1TKZB

Crystal structure of hiv-1 reverse transcriptase in complex with gw429576
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
422
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 113
structure length 401
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkzB04
3KLVA 4RW6B 1N56A 4O3OA 3QO9B 1NHVA 4NLWA 5C42B 3BR9A 3KOAA 4QWAA 4K50A 4H54A 5KFMA 3V81B 1KHVA 1C0UB 4NLPA 4PQUB 2UUTA 4WZQA 1D0EA 4R8UA 1C1BA 2B5JB 5HLFB 2RDIA 4MH8A 5KG6A 4RW7A 1GX6A 3UDLA 4IG3B 5L1LA 4KBIA 3RBEA 2BR0A 1HARA 4KE5A 5DG9A 1C0TA 3CJ5A 5EWFA 1C1CB 1RT4A 3I0SB 1JLQB 2IJNA 3CDEA 1S6PB 4IRCA 3IN5A 2V9WA 1D1UA 5L1KA 4H4MB 4FBUA 2J6SA 3N6NA 3RB3A 4LSLA 4KHRA 2IM3A 4KHMA 3EPIA 5C42A 4ED1A 2HWHA 2IC3B 1T94A 1GX5A 4PUOA 4QW8A 2CJQA 1IKVA 2C28A 3V81A 4ZPAA 1JLCA 2JEGA 3V6KA 3BSCA 3N6LA 1NNDA 3V4IB 3TQ1A 4ZVFA 4K4SA 4PUOB 1MMLA 4IDKA 5F9NA 4ECTA 2W8KA 1S1WB 3IG1A 4TYAA 4NLGA 3DRSA 1RT7B 3DDKA 1VRUB 1EP4B 3DOLA 2VA2A 5J2MA 4Q8FA 3GYNA 1XR6A 2IJFA 1HNVA 1HNIB 3MEDA 2RKIB 3KMQA 2OPRB 3KMSA 3NMAA 1RTHA 5HP1B 3PHEA 4LSNA 3N6MA 4Y34A 3MEDB 5HBMB 5KFIA 4IFYA 4QPXA 3GIKA 3BSOA 1EETB 5J2PA 2C2EA 3CJ4A 4WFYA 1FK9A 4LQ9A 1RA6A 5DLFA 2UVWA 2ATLA 5KFTA 1RTDB 3D28A 5F8LA 1HPZB 5KFWA 4IFVB 1ZTWA 5KT7A 3G6YA 4DL3A 2WK4A 3DRPA 4ECWA 3SFGA 1KHWA 5KFLA 5KFEA 2ZKUA 1JLGA 3KK2A 4MKBA 3H5SA 2XCAA 1BQMA 4IFVA 4KB7A 4IG0B 4I2PB 1JLEA 1IKXA 4RW8B 3OL7A 4U7CA 2BANA 4R5PA 4X2BA 4IKAA 3ISND 1T03A 4RUCA 1TKXB 5J1EB 1S0NA 2HNZA 1JLFB 1CSJA 4U6PA 3LAKA 5KFGA 5KG0A 1RTHB 2DPJA 3MR2A 2OPPA 3FFIA 3LP0B 1WNEA 1TKXA 5J1EA 4EYIB 4GC6A 4ZVEA 4NLUA 1C1BB 2B5JA 5HLFA 3SFUA 3GQCA 1RYRA 2YNFB 4ZPCA 2V4QA 1ZETA 2OPQB 3PR5B 4H4OB 4O44A 1SH3A 4R0EA 4F4ZA 3DLEB 4G1QB 5KFVA 2FVRA 4ZPBA 4EYHB 1DTTA 1JX4A 3I0SA 4K4XA 3KLIB 1TKZA 4RNHA 1IM4A 4RW6A 1VRTA 3T5KA 4RNOA 3DLEA 4G1QA 1S9FA 4EEYA 1LWCB 3MECA 1IKYA 5FDLA 4IRDA 5KFAA 1RT6A 5K14B 4KFBA 4DL5A 2XCPA 1RA7A 4M95A 3E51A 4ZVHA 2RDJA 2BQ3A 4ICLB 2I1RA 3BQ1A 2FLNA 1S1UB 3DLGA 4MK9A 1R0AA 4KKOA 2ZD1A 4TXSA 4Q43A 4YQWA 4G3IA 3OL8A 2YKMA 4Q8EA 4I7FA 1SUQA 2XI3A 3OL9A 3RB0A 3CWJA 5I42A 1HQEB 3KNAA 2WHOA 4MFBB 4M94A 3GV8B 1RYSA 2YNHA 3V6DB 3DMJA 5I42B 3QIPB 4O3PA 2W8LA 4ID5B 4QWDA 1Z4UA 2FVCA 2VG5A 2FJWA 3CVKA 1RAJA 1LW2B 2W7PA 1S9EA 2J6UA 4J9OA 3KLEA 4QWBA 5F8HA 2FLLA 5DG7A 5HBMA 2AGPA 2UVUA 4MK7A 2FVPA 1FK9B 2ZE2B 3QLHB 4TLRA 1QE1B 3DOKB 1FKOA 5J2QA 2FJVA 4NLOA 4JUZA 1HPZA 4R8UB 2XI2A 5EWEA 4IG3A 4J9QA 3DRSB 3MEEA 1KLMB 5KG4A 4EBCA 4ZP7A 4J9NA 3M8QA 2YNGB 4EBEA 2ASDA 5KFNA 3QIPA 5KT4A 2AGQA 3M9OB 5EDWA 3T5LA 1S9GB 4I2QB 5KFYA 1S97A 1FKPA 2OPSA 5F8JA 3Q8QB 1S4FA 4B3OA 5DLGA 3FRZA 4NRUA 4RZRA 1S9GA 4I2QA 3MR5A 3H40A 1DTQA 3GV7B 3RB6A 2DPIA 2J6TA 5F8IA 4ED8A 1REVB 3BREA 3BQ0A 3DI6B 4B3OB 3KK2B 4WYWA 5KT2A 4ZPDA 4RW9B 3H5UA 4J9RA 5CYMA 1IKXB 3KHRA 3DYAB 3QYYA 2CKWA 3IGVA 3QIDA 1VRTB 2EC0A 2C2RA 2IM1A 4RNFA 1S1TB 3MEGA 3OHAA 4URSA 3PW5A 2JEJA 5J2NA 4TY8A 5F9LA 3IS9A 3Q8RB 3KLHB 1U09A 3H59A 4ECYA 4IR9A 4MIBA 2JEIA 4PWDB 5DG8A 4KFBB 2BRLA 3FQKA 5KFCA 3LP0A 3UPFA 4XO0A 5KFPA 4IQXA 4ICLA 1S0MA 3KLHA 2IAJB 3T5JA 3KLFA 2JLEA 3OHBA 5HP1A 3M9MB 4IH6A 4YR2A 1HYSA 3BJYA 3GILA 3C6TB 3LP1A 5KFRA 4NRTA 2XGPA 1MU2B 2HNDB 1JKHA 3QGGA 5KFOA 4TY9A 3BGRB 1QAIA 5KT5A 1SV5A 3DYAA 1W25A 4Q44A 5KFHA 1JKHB 3V6JA 1EP4A 3DOLB 2C22A 1JLAB 5KT6A 5KT3A 1UWBA 3ITHA 3I5AA 1HNIA 4WYLA 4RW8A 4NCGA 5C24B 1TV6A 3KLGB 4NLQA 3M9NB 3I5BA 4F50A 3RAXA 1N4LA 1LW0B 1JXLA 3H4BA 1UWBB 3ITHB 4KSEB 2D7SA 1T3NA 1TL3A 3OSPA 1JLFA 1EETA 2BQRA 1HMVB 2OPPB 3FFIB 4XPCA 2O5DA 5KFJA 3CO9A 3OL6A 3I5CA 2IMWP 2W9AA 1SH0A 4K4VA 2XWYA 3H2LA 3LP1B 4EO6A 3IRXB 3LANA 4YR0A 4FBTA 3NAIA 3H5XA 4F4WA 5KG7A 3M8QB 5HROA 3KK1A 4GC7A 1LW2A 1JLEB 4I2PA 4WE1B 2WOMA 4KV8A 1RT2A 1DLOB 1SV5B 3MR6A 4LSLB 2JC0A 3NKYA 4NLYA 4ECZA 3LP2A 5T14A 3KK1B 4DL4A 2WCXA 1TV6B 4ED6A 4O3QA 4NYZA 1FKPB 3PZPA 3H4DA 1JLCB 2R8HA 2FJXA 2GIQA 5J2QB 2BQUA 5DQHA 1TL3B 1TVRB 5KFSA 2QE5A 5DGBA 3PW7A 4JV1A 2ZD1B 1T05B 2V0NA 2HNYB 3HVWA 4IDKB 4H4OA 4I7FB 4RW9A 2R2UA 1S1WA 1IKWA 3IG1B 1HQEA 3IRXA 3RAQA 1VRUA 2YNHB 1S49A 1TQLA 3T1AA 1QAJA 4IH7A 4ZP9A 4KO0A 3CJ2A 5KG3A 3PW0A 3UQSA 3LP2B 2IM2A 2AX1A 4EBDA 3TVKA 4WFZA 2W7OA 2XGQA 4HYKA 5J2PB 1DTQB 3DLGB 2W9CB 4NLSA 1S10A 3M8PA 1TL1B 4O3SA 2VG7B 4TN2A 3UR0A 2R8IA 5CYMB 5KG2A 4ZHRA 3I0RA 2HNYA 4RW4B 2W9BA 1TL1A 1JLGB 4FS1A 2YKNB 3D5MA 5J2MB 3V4IA 4ECSA 4HKQA 2AU0A 3DMJB 5CYQB 5KFFA 3SI8A 2E9ZA 4QWEA 3KHGA 5JUMA 4J9MA 3NGDA 2R8KA 2BANB 4R5PB 2FVQA 1JLAA 3BSNA 2VA3A 1LWFB 5DQGA 3KLGA 2R2SA 5KFXA 2I5JA 4Y3CA 3KLEB 4DL2A 1LW0A 1S1VB 2WONA 4F4YA 4K4TA 2RKIA 3H98A 2W9CA 3DRPB 2B6AB 3DM2B 2HMIB 1HQUB 2WONB 3QGIA 3GV5B 2E9TA 3GIJA 4IFYB 1RT5A 4YR3A 3G6XA 3TAMA 3T19A 2R2RA 5F8GA 3I0RB 2W9BB 1RT3A 3PW2A 1KLMA 1TKZB 4DL7A 4NLTA 5KFZA 2AGOA 1RTDA 4MK8A 4RNMA 2ASJA 3QGHA 4WZMA 3TAMB 3E01B 2RF2B 3DRRA 1DLOA 1RT2B 2HNZB 2WOMB 4KV8B 5KG5A 4J9LA 5F8MA 5D3GB 3KJVA 2R8GA 4IOBA 2E9RX 2VG6A 1BQMB 4FS2A 3QO9A 1J5OB 1RTJA 2RF2A 3DRRB 1TKTA 3FDSA 4ED2A 4K4UA 2OPRA 5D3GA 2BRKA 2D3UA 3CJ0A 4JV0A 4NLDA 