B 3AE3B 1XCTL 1WJNA 2PMVA 1RYJA 3PRPB 2INCC 4MSMB 2W9NA 1IGDA 2FCSA 4ZHPA 4G0NB 2MBBB 1LFDA 1EU4A 4DHZB 1R4MI 3WANA 5DPTA 1WZCA 3EC8A 1SJHD 3ML9A 2FBWB 4W9CA 1NI2A 3EI2A 2NS5A 4BKTA 2WDQB 4RF0A 2DENB 3BWUD 4WURA 2WXKA 2C7NB 2KDBA 1JWBD 2FE8A 1TT5B 3GZNI 2QC8A 3I57A 1XLPA 3OG5A 2IPKD 3VQIA 3PHXB 3RHUA 1NYQA 4ANWA 4NQKE 3VR9B 3I7NA 5IA7A 3UF8A 1TS5A 2G4SA 3RNGC 2HYEA 3KUZA 2NPTB 3PV1A 2KN5A 4N59A 4KSKC 2V3NA 2IBIB 4RMAA 4A55A 5JHAA 4IW0A 4M8NA 2LJIA 1E7VA 1YMHE 3RNFC 1VD2A 3Q8EA 4RH6A 3EECA 1WYGA 5AZHA 2XEWA 4G3XB 1FD6A 3EI4A 1WRDB 1XCQL 3QX1A 4KGTA 2KKCA 1IP9A 1OTRB 2LHDA 1DOYA 2KANA 5E6OA 2X8XX 4AUQC 4FBJB 2CR5A 2O6VD 2BWFA 2HE7A 2M1MA 4Q2JA 2I38A 4JL9A 2HDEA 1F2RI 2C7MB 2DYBA 4FHJA 3RFZB 1FCCC 3RNBC 3R7RA 1P7EA 1WX9A 1VDVA 1RRBA 3U7ZA 1K53A 2MJEA 4KZCA 2BS2B 1RFAA 4PS3A 1SE2A 1JROA 2EMSA 1GB4A 2WDVB 3AB5A 1I4RA 1E7PB 2UU7A 1RWSA 4KKIA 1XLNA 3VTVA 4WJPA 2PLPA 2WGSA 1WY8A 2K6DB 1J7CA 1T6BX 2VH1A 3TUOA 4ZYSA 3AE6B 4MJSB 2XK5A 4REZA 2K22A 1FXTB 3O65B 3QCAA 3BY4B 3VFKA 3T3NA 1UH6A 3NVZA 2CJNA 2C60A 3B9JA 1EWYC 1T0YA 4M00A 2B3AA 4E3CA 2AQ1B 4AS1A 3E9SA 3ZO5B 2BS4B 2V3SA 2HD5B 3TSSA 2CU1A 4KGSA 1J19A 2L7RA 4XGAB 3M95A 1GAQB 3N9YC 4PYZA 2SAKA 5FR6A 2JXTA 2HJ1A 2VZKD 1NVID 4DXFA 4IM0A 1SIFA 4W9KA 2LEKA 3DHHC 1D5XC 3UQAA 1EM7A 4I6PA 1V97A 5BMHA 3N32A 2JXXA 3KEWA 4E71A 2NTTA 2ZPNA 3RNCC 4B0EA 3HM3A 1WMHA 3WQZA 4AP4C 4KDLB 4KIKA 4H2AA 1SSNA 3PTFC 4F1SA 2WU2B 4GU2A 2V0GA 4CI1A 2KQ4X 2INDC 1DGJA 3PZ8A 3QQ8B 2ZCBA 3EI3A 4DDGD 2ACZB 1VRAB 3GE8C 4PS7A 2IO1B 2W82A 2ZEQA 1XVIA 2A4ZA 2Z0EB 1WNUA 1VLBA 5HHDG 1PQSA 3VTUA 4D2KA 2BYFA 4KGRA 4B0MA 4US8A 1OGWA 4FLHA 2PKOA 2ICIA 4DK5A 4DQOC 4MEMA 1V2YA 5G5HA 4NAMA 1JWSD 2ZPYA 3WAOA 1PGBA 4BKSA 3ZUNA 3RMKC 3PVLA 1J7AA 3EA6A 1M94A 4RGOS 4WWNA 3O13A 3KQ4A 1Y56A 3DBLI 1S1QB 3DHGC 1AW7A 1TGZB 1MJDA 3ZTWA 3DBHI 4YT0B 2JF5A 2AWTA 2WLBA 4MGYE 2RDBC 2K25A 5D6JB 2I1KA 2IGGA 4RFBA 1KOTA 3RPFC 1WGGA 3I7OA 2WXOA 1JRUA 1FPYA 4HVBA 5C3JB 1T5XD 4P1BC 2GMIC 4AJYB 3DCGA 2MP2A 3BINA 2WXLA 3DVGX 4G11A 3VRAB 2BQQA 2LI5A 4AR8A 4BBNF 4HEA1 2LASA 3BZDB 1F9JA 3V6EB 2OOBB 4IWQA 1VR9A 2KLCA 3OWEB 4XR1A 1WXAA 1LM8B 5HKHA 2KAJA 4LCDE 1L6VA 1WZ3A 2KWVB 3TCAA 4RGMA 4OVZA 5TSSA 4A6QA 1M4VA 2Z59B 3MC9A 4GB9A 1RLFA 2Q5WD 4XZ4A 1K51A 2LGIA 2KQSA 3CSFA 1YN5A 2D5GA 1YQBA 3VXWA 2FCNA 3PGEA 1SF0A 1HQRD 4C80A 3I7PA 2KDFB 2QDFA 3ZDMC 2Z0DB 1V9JA 1NYRA 1WE7A 1Q5WB 3FAHA 2QHOA 1V4PA 2KWCA 4BBNC 1HZ6A 5IO9A 4A90A 2LWPA 4ICUA 4WJQA 3H7SA 4KX6B 2K6QA 3IHPC 2G9HD 1D5ZC 2FCQA 2G3QB 1R7SA 4ARIA 2I2YA 2KQ7A 1FRDA 2M0XA 2TSSA 1ROEA 2KC1A 3V61A 3AV8A 1TBEA 1C4AA 1WJ6A 1H8CA 3ABVB 1TZ1A 3V60A 1RFKA 1N6ZA 3GP7A 4XE0A 3AECB 2PVOD 1EO6A 2L83A 2KDMA 4JLCA 3I7HA 3PLUA 3C8YA 1E0ZA 3BYTB 3TL5A 4CYEA 1LO5D 1KF6B 4L23A 1XF5L 1XQQA 2NBUA 3Q14C 1F2RC 4MELA 2XK5B 4RCOA 2KZRA 4LDTB 2XNAC 4GXBA 2XBBC 1KM7A 1NEKB 2MA9B 2B5LA 1C76A 3ML8A 4RNAA 2PTLA 4AR9A 2KK8A 4A09A 1I4HA 1SE3A 4JE3B 3V05A 3HHMA 1WGHA 1SE4A 2ZTGA 4WH4A 3X23A 1MPEA 3RT3B 5FR3A 2J52A 3ZX4A 3UGBB 3TEXA 3C0RB 1ISNA 2QSDA 2X38A 3UIPB 2E6XA 4A0AA 2KT7A 2DYOA 2QEJC 1K8RB 1VZ7A 3QK0A 1FXAA 1P7FA 3BK2A 4OW0A 1WGDA 1C78A 1I42A 2WNMA 1I4PA 4JX1C 5IAAC 1EF1A 3V6CB 3W2DA 4PS8A 3JW0X 3ETRA 3A4SC 1WXQA 5AUKA 2NVUI 1WJUA 2WU5B 1WMHB 1DYQA 4KIKB 1PUTA 1Q1OA 1J7BA 1E8XA 3P63A 3QWZB 4HLEA 3V62A 4HWIB 1HE8A 3IAM1 4WQMA 3BVMA 3C19A 1ET9A 1C1YB 3H1UA 4AOFA 3AE9B 5D94A 1TY0A 2L00B 4GDLA 3L08A 3I7KA 1Z2MA 1V81A 5I4DA 4WIPA 3ZRFA 1AYFA 1WR1A 5CHFA 5L83A 1T0SC 2LVOA 1XD3B 2IZVB 1KRHA 4K81A 3ZIMA 1XO3A 4HPPA 5HG2A 3NZSA 4N9F4 1CMXB 3PS6A 2J4XA 1JRPA 3NHEB 1L7YA 3Q3NC 4W9DA 4YTMB 3EFUA 2CS4A 4RF1A 3A33B 4GGQA 1WGYA 2JZPA 3DBLB 4GN1A 2RD0A 4GMVA 4DBGA 1XLOA 2N0SB 3HVZA 3U30A 4C7ZA 4G50A 2DAFA 2KTRA 2GRIA 2JWZA 3DBHB 3ZUPA 3VUYA 2FUHB 3ZQ4A 4IDIA 5E6PA 4XWWA 2MP2B 3W5VB 2IUTA 5AEKB 4ZRJA 2LD9A 1C79A 1GC6A 2JT4B 4P7IA 2YLMA 2K8HA 4EEWA 2GBNA 4MACA 1GUAB 4XC2A 1NENB 2JRHA 4LTUA 4JIOU 3P4QB 1UGMA 5BMIA 1V80A 2JY6A 2OEDA 5EE0A 2LVQA 3NG0A 2MSED 2KVZA 1GB1A 2IYDB 4ANXA 3FC4A 3PT2B 3MHSD 4YTNB 4OHJA 2LFIA 4HPMB 4MSQB 2JPHA 2I06A 3ZRCA 1QF6A 2DZIA 2RGFA 3B0AA 3I9V1 4IG7B 1WE6A 1FRRA 2M56B 4K7SA 2KMMA 4YL8A 3DDCB 2K9XA 1T3QA 3PRMB 1KJTA 4XDCA 4NZLB 3OJ4B 3VVWB 1ZP0B 1D5MC 2R61A 4XR3A 2JWUA 3AE4B 1WH3A 2D3AA 1WI0A 3AE8B 2K1FA 4HDOA 5LXIB 1KLVA 2OJRA 3L16A 1CZPA 1I7HA 3IFWB 1WYWB 4ASWC 2KFJA 3HVDA 1TKEA 4YSYB 4EOYA 3U8ZA 1R4NI 3M62B 1U4AA 3KLSX 1MI0A 4P1CC 2FUG1 2FIFA 1OQRA 4KVGB 4QAYA 3ZJVA 1XT9B 3L13A 1FM0D 3LYYA 4HPLB 4TSSA 1WGKA 2JUOA 3RULA 3I8EA 2LZ6A 1I4GA 2M17A 3AU5A 3AN1A 1LGRA 3DVGY 1QOFA 1WZ0A 1UNSA 4TZ4A 4FN2A 3L10B 4WAAA 2L32A 1QKZA 4A3OA 5BYSA 2INNE 1OEYJ 5CX3A 3WAMA 1T0QC 3QARA 2WXFA 1GPXA 4YWGG 2NBWB 4RM9A 4M0WA 2J0JA 3ZW7A 4HKZE 5GXGB 1Y8RC 2N9XA 1YJ1A 3P4PB 1I35A 1OQYA 1MVKA 4L2YA 3PZDA 3H7PA 1V6EA 2BBCA 3U52E 1P1AA 4AJWA 5AZFA 1QZEA 1V5OA 1Q10A 4NQLB 5H92C 1SB3C 2HTHA 4E54A 1QLBB 1YQ4B 2ZNVB 3NJTA 