1TL1B

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 114
structure length 400
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B03
1RA7A 5HBMA 4IKAA 4NLSA 5KG4A 4Q8EA 1BQNB 2W9CB 1S1VB 5KT6A 5JUMA 3MEEB 3C6TA 3BQ2A 1RTHB 1S1TA 4K4VA 1S9GA 1IKXB 2YNHB 5KFFA 2VG6B 4NRTA 4URSA 3CJ2A 1RTDB 3H2LA 1S6PA 2J6TA 1HMVB 1Z4UA 2WHOA 2W9CA 3OL9A 4IRCA 4JUZA 4MH8A 1IKVB 5HBMB 2FJVA 2IMWP 1TL1B 1RT1A 4ED6A 1TKTA 4O3PA 5I3UB 1U09A 3DRRA 4DL3A 3BSNA 5C5JA 3PW5A 4PQUA 4NZ0A 5EUHA 3RAXA 4IR1A 4H4OB 2YNGA 4U6PA 3V6DB 4KV8A 4ZHRB 1FKOB 2YNIA 3G86A 5KFCA 2ZE2A 4IFYA 2GIRA 3E51A 4J9RA 3KJVB 5L1KA 1C0TA 4MFBB 5KFQA 1TVRB 1LWCB 4LSLA 5J2NA 4O3OA 4O44B 4ECTA 4O3SA 3T5HA 4PQUB 3LP2A 1IKWA 3DRPA 2UUTA 1TKZA 1TL1A 4ZPBA 4QW8A 2ASJA 2J6UA 2FVQA 3OL8A 4DEZA 5KFOA 5HROA 2AGQA 2VA3A 4WE1B 3D28A 4NLPA 1JLBA 4R8UA 4RW4A 2OPQA 5L1IA 5KFUA 2R8HA 3DRSB 1N6QB 1CSJA 5F8GA 4YP3A 1RT4A 2ATLA 4O44A 1REVB 3DLEB 4ECSA 3CDEA 3LP2B 3QLHB 2BRKA 1TVRA 4Y3CA 4NLXA 4F4WA 1LWFA 1S1TB 3JSMA 2XGPA 1JXLA 2YKMB 5J2PB 2ILYA 4K4ZA 4NLOA 3T5KA 4O3QA 5I42A 3NBPA 4MK9A 3OLAA 1RT6B 3KMSA 4WE1A 4ED1A 4KB7A 4O4RA 4EBCA 4NLQA 4NYZA 2R2TA 1HNVB 5D3GA 3GYNA 5I3UA 3QYYA 1S10A 4F4YA 2FLNA 4JV1A 4MK8A 5KFVA 2VG7A 4ZMMA 1LWFB 4R5PA 4KHRA 5KG2A 1JLQB 1T05A 3MTKA 2JEFA 1RTIB 5HLFB 2BE2A 3DOKA 3HVTA 3LP0A 5KFKA 4IRDA 3CJ4A 4NLUA 4XPCA 4NLVA 3M9OB 3H5XA 2WRMA 3MEDB 3NAIA 1N48A 1HNVA 4OL8A 4YQWA 3CVKA 3M8PA 3H59A 4EYHB 4DL4A 5KFNA 2C2EA 2E9TA 4K4UA 3DOLA 1HQUB 3CJ3A 3UDLA 1S6QB 2JC1A 1JLFB 2HMIB 3MR5A 1TKZB 1NHVA 1T94A 1JLGB 3SI8A 4G3IA 4LSLB 3IRXA 5J2NB 5DG8A 2IJNA 3PR5B 2HNDA 3QGHA 4O4GA 4R0EA 2D7SA 4IFVB 4KO0A 4Q45A 4ED3A 2BQRA 4WZQA 3LAKA 4KHMA 1IKYB 3JYTA 3ISND 1JX4A 3OSPA 1D0EA 4EBEA 1HQEB 3ICLA 1SH0A 3Q8PB 2ZD1B 1D1UA 