5I3UB 1JLBA 4LSNB 4DG1B 4RU9A 1RTJB 1NHUA 2UUWA 1TVRA 3HVTA 4Q45A 1DTTB 1TP7A 2WRMA 4IH5A 5KFBA 3KLIA 3MFIA 3DI6A 4NLXA 5KFQA 5KFKA 4ZMMA 1RT5B 3VQSA 5L1JA 2AQ4A 4NZ0A 2YNFA 2WTFA 1IKYB 3DLKB 3BGRA 4ECVA 4O3RA 4K4WA 4H4MA 3JYTB 1RTIA 4DL6A 4KO0B 3KHLA 3RB4A 2GIRA 3IS9B 4ZP6A 4KKOB 1T03B 3LALA 1S6QB 1RTIB 4NCGB 1SUQB 3MECB 5C24A 2IC3A 3JSMA 3LAMA 1IKVB 1C2PA 1QUVA 1JLBB 1N6QA 1XR7A 4NLRA 4Y2AA 1FKOB 4Y2CA 1S0OA 3T5HA 3PW4A 4F4XA 1R0AB 1RT4B 3MF5A 1N6QB 2HNDA 2OPQA 1S6PA 4ECRA 2D41A 5L1IA 4Q0BA 4MFBA 1RT7A 3KHHA 4TQSA 1XR5A 3FQLA 4URGA 3FSIA 3GIMA 4ECQA 4IR1A 1HNVB 4WE1A 4NLVA 3QZ7A 4DEZA 5C5JA 3M8PB 2HWIA 5KG1A 2FVSA 1HMVA 5DQIA 3G6VA 3PJXA 2HMIA 2D3ZA 4ZVGA 3CDUA 2YKMB 4J9KA 2R8JA 3NAHA 1N48A 3V6HA 4YP3A 3EZUA 2JEFA 4LQ3A 2ILYA 3C6UB 1T05A 2GC8A 2ZE2A 3QLHA 5KFDA 3PVXA 2ASLA 4ED7A 2IA6A 3EPGA 2XC9A 1S1TA 3MEGB 4IG0A 1C1CA 3C6UA 3BSAA 4Q0BB 4K4YA 2JC1A 2BE2B 2I5JB 4J9PA 2FLPA 1ZTTA 2OH2A 5F8NA 3KK3B 1S1VA 3H5YA 1TKTB 3ISNC 1BQNB 3CJ3A 4J9SA 5DGAA 5EUHA 1C0UA 5I3UA 3KK3A 4ED3A 4PQUA 1BQNA 3C6TA 3Q8PB 2OPSB 1RT3B 3PJWA 5EWGA 4XPEA 2AWZA 4YMEA 2R2TA 2VG7A 2F8EX 1C0TB 3MFHA 4ZHRB 5J2NB 1REVA 1RT1B 1I6JA 2AX0A 4MKAA 1N5YB 4TY8B 3KJVB 5L9XA 3DLKA 4TQRA 4PWDA 4O4GB 2YNGA 5C25B 1OS5A 1J5OA 4WXOA 4RUAA 2BE2A 3PR4A 1N5YA 1RT6B 5K14A 3KLFB 5JXSA 4ECUA 5C25A 4DG1A 4QWCA 1LWFA 4KAIA 3HKWA 3OLAA 3Q8SB 3HVTB 4O4RA 4ECXA 1S1UA 3RBDA 4WFXA 1MU2A 2B43A 2IBKA 1K1QA 4O44B 4EO8A 3NBPB 3ICLA 4JV2A 4O3NA 3DM2A 2B6AA 3CDWA 4RNNA 4RW4A 4ZP8A 2YNIB 1JIHA 4QW9A 2YKNA 3OLBA 3MR3A 1HYSB 5HROB 4ED0A 3JYTA 5CYQA 3BQ2A 1LWCA 5FDLB 1RT1A 4ID5A 2HAIA 3MTKA 2YNIA 1RDRA 2UVRA 4IRKA 4O4GA 1S6QA 3HVAA 3JSMB 2V4RA 4OL8A 2VG6B 3IGNA 1LWEB 3QZ8A 4MIAA 2C2DA 4K4ZA 3GIIA 2IAJA 4RW7B 2IM0A 1YVFA 2ILZA 4URQU 1HQUA 1QE1A 3DOKA 1K1SA 1LWEA 2WB4A 3NBPA 3NL0A 3V6DA 1S1XA 3CIZA 3OSNA 1IKWB 2UVVA 3HHKA 1JLQA 3MEEB 4WXWA 1SH2A 3G86A 5KFUA 2VG5B 2ALZA 4TYBA 1S1XB 3E01A 1S48A 1S9EB 2QV6A
chains in the Genus database with same CATH superfamily
3KLVA 1I51B 4DU8A 3CCSS 2JFKA 3PV8A 4O3OA 4DR3F 4F0MA 1VQYA 4NLWA 1UVIA 3O44A 5C42B 3BR9A 3R8YA 4K50A 4H54A 5KFMA 1U8WA 2Z30B 1KHVA 3M05A 2QC3A 2Z56B 2IMOA 4NLPA 2UUTA 2KKHA 2MJNA 1JJHA 1C1BA 2B5JB 3VV2B 4DL0C 4IO1A 1H0HB 2VF3A 3PYDA 5LXRA 4LRCA 3UDLA 4IG3B 5L1LA 4RO0A 1HARA 4TLQA 1WSVA 2FJBB 2AZ3A 2Z57B 3CJ5A 1C1CB 2VBWA 5ITHA 1TUGB 2EFGA 1JLQB 1Q16B 3CDEA 1T9XA 4ZCIA 3QJLA 1OIAA 3IN5A 2V9WA 1U2FA 3PXGa 3DGPB 2BJ3A 1VQ8S 3LTOA 5HJXA 3HPOA 1KQKA 2GO8A 2HYIB 3KG1A 2CUYA 3RB3A 1A0OB 4KHRA 5LSOA 3MAQA 1WDDA 4KHMA 4ETXA 4ED1A 3RG6A 2IC3B 5A8RB 3TZXA 4PUOA 1UZHA 2CJQA 3C16A 2P6SA 4K2JA 5HAOA 4QW8A 4CO3A 4HI1A 1JLCA 2R7UA 3V6KA 1NM2A 3V4IB 4ZCMA 4ZVFA 3OR2B 6FDRA 3IMQJ 4EZ6A 2CPXA 1UVKA 3TUJC 4IDKA 2MJUA 4OJHA 4ECTA 4LFAF 2XLKA 2DGSA 1XK8A 4YHHJ 2XO7A 4OHXA 1NJZA 1NK9A 3DOLA 1ULRA 3PEJA 3UE2A 2IJFA 3L7PA 2FY1A 3MEDA 2WVDA 1EJ7L 2HQ3A 2RKIB 2F5GA 4E98A 1U0HB 2OPRB 3NS5A 5HP1B 2IDLA 5KOXA 1H72C 5HBMB 1UPMB 3K0JA 3E3XA 3GIKA 2OFGX 1EETB 5J2PA 1LEOA 2ERRA 3EVMA 2VPWB 3MCOA 4J91A 4LF2A 4M5DB 3WX8A 4DMZA 2X1GA 7AT1B 4W98A 1XERA 5CAAA 5KFTA 4L74A 4C8KA 4O0NA 5F8LA 1T9TA 4FPIA 1X5TA 2DB1A 2NQPA 4ECWA 4NCBA 1S4EA 2RRNA 4CYUA 1NK0A 1XWLA 2OO4A 1BQMA 4IFVA 1GT8A 4UOHA 3UCGA 1M5PC 2W2MP 3FUYA 4RW8B 4PXEA 3TUPA 3M2RA 4FF1A 3SMZA 3WC0A 1SJ4P 2GFFA 3ZZPA 2WSCC 1S0NA 1CSJA 1JLFB 3BO4A 4B3MF 2NUUG 2YWGA 5KG0A 2C2KB 2DPJA 5C7PA 2OPPA 1WWHA 4OIXA 2E7WA 2B9YA 3LP0B 3QATA 1TKXA 1SVDA 2DNQA 1U1PA 2QFJA 4ZVEA 3M8RA 2C1EB 4DV7J 2YNFB 1LOUA 1NJIT 3PR5B 4HTIA 4H4OB 1IJFB 2G2OA 2ZHOA 1GXTA 2E5HA 3GG1A 3DKDA 4HH1A 3U27A 4RW6A 2OP5A 3T9NA 1OWXA 5H9FJ 4IRDA 2UZAA 2DD8S 5K14B 3EVWA 1S57A 3PEHA 4I56A 5DM7Q 4DL5A 1ZM4A 2Q6CA 4DDFA 2VBYA 1BE4A 1SBRA 2Y0BB 3PRDA 5GAGI 2FLNA 1KVIA 1S1UB 3DLGA 4CLYA 4YQWA 4DV4F 3IWNC 1XIQA 1RWWB 1WF0A 2CQBA 2CWKA 2DO0A 2YKMA 2EFQA 2MZSA 3L95X 4OZ0A 1SUQA 4YN3B 2J7WA 1OQ3A 2HFVA 1RKIA 3G8TA 3BO3A 4DV3F 4EI2A 3RB0A 4DR4J 1HQEB 4HEA9 3Q2SC 1YIJS 4MFBB 5IFMA 1FX2A 3KNAA 2UXCJ 1NSKL 1V5VA 2IYGA 2C2NA 2L48A 3DMJA 3NXZA 5I42B 2DT9A 5B7WA 5DDPC 1CQMA 1XMQJ 1F9EB 1N34J 2FJWA 1LV5A 1VMBA 1RAJA 3CVKA 1PJ5A 2W7PA 2AKWB 5HVGA 1NEEA 4H4KA 1MMDA 2IYIA 4QWBA 3T41A 4YS2A 3BKTA 3GJRB 3KUEA 5A0YA 5DDQC 5DG7A 2AGPA 5LMNJ 2FVPA 1MW7A 4I6YA 3OFFA 1FK9B 3SV4A 3QLHB 3NCQA 3L9ZA 4DR7F 4I68A 1IBMF 2N7YA 3M1VA 1HPZA 2CNOB 3P4UB 4R8UB 2IVYA 2ZZMA 4ZPWR 4F3MA 3RRKA 3MEEA 5KG4A 2KJVA 3KG0A 3H8YA 1IWGA 4J9NA 2IA0A 1X60A 2YNGB 2NSCA 4AXJA 4X4SA 2F3JA 1KFSA 8AT1B 3LW5C 4LFCJ 2XLIA 2Y1JA 2CNNB 2IPOB 3PG9A 1FFGB 4M5NA 2ABYA 5LXYA 2HRTA 1S9GB 4I2QB 1VIXA 1XNRF 3ILIA 1LK5A 4ZLJA 1S4FA 4RBVA 3EJMA 2EG1A 4NRUA 2VPYB 4PPZA 4G3IA 2IFXA 3H40A 4NMLA 4EZ9A 1HBMA 4ATNA 3EGNA 2L41A 2VQEJ 3PX6A 2R7XA 4B3OB 2H65B 4WYWA 2CZ9A 4E8UA 4RW9B 3H5UA 4J9RA 2MY7A 4M5GA 4PEOA 4C0HA 1AZSA 3KHRA 4DQRA 1FFSB 1LWXA 3IGVA 4X62J 4B3MJ 2XS7A 3HSDA 4U8VA 2C2RA 1S1TB 1Y11A 3FBBA 1M5KC 3AHPA 3GFYA 4J5OA 1SKSA 1P1TA 2PFDA 2GJ2A 2QLBB 2QG9B 3FMBA 4KIAA 3US5A 3UPFA 1VQMS 1V9OA 3KLHA 