3PO0A 1ZE3D 3L17A 1I4XA 5E6NA 1V1PA 4OZAA 2JSVX 4B95A 4CQNA 3AU4A 5HI1A 2GI9A 1D3ZA 2BW2A 4HXDA 3NVWA 3N3KB 3NZ3A 2IGHA 4W9LA 2EMTA 2ONQA 1HEZE 3RCZA 1V8CA 2BVCA 4BKSD 1P98A 1AWDA 2FCMA 2ZNVC 2KWDA 3N30A 1ZKHA 4KV2A 1B9RA 3EHVA 2WDRB 1HXYD 1CQVA 2WYQA 4EZKA 1FFVA 2MX2A 1OFFA 1SIJA 4DHJB 1PGAA 4GDLB 3SEBA 3ZW3A 1YD8U 3PHWB 4LJPB 5D2MB 2BWES 2L8JA 4XX5A 1P0RA 1VZ8A 4XR2A 1MG4A 3EI1A 3R2IA 3EFCA 3KUCB 4CHKA 2H88B 2KJ6A 4WJNA 1IPGA 4ITKA 4NJ7A 4A0BA 4ZDVA 5AZGA 2H89B 1JWMD 3OLMD 1E7UA 5J2RA 1L5PA 5C1ZA 1TS2A 4C4VA 3W1YA 1B1ZA 2L3ZA 2J0MA 1YIWA 4LNFA 2K3UA 3IAS1 2MCNB 2KTRB 3ZXRA 5IN7A 1H4RA 2LXAA 3PSEB 2MEKA 3PLVA 4NJ6A 3A9JA 2BF8B 2PIAA 4BKGA 1TZOA 4EUTA 1WGRA 2CHZA 4N6EB 2GB1A 3LJ3A 1LQBA 3N1XC 3R3MA 2V1YA 2N1VA 1WJ4A 4W9FA 2JU6X 4KSLC 2AEHA 3FILA 3NZUA 3HM6X 1X1MA 3P4SB 3AEGB 3DWGC 3Q3MC 5J18A 3I63C 3RI7C 4PT5A 4PK1A 5CHVC 4S0RA 1QOGA 3CWIA 4BOSC 1HTQA 3I3TB 1C4CA 3QA8A 3ZU6A 2KWUB 3W1SA 3ZTCA 3ZWKA 3NVVA 3BIID 3AXCA 3GB1A 4P6VF 1Z5SB 4BZAA 1GG3A 5CHWA 2L76A 4C7YA 2G4DB 4F8CB 1OEYA 1N61A 3I7LA 1QOAA 2MLBA 1UZXB 4B6WA 5DPSA 2N7JA 1QQRA 4BFRA 1L4DB 3NOBA 4IM2A 5MPOA 3DBRB 3N20C 2KJRA 1JCKB 4LNIA 2E3TA 2JYEA 3SU8X 4GDKA 4ZYNA 3ONSA 2W3RA 2BS3B 1L0VB 5G5GA 3TEZA 3AEBB 1FFUA 3NRZA 5LLIA 3RNAC 3B1LX 4OVVA 1R4NB 2WXIA 4FULA 3N1YC 1GC7A 3KH0A 4JWUC 3DOWA 2MJDA 1EUVB 1YN3A 2KNBA 1ZXIA 4ZRQA 3VR8B 3SHQA 2KLGA 3P4RB 2RPVA 3H8HA 3TIXA 1WM2A 1KLUD 2UYZB 3JSVA 1FO4A 2V4IB 2IJ0A 2J42A 3DWMA 2LGDA 4A08A 2J0KA 4MGKE 5CTRC 1L4ZB 3A1QA 2KACA 4HJKA 2R2QA
chains in the Genus database with same CATH topology
1KTKA 1D4BA 1E7PB 1N63A 1RWSA 4KKIA 3MFGA 1XLNA 2BYTA 3BYYB 2JZPA 2PLPA 3B2GA 1J7CA 1T6BX 3SFEB 3LXFA 4ARCA 1K50A 1XLOA 2N0SB 1AN8A 3HVZA 3TUOA 4C7ZA 1ZPSA 4ZYSA 3AE6B 2GRIA 1FNWA 1STEA 1N5XA 4REZA 2K22A 3T3OA 2DWQA 2W55A 4WAFA 3ZQ4A 3T3NA 4MM3B 4IDIA 1IBXA 3LB8C 4XWWA 1WXOA 3W5VB 2IUTA 1YN4A 5BMGA 3TEYA 5D7GA 3NVZA 2CJNA 1C79A 3B9JA 1EWYC 4JPSA 1KLGD 5EE3A 1SXTA 2AQ1B 4AS1A 3E9SA 1VZ6A 4DXGA 2BS4B 3BK1A 4MACA 2W54A 3TSSA 1V1PB 1NENB 4A8XC 3NVYA 4KGSA 4LTUA 3ZJUA 5EE1A 2WXGA 2L1AA 3P4QB 2RMMA 2WQYB 5BMIA 2M19A 2RDGA 4HKQA 5EE0A 2OEDA 3EUB2 2ZZEA 1GAQB 3N9YC 4WWMA 2SAKA 1GB1A 2JXTA 2WXNA 3FC4A 3AE5B 4MT5A 4YTNB 2VZKD 4YXDB 3J9CA 2ZW1A 1NVID 4OHJA 4DXFA 1C9FA 2LFIA 5D3DA 2LEKA 3R2TA 2I06A 1D5XC 4CI3A 1CJEA 1EM7A 1ZDXA 1V97A 1QF6A 3I9V1 3Q69A 1FRRA 2M56B 1WRIA 5BMHA 1MHXA 1TS3A 3KEWA 2ON8A 1JWUD 2KMMA 3AEEB 2IUUA 2NTTA 2K9XA 4B0EA 5C2TB 1T3QA 3WQZA 1EU3A 4XDCA 1I4QA 1L6UA 1L0YB 4NZLB 2WXJA 3AM9A 1ZP0B 4H2AA 3AE7B 1SSNA 4AREA 1D5MC 3ZJTA 2R61A 4XR3A 1ZOYB 2JWUA 2WU2B 3AE4B 2DYMA 3I89A 3U4EG 3AE8B 2V0GA 4CI1A 3AEFB 2KQ4X 1YNTE 1DGJA 4L1BA 3PZ8A 3EI3A 1CZPA 1I7HA 1FIQA 2ACZB 1VRAB 5T8IA 3HVDA 1TKEA 1XXGA 3AH7A 4YSYB 3RFNA 2BB5A 2K5PA 5EE9A 2MH7A 1ACCA 2W82A 4JWSC 1ZUD2 3U2SC 3KLSX 1MI0A 3SFDB 2FUG1 3W9CB 1WNUA 4CI2A 3UI3A 1OQRA 3ZGZA 1JALA 3HUIA 2WXPA 4ZRPA 1VLBA 5HHDG 1FCLA 1PDXA 3P42A 1ZXHA 4D2KA 4NAWB 1JMLA 4KGRA 1IGCA 3ZJVA 2N9KA 4NJCA 1IUEA 1RM6C 4KKJA 4B0MA 4US8A 1MHHE 1VJKA 3W5UB 4HROA 5FKAC 4O1NA 1FM0D 3LYYA 2PKOA 2ICIA 4TSSA 1WGKA 4DQOC 3I8EA 2J53A 1I4GA 2WXMA 5G5HA 4HJGE 1JWSD 4NAMA 3AN1A 3ZYYX 1PGBA 2B5MA 1YJIA 1QOFA 4IOIE 1UNSA 2Y6IA 1J7AA 3EA6A 3TEWA 2RDHA 4TZ4A 2NMQA 3NS1A 4RGOS 3O13A 3KQ4A 1Y56A 4UDUC 1XLQA 2L32A 1QKZA 1AW7A 5BYSA 2INNE 2ZZFA 1FNUA 1PFDA 2LUMA 2WXFA 1GPXA 4YWGG 1DOXA 2Y3AA 4YT0B 4M0WA 3Q8CA 2L52A 2WLBA 1BMLC 4XDDA 1ENFA 1WWTA 2G1EA 2B76B 4HKZE 4HRSA 2Z8LA 3Q8FA 2INPE 3BVZA 4E5ZA 2IGGA 4RFBA 5GXGB 3RPFC 3P4PB 1E10A 2WXOA 3I7OA 3FILB 1MVKA 4L2YA 5C3JB 1T5XD 2BBCA 2QMTA 5E6JA 3MC0B 3U52E 4MH8A 1WSPA 2WXLA 1Q10A 3VRAB 1TS4A 4ARFA 5H92C 1SB3C 4AR8A 4HEA1 3BZDB 2XN9C 4E54A 2N9LA 5D3IB 1QLBB 1F77A 1ZDVA 1YQ4B 1VR9A 3SR6A 3PO0A 2AQ3B 1PGXA 3OWEB 2BB6A 1QILA 1ZE3D 4XR1A 1I4XA 3GS2A 1V1PA 4OZAA 1JW9D 1KFYB 2JSVX 5FK9C 1FMAD 4CQNA 2KAJA 3AMZA 4P16A 5HI1A 2GI9A 1C4PA 1L6VA 2MJ3A 4RGMA 4OVZA 5TSSA 4A9AA 2BW2A 1YQ3B 1M4VA 4A6QA 3NVWA 2ZW0A 2Q5WD 3KWVA 3NZ3A 1K51A 2LGIA 2IGHA 1JWAD 1SEBD 2ONQA 1HEZE 4LK0M 4N58A 1YN5A 1OQQA 1V8CA 4OZCA 2D5GA 5H8YE 1ESFA 1TJEA 1F0ZA 1SF0A 3NUHB 2QILA 5FQDA 1HQRD 4C80A 1AWDA 2CJOA 2LMCA 4RGTA 3I7PA 4GDKB 1TKYA 2Y5CA 2KWDA 1L0XB 4RGNA 1C77A 1NYRA 4USAA 4ZHOA 1B9RA 2WXHA 2WDRB 3FAHA 4C56C 1HXYD 1CQVA 4TQ0A 1KH0A 2PVGC 1V4PA 1FFVA 4XWTA 2ZZGA 3E56A 1OFFA 1HZ6A 1SBBB 4TQ1A 4A90A 1FXIA 1SIJA 2Y50A 3L4PA 1PGAA 4GDLB 2HTME 3SEBA 5LNK1 4KX6B 4XR0A 2G9HD 1D5ZC 1R7SA 5AUIA 2V3PA 1TY2A 1VZ8A 3AE1B 4ARIA 4XR2A 2I2YA 1FRDA 1UGJA 3EI1A 2TSSA 1BUIC 3R2IA 2VZKB 1GOZA 1ROEA 4US9A 3PZ7A 2H88B 2QIEB 2IUSA 2DLBA 2Y5PA 3AV8A 4IKGA 1E6EB 1N5WA 3BVGA 1C4AA 2WP9B 4ITKA 2JQRB 3IXSA 5BYRA 3URYA 2NTSA 4A0BA 3EGRA 1A70A 3ABVB 3AEDB 1K52A 2H89B 4YTPB 2EELA 1RFKA 4TMAB 1JWMD 2YEPF 3GP7A 3WCQA 4A11A 4XE0A 1EWCA 3AECB 1YJJA 1L5PA 1PYWD 2PVOD 3IT4B 1TS2A 2L83A 2KDMA 3I7HA 3C8YA 1E0ZA 3MHZA 3V3XA 2EWJA 4OZBA 4AQ7A 