2FVPA 3GQCA 4K4YA 1HPZB 1DTTB 5DG7A 2WB4A 3DLKA 3OHBA 1DTQB 1HNIA 2V0NA 5KFZA 3V4IB 1LWEB 2OPRB 3OLBA 3DDKA 3H4BA 3PW4A 4IDKA 2GIQA 4K4XA 1RT7A 3V6KA 4G1QB 4PUOB 1RTHA 1SH3A 2I1RA 4MIBA 1MU2B 3VQSA 2BANA 3EPGA 4LQ3A 3C6TB 1RT2A 4QWCA 2AQ4A 5KFJA 1EETB 5K14B 4DG1A 2QV6A 1HNIB 5FDLB 4QWBA 5F8LA 3PW7A 5KT4A 1S6PB 3FFIA 4KFBA 1SH2A 1UWBB 5DQGA 3GILA 4ECWA 3PZPA 3IN5A 3OHAA 1S97A 1DLOA 3H5SA 3I5CA 1HQUA 1R0AA 2UVVA 4QPXA 4QWAA 2IC3B 2IAJB 1EETA 4J9QA 4IFVA 2ASLA 4EO8A 4KE5A 5KFPA 2YNIB 2YNFB 4FS1A 1TV6A 4O3RA 4O4GB 1JIHA 5KFBA 2FJXA 3PVXA 2CKWA 1DLOB 1JLFA 2HMIA 3H98A 4IH6A 1JLGA 1TKTB 4ECQA 1UWBA 3T1AA 4RU9A 4J9NA 3KK1A 1FK9B 1K1QA 3HVWA 3H4DA 1S1XB 3BQ1A 1BQNA 1C1BA 2IM2A 4I2QA 1FKPA 2R2SA 4Y34A 2FVCA 4LQ9A 4YR3A 3KLGB 2JLEA 3RBEA 3GIMA 4IG3A 3DMJB 4RNMA 3KHRA 4ECYA 5DG9A 3HKWA 2I5JB 4IR9A 3ISNC 2FJWA 3TVKA 5CYQB 2WK4A 2HWIA 1HYSA 3E01A 1OS5A 2OPSA 3V4IA 4R8UB 3DLKB 2XGQA 3CO9A 1S1XA 4URQU 2IM3A 4RNHA 5EWGA 3OSNA 5F8NA 2WTFA 4ECVA 3MR2A 3I0SA 5KFSA 1RDRA 5KG1A 4URGA 1QAIA 4QWEA 4M95A 4KBIA 5KT5A 1RT6A 1C0UB 3I0RA 4RNOA 2OPSB 3KLFA 3H40A 2HNZA 1S1UB 3BGRA 3LP1B 4ED0A 3GIJA 1HYSB 5CYMA 4ED7A 4WFXA 4WYWA 3NKYA 3DRPB 2BQ3A 5KFMA 4DL6A 1RYRA 2E9RX 4MKAA 1HARA 1S0MA 4B3OA 1QE1A 5DLGA 1R0AB 1JLCB 4I7FA 2BE2B 3DOKB 3HVTB 4X2BA 3C6UA 2C28A 4R5PB 2HNYB 3DLGB 4RUCA 2C2RA 2R2RA 3LP1A 1NHUA 2YKNA 3N6LA 2FLLA 3PJWA 4TQRA 3BQ0A 1HMVA 5F8JA 2HWHA 1VRTB 3BR9A 3EPIA 1EP4B 5KFRA 4RW8A 1S4FA 3FDSA 4K4WA 2R8GA 5HLFA 4KAIA 3FQLA 4EYIB 3HVAA 2FLPA 3KLGA 4I2PA 4TQSA 4ZP7A 4ECRA 4RW6B 2E9ZA 1S9FA 3M9MB 3GV8B 5DGBA 4NLYA 2C2DA 2RDIA 3CJ0A 2DPIA 5F8IA 4J9MA 3QZ7A 4RW8B 4MK7A 5DQHA 2W9AA 3MEEA 4TXSA 5C25B 2RF2B 3KK3B 2R8IA 4LSNB 4RW9A 4GC6A 2AX0A 4RNFA 3OL7A 3KHLA 2BRLA 3IS9B 4H4MA 4ZVHA 