2IAJB 3W66A 1VBXA 4PRFA 2LKZA 1PAEX 2XB2D 2BBEA 3W2WB 1XTZA 1HNWF 1FNOA 1BY9A 2PT0A 4IH6A 4K2XA 4YY3J 2YQ3A 3SEOA 1HYSA 5IC6B 3MM7B 3WBZA 3OFEA 3OV7A 1MU2B 3D2WA 4DF8A 3RRHA 3IAM9 5HO4A 1TMMA 3G6ES 4TY9A 4C8LA 1O0PA 1TZ0A 4B08A 1IN0A 2MMYA 4OYXA 1NDPA 1NH7A 2XHCA 1SV5A 3DYAA 1D8ZA 1OJ4A 2LQ8A 3K8WA 3CW2C 1EP4A 2PA8D 2XBPA 3N01A 4LRDA 4BHQA 2ZITA 4QIEA 4EU0A 2LU2A 5GAGU 2R9LA 3CJRA 4JI7F 1BD6A 5C24B 4B9SA 4NLQA 4C3KA 1GMUA 4JOUA 4F4AA 1K8AT 4JYAF 4KSEB 1RP5A 2KJWA 4V1Ak 2BJ8A 4I6AA 2KZMA 3W62A 1IBMJ 1HMVB 1PC4A 2I0XA 2K7JA 1FRLA 1MN7A 3OL6A 4UY8T 2W9AA 1N33J 3MR7A 4QBUA 1L3KA 1WHXA 2XMJA 1KDNA 3LANA 4I64A 4YFUA 2GHPA 1EB0A 2GJIA 4YR0A 2QA1A 3DGPA 2GMJA 2WOMA 1DLOB 1NRKA 4B9LA 2CNKB 3RR7A 3EXCX 3KK1B 1D9AA 1SXLA 4PYDA 1TV6B 1KS2A 2FYXA 2HGNA 4JI3F 4NYZA 3EXYA 2E1AA 2Y1LB 1IQZA 1JLCB 3IM8A 2FJXA 3S1TA 5GADU 4CRJA 4ZCKA 3MOZA 4FVCA 3TA0A 2J9DA 2P6TA 3M2UA 4CM0A 2QJ3A 3OR2A 5KFSA 5DGBA 2DGXA 1H2UX 2H5IB 2V0NA 2ZWOA 1CS4B 3EYZA 3W8PA 1NK7A 1KSPA 4IDKB 1RGVA 4I7FB 1JWWA 3KFWX 2VJUA 3MPWA 2H54B 5JMNA 3W60A 4ES3A 3IRXA 5AJ3F 2QA2A 1VLYA 3CDBA 3BDPA 2A2CA 4ZP9A 4EGLA 4DLEA 3CSKA 5KG3A 2E44A 2ZOGA 3FBEA 4TU9A 1VIOA 4LF4J 4FYDA 4N5SA 1WC4A 4EBDA 5IM0A 2QSFA 3TVKA 1B64A 4U96A 4ERDA 1NZ8A 4FYWB 3A3OB 2GAHC 1RAOA 5J2PB 3F56A 4WK3A 4M5MA 2W9CB 5ETLA 4NLSA 2J76E 4O3SA 3P49B 5D4OA 4DR5F 2BKOA 3SCIE 3UR0A 1RISA 2RIJA 2RRBA 2OJ3A 1DAXA 3I0RA 2HNYA 4RW4B 3MURP 2W9BA 3Q0AA 3V4IA 2AU0A 5K8MA 1S6UA 3M4XA 2CQGA 2R8KA 5JUMA 2MQOA 4J9MA 2EG2A 2DRDA 3JQJA 5RUBA 3DXBA 4NXNJ 1IR2A 2AMCB 4N8NA 4QIVA 3D3CJ 3RAMA 1HBNB 2R2SA 5KFXA 3TVZA 5K5MA 1G2EA 2I5JA 4DCPB 3KLEB 4DL2A 2Z8QA 1ZAWA 2W2OP 3HCXA 3VVTA 2WONA 5I4MA 1RXOB 1NJYA 2RKIA 1K47A 1DJ0A 2FHJD 3PHTA 2LA4A 2B6AB 3DC2A 3QGIA 5HI7A 3GV5B 1UVLA 1PYOB 1BWVA 2AJ0A 2JH3A 1WOOA 2UP1A 2R2RA 5D0GA 3AJDA 1MMNA 5A8WA 1V6HA 4DL7A 4DV3J 4NLTA 2OD6A 4J90A 5KFZA 3MMJA 4EMDA 2XMVA 2DEIA 4USUA 4OI1A 2RF2B 1RT2B 2HNZB 4J9LA 4FVMA 5F8MA 3HHEA 5IZHA 2HFUA 4H4KC 3R5CA 4ZPVR 1BQMB 3AY0A 2DGVA 3EZOA 4ZN1A 3M2RB 3TO8A 5F3ZA 5D3GA 3GTYX 3O3LA 5D6GA 3HKZD 4RBUA 2N4DA 1FRMA 1FVSA 2FJEB 2YQ0A 1EHWA 1CBKA 1NHUA 4X2BA 1FDNA 3HVTA 1FNMA 1YRXA 1NK5A 3HULA 9RUBA 3N9UC 2V8GA 4Y2MA 3W5YA 4OX9F 1XMBA 3DGVA 1RT5B 4ZMMA 1E6YB 1EKSA 3HHLC 2YNFA 1VHFA 4F4KA 4JI7J 1UPPA 1QJHA 3AOCA 3OTOJ 1C4AA 1ITPA 1R8HA 3DLKB 4ECVA 4O3RA 2KT3A 5B0AA 1K0VA 4DL6A 4NEYA 2IRXA 2G0CA 1ZH5A 3MPUB 2LVWA 5LT5A 3IS9B 1VQ5S 1Q5YA 4X4TA 2A1BA 1T03B 2MKJA 3SCLE 4DUYF 4IYQA 5A0YB 1KP6A 2V9KA 3JSMA 1HWUA 3LAMA 1X0FA 1R0CB 2JJ4D 2NUHA 4Y2CA 4ZJQA 1XR7A 5FLXY 1S0OA 4JI1J 2DY9A 4F4XA 4C8YA 1RHJB 3MF5A 1LFWA 4K5SA 3B54A 1N6QB 2QIFA 2HNDA 1PBUA 3U7JA 4B3TF 3T1HJ 1TTHB 1DARA 1UEUA 5E3QA 2W7AA 2J8AA 2KH9A 5L1IA 2EFOA 2XSJA 4MFBA 2EEYA 2Q6BA 4HHHA 4OYMA 1XR5A 2V50A 4C98A 5DDOC 4TQSA 3KHHA 3CXCR 2LFVA 2Q1LA 3MTJA 4QYZJ 5DS7A 3QZ7A 4DEZA 3CJTA 5EX3A 1FTRA 3GMGA 2LQ5A 2DNKA 2HWIA 1XC9A 1X5OA 3I4PA 3MM6B 1F6TA 4P7TA 4P72A 3PJXA 1Q53A 5DQIA 1YLXA 1LXNA 2PDAA 3CDUA 2AZ1A 5DRKA 4J9KA 3NAHA 2WBRA 3V6HA 1N48A 2ILYA 2B3TB 4K59A 3PVXA 3QLHA 1U6ZA 2MHEA 2R4FA 1ZA2B 3P5TL 3EPGA 2XC9A 1B0TA 1S1TA 1R7IA 1RLCL 1C1CA 3C6UA 3KYLA 4Q0BB 4K4YA 4P52A 2JC1A 1MLAA 1TFYA 3SIPB 2OH2A 4G1PA 3P6YC 3ENWA 1YRTA 3MAHA 3TOQA 5G0RB 4OJ3A 4G65A 2HHXA 2RJZA 3CJ3A 1AFIA 5LSLA 3LWMA 3BDEA 4LF4F 1SCJB 5I3UA 2G0JA 4C11B 4ELUA 2XSFA 2XULA 4CNYA 2J9CA 3SBMA 1BQNA 3MM7A 1AXQA 1V3RA 3R2DJ 1G7CB 3IA0A 3BGUA 1KOHA 2W2PP 4XPEA 2DITA 2AWZA 3FC9A 5HSPA 3J7YU 2VG7A 1M1GA 2F8EX 2VDHA 3KUGA 1KQFB 4A8KA 1H38A 2BQUA 4ZHRB 1EQMA 1RT1B 4QZVB 4B3RJ 2BE9B 2IHR1 1UWAA 3EICA 3D1HA 1CPZA 1B3TA 4P71A 4NXMF 4WXOA 5C25B 2O67A 1J5OA 3IM9A 2MZQA 2E1PA 2DIVA 4M1KA 5HMYA 1AZSB 4DV5F 2F8MA 2Y8YA 4CP5A 2ZBIA 2XQCA 5JXSA 4LIRA 3HFVA 4DG1A 2E1CA 4WP8A 5LSRA 4Y6IA 5ETOA 2V6AA 3M6XA 3SSRA 1KOOA 2DCUB 3RBDA 4AL5A 4PQAA 4ED4A 2B43A 1IJEB 3MMCA 4NMXA 4HI2A 4KTQA 2HVIA 1NJXA 1HBOB 1CVJA 2H5JB 2XY5A 3I82A 3QGPA 3QWPA 4O3NA 2KDOA 4L76A 3CDWA 4X4RA 4XDCA 2R7SA 2N3OA 5ADZA 3ETMA 3MR3A 1KQSR 3EMTA 4W90B 1HYSB 2FY8A 5AXMA 4ED0A 4JV5F 5CYQA 4WTOB 1I3OB 4F25A 3PACA 1VC6A 4E0DA 2HAIA 4ID5A 2F4VF 1T9VA 3QAEA 2IBOA 2ZJRQ 3K59A 2XMTA 2OMLA 1PYTA 2WBMA 2VFRA 2ACMA 2NZCA 1WEYA 2MEWA 2C3PA 1S5ZA 2RS8A 2V4RA 3N5BA 2LDIA 4HL9A 3QZ8A 4MIAA 4J9UE 4K4ZA 3GIIA 5IS2A 1SKRA 1P9QC 3MM8B 1HQUA 1JMTA 2WB4A 2NLWA 2QLWA 4NOHA 4LJMA 1S1XA 1DQ9A 2UVVA 3SQGB 1HW9A 1AROP 4WXWA 1SH2A 2Z2MA 3CD7A 2HFOA 3DU5A 2FPHX 2QT7A 3HHLA 4TYBA 4ZCLA 3E01A 1S99A 4ANCA 1S48A 1JJ2R 1IBLF 1GQEA 2GVDA 3WX4A 3NLCA 5A8KB 3CCLS 4RW6B 5HVHA 2ZH8A 4LF5F 1N56A 3QO9B 1NHVA 2CQPA 4QWAA 2DBBA 1Q1KA 1FRIA 4ZPTR 2UUBJ 3V81B 1C0UB 2YXLA 2OHDA 3FRYA 2HLUA 3W61A 3ZC4A 4DCJB 4R8UA 3MCMA 2V4JA 4RW7A 2UV8G 5KG6A 3D3BJ 3RBEA 3BPDA 4PWWA 1VQ6S 2OMOA 3CCRS 1TUVA 3M2UB 5DG9A 4DV5J 1C0TA 5L38A 3G8SA 1VBKA 1RT4A 3PIPQ 4DR1F 3PDNA 2XZWA 4A8WA 3TAPA 5L1KA 2NYHA 4H4MB 2AJ2A 2GA7A 2M70A 3TEGA 1N32F 4P9SA 2HBQB 3GJSB 2QO3A 4LSLA 4TU7A 4YB1P 3WIVA 3QT8A 3CUNA 1YJUA 3K5PA 2OFHX 1U1OA 2HWHA 2E29A 1IKVA 