1B1ZA 3BYTB 2DBYA 1LO5D 1KF6B 4L23A 1XF5L 2K3UA 2LHEA 2BTEA 1F2RC 1V7OA 3IAS1 3IT6B 1UWMA 1D6EC 4R3DA 4RCOA 2JYTA 3AE3B 2XNAC 1FEHA 1XCTL 3R8BA 1TKGA 1ET6A 2PMVA 2YEPB 1IBXB 1NEKB 2QJLA 2MEKA 3MP9A 2B5LA 2SEBD 1RYJA 4LLGM 1C76A 1ECRA 4RNAA 2PIAA 2PTLA 1IGDA 3VRBB 4AR9A 2CU3A 4ZHPA 1TZOA 1QT9A 4A09A 1I4HA 1SE3A 1EU4A 4JE3B 3V05A 2EKIA 2IDYA 1SE4A 4GLSC 2ZTGA 2PW9A 4N6EB 4WH4A 2W3SA 2GB1A 1MPEA 1E9MA 5FR3A 4YSZB 5BYQA 2J52A 1SJHD 2FBWB 2JU6X 3TEXA 3FILA 2QSDA 3EI2A 1DOIA 3Q8AA 2WXQA 2WDQB 2X38A 4RF0A 3P4SB 3BWUD 2E6XA 4A0AA 4WURA 2QEJC 2DYOA 2WXRA 3AEGB 3DWGC 2AQ2B 2WXKA 1QOBA 1VZ7A 4PT5A 1FXAA 1P7FA 1HZ5A 1QOGA 1JWBD 2FE8A 3B2FA 3BK2A 3CWIA 4EE2A 1C4CA 4OW0A 3I57A 1C78A 2WNMA 1XLPA 1I4PA 4JX1C 2WS3B 3W1SA 3E0CA 2IPKD 1NI3A 1N62A 3VQIA 3NVVA 3BIID 3W2DA 3ETRA 3RHUA 4AR1A 3GB1A 1WXQA 1NYQA 5AUKA 2E1BA 4P6VF 3VR9B 3I7NA 1TS5A 2WU5B 1XEEA 4C7YA 2HYEA 1N61A 1DYQA 3I7LA 1QOAA 1PUTA 2AX5A 2N7JA 3Q8BA 1QQRA 1L4DB 4N59A 1J7BA 5MPOA 2V3NA 3AEAB 1JQ4A 2K0PA 3P63A 4A55A 1JCKB 2LJIA 2E3TA 1FNVA 1YMHE 2JYEA 4J3OD 2Y3UA 3Q8EA 4RH6A 1WYGA 2IGDA 1FD6A 2W3RA 3EI4A 2BS3B 4ZOHC 3IAM1 1XCQL 4WQMA 3P1MA 1L0VB 3BVMA 4KGTA 1ET9A 5HFYA 5G5GA 2LHDA 3TEZA 1DOYA 3AEBB 1FFUA 3NRZA 3AE9B 3HRDD 3MJ5A 1SJED 1TY0A 2WXIA 4FXCA 1BXTA 4Q2JA 2I38A 1HA5A 2HDEA 3I7KA 2M0AA 2JX5A 1F2RI 4JWUC 5I4DA 3RFZB 4WIPA 1AYFA 2MJDA 1FCCC 1YN3A 1V1OA 1TYGB 1ZXIA 4ZRQA 1P7EA 3VR8B 1VDVA 5JXVA 2I05A 1UUPA 3U7ZA 1KRHA 3P4RB 2RPVA 2KN4A 3H8HA 1K53A 2BT6A 3I8CA 1CK1A 1XO3A 3KWLA 2MJEA 1KLUD 3AE2B 5HG2A 1FO4A 2BS2B 2IJ0A 2J42A 2OHFA 2V4IB 3CIRB 3DWMA 1SE2A 4A08A 2J4XA 1JROA 1JRPA 1L4ZB 1GB4A 2WDVB 1N60A 3AB5A 1I4RA 4YSXB 4YTMB 1UWXA 2KACA 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWS C;  1E7P B;  2FBW B;  1N63 A;  1RWS A;  1ZUD 2;  1XLN A;  4N58 A;  1OQQ A;  1V8C A;  5H8Y E;  3SFD B;  1F0Z A;  1TJE A;  3W9C B;  1DOI A;  4YSZ B;  1SF0 A;  4US8 A;  2WDQ B;  1OQR A;  1WNU A;  4C80 A;  1AWD A;  2CJO A;  3HUI A;  3B2G A;  3P4S B;  1J7C A;  3SFE B;  1VLB A;  1TKY A;  3AEG B;  3DWG C;  1PDX A;  2Y5C A;  3LXF A;  1XLO A;  2N0S B;  3HVZ A;  4C7Z A;  1QOB A;  1FXA A;  3AE6 B;  1IUE A;  1QOG A;  1RM6 C;  1NYR A;  1N5X A;  1VJK A;  4USA A;  1JWB D;  4HRO A;  3W5U B;  2K22 A;  3B2F A;  3CWI A;  1FM0 D;  4ZHO A;  2DWQ A;  2PKO A;  2W55 A;  2WDR B;  3FAH A;  1WGK A;  4IDI A;  1XLP A;  2PVG C;  2WS3 B;  3LB8 C;  1FFV A;  4JX1 C;  1V4P A;  2ZZG A;  1WXO A;  1OFF A;  1NI3 A;  1N62 A;  3W5V B;  3NVV A;  1FXI A;  1SIJ A;  3BII D;  3L4P A;  5G5H A;  3ETR A;  3RHU A;  3AN1 A;  2HTM E;  3NVZ A;  3ZYY X;  4KX6 B;  1WXQ A;  1NYQ A;  2CJN A;  3B9J A;  5AUK A;  2E1B A;  1EWY C;  4P6V F;  1R7S A;  5AUI A;  3VR9 B;  5EE3 A;  2WU5 B;  1YJI A;  1QOF A;  4C7Y A;  3AE1 B;  1N61 A;  1J7A A;  1QOA A;  1FRD A;  3NS1 A;  1PUT A;  2BS4 B;  2AX5 A;  1ROE A;  4N59 A;  1XLQ A;  1J7B A;  2H88 B;  2QIE B;  4US9 A;  5MPO A;  2W54 A;  3AEA B;  1JQ4 A;  1NEN B;  3AV8 A;  3P63 A;  3NVY A;  2ZZF A;  1E6E B;  1N5W A;  4LTU A;  1PFD A;  2WP9 B;  4ITK A;  2JQR B;  3P4Q B;  5EE1 A;  1GPX A;  2WQY B;  2E3T A;  1DOX A;  4YT0 B;  2M19 A;  5EE0 A;  2L52 A;  1A70 A;  3EUB 2;  2WLB A;  3ABV B;  3AED B;  1WWT A;  1WYG A;  2G1E A;  2H89 B;  2B76 B;  4YTP B;  4HRS A;  2ZZE A;  1GAQ B;  1RFK A;  4WWM A;  2W3R A;  2BS3 B;  4ZOH C;  3FC4 A;  5GXG B;  3AE5 B;  4WQM A;  3WCQ A;  3P1M A;  3AEC B;  1L0V B;  1YJJ A;  1L5P A;  4YTN B;  3P4P B;  5G5G A;  3RPF C;  2PVO D;  4YXD B;  1E10 A;  1NVI D;  3AEB B;  1DOY A;  1FFU A;  2L83 A;  3NRZ A;  3AE9 B;  1E0Z A;  2LEK A;  5EE9 A;  3HRD D;  5C3J B;  1CJE A;  2DBY A;  1KF6 B;  1V97 A;  1QF6 A;  3VRA B;  1FRR A;  2M56 B;  1WRI A;  4FXC A;  1V7O A;  3KEW A;  5H92 C;  1SB3 C;  1UWM A;  2KMM A;  2JX5 A;  3AEE B;  2K9X A;  5C2T B;  1T3Q A;  4JWU C;  1B9R A;  3AE3 B;  1QLB B;  3WQZ A;  1AYF A;  1TKG A;  1L6U A;  1YQ4 B;  2MJD A;  3AM9 A;  3SR6 A;  1TYG B;  1NEK B;  1ZXI A;  3PO0 A;  1ZP0 B;  2QJL A;  3VR8 B;  1VDV A;  3AE7 B;  1RYJ A;  1ZOY B;  2WU2 B;  1KRH A;  3AE4 B;  2PIA A;  3P4R B;  3VRB B;  1JW9 D;  3AE8 B;  1KFY B;  2CU3 A;  4ZHP A;  2BT6 A;  1QT9 A;  3AEF B;  1FMA D;  1XO3 A;  3KWL A;  2MJE A;  2KAJ A;  3AMZ A;  1DGJ A;  3AE2 B;  2EKI A;  1L6V A;  1FO4 A;  2MJ3 A;  2BS2 B;  2OHF A;  3CIR B;  1CZP A;  1I7H A;  1FIQ A;  2ACZ B;  3DWM A;  1YQ3 B;  4A9A A;  2ZTG A;  4N6E B;  1JRO A;  1JRP A;  2W3S A;  3NVW A;  2WDV B;  4YSY B;  1TKE A;  2Q5W D;  3AH7 A;  1N60 A;  3AB5 A;  4YTM B;  4YSX B;  3RFN A;  1E9M A;  1JAL A;  2K5P A;  1JWA D;  2MH7 A; 
#chains in the Genus database with same CATH topology