1BQMA 5KG7A 3MR6A 3MR3A 2B5JA 4TY8B 1XR5A 1RTDA 3MEDA 3RAQA 2ALZA 3MEGA 1QE1B 1RT7B 2ZKUA 4TYBA 1S9GB 3LALA 4RW7B 4RNNA 2B6AA 3V81A 1REVA 1RTIA 4HKQA 4ZVFA 5F9LA 2QE5A 1S0NA 1JKHB 2C22A 4J9PA 2YNGB 5K14A 4DG1B 3MF5A 4IH7A 3DLGA 4KKOA 3M8PB 4M94A 3DRRB 4Q43A 3TQ1A 3RB6A 3QO9A 1RT1B 2B43A 3MFIA 1QAJA 1RTJA 3KLHB 4F4ZA 3G6VA 1TL3B 1TQLA 3JYTB 5KFWA 2CJQA 1LW2A 2RKIA 3KK2B 2R8JA 1S1WA 1T3NA 2VG7B 4H4OA 4NLDA 4Q8FA 4KV8B 1JLEB 4ZHRA 5EWFA 1RT5B 4WFZA 4ZVEA 4J9SA 4IG0A 2OPPB 5J1EA 1VRTA 2F8EX 3FFIB 4KFBB 5KG0A 3N6MA 2XC9A 5KFDA 3KMQA 3IS9A 4H4MB 2D41A 4QW9A 5HROB 1T03A 1N5YA 4Y2AA 1NNDA 5C25A 2JEGA 4FBTA 2IA6A 3DM2A 5C42B 3G6XA 4ZVGA 1SUQB 3NL0A 3UPFA 1JLEA 4XPEA 2JC0A 3Q8SB 5DLFA 4TY8A 2XWYA 1N5YB 4TY9A 1TKXA 2VG5A 2HNDB 2WOMB 1JLAA 4IG3B 4KSEB 5T14A 4K4TA 3PJXA 1SV5A 4NLRA 4Y2CA 5F8MA 4IQXA 3NBPB 2RDJA 3LAMA 5KG5A 4DL7A 5C24B 1JKHA 4K4SA 1C0TB 3Q8QB 1K1SA 4DL5A 3RB4A 5CYQA 1YVFA 3E01B 2IC3A 3BSCA 5KFEA 5JXSA 2YNHA 3CDWA 4ICLB 1KLMB 3QIPB 1RTJB 3KLHA 3ITHA 2R2UA 1C2PA 1XR6A 3LP0B 1GX5A 4ZP9A 1S49A 2YNFA 3GV5B 2UVUA 3TAMB 3NAHA 1FKPB 1C1CB 2IBKA 1LW0B 2HNZB 3BGRB 3PW0A 3T19A 2IJFA 1IKVA 3T5LA 1C0UA 3I0RB 2XI3A 5C24A 3T5JA 2YKNB 5KFHA 3RB3A 4YMEA 1FK9A 3D5MA 4IOBA 2OPPA 2HNYA 5J1EB 3KHGA 3IG1A 5KFLA 3GIIA 4I7FB 3DI6B 1VRUA 3MECB 4NCGA 5J2MA 3C6UB 5J2QA 1QUVA 1RT5A 5EWEA 4JV2A 2ILZA 4B3OB 1ZTWA 2FVSA 2UUWA 3KHHA 4MFBA 5I42B 3I5AA 4F50A 1RYSA 3IGVA 4EBDA 4TYAA 3BREA 1S1VA 2I5JA 2OH2A 1DTTA 4O3NA 4ZP8A 3UR0A 1SUQA 1EP4A 3CJ5A 2ZD1A 5J2MB 5J2QB 2UVWA 4XO0A 3I0SB 2IM1A 1HQEA 3QIDA 2W9BA 3DYAB 5KFXA 1JLBB 3EZUA 4WXOA 5L9XA 3M8QB 1IM4A 3H5UA 1TP7A 1WNEA 4WXWA 4TLRA 3GIKA 4IH5A 2W8LA 2GC8A 2BANB 2D3ZA 5EDWA 1KHWA 3SFUA 3FQKA 1RT2B 5KFTA 4ED8A 3V6HA 2UVRA 4ZPCA 2R8KA 2XCPA 1MU2A 3QLHA 3QIPA 5F8HA 4PWDB 1JLCA 4J9OA 4EEYA 1ZTTA 2BQUA 3FRZA 3CWJA 5KT3A 3G6YA 2B5JB 1LWEA 2OPRA 1KHVA 3KJVA 3OL6A 4IDKB 2ASDA 2DPJA 3KLEB 3M8QA 4RZRA 5L1JA 4LSNA 4RW9B 3HHKA 3Q8RB 2AGPA 3V6DA 4U7CA 1RT3A 3RB0A 5D3GB 3IG1B 2WONA 1GX6A 4RW7A 1W25A 1KLMA 4ICLA 3FSIA 1XR7A 4ECXA 1TV6B 3PW2A 1N56A 4NLTA 3I5BA 1S9EA 3M9NB 2HAIA 4IRKA 1S0OA 5L1LA 3LANA 4RUAA 1C1CA 4WZMA 4NLGA 1MMLA 5F9NA 2EC0A 2AGOA 3BJYA 3KLFB 3IGNA 3BSAA 4Q44A 2RF2A 3KK3A 1S48A 3DLEA 4ZPAA 2WCXA 4JV0A 3KLVA 2BR0A 1RT3B 1VRUB 4NCGB 3DRSA 3KLIB 1N6QA 3RBDA 2JEIA 1DTQA 1C1BB 2AWZA 4RW4B 4I2QB 3DYAA 1BQMB 3KK1B 5KFAA 2FVRA 4EO6A 4DL2A 3N6NA 5DGAA 4WFYA 3JSMB 2W7PA 2B6AB 3V81B 4IG0B 3H5YA 4F4XA 4YR2A 3MEGB 4H54A 4PWDA 3DM2B 5KFYA 5KG3A 3DMJA 1N4LA 4ZP6A 4GC7A 3KNAA 5HP1B 4ECZA 2AX1A 2YKMA 5J2PA 2AU0A 4KO0B 1JLQA 1T05B 1J5OB 2V4RA 1T03B 2J6SA 2VA2A 1I6JA 2W9BB 3BSOA 4I2PB 2W7OA 4FS2A 1HPZA 4YR0A 3PR4A 5C42A 4ID5A 4Q0BA 3QO9B 5KG6A 4QWDA 4ECUA 4TN2A 4KKOB 5KT2A 3CIZA 2IM0A 2WOMA 1S1WB 5KFGA 2XI2A 4ED2A 2W8KA 1TKXB 1LW2B 2RKIB 2VG5B 3KK2A 3KLEA 3CDUA 4MKBA 1S1UA 3NMAA 1TL3A 1S9EB 4NLWA 3QGGA 3MFHA 4G1QA 4PUOA 2VG6A 4NRUA 4HYKA 4ZPDA 3IRXB 2V4QA 3V6JA 3QGIA 2WONB 1S6QA 1RAJA 4ID5B 4MIAA 5CYMB 4IFYB 4J9LA 3GV7B 2D3UA 3DOLB 3UQSA 1FKOA 1LW0A 5KT7A 3NGDA 3KLIA 1RA6A 4WYLA 3TAMA 1IKWB 3ITHB 3PHEA 2JEJA 5KFIA 1LWCA 4FBUA 4K50A 3SFGA 1IKYA 2ZE2B 2V9WA 1J5OA 4RW6A 2IAJA 5HP1A 3KOAA 2XCAA 1ZETA 5DQIA 4J9KA 3QZ8A 3DI6A 3MECA 1IKXA 1RT4B 4Q0BB 1SV5B 2O5DA 2OPQB 5FDLA 1JLAB
chains in the Genus database with same CATH superfamily