4FXWA 2E1RA 5CZVA 2RUGA 4DF4A 2JEGA 3BSCA 4RUHA 2LEAA 1VGYA 3O1LA 4Y65A 4GKKF 2LLZA 2HHTA 2I38A 1T7PA 4JI5F 1MMLA 4CTAA 3UNYA 1VQNS 2JWNA 4DUZF 5F9NA 4P73A 2W8KA 2A2DA 4C6AA 1HWJA 1S1WB 3AB4B 4WKRA 2B4VA 4KH0B 1RSCA 3MCSA 3DDKA 4CLPA 2CZVC 4X66J 2VA2A 4Q8FA 2Y1RI 1XR6A 1ZZFA 4P2SA 5AXLA 3TYTA 4OZ3A 1VJQA 1BHNA 4RPFA 3RBZA 3CT9A 2Z4PA 7FDRA 3NMAA 5B0FA 4DU7A 4OYIA 1S6OA 2C3OA 2JVOA 5CCMA 4U8YA 3UN3A 2KVQE 3WC2A 3HO1A 2NXJA 3MHYA 2DR6A 3BSOA 4B9TA 2MQLA 1NAQA 4OZJA 4DR1J 1FK9A 4GRSA 3S8SA 3THPA 2ATLA 4V19J 3UVJA 1RTDB 2FTRA 3NP5A 1HPZB 5KFWA 1WDTA 1K73T 2YTCA 2YKQA 3W65A 3G6YA 3L7UA 1FJGJ 1KHWA 5KFLA 3EGZA 3VCDA 4JI8F 1DQ8A 3FBCA 3KDOA 3D0HE 1NO8A 4I2PB 1TMJA 4KB7A 4CT9A 2MKKA 1Q8KA 2J7UA 1J2VA 1UA1A 4LBIA 4FYXB 1T03A 4RUCA 3OUYA 5J1EB 1H2VZ 2CZ4A 2HNZA 3D6FB 4U6PA 4JBCA 1UVMA 5CA5A 1RTHB 3PNIA 2CDRB 4CH7A 3MR2A 2F7VA 3HD2A 4PXBA 1I94F 1RHUB 3SFUA 2HHWA 3W1YC 3M30B 3M7VA 4HACB 3W9IA 3BN4A 1SH3A 1YJRA 2GZOA 4KRWA 4R0EA 4QR0A 2GVZB 2VOOA 2APOA 2UUAF 4EK2A 4ITSA 4BC7A 3I0SA 3T6JA 3AD8C 1TKZA 4Y28C 1IM4A 4CH0S 4UW2A 3BR8A 3DLEA 4G1QA 1S9FA 5BXIA 2UXBF 2HIQA 4OZNA 1SC1B 2EWHA 1FCAA 2HBRB 3CB4A 3D6TB 4HDHA 3IO1A 2XCPA 3C14A 1RUSA 1WHWA 2LQBA 3E51A 4ZVHA 4Z37A 2RDJA 2DISA 3CD5A 2ZBCA 4RLEA 1TL7B 4P75A 2E5LJ 1R27B 1R0AA 2XS2A 3PCOB 3W2WA 2DR7A 3OL8A 4Q8EA 4ILRA 3IFEA 4I7FA 1QY7A 5U47A 3CWJA 3GSIA 4QIWD 5BJRA 4X4OA 1FD2A 4M94A 1EZZB 4KC5A 1VI7A 2HQFA 2H4YB 3ILJA 3J81j 4LSZB 4O3PA 4AQYJ 1HR0J 3HF5A 2VD3A 1UJ5A 2A6MA 2B8QA 2CIMA 2FVCA 2ZOFA 3R3TA 4ANDA 2VASA 3DXSX 3ZZOA 4CIOA 4W92B 4A46A 5CCLA 1HWLA 5AXNA 2XNRA 4L3NA 1Y5LB 4C11A 4X65J 4NXMJ 2CWXA 2RAQA 1YBUA 3GCXP 3KNGA 1KRPA 1YX2A 4MK7A 4PYAA 1M1HA 2ZE2B 3P5BP 4TLRA 1QE1B 3QRQA 2HHQA 1BC6A 2QRRA 2QMWA 3CCJS 4NLOA 2V8HA 4FF3A 1KONA 2FC9A 3K57A 2OTJS 3HHDA 4J9QA 4Q5VA 2BJ1A 2XYHB 4DFPA 2DGWA 1SIWB 2XWXA 3OBIA 3QIPA 4RL1A 2M4MA 3BKUA 5D0EA 3MOJB 3NG8A 2QZ8A 2UV8A 4L72B 4NYPA 3SXLA 5KT4A 5DDRC 3M9OB 4NI2B 4F36A 5EDWA 4XIUA 1NBEB 1ROFA 3FZ2A 2ZBPA 2ZH5A 3T5LA 2D69A 4FF4A 4LF8J 1WORA 2MQ8A 3FEYB 3QMQA 2XG8A 3MM5B 2YY3A 3FRZA 3AODA 2J6TA 1RHRB 3FCWA 4NL5A 3MR5A 2DPIA 3L09A 2ZEJA 3B6BA 3EGVA 4ED8A 1VBYA 3BQ0A 2GW8A 2CVEA 3KK2B 3J80Y 3AQOA 3OD2A 2WB1D 1SJRA 3ZZZA 1IKXB 2GCFA 2RNEA 1WHYA 4LREA 3QYYA 3OVSA 5K8PA 2NXCA 3A8IA 1VRTB 2EC0A 2HFZA 3ILLA 4ZVTB 2JSXA 2MQMA 3OHAA 2DHAA 2GHVC 2X3GA 4Z2XA 1RACB 1QLNA 5DG8A 1TU0B 4KFBB 5KFCA 3R1HA 2XZDB 4PXCA 5K9FA 4IQXA 2HZAA 4K0KF 4ICLA 2X3DA 1KVKA 2UU9F 4RWXA 3VVUA 5LJ5Y 3T5JA 1WKJA 1YJ7A 2XZTB 4YR2A 3DRXA 4JP8A 4CT8A 1T9WA 1E6YA 3GILA 3C6TB 4J9VA 2UXCF 3POTB 1NLKL 1NPRA 3CIMA 2DNLA 1JKHA 4M5KA 2PE8A 3I31A 3QGGA 1VCTA 5KFOA 1HBOA 1QAIA 4K0KJ 2AP6A 1F3FA 3C15B 1UJ6A 5A6WA 3B4MA 1W25A 4JI6J 1P9YA 4Q44A 4PG4A 5E2QA 1X4HA 1Y3KA 5KT6A 4UOCA 3I5AA 1HNIA 5IT4A 1RTZA 2MPUA 4RWWA 3G71S 4F50A 1HBUA 1S72S 3G9CA 1N4LA 1DHMA 4F02A 3R1LA 1UWBB 3ITHB 2NYIA 4CQ1A 4DV7F 1T3NA 1U4BA 3D67A 4X64F 3MUTP 3E2EA 4DQQA 5MLCV 2BQRA 1UVNA 3O8WA 3MXHP 2K8GA 2U1AA 3FFIB 3LUYA 3N4WA 2O5DA 3MM9A 1X4GA 3QFHA 3OFHA 3CC2S 4K4VA 1UL3A 2RQKA 4X4NA 3LP1B 3AXMA 3QSYB 3MM8A 4OFZA 2ROGA 1VDHA 3M8QB 1G3OA 5CZXA 3EM1A 1JLEB 4PG8A 3EE3A 3CMAS 1RT2A 2K1RA 4LSLB 2JC0A 4MYTA 1K44A 4NLYA 4Z7YA 1KWMA 4RU2A 4ES2A 2EFPA 3CCZA 4HT7A 3J7Z5 2WCXA 5DZ6A 4DL4A 1P27B 4ED6A 3J7ZT 1KVJA 4J7CA 3ENVA 4OHWA 1RU1A 1FKPB 1FWPA 2DCLA 3H90A 1NSQA 3H4DA 4FF2A 1TL3B 2EVZA 5EGYA 2CADA 3NGRA 4ALZA 1V3ZA 5IV4A 3MPYA 2V68A 2GGPB 1FEEA 3KG4A 3ETOA 4YEAA 1YSJA 4C3MA 2B8PA 3NMRA 1Y0HA 1S1WA 3OTCA 4NEZA 3VR1A 2UUBF 1R8PA 1U02A 3RAQA 2AJ1A 7FD1A 3WHIA 1TQLA 4DQSA 1RJJA 4R0JA 4RR5A 1Q7LB 4K5RA 3UQSA 2GMLA 3LP2B 2IM2A 4RX6A 2GMHA 4YOEA 2ZHAA 3J7YI 2W7OA 3C2PA 2H4WB 3EVOA 2RSQA 4HYKA 2G9OA 4CLSA 2R3VA 1WTFA 1Q0NA 1Q8IA 1HIYA 1WJ9A 3A8JA 3EGWB 2MZTA 3W63A 2XLJA 4EUVA 2VG7B 3UWTA 4L3KA 5CYMB 1GAOA 3V4MA 3K5MA 5KG2A 4ZHRA 4DSIA 1YHQS 4AYBD 3QNWB 1TL1A 1VC5A 2YKNB 4ECSA 4E2FB 1WELA 1RAHB 2PIIA 4OI4A 4DUTA 3DOMB 3L3CA 2XSJB 1FD8A 3QAUA 1O5JA 2OEJA 1YK9A 1EAYC 3RBXA 4IO9Q 1JLAA 2XYGB 3OUYB 1YZ7A 4KY3A 1R3NA 4C9DA 4ZLNA 4USJC 4Y3CA 4UY85 1F2GA 2NS1B 5DM6Q 1N5TA 4K4TA 4TVAB 2F63A 1K9MT 4DSLA 3MZIA 3OW2R 1PJ6A 3G2XA 4DJBA 5GAEU 5D4PA 2E9TA 2KTQA 3G6XA 3TAMA 2LU1A 2HEKA 4K8RA 4P10A 5EN1A 2KFYA 1D9DA 1KLMA 1TKZB 3GONA 3NWRA 2AGOA 1RTDA 4MK8A 3QGHA 2KYXA 4A4JA 2P5VA 3DRRA 2QMXA 4KV8B 5KG5A 1CC7A 3CDAA 3CTRA 3UI3A 2A0FB 4CLTA 5L39A 4DFKA 4IOBA 4B3TJ 2XTJP 2MGZA 2G4BA 1H7XA 3TJAA 1J5OB 1RTJA 2G1DA 3HZGA 4Q2LA 3M6UA 3FDSA 2H5EA 4C0OC 2BJ7A 4ED2A 3M8YA 2HVHA 5ETVA 5I3UB 3KXDA 3ISZA 2AHOB 4DG1B 1B0VA 1YDLA 1BUXA 2DY1A 4USHA 2ROEA 2R7RA 1PO6A 1DTTB 1TP7A 2Z0GA 2CPFA 2WRMA 3OTDA 3KLIA 2FUG9 2KVIA 3DI6A 3MMCB 4NLXA 5K20B 4OMFG 4DV1F 3BH7B 2EBEA 3PX0A 5CH7B 3SDEA 3VAKA 2BOPA 5B08A 3WQPA 2YBVA 1DBDA 4KH1B 2B9XA 1E6VB 2OSRA 3LA0A 4QR2A 5DJBA 3VAMA 1U24A 2WSFC 1RBLA 1TAQA 3BGRA 1R8BA 1Y10A 2HGLA 2DXEA 2CQIA 3VGTA 1RTIA 1QSLA 4JYAJ 2BJEA 1RWKB 2VONA 1RABB 3WIUA 3M32B 1W2BR 2KHDA 5A2QY 2OTLS 4P2FA 3CCQS 2EXUA 2HZCA 1T9YA 