 1J8C A;  4FJV B;  1N63 A;  2BYT A;  2GLS A;  4A3P A;  3UQB A;  4MH0 E;  3T9L A;  4M0W B;  3B2G A;  3SFE B;  3LXF A;  3B08 A;  1ZPS A;  2DAJ A;  3RNE C;  1STE A;  3RZW C;  5KHO A;  3T3O A;  4WAF A;  3H7P B;  1IBX A;  1WXO A;  4J6I A;  5BMG A;  5D7G A;  1G6J A;  4JPS A;  1KLG D;  3S2A A;  1SXT A;  1P9D U;  1WM3 A;  4DXG A;  3ZDT A;  4GSW A;  1V1P B;  3GE3 C;  3NVY A;  2N9P C;  2KMA A;  3ZJU A;  2NCN A;  5JH5 C;  5EE1 A;  2WXG A;  1RAX A;  2IO3 B;  4HKQ A;  2PE6 B;  2FAZ A;  5IOI A;  3ZNG C;  2WXN A;  4K7U A;  4YXD B;  2ZW1 A;  3H6N A;  2BYV E;  3R2T A;  3VTW A;  4CI3 A;  1UBI A;  2LVP A;  2KOX A;  1MHX A;  2CHX A;  1TS3 A;  1GNU A;  3ZNI D;  1JWU D;  4DXA B;  2RSU A;  2IUU A;  5C2T B;  4K7W A;  1TTN A;  1L6U A;  3AM9 A;  2VH2 A;  3AUL A;  2PPH A;  3L54 A;  2MWS B;  4ARE A;  4GIV A;  3ZJT A;  1ZOY B;  2DYM A;  3U4E G;  1UD7 A;  1WXM A;  2D3B A;  2KD0 A;  4L1B A;  1FIQ A;  2D3C A;  1WX7 A;  2KVR A;  5T8I A;  3VH4 B;  4FJY A;  4I6N B;  2BGF A;  3RFN A;  2K5P A;  2MH7 A;  1GJZ A;  4CO7 A;  4E74 A;  3U2S C;  1A5R A;  1UBQ A;  3KYD D;  4W9J A;  3SFD B;  3W9C B;  2C5L C;  3ZGZ A;  2MW5 A;  3HUI A;  3OAW A;  2WXP A;  1FCL A;  1PDX A;  4KDI C;  1WF9 A;  1V49 A;  1JML A;  1IGC A;  4B9K A;  2N9K A;  1VJK A;  3W5U B;  4HRO A;  4C4V B;  3AI5 A;  2J53 A;  2DHZ A;  2WXM A;  2KJH B;  3ZYY X;  2JRI B;  2B5M A;  2WX0 A;  2Y6I A;  3WIM A;  2NMQ A;  3NS1 A;  4ICV A;  1XLQ A;  3A9J B;  3K9P B;  2ZZF A;  1FNU A;  4M8M A;  2LUM A;  2MBE A;  1IYF A;  3TMP B;  2Y3A A;  3Q8C A;  4W9I A;  1WWT A;  2G1E A;  2B76 B;  4HRS A;  2Z8L A;  3Q8F A;  2INP E;  3QJZ A;  2D11 A;  2ZVN A;  1E10 A;  3FIL B;  5DPR A;  4MM3 A;  2QMT A;  3MC0 B;  4MH8 A;  4EFO A;  4ANV A;  2ASQ A;  3X0W A;  4ARF A;  2XN9 C;  1VCB A;  3ZTY A;  2N9L A;  4ACF A;  3SR6 A;  2DX5 B;  4HK2 A;  2AQ3 B;  2BB6 A;  2DZJ A;  4KZ0 A;  3GS2 A;  4II2 B;  5IP4 D;  3QIJ A;  1FMA D;  4A20 A;  4P16 A;  1SGH A;  3AMZ A;  2KC2 A;  2MJ3 A;  4A9A A;  2ZW0 A;  4IUM B;  3KWV A;  4WWP A;  5L95 C;  1WFY A;  4X57 B;  2L0T A;  2ZCC A;  3DBR I;  3SDL C;  1ZW7 A;  4LK0 M;  3NS8 A;  1F0Z A;  2QIL A;  2LJ5 A;  4GDK B;  3W1S C;  2DNF A;  2C9W B;  3Q6B A;  1L0X B;  5TR5 A;  2M4N A;  3R7Q A;  3PRZ A;  4TQ0 A;  4LDT D;  1SBB B;  4TQ1 A;  4XR0 A;  2DZK A;  3Q3J A;  1ZGU B;  5AUI A;  2MBO A;  3AE1 B;  1WIA A;  2AL3 A;  3DPD A;  3D32 A;  4LNN A;  1C3T A;  4HDQ A;  2NR2 A;  1GOZ A;  3ECI A;  3PZ7 A;  2WHI A;  3IBE A;  4ZRK A;  2K8B A;  3A4R A;  2PEA A;  2DLB A;  2Y5P A;  2WP9 B;  3RZF A;  5BYR A;  1YX6 B;  3URY A;  3JSV B;  3KVF B;  5C23 A;  3EGR A;  3AED B;  1K52 A;  2ZVO A;  4YTP B;  1T0R C;  4NAW A;  2YEP F;  3A1Q B;  1EWC A;  1P3Q U;  2MHJ A;  2WDT B;  2EWJ A;  4AQ7 A;  1UF0 A;  2K39 A;  2O2V A;  2LHE A;  1HTO A;  3H9D A;  4W9G A;  3JYU A;  3SD5 A;  2C7H A;  4LNO A;  4ZRI A;  3ALB A;  3FKY A;  1FEH A;  3R8B A;  4HCP B;  1TKG A;  2KFK A;  1ET6 A;  2YEP B;  1IBX B;  2A5U A;  2QJL A;  3MP9 A;  2SEB D;  1S3S G;  4LLG M;  1ECR A;  3VRB B;  2CKH B;  2CU3 A;  4ANU A;  1QT9 A;  1E90 A;  4BVU C;  2O6V A;  1E8Y A;  2EKI A;  2IDY A;  2JZZ A;  4GLS C;  2ZJD A;  3U7D A;  2PW9 A;  2W3S A;  3NY5 A;  2DZM A;  1E9M A;  4YSZ B;  5BYQ A;  2GOW A;  5DPW A;  4WWO A;  1DOI A;  3CF6 E;  2WXQ A;  3Q8A A;  4DWF A;  3M3J A;  3RUI B;  2WXR A;  1MG8 A;  2AQ2 B;  1QOB A;  3DVN U;  4MDK E;  2L0F A;  2D10 A;  1SE9 A;  1HZ5 A;  1EF5 A;  3ZXV A;  2GBR A;  3B2F A;  4EE2 A;  3K9O B;  2WS3 B;  3E0C A;  2MBH A;  1NI3 A;  1N62 A;  2KDI A;  3QHT A;  4AR1 A;  2E1B A;  2J7Q B;  3Q3O C;  3R66 C;  1Q0W B;  4FJZ A;  1XEE A;  5EDS A;  1BT0 A;  3A9K A;  2AX5 A;  3Q8B A;  4WJO A;  3I5J C;  3AEA B;  1JQ4 A;  2K0P A;  4J3O D;  1FNV A;  1TIF A;  2M8S A;  2Y3U A;  2VRR B;  3VDZ A;  2OJW A;  2IGD A;  4S17 A;  2GBJ A;  4ZOH C;  3P1M A;  5HFY A;  4FA6 A;  2UWQ A;  2GBM A;  1E8W A;  3HRD D;  2NBV B;  3MJ5 A;  1SJE D;  3WA0 A;  4FXC A;  1J0G A;  2QCZ A;  4GOC A;  1BXT A;  1HA5 A;  2M0A A;  2JX5 A;  3RD2 A;  1V1O A;  4EZJ A;  1TYG B;  5JXV A;  2I05 A;  1UUP A;  4M01 A;  3UIO B;  2KO3 A;  4TV3 A;  2KN4 A;  2BT6 A;  2BKR B;  3I8C A;  1CK1 A;  3KWL A;  3M63 B;  3VUX A;  3AE2 B;  4IWO A;  2FID A;  2N4F A;  2JVC A;  2OHF A;  3CIR B;  3RYT A;  1N60 A;  4YSX B;  1UWX A;  1JAL A;  1KTK A;  2JZ3 B;  1D4B A;  3MFG A;  3BYY B;  2AL6 A;  2RPQ A;  5BO4 B;  4TKN A;  4ARC A;  2MBQ A;  1K50 A;  2V4L A;  1AN8 A;  1FNW A;  1N5X A;  2N1W A;  4F7Z A;  2EKE C;  2DWQ A;  2W55 A;  3GOE A;  4MM3 B;  3LB8 C;  2KHW B;  1YN4 A;  1F52 A;  4PYU A;  4MGI E;  3TEY A;  3N1Z C;  2I1J A;  1WX8 A;  1NDD A;  2LRW A;  1R4M B;  5EE3 A;  2D3G A;  3LDZ E;  3TBL D;  1VZ6 A;  2LGS A;  2KXJ A;  3BK1 A;  3QC8 B;  4I6L B;  2W54 A;  3MTN B;  4A8X C;  2MRP A;  3VAW A;  3ZNH B;  2L1A A;  2RMM A;  2WQY B;  2PE9 A;  2M19 A;  2RDG A;  4II3 B;  2LGX A;  2AYO B;  3EUB 2;  3HK0 A;  4JQW C;  2ZZE A;  2D2Q A;  4WWM A;  3AE5 B;  4MT5 A;  3KW5 B;  3J9C A;  2LRU A;  3GZN B;  1C9F A;  4K3B A;  5D3D A;  3RN9 C;  1CJE A;  3WAL A;  1ZDX A;  2BPS A;  3Q69 A;  3VHT C;  4W9H A;  1WRI A;  4LJO B;  2IO2 B;  2ON8 A;  3DBS A;  3AEE B;  1EU3 A;  2RR9 A;  2NPT A;  3APC A;  1I4Q A;  1L0Y B;  2BYE A;  2WXJ A;  4NY0 A;  3AE7 B;  2LUE A;  3I89 A;  3ENE A;  1E5W A;  3AEF B;  1YNT E;  3KYC D;  1V86 A;  1YOV B;  1UEL A;  1XXG A;  3AH7 A;  2R2O A;  2BB5 A;  5EE9 A;  1ACC A;  4JWS C;  1ZUD 2;  3OJ3 A;  3ZWD A;  1MFW A;  2K8C A;  5G55 A;  4CI2 A;  3UI3 A;  4ZRP A;  4NNJ B;  3P42 A;  1ZXH A;  4NAW B;  4XYC A;  2REX A;  4NJC A;  1IUE A;  1RM6 C;  4KKJ A;  1MHH E;  3VH3 B;  5FKA C;  4O1N A;  4URK A;  3ZTD A;  2ZOS A;  4IWP A;  4HJG E;  2KYW A;  4LNK A;  4OVU A;  4DHZ E;  2O2V B;  3PPA A;  1YJI A;  2KFK B;  1F1H A;  4IOI E;  3TEW A;  2RDH A;  4UDU C;  4MGZ E;  4EZL A;  2IY0 B;  3UIN B;  2WWZ A;  1YX5 B;  1PFD A;  1LXD A;  2O6V B;  1DOX A;  3MJW A;  2LGY A;  2L52 A;  1BML C;  2IO0 B;  2GBK A;  4XDD A;  1ENF A;  3QAQ A;  3VUW A;  3BVZ A;  4E5Z A;  5IKC M;  4MJS A;  3ZX5 A;  2L05 A;  2KMC A;  5E6J A;  4BOZ B;  4IM3 A;  1WSP A;  3ZLZ A;  1E8Z A;  1TS4 A;  3PRE A;  4DHJ D;  1V5T A;  5GMV A;  5D3I B;  2D07 B;  2ZZP B;  1F77 A;  1ZDV A;  3CST A;  5JHB A;  2G45 B;  1PGX A;  1QIL A;  2N7D A;  5G2N A;  3WAP A;  4BAX A;  4RM8 A;  3T8M A;  3APF A;  2LXC A;  3KUD B;  1JW9 D;  1KFY B;  4C00 A;  5FK9 C;  5J17 A;  1AAR A;  3Q2A C;  3IG3 A;  1C4P A;  4K3C A;  1YQ3 B;  3A9K B;  3JVZ X;  2KX3 A;  3DHI C;  2N9E B;  1JWA D;  1SEB D;  3DVN V;  3ZKJ C;  4N58 A;  4DDI D;  1OQQ A;  5H8Y E;  4OZC A;  1ESF A;  1TJE A;  3NUH B;  2MQJ A;  2V9H A;  5FQD A;  2CJO A;  2LMC A;  4RGT A;  3CMM B;  1TKY A;  2Y5C A;  2BKF A;  1WR6 E;  2CHW A;  4RGN A;  1C77 A;  2HJ8 A;  4FAD A;  4WQO B;  4USA A;  4ZHO A;  2WXH A;  1WXV A;  4C56 C;  2WX1 A;  1KH0 A;  2PVG C;  4K1R B;  2ZZG A;  4XWT A;  3TJP A;  3E56 A;  1FXI A;  2Y50 A;  3L4P A;  2HTM E;  5LNK 1;  2KDE B;  4JGH B;  2N7E A;  1WXS A;  2V3P A;  3IVF A;  4HCN B;  1TY2 A;  5JZE B;  3HIZ A;  2Y5B B;  2IY1 B;  1UGJ A;  3APD A;  4W9E A;  1BUI C;  3P2B A;  5DCN A;  2VZK B;  4US9 A;  2QIE B;  2IUS A;  3DQV A;  4IKG A;  3ZNZ B;  1E6E B;  1N5W A;  2KX0 A;  3BVG A;  1L2N A;  2JQR B;  3IXS A;  2NTS A;  5LXH A;  1A70 A;  4TUU A;  4AWJ A;  3ZVV A;  2EEL A;  4TMA B;  4A11 A;  3WCQ A;  2KTF A;  1NBF C;  1YJJ A;  2FNJ B;  1PYW D;  3IT4 B;  4NPN A;  3Q3F A;  3MC8 A;  4EKU A;  3MHZ A;  3V3X A;  4OZB A;  2YVC A;  4FHK A;  2DBY A;  4M02 A;  5KHQ A;  2BTE A;  1V7O A;  2PJH A;  3IT6 B;  1UWM A;  3L0W B;  1D6E C;  4R3D A;  2JYT A;  4IC7 B;  3AE3 B;  1XCT L;  1WJN A;  2PMV A;  1RYJ A;  3PRP B;  2INC C;  4MSM B;  2W9N A;  1IGD A;  2FCS A;  4ZHP A;  4G0N B;  2MBB B;  1LFD A;  1EU4 A;  4DHZ B;  1R4M I;  3WAN A;  5DPT A;  1WZC A;  3EC8 A;  1SJH D;  3ML9 A;  2FBW B;  4W9C A;  1NI2 A;  3EI2 A;  2NS5 A;  4BKT A;  2WDQ B;  4RF0 A;  2DEN B;  3BWU D;  4WUR A;  2WXK A;  2C7N B;  2KDB A;  1JWB D;  2FE8 A;  1TT5 B;  3GZN I;  2QC8 A;  3I57 A;  1XLP A;  3OG5 A;  2IPK D;  3VQI A;  3PHX B;  3RHU A;  1NYQ A;  4ANW A;  4NQK E;  3VR9 B;  3I7N A;  5IA7 A;  3UF8 A;  1TS5 A;  2G4S A;  3RNG C;  2HYE A;  3KUZ A;  2NPT B;  3PV1 A;  2KN5 A;  4N59 A;  4KSK C;  2V3N A;  2IBI B;  4RMA A;  4A55 A;  5JHA A;  4IW0 A;  4M8N A;  2LJI A;  1E7V A;  1YMH E;  3RNF C;  1VD2 A;  3Q8E A;  4RH6 A;  3EEC A;  1WYG A;  5AZH A;  2XEW A;  4G3X B;  1FD6 A;  3EI4 A;  1WRD B;  1XCQ L;  3QX1 A;  4KGT A;  2KKC A;  1IP9 A;  1OTR B;  2LHD A;  1DOY A;  2KAN A;  5E6O A;  2X8X X;  4AUQ C;  4FBJ B;  2CR5 A;  2O6V D;  2BWF A;  2HE7 A;  2M1M A;  4Q2J A;  2I38 A;  4JL9 A;  2HDE A;  1F2R I;  2C7M B;  2DYB A;  4FHJ A;  3RFZ B;  1FCC C;  3RNB C;  3R7R A;  1P7E A;  1WX9 A;  1VDV A;  1RRB A;  3U7Z A;  1K53 A;  2MJE A;  4KZC A;  2BS2 B;  1RFA A;  4PS3 A;  1SE2 A;  1JRO A;  2EMS A;  1GB4 A;  2WDV B;  3AB5 A;  1I4R A;  1E7P B;  2UU7 A;  1RWS A;  4KKI A;  1XLN A;  3VTV A;  4WJP A;  2PLP A;  2WGS A;  1WY8 A;  2K6D B;  1J7C A;  1T6B X;  2VH1 A;  3TUO A;  4ZYS A;  3AE6 B;  4MJS B;  2XK5 A;  4REZ A;  2K22 A;  1FXT B;  3O65 B;  3QCA A;  3BY4 B;  3VFK A;  3T3N A;  1UH6 A;  3NVZ A;  2CJN A;  2C60 A;  3B9J A;  1EWY C;  1T0Y A;  4M00 A;  2B3A A;  4E3C A;  2AQ1 B;  4AS1 A;  3E9S A;  3ZO5 B;  2BS4 B;  2V3S A;  2HD5 B;  3TSS A;  2CU1 A;  4KGS A;  1J19 A;  2L7R A;  4XGA B;  3M95 A;  1GAQ B;  3N9Y C;  4PYZ A;  2SAK A;  5FR6 A;  2JXT A;  2HJ1 A;  2VZK D;  1NVI D;  4DXF A;  4IM0 A;  1SIF A;  4W9K A;  2LEK A;  3DHH C;  1D5X C;  3UQA A;  1EM7 A;  4I6P A;  1V97 A;  5BMH A;  3N32 A;  2JXX A;  3KEW A;  4E71 A;  2NTT A;  2ZPN A;  3RNC C;  4B0E A;  3HM3 A;  1WMH A;  3WQZ A;  4AP4 C;  4KDL B;  4KIK A;  4H2A A;  1SSN A;  3PTF C;  4F1S A;  2WU2 B;  4GU2 A;  2V0G A;  4CI1 A;  2KQ4 X;  2IND C;  1DGJ A;  3PZ8 A;  3QQ8 B;  2ZCB A;  3EI3 A;  4DDG D;  2ACZ B;  1VRA B;  3GE8 C;  4PS7 A;  2IO1 B;  2W82 A;  2ZEQ A;  1XVI A;  2A4Z A;  2Z0E B;  1WNU A;  1VLB A;  5HHD G;  1PQS A;  3VTU A;  4D2K A;  2BYF A;  4KGR A;  4B0M A;  4US8 A;  1OGW A;  4FLH A;  2PKO A;  2ICI A;  4DK5 A;  4DQO C;  4MEM A;  1V2Y A;  5G5H A;  4NAM A;  1JWS D;  2ZPY A;  