3VTIA 2ACMA 2LQBA 4DWIA 2RU3A 4JV5F 3OJSA 2JLFA 1S1VB 3ZXWA 5IV3A 5LJ5Y 4BCAA 5JUMA 2G0IA 4RUBA 2ZOFA 1Z1ZA 2QMWA 1GXTA 1WEYA 2C3PA 2YNHB 3KUHA 4PG7A 4EGLA 1RAIB 3FSXA 2VOOA 4C98A 4JI4F 1S6PA 3CD0A 1HMVB 2JVOA 2WHOA 3D66A 3SIPB 3FKBA 2ZOMA 1T02A 5HBMB 4ZN1A 3JB9k 4B3RJ 1JJ2R 3HZGA 2E5IA 2HIYA 3VHQA 3S01A 3IRWP 1M5KC 4ED6A 1GK8A 1O0PA 3GONA 3CCLS 2C1EB 2XSJB 3VV2B 3K5NA 4JI1J 4PPDA 4DV2J 4DL3A 3T6BA 4Y00A 4PQUA 3GFXA 4NZ0A 5L39A 1YRUA 4IR1A 2OEJA 4KV8A 2B51A 1RZMA 2QSWA 3AODA 4DXLA 2GIRA 3L7PA 4J9RA 3E51A 3CJKA 5IOLA 3KJVB 2VQEJ 3R7NB 2X1FA 3D3BJ 4MFBB 1YZ7A 3MUVP 3TX8A 1AXQA 3D54A 4O3OA 1IR0A 4IYQA 2MLXA 2QRRA 4ECTA 1IKWA 1Q78A 5D4LA 4X4TA 2YX1A 3PM9A 2Y1IA 2ASJA 2RT3A 4NI2B 4ED4A 4PWWA 2P8IA 1HIYA 3D28A 1NPKA 1JLBA 1AUSL 3QFWA 4R8UA 1RLDA 1VIXA 4NXNJ 1Q8IA 1RCXB 2B0GA 1N6QB 1CSJA 1HWKA 3TI0A 1RT4A 2CPZA 3DLEB 1OY6A 2V8HA 3CDEA 4HHJA 4LBIA 5HANA 3UR3C 3GIRA 4TU8A 4OI6A 2LFVA 2KN4A 2PEHA 2ZH7A 2AJ1A 1LV5A 5J2PB 2XNQA 3T5KA 1HHTP 2G2YA 2E1MC 4WE1A 3UI3A 1H38A 3I4PA 3R3TA 4M8LA 5RUBA 3DLLQ 3MGJA 4PWUA 4CNYA 3VCDA 3H2UB 3GYNA 3AD7C 2FLNA 4JV1A 1KOHA 3GYGA 4ZLJA 1PILA 3O2IA 4ES2A 4JI7J 5U47A 1H74A 1MMDA 3OVBA 4ZMMA 3M2UB 3D6FB 3GCWP 5LMUF 4JI5F 4CT8A 1JLQB 2EFOA 1WG4A 3MTKA 3J81U 2XULA 5HLFB 4IRDA 1PYSB 3MM7B 3LP0A 2MJNA 1Q86T 3CJ4A 3BKFA 3C66A 4NLVA 3M9OB 2XY6A 4DR7F 1LK7A 1FFGB 2M0GB 2VF3A 3AOAA 3KYLA 2UZAA 1ROFA 3TUZC 2GJ2A 1WACA 4NA1A 1N48A 2V4JB 3LGHA 3M8PA 5K8MA 3J7A1 3CIMA 4KPCA 4WU3A 4V1Ak 2DCLA 2FDNA 4OV1A 4QBUA 1YX2A 1S6QB 3ILJA 5K8OA 1E6YB 2JC1A 4KRWA 1JJCB 3T1HF 2H65B 2L9WA 1TKZB 1T94A 4BWJA 2P6TA 4ZJQA 3KKFA 4H4KC 2IJNA 3PR5B 3ZTOA 3GR0A 2NXCA 2HNDA 2J8SA 3GG0A 4I1TA 5E3PA 2H9ZA 4Q45A 1I51B 4ED3A 2BW7A 1QSSA 1JXEA 3LO3A 3SQGB 3KDNA 1IKYB 4KHMA 5GAHU 4B3SF 3JYTA 3GCXP 2XS2A 2EFNA 1HR0J 1S12A 2H54B 1NXIA 4PG5A 1HQEB 1NUEA 2GA7A 4FN5A 5GAHI 3ICLA 1SH0A 4F02A 1SQEA 4U8YA 1D1UA 3U02A 3GQCA 2AKWB 1HPZB 1DTTB 2AEFA 3DLKA 3TANA 3OFHA 3P5BP 2LEBA 2G0JA 