4DX5A 3HXMA 4NCGB 2FDNA 3TNVA 1FTCA 2HIYA 2IC3A 2H9ZA 3AFGA 3M2VB 1X4DA 3MEKA 1C2PA 4TNOA 1QUVA 2X1AA 4F2RA 4JI5J 1JLBB 4LR9A 1ZM9A 2DH9A 4ES1A 4ER8A 4F3OA 5FLXU 4OYPA 2HFNA 1R0AB 1RT4B 4A8XA 4AUKA 4C0BA 2DHHA 2VICA 3MPVA 2OPQA 1CJUA 2LCWA 5LMNF 4DX8H 1MWYA 2M3DA 2O01C 5IWAF 2XY6A 2DEJA 2F9JA 2V63A 2HQIA 2ZNZA 3M8WA 1X31C 1W2IA 2DJWA 4WBFA 4URGA 2CDQA 4PG5A 4PKDB 4WFAQ 4ECQA 4DHVA 4DV0F 4WE1A 1F9HA 3ZFVA 1U0HA 1I1GA 2GO9A 2HK2A 5C5JA 4Q2MA 2COLA 3KJQB 1GMVA 3W2VA 3M8PB 4ZIVA 4A8FA 3RZAA 1SL2A 2YKOA 4Y2IA 4N76A 1UKUA 1U6FA 3D6HB 3CF5Q 3UDCA 1GEHA 1VQLS 3I32A 4GKJF 3VZHA 3OTEA 2KFNA 2AEMA 4OJ1A 1S79A 3I87A 3UN2A 2RS2A 2DNOA 3SQGA 1T05A 2CQCA 2ZE2A 4CLWA 3NNHA 1CG2A 5EX0A 4YHHF 1LXJA 3HHLB 1L5UA 5HANA 2X1FA 2L3MA 4CH1A 2KG1A 3W7BA 4J9PA 2FLPA 5CYJA 1Y5IB 4O0IA 3KK3B 3EDQB 2E7XA 2D1CA 2EFNA 2ZVIA 1TKTB 2V8VA 4DI6A 4C4WA 2IVMA 1C0UA 2FLOA 4YB5A 4LFCF 1HHSA 2F8HA 5AE1A 4ED3A 2DNMA 4OX7A 4ZJOA 3UVJB 3PKMA 4QYZK 3C6TA 2L9DA 3DHWC 3K17A 3LOUA 2MKSA 4WU3A 5D4LA 4RBTA 3VF0B 4U95A 3OVAA 1RT3B 3AOBA 1Q7YT 1EARA 1RHMB 1SQEA 2KXFA 3PJWA 4ZVQB 4YMEA 3M8SA 2XMAA 1NMEB 1C0TB 5J1NA 4DFJA 5B0DA 5T41A 1YRUA 2P2CB 4QU6A 3RRGA 1NKCA 3KJVB 2HVZA 2ZBRA 4PWDA 4MTPA 2ADBA 2ZM6J 1OS5A 3NNAA 1RK8A 2BMBA 2KG0A 1FF2A 1FHTA 2MQNA 2BE2A 2BEFA 4GVBA 4WPAA 1N5YA 1HBUB 5ETTA 5K14A 3PR4A 3KLFB 2VHGA 4C8OA 3THTA 1NKBA 2ASYA 2ZC3A 1LWFA 4KAIA 5D78A 2ZKTA 4Q7AA 5ETSA 3OLAA 1I5OB 1KNZA 2AIRB 2YWKA 1S1UA 3OQ2A 1RAIB 3NOCA 2YH1A 3DLBA 1URNA 4OLOA 1CLFA 2DNRA 2KO1A 4C2MA 1H73A 2FJDB 3ICLA 4NZ7A 4EO8A 1VQOS 2OIHA 1WUUA 3GCWP 1GMWD 3QBCA 1OO0B 4M5JA 4ZP8A 5H9EJ 3AD9C 1JIHA 2UU9J 4WCEQ 1RBOB 3OLBA 5HL7Q 3JYTA 4KGXB 3W9HA 1Y4ZB 1Y7PA 5E3PA 2YNIA 3UDVA 2UVRA 4IRKA 1HLWA 4O4GA 2YX7A 4I1TA 2XNQA 2V5HG 3JS9A 4CM2A 3GYXB 2ZH3A 1NJWA 2AYGA 1AW0A 5AJ3J 4KPCA 1LWEB 1WC6A 1S0VA 3MI7X 2DGOA 1YKWA 3O2IA 2EI5A 1PYSB 2LDYA 2ATCB 4JI6F 2IM0A 3RYLA 4URQU 3AJ2A 4HDGA 3J7AN 3BZQA 1HI8A 2HGMA 3M8ZA 4I0WA 4LUBA 4QJVA 3NBPA 3W5ZA 4PR6A 2N3LA 5ETRA 3QQCD 4JI0F 3LGHA 2PI4A 4AE5A 3ZZUA 3HHKA 1JLQA 1SC6A 3MEEB 4MKVA 4JB8B 5IV3A 1QTMA 3CJKB 1H74A 3TR5A 2HW3A 1NK8A 1KTVA 4DR4F 3ET6B 3NCPA 1PBAA 4LR8A 3Q89A 2J0XA 4WJBA 2VOPA 2LECA 4CLFA 1FDDA 2J0QD 1M0SA 3GG0A 1NH8A 4MMOA 2K06A 2FQQB 3BN7A 1ZS6A 3C14B 3K58A 1D9FA 4PQUB 3MAAA 1N0UA 1UFLA 2RDIA 1HL6A 1GX6A 3HI9A 3B82A 2DK2A 2GX8A 3QT5A 2BR0A 3DRYA 4FZVA 2BDPA 4KE5A 3OR1B 3IBFB 1BLUA 2H1YA 3LPYA 5EWFA 4LIWA 3I0SB 3A13A 3C66A 1IBKJ 4LF9F 1F3VA 2IJNA 1S6PB 3MMAA 5LOQA 1R6VA 3JB9k 3W8GA 2CQ1A 4I69A 3AXKA 4IRCA 3HK2A 4OHYA 2C3UA 5F41A 3SCJE 3OJUA 2J6SA 4S0MA 3N6NA 1APSA 2M7SA 3HZEA 4QCLA 1M5OC 1FI4A 2IM3A 4UQTA 1VHIA 1GH8A 3QFWA 5DO2A 3EPIA 1O51A 3IP0A 5C42A 3KJNB 5AXKA 2C28A 3GJTB 4UZBA 2GNKA 3DN9A 3P3DA 1Q78A 2PMHA 1CJTB 4ZPAA 2VFVA 4Y0FA 3W3SA 2W24A 5C2GA 5IT9U 2GS8A 2A6OA 2IY5B 2FIUA 1NNDA 3N6LA 1PIEA 4NZ6A 1GXLA 1PKUA 1XEZA 4FYYB 4PUOB 2RQMA 3C16B 3DFEA 4ZJLA 4K4SA 3N0VA 1PGZA 2NPIA 1U49A 1P1LA 3Q8UA 2CJ9A 3JTPA 1QTNB 1J27A 3IG1A 4TYAA 1L3UA 4NLGA 1Z2ZA 4WP9A 2A18A 3JSYA 1RT7B 3BYRA 1VRUB 1EP4B 3KJFB 3L7OA 3QWUA 2O1PA 4FNIA 1WF2A 2EPIA 2WZ1A 3NRBA 4WTYA 1HNVA 4F3QA 3NGKA 5HMXA 2Q66A 3KMQA 3KMSA 1GK8A 3IBWA 3G82A 4DPUA 1TK8A 5T7LB 3PHEA 3N6MA 4Y34A 3MEDB 5KFIA 4IFYA 1RWVB 4ELTA 2X51A 2CJKA 3DU6A 4BS2A 4JI2F 1IBKF 1WACA 4LF9J 1OYDA 2UVWA 1R0BG 3D28A 2CQ0A 2J8SA 2BJDA 4IFVB 1MG7A 3NS6A 1FRHA 4XK8C 1RHKB 2JRSA 2WK4A 3BPSP 3SFGA 4LF5J 1DQAA 2ZKUA 3KK2A 2BZ2A 3D0IE 3H5SA 5SZTA 3R5GA 4IG0B 1IKXA 1FWLA 2GV1A 2XEXA 4U7CA 1YWXA 2BANA 4ZVOB 3Q22A 4IKAA 5M2PA 4XAKA 4LFBF 1AFJA 1K0TA 1ZOTA 5E3AA 1TKXB 2J9DE 1CJVB 1WKLA 1A9NB 4JI8J 5KFGA 3FFIA 3HSZA 4UTGA 4EYIB 4DV6J 5HLFA 2Y3YA 3U02A 4FXDA 1UFWA 2J0SD 3LGMA 2V4QA 2V67A 2RB7A 3CD0A 2AEFA 2OPQB 4O44A 2CJBA 4WIQA 4F4ZA 3AH6A 5KFVA 4EYHB 5IC4B 1DTTA 4JI4F 1KTQA 4HHUA 5A6PA 4K4XA 3KLIB 3T5KA 1SIZA 1VRTA 3T9ZA 4RNOA 1SC4B 3JQKA 2F4VJ 3C15A 3FBFA 4NXNF 1IVZA 5FDLA 4R25A 1TK5A 1WEXA 4AFFA 2MZRA 3NS7B 5KFAA 1RT6A 4BWMA 2UXDJ 4KFBA 2G2ZA 1S7HA 2BJ9A 3FZBA 4WWSA 3T1YJ 1RA7A 4BC9A 1RWOB 2VBZA 4OHZA 4OI0A 4ICLB 2I1RA 2VB6A 4P2MA 4BLGA 1RWPB 2RQCA 4MK9A 3BQ1A 4DUZJ 1JJ4A 1X4BA 2LXUA 1VQ7S 2XI3A 2E7VA 4DR5J 3OL9A 2DH7A 2CJYB 1VQPS 4V19X 3NOGA 4DWIA 4NCAA 1YQHA 5I42A 2WHOA 1R43A 3GIRA 4DV4J 1RYSA 2VFUA 1BWEA 1H7WA 2FZGB 2BOAA 2M2BA 2W01A 1FFWB 1WOSA 2B0GA 1NDLA 1LQ9A 2FHKA 4USMA 4QWDA 4EFAC 2W8LA 1Z4UA 6AT1B 1VK8A 2QA4S 1N5SA 2FGCA 1S9EA 1GTHA 2K1RB 2J6UA 1HHTP 1FX4A 2DNPA 3KLEA 4QIGA 4J9OA 1XMQF 2NZ4A 5F8HA 5M2UA 4OI2A 4TKTA 4JI4J 5L9NA 2ZM6F 2F9DA 2BVZA 2VDIA 3FJ2A 4P7VA 5IWAJ 3RTVA 1WG1A 1Y5NB 2H3EB 3ZO7A 4CDIA 2HSEB 3DOKB 4DLGA 2LP4A 2Z2LA 1X9WA 2FJVA 4JUZA 3NGUA 3RW7A 5IQ6A 5HATA 3DRSB 1M5HA 2RH3A 2VU5A 2ZFHA 5D77A 4ZP7A 2E66A 3ENQA 4AL7A 1JXVA 5FJ4A 2I2YA 3M8QA 3R7NB 3T1YF 1H98A 2AGQA 3AJ1A 1NK4A 4PWUA 3X1LB 3BBCA 1SJ3P 3EX7B 2LEBA 2QX0A 1KD1T 2NPFA 1M5VC 1HA1A 2CPDA 4KT0C 3LPEA 2MQQA 1FKPA 5F8JA 2BKNA 3Q8QB 3R6LB 4B3OA 4X84A 1FE0A 3D6MB 4RZRA 2IDEA 1S9GA 4I2QA 3RB6A 2DYAA 1P6TA 1ZAVA 