3WAO A;  1PGB A;  4BKS A;  3ZUN A;  3RMK C;  3PVL A;  1J7A A;  3EA6 A;  1M94 A;  4RGO S;  4WWN A;  3O13 A;  3KQ4 A;  1Y56 A;  3DBL I;  1S1Q B;  3DHG C;  1AW7 A;  1TGZ B;  1MJD A;  3ZTW A;  3DBH I;  4YT0 B;  2JF5 A;  2AWT A;  2WLB A;  4MGY E;  2RDB C;  2K25 A;  5D6J B;  2I1K A;  2IGG A;  4RFB A;  1KOT A;  3RPF C;  1WGG A;  3I7O A;  2WXO A;  1JRU A;  1FPY A;  4HVB A;  5C3J B;  1T5X D;  4P1B C;  2GMI C;  4AJY B;  3DCG A;  2MP2 A;  3BIN A;  2WXL A;  3DVG X;  4G11 A;  3VRA B;  2BQQ A;  2LI5 A;  4AR8 A;  4BBN F;  4HEA 1;  2LAS A;  3BZD B;  1F9J A;  3V6E B;  2OOB B;  4IWQ A;  1VR9 A;  2KLC A;  3OWE B;  4XR1 A;  1WXA A;  1LM8 B;  5HKH A;  2KAJ A;  4LCD E;  1L6V A;  1WZ3 A;  2KWV B;  3TCA A;  4RGM A;  4OVZ A;  5TSS A;  4A6Q A;  1M4V A;  2Z59 B;  3MC9 A;  4GB9 A;  1RLF A;  2Q5W D;  4XZ4 A;  1K51 A;  2LGI A;  2KQS A;  3CSF A;  1YN5 A;  2D5G A;  1YQB A;  3VXW A;  2FCN A;  3PGE A;  1SF0 A;  1HQR D;  4C80 A;  3I7P A;  2KDF B;  2QDF A;  3ZDM C;  2Z0D B;  1V9J A;  1NYR A;  1WE7 A;  1Q5W B;  3FAH A;  2QHO A;  1V4P A;  2KWC A;  4BBN C;  1HZ6 A;  5IO9 A;  4A90 A;  2LWP A;  4ICU A;  4WJQ A;  3H7S A;  4KX6 B;  2K6Q A;  3IHP C;  2G9H D;  1D5Z C;  2FCQ A;  2G3Q B;  1R7S A;  4ARI A;  2I2Y A;  2KQ7 A;  1FRD A;  2M0X A;  2TSS A;  1ROE A;  2KC1 A;  3V61 A;  3AV8 A;  1TBE A;  1C4A A;  1WJ6 A;  1H8C A;  3ABV B;  1TZ1 A;  3V60 A;  1RFK A;  1N6Z A;  3GP7 A;  4XE0 A;  3AEC B;  2PVO D;  1EO6 A;  2L83 A;  2KDM A;  4JLC A;  3I7H A;  3PLU A;  3C8Y A;  1E0Z A;  3BYT B;  3TL5 A;  4CYE A;  1LO5 D;  1KF6 B;  4L23 A;  1XF5 L;  1XQQ A;  2NBU A;  3Q14 C;  1F2R C;  4MEL A;  2XK5 B;  4RCO A;  2KZR A;  4LDT B;  2XNA C;  4GXB A;  2XBB C;  1KM7 A;  1NEK B;  2MA9 B;  2B5L A;  1C76 A;  3ML8 A;  4RNA A;  2PTL A;  4AR9 A;  2KK8 A;  4A09 A;  1I4H A;  1SE3 A;  4JE3 B;  3V05 A;  3HHM A;  1WGH A;  1SE4 A;  2ZTG A;  4WH4 A;  3X23 A;  1MPE A;  3RT3 B;  5FR3 A;  2J52 A;  3ZX4 A;  3UGB B;  3TEX A;  3C0R B;  1ISN A;  2QSD A;  2X38 A;  3UIP B;  2E6X A;  4A0A A;  2KT7 A;  2DYO A;  2QEJ C;  1K8R B;  1VZ7 A;  3QK0 A;  1FXA A;  1P7F A;  3BK2 A;  4OW0 A;  1WGD A;  1C78 A;  1I42 A;  2WNM A;  1I4P A;  4JX1 C;  5IAA C;  1EF1 A;  3V6C B;  3W2D A;  4PS8 A;  3JW0 X;  3ETR A;  3A4S C;  1WXQ A;  5AUK A;  2NVU I;  1WJU A;  2WU5 B;  1WMH B;  1DYQ A;  4KIK B;  1PUT A;  1Q1O A;  1J7B A;  1E8X A;  3P63 A;  3QWZ B;  4HLE A;  3V62 A;  4HWI B;  1HE8 A;  3IAM 1;  4WQM A;  3BVM A;  3C19 A;  1ET9 A;  1C1Y B;  3H1U A;  4AOF A;  3AE9 B;  5D94 A;  1TY0 A;  2L00 B;  4GDL A;  3L08 A;  3I7K A;  1Z2M A;  1V81 A;  5I4D A;  4WIP A;  3ZRF A;  1AYF A;  1WR1 A;  5CHF A;  5L83 A;  1T0S C;  2LVO A;  1XD3 B;  2IZV B;  1KRH A;  4K81 A;  3ZIM A;  1XO3 A;  4HPP A;  5HG2 A;  3NZS A;  4N9F 4;  1CMX B;  3PS6 A;  2J4X A;  1JRP A;  3NHE B;  1L7Y A;  3Q3N C;  4W9D A;  4YTM B;  3EFU A;  2CS4 A;  4RF1 A;  3A33 B;  4GGQ A;  1WGY A;  2JZP A;  3DBL B;  4GN1 A;  2RD0 A;  4GMV A;  4DBG A;  1XLO A;  2N0S B;  3HVZ A;  3U30 A;  4C7Z A;  4G50 A;  2DAF A;  2KTR A;  2GRI A;  2JWZ A;  3DBH B;  3ZUP A;  3VUY A;  2FUH B;  3ZQ4 A;  4IDI A;  5E6P A;  4XWW A;  2MP2 B;  3W5V B;  2IUT A;  5AEK B;  4ZRJ A;  2LD9 A;  1C79 A;  1GC6 A;  2JT4 B;  4P7I A;  2YLM A;  2K8H A;  4EEW A;  2GBN A;  4MAC A;  1GUA B;  4XC2 A;  1NEN B;  2JRH A;  4LTU A;  4JIO U;  3P4Q B;  1UGM A;  5BMI A;  1V80 A;  2JY6 A;  2OED A;  5EE0 A;  2LVQ A;  3NG0 A;  2MSE D;  2KVZ A;  1GB1 A;  2IYD B;  4ANX A;  3FC4 A;  3PT2 B;  3MHS D;  4YTN B;  4OHJ A;  2LFI A;  4HPM B;  4MSQ B;  2JPH A;  2I06 A;  3ZRC A;  1QF6 A;  2DZI A;  2RGF A;  3B0A A;  3I9V 1;  4IG7 B;  1WE6 A;  1FRR A;  2M56 B;  4K7S A;  2KMM A;  4YL8 A;  3DDC B;  2K9X A;  1T3Q A;  3PRM B;  1KJT A;  4XDC A;  4NZL B;  3OJ4 B;  3VVW B;  1ZP0 B;  1D5M C;  2R61 A;  4XR3 A;  2JWU A;  3AE4 B;  1WH3 A;  2D3A A;  1WI0 A;  3AE8 B;  2K1F A;  4HDO A;  5LXI B;  1KLV A;  2OJR A;  3L16 A;  1CZP A;  1I7H A;  3IFW B;  1WYW B;  4ASW C;  2KFJ A;  3HVD A;  1TKE A;  4YSY B;  4EOY A;  3U8Z A;  1R4N I;  3M62 B;  1U4A A;  3KLS X;  1MI0 A;  4P1C C;  2FUG 1;  2FIF A;  1OQR A;  4KVG B;  4QAY A;  3ZJV A;  1XT9 B;  3L13 A;  1FM0 D;  3LYY A;  4HPL B;  4TSS A;  1WGK A;  2JUO A;  3RUL A;  3I8E A;  2LZ6 A;  1I4G A;  2M17 A;  3AU5 A;  3AN1 A;  1LGR A;  3DVG Y;  1QOF A;  1WZ0 A;  1UNS A;  4TZ4 A;  4FN2 A;  3L10 B;  4WAA A;  2L32 A;  1QKZ A;  4A3O A;  5BYS A;  2INN E;  1OEY J;  5CX3 A;  3WAM A;  1T0Q C;  3QAR A;  2WXF A;  1GPX A;  4YWG G;  2NBW B;  4RM9 A;  4M0W A;  2J0J A;  3ZW7 A;  4HKZ E;  5GXG B;  1Y8R C;  2N9X A;  1YJ1 A;  3P4P B;  1I35 A;  1OQY A;  1MVK A;  4L2Y A;  3PZD A;  3H7P A;  1V6E A;  2BBC A;  3U52 E;  1P1A A;  4AJW A;  5AZF A;  1QZE A;  1V5O A;  1Q10 A;  4NQL B;  5H92 C;  1SB3 C;  2HTH A;  4E54 A;  1QLB B;  1YQ4 B;  2ZNV B;  3NJT A;  3PO0 A;  1ZE3 D;  3L17 A;  1I4X A;  5E6N A;  1V1P A;  4OZA A;  2JSV X;  4B95 A;  4CQN A;  3AU4 A;  