2DH9A 2D74B 5KAKA 1HNIA 2AEMA 2V0NA 2COLA 5EX0A 2MJUA 3DDKA 3H4BA 3CUNA 2HGMA 1U6ZA 4JI2J 4PUOB 1SXLA 4R25A 5GADI 2HHPA 4YEAA 4OMFG 2F4FA 4P7TA 3K7RA 3VQSA 1YJTA 2B4PA 1TUVA 1AZSA 2AJ0A 1RT2A 3AQPA 3BN7A 2AQ4A 5KFJA 4LF2A 3L09A 1HNIB 5D78A 5FDLB 1LOUA 3TO8A 1V5IB 4QWBA 3NCQA 1WG1A 2AGPA 4ILLA 4XDDA 1S6PB 4KFBA 1BHNA 3GE9A 2FGOA 3PZPA 4DR1F 2QO3A 1S97A 2MQQA 1HQUA 2EEYA 4LF5F 1BQXA 2DNNA 2NYIA 1UEVA 2IC3B 1VJWA 4Y0FA 4OLPA 3BZQA 4X66J 4QWAA 4ZN3A 1XJWB 1Q0NA 3A8EA 3ZTSA 3I56S 4IFVA 2MZSA 3I96A 4WP8A 4X62J 5KFPA 4IOCQ 2YNIB 1X9MA 3F41A 2CJBA 3PV8A 3GLJA 3JQMA 4WKYA 1JIHA 2A6OA 5KFBA 2DVIA 1AT1B 4P74A 2FJXA 3PVXA 5DETA 3H98A 4YFUA 1TKTB 1UWBA 3T1AA 2B8PA 2XLKA 3KK1A 1FK9B 1HLWA 1K1QA 1R8BA 4PXDA 3OTOJ 3H4DA 1V3ZA 1VC6A 1UA1A 2Y3YA 1U7LA 4LT6A 2NXJA 3CCRS 4JI6F 3ZZ0A 1NZ8A 5E33A 3R5JB 2U1AA 3GSIA 4QIEA 2JLEA 4WP9A 2NQPA 1W7WA 2CQBA 4RNMA 3HKZD 4USTA 3VAJA 4ECYA 1X9SA 1CLFA 4KH0B 1G4CA 4JI1F 1U0HB 2BYCA 2XYHB 3M4XA 2UUCJ 3PO4A 2FJWA 2ZBIA 3TVKA 3W61A 3HK2A 1K0TA 2DY1A 2HWIA 2PD1A 3D0IE 3CCMS 1NJYA 1R3NA 7AT1B 2E5LJ 1Y10A 1VHIA 2IA0A 1RJJA 3C14B 2LQ8A 1T9TA 1RAHB 2J9EA 3I4HX 4DN0A 4URQU 2XGQA 3BO2A 1Q82T 2UXBJ 5F8NA 4QR2A 2VQEF 2XLJA 2VODA 1ULRA 1VRQC 2EBGA 2ZC4A 5KFSA 4J91A 2L41A 1QAIA 2AP6A 4M95A 3ETMA 2KT5A 5KT5A 5F3TA 4BC7A 1C0UB 5LL6d 5HMWA 3HLUA 2HNZA 3BGRA 3H40A 3LP1B 2QA4G 4ZVTB 1DRZA 1YITS 4E2FB 2BABA 5CYMA 2HS3A 3POTA 4WFXA 2MKCA 3DRPB 2YH0A 4WYWA 3G6ES 2JLGA 4ED7A 4NX9A 1RYRA 3W2VB 1R0AB 3D0GE 3ZZTA 2VONA 1XMOF 4ID8A 2C28A 4CH1A 1TUWA 3RJMB 1PSDA 3EX7B 4ETXA 2JVRA 2O67A 1WG5A 3N6LA 2HVEA 2Q79A 2C3UA 1S7HA 6AT1B 2FLLA 4HT5A 4CLUA 2NXUA 3IBWA 3W64A 4TQRA 5F8JA 4LF1A 3DLBA 4F4AA 1OWXA 1Q95G 1WF2A 2DR8A 2R8GA 1DQ8A 3N4WA 3HVAA 4F0MA 3TX0A 4ECRA 3GG1A 2XTJP 