2P9GA 5F8IA 1NUEA 3BREA 4JI2J 3ADAC 1EX8A 3I9ZA 3M1VB 2EW9A 4ZPDA 2CYYA 3QSIA 1F5CA 3HJFA 5CYMA 4I6WA 1TUWA 3OPKA 3BB5A 3EZ5A 2DKOB 3AT1B 1HNZJ 3DYAB 2WAQD 3UN5A 2ACYA 2E5GA 3QIDA 2W4DA 2IM1A 2CQ2A 4RNFA 2ZH7A 3KWMA 1U48A 3SSSA 1N5VA 2Z2YB 2C3MA 3ZNUA 5JVGQ 5F9LA 3Q8RB 3IS9A 2CJAA 3KLHB 3D68A 3BGLA 4X62F 3IRWP 1U47A 1CULA 4PWDB 3R5BA 4IR9A 2JEIA 1G6BA 3MCNA 3WDOA 5D0RA 4XO0A 4F26A 1CQNA 1VR6A 2CPHA 3GWCA 3TUZC 1WTBA 1S0MA 4JI1F 2B56A 3KLFA 1HR0F 1ICEB 2KI2A 3H2VE 4FYVB 3PYEA 3M9MB 3L4BC 3BJYA 2ZOMA 1VRQC 3D7SB 1W7WA 3RUBL 3HD1A 3PRBA 2VZ9A 1HBMB 4NRTA 1OPZA 3N28A 2HNDB 5B0BA 3BQ2A 4LF7F 3A4TA 3AA8A 5GAHU 3BGRB 3R5JB 5HQMA 1NSAA 1KN6A 3E8OA 5KFHA 3DOLB 1JLAB 5KT3A 1X4AA 4FKYA 3TW0A 1UZDA 3JAMU 4NCGA 3U1NA 1TV6A 2RQ4A 5HJYA 5FIIA 3M9NB 2Z58B 1TR0A 3F41A 1UFKA 3H4BA 1T02A 1N8RT 2OEMA 3MD1A 4OJGA 3BO2A 1JXLA 1DFDA 4N7TA 5H9EK 1EETA 4CLUA 3A8KA 2PO4A 8RUCA 4A48A 1UTAA 1TELA 2IMWP 1SPBP 5B0EA 4UOGA 2HLTA 4DPOA 2A10A 1MWQA 3HJVA 1X0PA 3JSBA 3IRXB 2QLFB 4EO6A 3H5XA 3NAIA 5HK4A 2AJQA 4F4WA 5C2CA 4C3LA 1KEKA 5HROA 3KK1A 4ZLLA 1LW2A 4GC7A 4WE1B 4KV8A 1S59A 1SV5B 4BBYA 3VAJA 1N34F 2VV5A 2MXYA 2M88A 1QM9A 3G87A 3D1QA 3TA2A 3K5LA 4X4VA 3UNGC 4OZ5A 2KB2A 4QR1A 1CEZA 3HSGA 1KKHA 3CCMS 2RDDA 3O5TB 1JQGA 1NDCA 2ZZTA 4PZVA 1R31A 3PZPA 2R8HA 1HNXJ 4KGZB 4MIWA 2GIQA 5J2QB 1RQ0A 3JAMY 5DQHA 4QOTA 1VBZA 4JV1A 2ZD1B 1T05B 3HVWA 2HNYB 3K5OA 4WK1A 5ETNA 4H4OA 3DDNA 4XDDA 4OV6A 1U2CA 2R2UA 2MY8A 3IG1B 1U26A 1IKWA 1QAXA 1U25A 1E6VA 1FE4A 1ZM3A 1G4CA 2HWTA 2Q79A 2QLXA 1VRUA 3HFKA 4OZ2A 2YNHB 5D4NA 3TA1A 1S49A 1ZBTA 1IWAA 3GFZA 3C19A 5IM0B 4DL3A 3UCZP 1QAJA 2P9EA 4IH7A 4DR2F 3CJ2A 2R7QA 3PW0A 1WHVA 3MMAB 3I96A 2AX1A 4HTJA 2EK6A 3JTOA 3F44A 1VJWA 2DHSA 3I9V9 1DY3A 1DTQB 3DLGB 3GFHA 2WW4A 2KT5A 1S10A 3M8PA 5ETQA 1MNEA 1GFWB 1RLDA 3NCRA 2IRYA 2OAUA 1B70B 2CAJA 4GO7X 2H51B 3TQEA 3HP6A 3F0NA 1CS4A 1SI9A 3PO5A 3T3FA 3LQVA 4FS1A 5J2MB 2DVIA 3DMJB 5CYQB 1YGYA 2V8DA 4ZVPB 3UR3C 5MAOA 2BM1A 1R8CA 3A12A 3T6BA 3TRGA 3VWSA 2BANB 4U67Q 4QWEA 3KHGA 2DNNA 2FVQA 3MWBA 4MAKA 1FKAF 3TQ1A 1U8SA 4YUDA 1LWFB 1IR1A 3KLGA 5D0HA 2O3DA 5DQGA 4B17A 2VJVA 3I56S 3GYGA 3R2CJ 1TAUA 4CO2A 1LW0A 1RE1B 2ZBQA 3Q8YA 4DPXA 1JB0C 4N56A 2ZH2A 1U1RA 1RI7A 2NSBA 4KYZA 1R6YA 3DRPB 5GAEI 2W9CA 1AUDA 1B7FA 1HQUB 2WONB 2CRLA 2HG4A 2RT3A 3HT0A 4ZVRB 4IFYB 1RT5A 2RMLA 2RUSA 4YR3A 1RBAA 4LRAA 3TX0A 3GIJA 2ALYB 4OHVA 5F8GA 2QMUB 2F65A 3I0RB 3JTNA 1RT3A 4KGVB 2W9BB 2MTLA 1M1KT 1WG4A 4DPTA 1YJWS 3G8QA 4WZMA 4RNMA 4DSJA 4UQGA 3E01B 2CVIA 2PC6A 1O8BA 1QVFR 1RZMA 4USKA 4WIIA 1JNRB 1RAAB 5D3GB 3KJVA 3KDNA 4F7VA 2R8GA 2DGQA 2LQ9A 1QDUB 3QO9A 3FK4A 4IOCQ 2RF2A 1TKTA 4OYOA 2NCKL 1L3TA 3M6WA 1YJVA 1HI0P 2EBGA 1KBRA 2D3UA 2BRKA 3CJ0A 4GMKA 4USVA 5FD1A 3VTIA 4NLDA 2QL5B 4CLKA 4LSNB 4Z7CA 2HQCA 2FB0A 4M5IA 4N77A 2XO6A 1VLOA 1TVRA 1HW8A 1OSDA 2HRYA 2UUWA 2HAFA 4MT1A 5I3QA 3VAHA 3OTOF 4IH5A 2VFTA 2MKCA 1XNQJ 5KFQA 5KFKA 1Q86T 3VQSA 2ZUAA 3PJ9A 4NZ0A 2CPJA 2OSQA 5F0UA 5CD4A 1IKYB 3GR0A 1A6LA 1X9SA 2EKYA 4NX9A 3LWLA 4BWJA 2K2PA 4H4MA 3JYTB 2V34A 3GU0A 4K4WA 2JL9A 4KO0B 2GIRA 1ELOA 2FGOA 3Q8VA 4NPOA 4DV1J 4KKOB 1F60B 4UT4A 3CJSA 2D3O1 3OXLA 3KTQA 2DR5A 1I94J 5E33A 1OY6A 1IKVB 1AT1B 1XBWA 1N6QA 4NLRA 4Y2AA 4B02A 3OR1A 4FKXA 3PW4A 1ACMB 2B9WA 2NREA 3CC7S 1TKDA 1N88A 3BEGB 4ZIWA 5BR8F 1S6PA 4ECRA 2MZJA 2D41A 3NWGA 2F40A 4ZOSA 3I55S 1L3SA 4Q0BA 4IUFA 2B4UA 3SZ2A 3K89A 2V2KA 1C4CA 4IR1A 2XMUA 1WOPA 2FHJA 2HZVA 2EK1A 4D3GA 1FT8A 4I4BA 4ZDNA 3MMBB 1IXKA 2FVSA 1UW4A 4C8ZA 3BS9A 1HMVA 2JVRA 4CCHA 2FD2A 2HMIA 2D3ZA 4LFAJ 4CLLA 3HFZB 4HVZA 4A8MP 3BBBA 1RWUA 2DGTA 3S7RA 2JEFA 4YP3A 3EZUA 4NA2A 3C6UB 2C2OB 3ZZTA 4FPRA 4PXDA 4NA1A 4LT6A 2DNGA 1P8GA 1REGX 4ED7A 3CJKA 5GMEA 2H48B 3CULA 2OELA 3BSAA 2KXNB 2UUCJ 2QL9B 3UD5A 1ZAXA 1NXIA 2HQDA 2U2FA 5H1SV 3Q23A 1RAEB 1S1VA 2W2NP 2G0IA 1OPIA 3ISNC 1H3DA 1GNKA 1BQNB 5IXUA 2W2QP 5DGAA 1X4CA 5G0RA 2M52A 4PQUA 1UAWA 3TARA 1HD0A 1UETA 2D3OR 4ZS6A 3Q8PB 3VAGA 3G4SS 2DRBA 1HNWJ 4YDDB 2MLXA 1Z1ZA 1X9MA 3RU0A 3BV8A 1GMWA 1LK7A 5CXTA 1F5AA 5AE2A 3J81U 1ZM2A 2AX0A 5J2NB 2LMIA 3D0GE 1RWNB 4MKAA 4TY8B 1AYEA 2GQQA 2YPYA 2IRUA 3DHXA 3PX4A 2HHHJ 2VC0A 2BXJA 1U0SA 3K2YA 3Q24A 4DV2F 4YB7A 5C25A 1KLNA 1IUJA 4QWCA 1UCNA 2DNZA 3Q8SB 2JNJA 4O4RA 4ECXA 1CULB 1CJTA 4WFXA 2IVFB 1QVGR 4QU7A 3FNNA 2HHSA 2R7TA 1VC0A 1K1QA 4MKYA 4O44B 2GHWA 3MPDA 3PYFA 3BM7A 3Q86A 5E7OB 5BR8J 4I67A 2VQFJ 4KPYA 3TEHB 3DM2A 3OXGA 5BYSA 4L73A 4RW4A 2BX6A 3VGVA 3CCUS 4QW9A 4DOZA 1QSSA 1YI2S 1U1KA 2KFZA 4DZ6A 2DR9A 5HROB 4FP9A 2RU3A 5LMUF 3FCHA 5FDLB 3M6VA 1CC8A 1RT1A 1N0VC 2DNYA 1PCAA 2GVDB 3MTKA 1RADB 4DN0A 4C97A 1NKEA 1S6QA 4WFBQ 3H7HB 4NASA 2FJAB 1Q5VA 1V3SA 4ZA1A 4DUYJ 1VYAA 2B7CB 4ZLPA 5KOWA 3CD6S 2QSWA 4B9NA 5T7LA 2AJ4A 2VG6B 3IGNA 3R5AA 3ZXWA 1H6KX 3B78A 3EDRB 2YX1A 2ZDOA 3H0PA 2C2DA 1MWZA 4M8LA 4AXIA 4DV6F 2Y0SD 3RR8A 4RW7B 2R42A 3K8VA 1YVFA 2AYMA 2ILZA 2V2QA 1K1SA 1QE1A 5HQLA 3S01A 4N47A 4O23A 3NL0A 3CIZA 3OSNA 1IKWB 3THVA 2HQGA 2MHNA 3SCKE 1FRJA 5A8KA 3G86A 3BGFA 3ELHA 1RAFB 2KT2A 5KFUA 3BF4A 1S1XB 