5HI1 A;  2GI9 A;  1D3Z A;  2BW2 A;  4HXD A;  3NVW A;  3N3K B;  3NZ3 A;  2IGH A;  4W9L A;  2EMT A;  2ONQ A;  1HEZ E;  3RCZ A;  1V8C A;  2BVC A;  4BKS D;  1P98 A;  1AWD A;  2FCM A;  2ZNV C;  2KWD A;  3N30 A;  1ZKH A;  4KV2 A;  1B9R A;  3EHV A;  2WDR B;  1HXY D;  1CQV A;  2WYQ A;  4EZK A;  1FFV A;  2MX2 A;  1OFF A;  1SIJ A;  4DHJ B;  1PGA A;  4GDL B;  3SEB A;  3ZW3 A;  1YD8 U;  3PHW B;  4LJP B;  5D2M B;  2BWE S;  2L8J A;  4XX5 A;  1P0R A;  1VZ8 A;  4XR2 A;  1MG4 A;  3EI1 A;  3R2I A;  3EFC A;  3KUC B;  4CHK A;  2H88 B;  2KJ6 A;  4WJN A;  1IPG A;  4ITK A;  4NJ7 A;  4A0B A;  4ZDV A;  5AZG A;  2H89 B;  1JWM D;  3OLM D;  1E7U A;  5J2R A;  1L5P A;  5C1Z A;  1TS2 A;  4C4V A;  3W1Y A;  1B1Z A;  2L3Z A;  2J0M A;  1YIW A;  4LNF A;  2K3U A;  3IAS 1;  2MCN B;  2KTR B;  3ZXR A;  5IN7 A;  1H4R A;  2LXA A;  3PSE B;  2MEK A;  3PLV A;  4NJ6 A;  3A9J A;  2BF8 B;  2PIA A;  4BKG A;  1TZO A;  4EUT A;  1WGR A;  2CHZ A;  4N6E B;  2GB1 A;  3LJ3 A;  1LQB A;  3N1X C;  3R3M A;  2V1Y A;  2N1V A;  1WJ4 A;  4W9F A;  2JU6 X;  4KSL C;  2AEH A;  3FIL A;  3NZU A;  3HM6 X;  1X1M A;  3P4S B;  3AEG B;  3DWG C;  3Q3M C;  5J18 A;  3I63 C;  3RI7 C;  4PT5 A;  4PK1 A;  5CHV C;  4S0R A;  1QOG A;  3CWI A;  4BOS C;  1HTQ A;  3I3T B;  1C4C A;  3QA8 A;  3ZU6 A;  2KWU B;  3W1S A;  3ZTC A;  3ZWK A;  3NVV A;  3BII D;  3AXC A;  3GB1 A;  4P6V F;  1Z5S B;  4BZA A;  1GG3 A;  5CHW A;  2L76 A;  4C7Y A;  2G4D B;  4F8C B;  1OEY A;  1N61 A;  3I7L A;  1QOA A;  2MLB A;  1UZX B;  4B6W A;  5DPS A;  2N7J A;  1QQR A;  4BFR A;  1L4D B;  3NOB A;  4IM2 A;  5MPO A;  3DBR B;  3N20 C;  2KJR A;  1JCK B;  4LNI A;  2E3T A;  2JYE A;  3SU8 X;  4GDK A;  4ZYN A;  3ONS A;  2W3R A;  2BS3 B;  1L0V B;  5G5G A;  3TEZ A;  3AEB B;  1FFU A;  3NRZ A;  5LLI A;  3RNA C;  3B1L X;  4OVV A;  1R4N B;  2WXI A;  4FUL A;  3N1Y C;  1GC7 A;  3KH0 A;  4JWU C;  3DOW A;  2MJD A;  1EUV B;  1YN3 A;  2KNB A;  1ZXI A;  4ZRQ A;  3VR8 B;  3SHQ A;  2KLG A;  3P4R B;  2RPV A;  3H8H A;  3TIX A;  1WM2 A;  1KLU D;  2UYZ B;  3JSV A;  1FO4 A;  2V4I B;  2IJ0 A;  2J42 A;  3DWM A;  2LGD A;  4A08 A;  2J0K A;  4MGK E;  5CTR C;  1L4Z B;  3A1Q A;  2KAC A;  4HJK A;  2R2Q A; 
#chains in the Genus database with same CATH homology
 1KTK A;  1D4B A;  1E7P B;  1N63 A;  1RWS A;  4KKI A;  3MFG A;  1XLN A;  2BYT A;  3BYY B;  2JZP A;  2PLP A;  3B2G A;  1J7C A;  1T6B X;  3SFE B;  3LXF A;  4ARC A;  1K50 A;  1XLO A;  2N0S B;  1AN8 A;  3HVZ A;  3TUO A;  4C7Z A;  1ZPS A;  4ZYS A;  3AE6 B;  2GRI A;  1FNW A;  1STE A;  1N5X A;  4REZ A;  2K22 A;  3T3O A;  2DWQ A;  2W55 A;  4WAF A;  3ZQ4 A;  3T3N A;  4MM3 B;  4IDI A;  1IBX A;  3LB8 C;  4XWW A;  1WXO A;  3W5V B;  2IUT A;  1YN4 A;  5BMG A;  3TEY A;  5D7G A;  3NVZ A;  2CJN A;  1C79 A;  3B9J A;  1EWY C;  4JPS A;  1KLG D;  5EE3 A;  1SXT A;  2AQ1 B;  4AS1 A;  3E9S A;  1VZ6 A;  4DXG A;  2BS4 B;  3BK1 A;  4MAC A;  2W54 A;  3TSS A;  1V1P B;  1NEN B;  4A8X C;  3NVY A;  4KGS A;  4LTU A;  3ZJU A;  5EE1 A;  2WXG A;  2L1A A;  3P4Q B;  2RMM A;  2WQY B;  5BMI A;  2M19 A;  2RDG A;  4HKQ A;  5EE0 A;  2OED A;  3EUB 2;  2ZZE A;  1GAQ B;  3N9Y C;  4WWM A;  2SAK A;  1GB1 A;  2JXT A;  2WXN A;  3FC4 A;  3AE5 B;  4MT5 A;  4YTN B;  2VZK D;  4YXD B;  3J9C A;  2ZW1 A;  1NVI D;  4OHJ A;  4DXF A;  1C9F A;  2LFI A;  5D3D A;  2LEK A;  3R2T A;  2I06 A;  1D5X C;  4CI3 A;  1CJE A;  1EM7 A;  1ZDX A;  1V97 A;  1QF6 A;  3I9V 1;  3Q69 A;  1FRR A;  2M56 B;  1WRI A;  5BMH A;  1MHX A;  1TS3 A;  3KEW A;  2ON8 A;  1JWU D;  2KMM A;  3AEE B;  2IUU A;  2NTT A;  2K9X A;  4B0E A;  5C2T B;  1T3Q A;  3WQZ A;  1EU3 A;  4XDC A;  1I4Q A;  1L6U A;  1L0Y B;  4NZL B;  2WXJ A;  3AM9 A;  1ZP0 B;  4H2A A;  3AE7 B;  1SSN A;  4ARE A;  1D5M C;  3ZJT A;  2R61 A;  4XR3 A;  1ZOY B;  2JWU A;  2WU2 B;  3AE4 B;  2DYM A;  3I89 A;  3U4E G;  3AE8 B;  2V0G A;  4CI1 A;  3AEF B;  2KQ4 X;  1YNT E;  1DGJ A;  4L1B A;  3PZ8 A;  3EI3 A;  1CZP A;  1I7H A;  1FIQ A;  2ACZ B;  1VRA B;  5T8I A;  3HVD A;  1TKE A;  1XXG A;  3AH7 A;  4YSY B;  3RFN A;  2BB5 A;  2K5P A;  5EE9 A;  2MH7 A;  1ACC A;  2W82 A;  4JWS C;  1ZUD 2;  3U2S C;  3KLS X;  1MI0 A;  3SFD B;  2FUG 1;  3W9C B;  1WNU A;  4CI2 A;  3UI3 A;  1OQR A;  3ZGZ A;  1JAL A;  3HUI A;  2WXP A;  4ZRP A;  1VLB A;  5HHD G;  1FCL A;  1PDX A;  3P42 A;  1ZXH A;  4D2K A;  4NAW B;  1JML A;  4KGR A;  1IGC A;  3ZJV A;  2N9K A;  4NJC A;  1IUE A;  1RM6 C;  4KKJ A;  4B0M A;  4US8 A;  1MHH E;  1VJK A;  3W5U B;  4HRO A;  5FKA C;  4O1N A;  1FM0 D;  3LYY A;  2PKO A;  2ICI A;  4TSS A;  1WGK A;  4DQO C;  3I8E A;  2J53 A;  1I4G A;  2WXM A;  5G5H A;  4HJG E;  1JWS D;  4NAM A;  3AN1 A;  3ZYY X;  1PGB A;  2B5M A;  1YJI A;  1QOF A;  4IOI E;  1UNS A;  2Y6I A;  1J7A A;  3EA6 A;  3TEW A;  2RDH A;  4TZ4 A;  2NMQ A;  3NS1 A;  4RGO S;  3O13 A;  3KQ4 A;  1Y56 A;  4UDU C;  1XLQ A;  2L32 A;  1QKZ A;  1AW7 A;  5BYS A;  2INN E;  2ZZF A;  1FNU A;  1PFD A;  2LUM A;  