4CO0A 3HZEA 2HHHJ 1MSWD 2VPYB 3PXGa 3W7BA 3GV8B 4F3OA 2RDIA 2HVIA 3CJ0A 4YB1P 4DV2F 4A8QA 3M6XA 4JI5J 2H5JB 2YH1A 5ETQA 3M2RA 4PG6A 1Q1KA 5HAOA 1VQLS 1R8HA 1NSQA 2R8IA 3KK3B 5MAOA 1ZS6A 3UCGA 3MOZA 4LRBA 2MHNA 4B02A 1CEZA 2B5JA 1CS4B 1XR5A 2GQQA 3QNWB 4TY8B 3VQTA 4CNZA 2VOPA 3Q83A 4NZ7A 1VQMS 3MEGA 1RT7B 1Y11A 2CADA 2GO8A 3FCVA 4RW7B 3OTEA 4DV4J 4HI2A 3OTOF 3PYDA 1JJHA 1REVA 1RTIA 1OQ3A 3EDQB 2LA4A 3I55S 1FWLA 5G0RB 3OQ2A 4AXIA 1S0NA 3AJ2A 5A6WA 1CJTB 2C22A 4M5MA 4J9PA 2DITA 4DG1B 1VI7A 1FTRA 2DXDA 2XSFA 4IH7A 4ATNA 1EQMA 3DRRB 3H25A 2DNQA 6FD1A 2NXEA 2N3OA 1CQNA 2B43A 1DARA 3BB5A 3MM5A 3PHTA 1QAJA 2DEIA 1NPRA 2L9NA 5CD4H 2J7WA 4PCQA 4PYAA 2KZZA 1TQLA 3EGVA 2AYGA 1V3RA 5LXRA 2G1HA 2RKIA 2XMKA 4DPWA 2XS7A 1NCLA 2GVZA 5IM0B 2F8HA 4Y65A 1SC3B 5B0FA 1S1WA 1AFIA 2YQ3A 1O51A 3HVRA 3BS9A 4C7QA 1NK6A 1EQ0A 1ICEB 4F36A 5EWFA 4DCPB 1WC3A 4M5JA 3S6EA 1WHVA 2Z2MA 2OPPB 5J1EA 4L76A 4J9SA 1OQ6A 2F8EX 4F2RA 1T95A 1W2IA 4JI2F 4KFBB 3MMAA 4YHHJ 3N6MA 4GKKJ 4KR0B 3BEGB 2XC9A 2MKHA 4CM0A 2MKIA 1AROP 3OFEA 4OI1A 3B82A 1H2TZ 5I3QA 2HIQA 3P96A 1QAXA 2W2MP 1U1RA 2JEGA 2M8DB 5H9FK 1URRA 3CC2S 2RUGA 5LXYA 4B3RF 3G82B 4FF2A 2GX8A 1XMOJ 1TR0A 4ZVGA 1SUQB 3HPOA 1UZDA 4DFJA 4CYUA 1F9EB 3ENQA 2JC0A 1CJKA 2NREA 2DR7A 1CJUA 4LF8J 2GGPA 3EZ5A 3Q22A 2MY7A 2W1BA 2E44A 4JP8A 2VG5A 1EX8A 1RAFB 1Q5YA 1U0HA 2HFVA 1EJ7L 2QSFA 4M63A 2WOMB 1X4BA 2JJ4D 1FJCA 4IG3B 4KSEB 2ZVSA 3TAQA 1HBNA 2FGCA 1RHUB 3IXQA 3PJXA 4K4TA 1YRXA 3QFHA 2A2DA 4OYWA 4C3MA 1KVJA 2XYGB 4DL7A 3HHLD 4IQMA 1F2HA 1X4CA 4YB5A 2AZ3A 2ZDPA 2XY7A 4OI2A 1YVFA 4ZKAA 3KTQA 2NLWA 2W25A 1FESA 3MMJA 3WQPA 5KFEA 1XR6A 3L7UA 2CNNB 3EGNA 3TZYA 3B54A 4DV0J 1U2FA 1V6HA 1T8EA 3W5ZA 1E6YA 4HL9A 3SEOA 1FKPB 4OI4A 1AB8A 1LW0B 2K1RA 2YX4A 1U1MA 3T19A 2D1CA 