2J0WA 3VQTA 3FSYA 1S9EB 2G13A 3J80U 1DZ5A 3EUNA 3DCAA 2OKQA 3P8BB 3IWXA 3R7BB 3LH2S 5THWA 3TJ9A 1CJVA 3BBFA 1IBLJ 3KOAA 2G1HA 1Q4RA 4QYRA 2OLWA 1JK9B 3IR5B 2AD9A 1VQSA 1SL0A 3MM5A 3TI0A 1D0EA 4ETZA 5HLFB 4DR7J 2BM0A 1DURA 4MH8A 2PMWA 3K5NA 1SC3B 1FJCA 4KBIA 4WF9Q 2OD4A 4WKYA 4UOFA 1ZYQA 1FJEB 2WVEA 4EBCA 2UXDF 2OI2A 4BDPA 2CG4A 1VS3A 1NB2A 2HK3A 1BGXT 4GO5X 3ONQA 1D1UA 4P74A 1PAUB 2KM8B 1S12A 2DNHA 2MSSA 2MSTA 4FBUA 2VKZG 2ZZNA 1X4EA 3O6QA 3CJQA 2XYPB 2MKYA 1R8AA 3CO0P 5HMZA 3D4JA 1PSDA 1T94A 5CABA 1GX5A 2BA9A 2XM3A 3H25A 1RCOB 1TK0A 3V81A 3QRRA 3CMES 2SXLA 2VQFF 3IC1A 1JNZB 4A8QA 2MKHA 3R6GB 3FSXA 4LRBA 2V4JB 5KFJA 2FC8A 1B4SA 4IQMA 2DRAA 3A8EA 4M5LA 1U1NA 2BACA 2QL7B 4Y00A 4LF6F 2CQHA 2DTJA 3BKFA 1S7IA 2CQ4A 4MJKA 1VQ4S 4GKJJ 2LA6A 4C48A 3DRSA 5A76A 5J2MA 1OY8A 3GYNA 3TZYA 1J5EF 1ZPWX 1HNIB 2GJFA 2JLGA 1Z2LA 2A3JA 3CCWA 4DXLA 4OZ1A 1X5SA 1RTHA 2WVBA 2LYVA 2R7OA 2V8PA 3IWLA 4LSNA 4P6QA 3TJ8A 2QA4G 3ULHA 3GR1A 2RU9A 4DV0J 2RE1A 4QPXA 2C2EA 3ZNJ1 1NK6A 4OYWA 4X65F 4B9UA 3CJ4A 3MM6A 4WFYA 1LFPA 4HACA 4LQ9A 1RA6A 5DLFA 3OVBA 1Y9OA 1SKWA 1YBTA 3UW1A 1ZTWA 5KT7A 2VODA 1PJ7A 3DRPA 3NEKA 2NXEA 4CWBA 5HMWA 2HRUA 3OTBA 5KFEA 1JLGA 1FWKA 1X7VA 4MKBA 4B3SJ 4ILLA 1BMQB 5BYQA 2XCAA 1JLEA 2VC1A 1FEHA 3OL7A 2KYZA 3CJ8A 4R5PA 4GVLA 4OYZA 4K7QA 2BKPA 4QIFA 4JI3J 2PEBA 1FJGF 2HHHF 3ISND 2MLZA 3SYZA 4U7UD 1HI1A 1WC3A 5F0WA 1Y3JA 2CPZA 3LAKA 3H2UB 3NNCA 3RGIA 2PA3A 2QEXS 1WNEA 5J1EA 1BQXA 4GC6A 4NLUA 1C1BB 2B5JA 3AB2B 2N4CA 4ZVUB 3GQCA 1T95A 3BYPA 4ZPCA 1RYRA 2VIHA 3H42A 3ZTOA 1ZETA 1CJKB 2GGPA 3TZZA 3DLEB 4G1QB 3CNQP 2FVRA 1FRXA 4ZPBA 1JX4A 2G2YA 3FEXB 1HHQA 2N7CA 4RNHA 2AT1B 2GVZA 2BW7A 4A47A 4DBQA 3N79A 4EEYA 1NPKA 1Q95G 1LWCB 3MECA 1IKYA 3VHQA 4AL6A 2V2ZA 4DSFA 1TL7A 4AT1B 4P2XA 4AQYF 2GAGC 5GAHI 2UUCF 2KZZA 2Q3PA 4KJIA 1UW9A 4F04B 3CMQA 4M95A 2BQ3A 3ZTRA 5A2QU 1KFDA 4TXSA 2QN6B 2XHWA 4KKOA 2ZD1A 3S6EA 5K8OA 5I3PA 4Q43A 1Q81T 4F67A 2W1BA 3J81Y 1GTEA 4ED5A 3OJSA 1MROA 3TAQA 2ZC4A 1OQ6A 3ILOA 4BCAA 5KTQA 1RWXB 2V2VA 1NZAA 3N5FA 1MN9A 3GV8B 1SJQA 1T9UA 1OY9A 2E5JA 3ZZRA 2YNHA 1UEVA 3DNCA 4G6VB 3C46A 3V6DB 1D09B 3WZ0A 3DLHA 4YY3F 3GFXA 4L6V3 3QIPB 3J7A1 5GMDA 3AAWB 5G4DA 4ID5B 4DPWA 2EKNA 3D66A 1FXRA 2ZUGA 4LRFA 2VG5A 5ETMA 1FO1A 4B9VA 4FDFA 1HNZF 1LW2B 3NGSA 5GVQA 1Y00A 2HVDA 5JJBA 3RW6A 1JXEA 3D1OA 4LVOP 2JZ5A 3A1YG 3MUMP 3Q83A 1VOMA 3FCVA 3R5DA 4JV5J 2FLLA 3CPWR 3VALA 4ID8A 5HBMA 1URRA 1WSRA 1T3OA 2ZH6A 3A3PB 2VH7A 3AQPA 2LEPA 3DDIA 3SSQA 4CO0A 2UVUA 4OX9J 1U2RA 4ZVSB 1G1XA 1FKOA 1WF1A 5J2QA 2VBXA 4WU2A 5EWEA 2XI2A 2D9PA 5ETKA 4IG3A 4Y2KA 1U1LA 2C42A 3BGOP 1KLMB 2IJRA 3ZTSA 5HVFA 4EBEA 2ASDA 2P9CA 5KFNA 2LXIA 2MB0B 2Y8WA 1SB6A 2CNLB 1FDBA 5E5NA 3F73A 3SV3A 4PCQA 2XMKA 1XMOF 2HS4A 4DX7A 2B4OA 3Q2TC 1U7LA 1FXDA 1U45A 5KFYA 2ZHBA 3HDSA 1S97A 1VK3A 3FMWA 2OPSA 1S76D 4ZK7M 4CZCA 3FKBA 5DLGA 3CCES 1NSPA 3GE9A 1DTQA 3GV7B 3UD3P 1REVB 3DI6B 2BV3A 5KT2A 4CYUB 2IIHA 4X64J 1M90T 2HHUA 2QTWA 2MYFA 3FVYA 3VZIA 2BABA 3HLUA 5LJ3Y 1F9FA 2W25A 3VAFA 2CPIA 2CKWA 2FHOB 4OYAA 3HT3A 1RB0A 2CJXB 3UFCX 3MEGA 4PG7A 4ANEA 4URSA 4WFNQ 3PW5A 3X3UA 2JEJA 3PY8A 5J2NA 4TY8A 1J5EJ 4ECYA 1KR4A 1U09A 3H59A 4MIBA 4NYOA 2MLYA 2QGFB 3TP2A 3FQKA 2BRLA 2HPUA 3MD3A 3LP0A 2JOQA 2RILA 4NI2A 5KFPA 1QAYA 1S77D 1O6XA 3KUHA 4USTA 2EFVA 2AW0A 3GPAA 2R7VA 2JLEA 2POKA 5HP1A 3OHBA 5H9FK 2O66A 3IXQA 3T1HF 2QFIA 3LP1A 5KFRA 2XGPA 4HT5A 2B51A 4OI6A 4CTAB 4USIA 4YB6A 1XJWB 3IR7B 3ZZYA 1HWKA 4DZDA 3MGJA 5KT5A 2AYBA 2AV5A 2C2ZB 2C22A 3PTWA 2CXEA 1JKHB 5HQ8A 2HURA 3V6JA 3DLLQ 2EC2A 3JSRA 3QT6A 4DR6J 1UWBA 3ITHA 4CNZA 4WYLA 4OI3A 4RW8A 2JFDA 3KLGB 3UDEA 1NPPA 1YJTA 3IR6B 2I8EA 3I5BA 4X66F 3RJMB 3RAXA 1VQKS 3TWZA 1LW0B 2ZH9A 1VFJA 2D7SA 1PG5B 2OGUA 1TL3A 2DO4A 4PAAA 1JLFA 3OSPA 3C3LA 3EWGA 2W4CA 2YVSA 1NCLA 2OPPB 4XPCA 1N52B 1QD1A 3CCTA 3CO9A 4XTTA 2YWHA 2C3YA 3I5CA 1SJFA 3OFGA 1KC8T 1EQ0A 1OYEA 1SH0A 2CPYA 4X4PA 2XWYA 2GQ2A 2KM8C 3HVRA 3H2LA 3POTA 3MUVP 4B3SF 4FBTA 1IM6A 1Q8LA 2L08A 3R9LA 5KG7A 1PC5A 1SL1A 2FHMA 2HVEA 4I2PA 4FNHA 2VKRA 4A8SA 1L3VA 2B4PA 3VGSA 3HMJG 3MR6A 4FXVA 3PO4A 3NKYA 3K7RA 1V5IB 4ECZA 3LP2A 4FN5A 5T14A 1WC0A 2AF6A 2HFSA 1RKJA 2DR8A 1IR0A 3TZWA 1R89A 1B0PA 1SQFA 4PG6A 4O3QA 2ZH1A 4DQPA 2WSEC 4KHPF 4KR0B 2HHVA 1TVRB 1TL5A 2QE5A 5GADI 3PW7A 2J5AA 3M30A 1FESA 4HH0A 5DETA 3UCUP 2V69A 5AT1B 3TANA 3P96A 5L8RC 3R27A 4RW9A 1D8YA 3GZ7A 2M8HA 1WC5A 1HQEA 2ZJPQ 2WW8A 1IQTA 4LR7A 5CHCB 5D15A 4QPTA 1N54B 4G1IA 2ZNYA 2YPZA 3T1AA 3GB0A 3GSDA 4KO0A 1Q8BA 1QUPA 1SQGA 2L9WA 2YWFA 5LM7E 2JX2A 4C8MA 2CA9A 3TX8A 4LF8F 4OLPA 2FZKB 4KQZA 1UP1A 1NDKA 4WFZA 5BYRA 9ATCB 1XMOJ 2UUAJ 2XGQA 1LKZA 1RU2A 1T11A 2F1FA 2QLJB 4LF7J 4PABA 2P8IA 2DHGA 1TL1B 1F0XA 1HKAA 4MYUA 5E3CA 4TN2A 2R8IA 4ENOA 5IT9Y 2ZJQQ 1HWIA 2PD1A 1JLGB 4U9RA 2PGCA 3D5MA 3GLJA 2WVCA 3PFEA 4HKQA 1D3WA 4EWTA 2M9KA 2VPZB 5KFFA 4F2SA 2E9ZA 3SI8A 4KHPJ 5E3RA 4ILMA 3NGDA 4R5PB 2AYEA 4CLZA 5B09A 1JJCB 2MGZB 1DRZA 3DOMA 3BSNA 2VA3A 4NWBA 1ZZNA 1MSWD 2PEHA 3ZZ0A 4WZQA 3HHNB 1YBAA 2JHEA 3ZTQA 2Z2ZA 1S1VB 4F4YA 