2WXF A;  1GPX A;  4YWG G;  1DOX A;  2Y3A A;  4YT0 B;  4M0W A;  3Q8C A;  2L52 A;  2WLB A;  1BML C;  4XDD A;  1ENF A;  1WWT A;  2G1E A;  2B76 B;  4HKZ E;  4HRS A;  2Z8L A;  3Q8F A;  2INP E;  3BVZ A;  4E5Z A;  2IGG A;  4RFB A;  5GXG B;  3RPF C;  3P4P B;  1E10 A;  2WXO A;  3I7O A;  3FIL B;  1MVK A;  4L2Y A;  5C3J B;  1T5X D;  2BBC A;  2QMT A;  5E6J A;  3MC0 B;  3U52 E;  4MH8 A;  1WSP A;  2WXL A;  1Q10 A;  3VRA B;  1TS4 A;  4ARF A;  5H92 C;  1SB3 C;  4AR8 A;  4HEA 1;  3BZD B;  2XN9 C;  4E54 A;  2N9L A;  5D3I B;  1QLB B;  1F77 A;  1ZDV A;  1YQ4 B;  1VR9 A;  3SR6 A;  3PO0 A;  2AQ3 B;  1PGX A;  3OWE B;  2BB6 A;  1QIL A;  1ZE3 D;  4XR1 A;  1I4X A;  3GS2 A;  1V1P A;  4OZA A;  1JW9 D;  1KFY B;  2JSV X;  5FK9 C;  1FMA D;  4CQN A;  2KAJ A;  3AMZ A;  4P16 A;  5HI1 A;  2GI9 A;  1C4P A;  1L6V A;  2MJ3 A;  4RGM A;  4OVZ A;  5TSS A;  4A9A A;  2BW2 A;  1YQ3 B;  1M4V A;  4A6Q A;  3NVW A;  2ZW0 A;  2Q5W D;  3KWV A;  3NZ3 A;  1K51 A;  2LGI A;  2IGH A;  1JWA D;  1SEB D;  2ONQ A;  1HEZ E;  4LK0 M;  4N58 A;  1YN5 A;  1OQQ A;  1V8C A;  4OZC A;  2D5G A;  5H8Y E;  1ESF A;  1TJE A;  1F0Z A;  1SF0 A;  3NUH B;  2QIL A;  5FQD A;  1HQR D;  4C80 A;  1AWD A;  2CJO A;  2LMC A;  4RGT A;  3I7P A;  4GDK B;  1TKY A;  2Y5C A;  2KWD A;  1L0X B;  4RGN A;  1C77 A;  1NYR A;  4USA A;  4ZHO A;  1B9R A;  2WXH A;  2WDR B;  3FAH A;  4C56 C;  1HXY D;  1CQV A;  4TQ0 A;  1KH0 A;  2PVG C;  1V4P A;  1FFV A;  4XWT A;  2ZZG A;  3E56 A;  1OFF A;  1HZ6 A;  1SBB B;  4TQ1 A;  4A90 A;  1FXI A;  1SIJ A;  2Y50 A;  3L4P A;  1PGA A;  4GDL B;  2HTM E;  3SEB A;  5LNK 1;  4KX6 B;  4XR0 A;  2G9H D;  1D5Z C;  1R7S A;  5AUI A;  2V3P A;  1TY2 A;  1VZ8 A;  3AE1 B;  4ARI A;  4XR2 A;  2I2Y A;  1FRD A;  1UGJ A;  3EI1 A;  2TSS A;  1BUI C;  3R2I A;  2VZK B;  1GOZ A;  1ROE A;  4US9 A;  3PZ7 A;  2H88 B;  2QIE B;  2IUS A;  2DLB A;  2Y5P A;  3AV8 A;  4IKG A;  1E6E B;  1N5W A;  3BVG A;  1C4A A;  2WP9 B;  4ITK A;  2JQR B;  3IXS A;  5BYR A;  3URY A;  2NTS A;  4A0B A;  3EGR A;  1A70 A;  3ABV B;  3AED B;  1K52 A;  2H89 B;  4YTP B;  2EEL A;  1RFK A;  4TMA B;  1JWM D;  2YEP F;  3GP7 A;  3WCQ A;  4A11 A;  4XE0 A;  1EWC A;  3AEC B;  1YJJ A;  1L5P A;  1PYW D;  2PVO D;  3IT4 B;  1TS2 A;  2L83 A;  2KDM A;  3I7H A;  3C8Y A;  1E0Z A;  3MHZ A;  3V3X A;  2EWJ A;  4OZB A;  4AQ7 A;  1B1Z A;  3BYT B;  2DBY A;  1LO5 D;  1KF6 B;  4L23 A;  1XF5 L;  2K3U A;  2LHE A;  2BTE A;  1F2R C;  1V7O A;  3IAS 1;  3IT6 B;  1UWM A;  1D6E C;  4R3D A;  4RCO A;  2JYT A;  3AE3 B;  2XNA C;  1FEH A;  1XCT L;  3R8B A;  1TKG A;  1ET6 A;  2PMV A;  2YEP B;  1IBX B;  1NEK B;  2QJL A;  2MEK A;  3MP9 A;  2B5L A;  2SEB D;  1RYJ A;  4LLG M;  1C76 A;  1ECR A;  4RNA A;  2PIA A;  2PTL A;  1IGD A;  3VRB B;  4AR9 A;  2CU3 A;  4ZHP A;  1TZO A;  1QT9 A;  4A09 A;  1I4H A;  1SE3 A;  1EU4 A;  4JE3 B;  3V05 A;  2EKI A;  2IDY A;  1SE4 A;  4GLS C;  2ZTG A;  2PW9 A;  4N6E B;  4WH4 A;  2W3S A;  2GB1 A;  1MPE A;  1E9M A;  5FR3 A;  4YSZ B;  5BYQ A;  2J52 A;  1SJH D;  2FBW B;  2JU6 X;  3TEX A;  3FIL A;  2QSD A;  3EI2 A;  1DOI A;  3Q8A A;  2WXQ A;  2WDQ B;  2X38 A;  4RF0 A;  3P4S B;  3BWU D;  2E6X A;  4A0A A;  4WUR A;  2QEJ C;  2DYO A;  2WXR A;  3AEG B;  3DWG C;  2AQ2 B;  2WXK A;  1QOB A;  1VZ7 A;  4PT5 A;  1FXA A;  1P7F A;  1HZ5 A;  1QOG A;  1JWB D;  2FE8 A;  3B2F A;  3BK2 A;  3CWI A;  4EE2 A;  1C4C A;  4OW0 A;  3I57 A;  1C78 A;  2WNM A;  1XLP A;  1I4P A;  4JX1 C;  2WS3 B;  3W1S A;  3E0C A;  2IPK D;  1NI3 A;  1N62 A;  3VQI A;  3NVV A;  3BII D;  3W2D A;  3ETR A;  3RHU A;  4AR1 A;  3GB1 A;  1WXQ A;  1NYQ A;  5AUK A;  2E1B A;  4P6V F;  3VR9 B;  3I7N A;  1TS5 A;  2WU5 B;  1XEE A;  4C7Y A;  2HYE A;  1N61 A;  1DYQ A;  3I7L A;  1QOA A;  1PUT A;  2AX5 A;  2N7J A;  3Q8B A;  1QQR A;  1L4D B;  4N59 A;  1J7B A;  5MPO A;  2V3N A;  3AEA B;  1JQ4 A;  2K0P A;  3P63 A;  4A55 A;  1JCK B;  2LJI A;  2E3T A;  1FNV A;  1YMH E;  2JYE A;  4J3O D;  2Y3U A;  3Q8E A;  4RH6 A;  1WYG A;  2IGD A;  1FD6 A;  2W3R A;  3EI4 A;  2BS3 B;  4ZOH C;  3IAM 1;  1XCQ L;  4WQM A;  3P1M A;  1L0V B;  3BVM A;  4KGT A;  1ET9 A;  5HFY A;  5G5G A;  2LHD A;  3TEZ A;  1DOY A;  3AEB B;  1FFU A;  3NRZ A;  3AE9 B;  3HRD D;  3MJ5 A;  1SJE D;  1TY0 A;  2WXI A;  4FXC A;  1BXT A;  4Q2J A;  2I38 A;  1HA5 A;  2HDE A;  3I7K A;  2M0A A;  2JX5 A;  1F2R I;  4JWU C;  5I4D A;  3RFZ B;  4WIP A;  1AYF A;  2MJD A;  1FCC C;  1YN3 A;  1V1O A;  1TYG B;  1ZXI A;  4ZRQ A;  1P7E A;  3VR8 B;  1VDV A;  5JXV A;  2I05 A;  1UUP A;  3U7Z A;  1KRH A;  3P4R B;  2RPV A;  2KN4 A;  3H8H A;  1K53 A;  2BT6 A;  3I8C A;  1CK1 A;  1XO3 A;  3KWL A;  2MJE A;  1KLU D;  3AE2 B;  5HG2 A;  1FO4 A;  2BS2 B;  2IJ0 A;  2J42 A;  2OHF A;  2V4I B;  3CIR B;  3DWM A;  1SE2 A;  4A08 A;  2J4X A;  1JRO A;  1JRP A;  1L4Z B;  1GB4 A;  2WDV B;  1N60 A;  3AB5 A;  1I4R A;  4YSX B;  4YTM B;  1UWX A;  2KAC A;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...