2KN4A 3MMBA 1A7GE 1GXUA 3SQOP 3H98A 5A8RA 3VAIA 2D9OA 3CE8A 3DM2B 2HMIB 3NY0A 2RVJA 2ROPA 1CJKA 1VISA 5B0GA 1FRKA 1QSYA 2F4FA 5D8HB 1Q82T 3T19A 5ETPA 3PW2A 3GJQB 4D3HA 4F8RA 3GP9A 1F2HA 2K3KA 3V2UC 3TAMB 2XMMA 4TU8A 2ASJA 1VQ9S 3TUIC 2NXUA 1Q79A 1DLOA 2WOMB 3KKFA 3NGTA 5L46A 4DV2J 4OV1A 2E9RX 1SKUB 2ZVSA 2VG6A 4FS2A 2N82B 1UA0A 3DRRB 2VFSA 1SJ1A 2ZWPA 2OPRA 4K4UA 3ZTPA 1BXNA 2X7IA 2BYCA 2KHCA 4JV0A 5E41A 1JLBA 3JXOA 4OQJA 4RU9A 2CQDA 1RTJB 2DHXA 2YKPA 4NE9C 4GKKJ 2I6WA 4C8NA 2GIFA 5DZ7A 4Q45A 2UXBJ 1FDAA 2K3IA 1YG0A 1UEKA 2RHSB 2JLFA 3CGIA 4M5DA 5F3TA 4U7UK 5AE3A 5KFBA 3IBCB 5IQQA 3U1MA 3MFIA 2VQEF 4OYBA 2M5YA 4JI0J 1N33F 2ZDPA 4DSKA 5L1JA 2AQ4A 2K7KA 1XN9A 1WEZA 3ENAA 5KAKA 5IOLA 2WTFA 1XNRJ 4DR6F 1WG5A 2X1BA 1UMJA 3IAS9 4USWA 2R7WA 4DS4A 2YX4A 3P45B 3SDEB 2XY7A 1T8EA 2AEJA 3KHLA 3RB4A 1PILA 3M2VA 4W4MA 1YTYA 2RHQB 4RUBA 4ZP6A 1EIYB 2YKAA 1XNQF 3QT7A 1YITS 3LALA 1S6QB 1RCXB 1RTIB 1RAGB 5C24A 1SUQB 3MECB 3PFOA 4J37A 4LF6J 1M5SA 1FXLA 5EHHA 3HSJA 1TL4A 1FKOB 2HBZB 5CQGA 2VL1A 3A3NB 1KQGB 2CG8A 3LF0A 4OX8A 3T5HA 3HHLD 4RKUC 2HHPA 3PM9A 1WKKA 1F1BB 4CO1A 4X4UA 4ZKAA 2NR0A 1RWMB 1OMSA 2B7BB 2PI5A 3V5RA 4AD6A 4N41A 1B7YB 4LF1A 1RT7A 3QRPA 1FVQA 1CJUB 5IT0A 3HX9A 1IBCB 3FQLA 3GIMA 3FSIA 1YZ6A 4B9MA 1N32J 1HNVB 1ZPVA 2Y1IA 2HS3A 4HR2A 4NLVA 3G82B 2WVFA 3M32A 2E1MC 1HD1A 4DS5A 3I4HX 5K8NA 1N36F 2LXFA 5M2RA 5KG1A 2CFXA 1TFWA 3OXFA 2RRAA 5JVHQ 2V94A 3UO0A 3G6VA 3QJPA 2E5IA 4DQIA 4ZVGA 3PRVA 3MM9B 3OT9A 2YKMB 4RJVA 3W2VB 1T0TV 2YWWA 3G96A 2R8JA 5LL6d 4LQ3A 1XQIA 4UUXA 4QQBA 5HN0A 2FZCB 2GC8A 3DLJA 3H20A 4M63A 5KFDA 3B4DA 2ASLA 4ELVA 4UUWA 2IA6A 4LMZA 3MEGB 4IG0A 2J7KA 3MDFA 2ADCA 4CO5A 2YH0A 2BE2B 2CQ3A 4HHJA 2I5JB 3AOAA 2DXFA 1ZTTA 4KGKA 4IOAQ 4PPDA 4LFBJ 5F8NA 3I6PA 2ZH4A 2PFFB 3H5YA 2QYGA 3W64A 2VUGA 1HFEL 4J9SA 4CO4A 2MDAA 2E5LF 1X5PA 4LVNP 2KU7A 5EUHA 2KRBA 4DPYA 3KK3A 2PMZD 2XS5A 2BW2A 2CPEA 3U1LA 4ZN3A 1ZA1B 4LBPA 2I9SA 3PKYA 3CCVS 2OPSB 5A8WB 2Y9HA 2D74B 3FEZA 5EWGA 2RD5C 4F0HA 4WP3A 2R2TA 1FNXH 4OZLA 3JQMA 3MFHA 2DH8A 1FERA 1UJ4A 3AD7C 1NHKL 2PN6A 1REVA 1I6JA 3LGNA 4HLBA 3AA9A 1N5YB 3D54A 5L9XA 4TQRA 3DLKA 4A8YA 1U1QA 2NXNA 4OX6A 1AB8A 4O4GB 2YNGA 2B9EA 4RUAA 1N36J 2M8DB 3CC4S 2XMWA 2YWEA 4A8OA 1RT6B 1RHQB 1WD6A 4N8OA 1F5BA 6FD1A 1AA1B 5CD4H 2MKIA 2YQ1A 4ECUA 1NB7A 2JDJA 1HBNA 3QPIA 3HKWA 4YDXA 5E0OA 1U1MA 3HVTB 3W5XA 2GQCA 1HNXF 3BH6B 3PYGA 1AUSL 1MU2A 1N5QA 4CI0B 1YJ9S 2IBKA 1FA0A 3NBPB 2VPXB 4JV2A 2KRRA 1B99A 4DSEA 4DR3J 3D9BA 2B6AA 4RNNA 1U6BA 3UD4P 2YNIB 2OUGA 4UZCA 2YKNA 1W26A 1X8DA 1UVJA 3C8YA 4LBHA 3LO3A 4DX6A 1LWCA 2AJFE 3ET6A 5SUHA 4F0KA 1X4FA 2HKEA 2DIUA 1RDRA 5J1PA 4KGMA 3PIOQ 3R7SB 2HS0A 3HM9A 4DR2J 2PSZA 5B0CA 2Q43A 8ATCB 4GVBB 2HBYB 3HVAA 3JSMB 4DCOB 5GMKa 1YJNS 1WI8A 4B3RF 3W9JA 4OL8A 3VGUA 2KXHA 4M5HA 1WC1A 2M0GB 3QJJA 3MAAB 1EKRA 2LQJA 1MROB 2IAJA 4C7QA 1NU4A 4DN9A 1WI6A 2BE7D 3CEDA 3DOKA 1LWEA 5LMUJ 2KL8A 2DXDA 1H2TZ 2L9NA 2QYCA 3V6DA 2BUNA 2C2MB 3FGVA 2MQPA 3R97A 2OEKA 2MZ1A 4UF4A 4DFMA 1FJ7A 4ZITA 2DGUA 4L75A 1LNQA 1OSCA 2J9EA 1HQ2A 3TVYA 2VG5B 2ALZA 4X4QA 2W4PA 4NA3A 3B8HA 2QV6A
chains in the Genus database with same CATH topology
3KLVA 3CCSS 2JFKA 3PV8A 4O3OA 4DR3F 1VQYA 4NLWA 1UVIA 3O44A 5C42B 3BR9A 4K50A 4H54A 5KFMA 1KHVA 3M05A 4NLPA 2IMOA 2UUTA 2KKHA 2MJNA 1JJHA 1C1BA 2B5JB 4DL0C 4WZQA 4IO1A 1H0HB 5LXRA 3UDLA 5L1LA 4IG3B 1HARA 4TLQA 2FJBB 3CJ5A 1C1CB 2VBWA 5ITHA 2EFGA 1JLQB 1Q16B 3CDEA 4ZCIA 3QJLA 1OIAA 3IN5A 2V9WA 1U2FA 3PXGa 1VQ8S 4DSJA 3HPOA 1KQKA 2GO8A 2HYIB 3KG1A 3RB3A 4KHRA 5LSOA 3MAQA 4KHMA 4ETXA 4ED1A 2IC3B 5A8RB 4PUOA 4QW8A 2CJQA 4CO3A 2P6SA 4HI1A 1JLCA 2R7UA 3V6KA 3V4IB 4ZCMA 4ZVFA 3OR2B 6FDRA 4EZ6A 2CPXA 1UVKA 3TUJC 4IDKA 2MJUA 4OJHA 4ECTA 4LFAF 2XLKA 2DGSA 1XK8A 2XO7A 1NJZA 4OHXA 1NK9A 3DOLA 1ULRA 3PEJA 3UE2A 2IJFA 3L7PA 2FY1A 3MEDA 2HQ3A 2RKIB 4E98A 2OPRB 3NS5A 5HP1B 5KOXA 5HBMB 3K0JA 3E3XA 3GIKA 2OFGX 1EETB 5J2PA 2ERRA 2VPWB 4M5DB 4DMZA 2X1GA 1XERA 5KFTA 4C8KA 5F8LA 1X5TA 2DB1A 2NQPA 4ECWA 4NCBA 2RRNA 1NK0A 1XWLA 2OO4A 1BQMA 4IFVA 1GT8A 3UCGA 1M5PC 4PXEA 4RW8B 3M2RA 4FF1A 3SMZA 3WC0A 1SJ4P 2GFFA 3ZZPA 2WSCC 1S0NA 1CSJA 1JLFB 3BO4A 4B3MF 2NUUG 2YWGA 5KG0A 2DPJA 2OPPA 1WWHA 4OIXA 2E7WA 2B9YA 3LP0B 1TKXA 2DNQA 1U1PA 2QFJA 4ZVEA 3M8RA 2YNFB 1LOUA 1NJIT 3PR5B 4HTIA 4H4OB 1IJFB 2ZHOA 1GXTA 2E5HA 3GG1A 4HH1A 3U27A 4RW6A 2OP5A 3T9NA 1OWXA 5H9FJ 4IRDA 2UZAA 2DD8S 5K14B 3PEHA 4I56A 5DM7Q 4DL5A 1ZM4A 2Q6CA 4DDFA 2VBYA 1SBRA 3PRDA 2FLNA 5GAGI 1KVIA 1S1UB 3DLGA 4YQWA 3IWNC 4DV4F 4B3SF 2CQBA 1WF0A 3L95X 2DO0A 4OZ0A 2MZSA 2YKMA 2EFQA 3ZZZA 1SUQA 3BO3A 2J7WA 1OQ3A 1RKJA 1RKIA 3G8TA 4DV3F 3RB0A 1HQEB 4HEA9 3Q2SC 1YIJS 4MFBB 5IFMA 3KNAA 2IYGA 2L48A 3DMJA 5I42B 2DT9A 5B7WA 5DDPC 1CQMA 2FJWA 1LV5A 1VMBA 1RAJA 3CVKA 2W7PA 1NEEA 4H4KA 1MMDA 2IYIA 4QWBA 5DG7A 5A0YA 5DDQC 2AGPA 2FVPA 1MW7A 4I6YA 3OFFA 1FK9B 3SV4A 3QLHB 3NCQA 4DR7F 4I68A 1IBMF 2N7YA 3M1VA 1HPZA 4R8UB 2ZZMA 2IVYA 4ZPWR 4F3MA 3RRKA 3MEEA 5KG4A 2KJVA 3KG0A 3H8YA 4J9NA 2IA0A 2YNGB 2NSCA 4AXJA 4X4SA 2F3JA 1KFSA 3LW5C