1IKVA 1DAXA 3GJRB 3LPYA 3HO1A 3MMAB 2CJ9A 2LYVA 4CLYA 2KTQA 1YIJS 3JSRA 3D9BA 3GZ7A 3GIIA 5ETNA 5J2QA 1BXNA 3C6UB 3I32A 1FCAA 1RT5A 4CTAA 4JV2A 4B3OB 3G82A 4MFBA 5I42B 2M3DA 3D2WA 2RQCA 1Y9OA 1RYSA 3M1VA 5LT5A 1Q8KA 1GMWA 4F3MA 4A8MP 3M8ZA 4O3NA 4CP5A 2N4CA 2MQMA 2XMVA 2ZNYA 2ZD1A 5J2QB 2HBZB 3CJ5A 5HQLA 4LF5J 3CJ8A 2FHJD 3Q2SC 2IM1A 3CCQS 1AW0A 5CA5A 1CQMA 4X66F 4M5DA 4MYTA 4CDIA 3HM9A 2DGXA 3HSDA 5F41A 5K9FA 5BR8J 3AH6A 1D8YA 1LKZA 5L9XA 1PCAA 4WXWA 1UL3A 1SQGA 4IH5A 4OQJA 4TLRA 1OO0B 1RWOB 1NMEB 1WOSA 3QGPA 3W62A 3WX4A 5EDWA 1UVKA 3V6HA 4X4OA 2WAQD 4X4VA 4K5RA 2I2YA 2MQLA 1MU2A 1RWWB 1XMBA 4LBPA 4IR9A 2HZCA 2NUHA 4L3NA 1ZTTA 1HWLA 3FRZA 3CWJA 3TVYA 3M8RA 3C3LA 2B5JB 1CS4A 2OPRA 4NL5A 2AF6A 2ZH3A 4RWWA 1Y4ZB 1OYEA 4RZRA 5IM0A 2BUNA 1KVIA 3JTPA 3FCWA 4DX5A 2KFYA 1FDAA 1IBKJ 3PRDA 2CJYB 3TZZA 2V34A 4G6VB 1NU4A 3SSQA 3VAHA 3SDEB 1GX6A 1W25A 1RGVA 1SB6A 4ZJLA 4U7UD 4ECXA 2P2CB 5HI7A 4X4PA 3BGFA 4NLTA 4M5HA 1AFJA 4IRKA 3LANA 2OFHX 2NSBA 2RHSB 5AT1B 4X84A 1WEZA 1WKJA 4WZMA 5THWA 3BJYA 1M1GA 2Q1LA 9ATCB 1VDHA 3SCKE 3VZHA 1X9WA 1LNQA 1FXDA 2EG1A 2IYGA 2LP4A 2WCXA 2BR0A 3A8KA 3QJPA 4FZVA 2CPYA 3RBDA 5H1SV 2CQ0A 2PMHA 4PQAA 4C0HA 4DSJA 3HD1A 1HHSA 1WSRA 2AWZA 2CQDA 4F67A 5CAAA 4I2QB 4EO6A 1DY3A 1WHXA 2YQ1A 3CCWA 3CSKA 2V4JA 3MCMA 4LJMA 3HT3A 5E2QA 4ES1A 4JI3F 2CQ1A 2AT1B 2AMCB 4ZIWA 2W7PA 3V81B 1PGZA 1KNZA 5ETOA 2EK6A 1HHQA 2GQCA 4H54A 3DM2B 2VH7A 2XWXA 2LKZA 4ZP6A 4N76A 4DFKA 3KNAA 4UZCA 3DHWC 1U4BA 5J2PA 4KO0B 1J5OB 3T6JA 2V4RA 1XNRJ 2CQ2A 3CMQA 4I2PB 1YLXA 4F2SA 4F8RA 4WIIA 4ZJOA 3W63A 1P6TA 1GTEA 4OJ3A 5C42A 2KFZA 2OELA 3BF4A 4LR9A 4G1IA 5LMNF 4MAKA 2LA6A 4ECUA 2G2OA 3A8IA 4KKOB 1EIYB 1N0UA 3CIZA 2IM0A 2WOMA 3D0HE 4HH1A 3S8SA 2QEXS 3PEJA 3CD6S 5HVGA 1TKXB 2RKIB 1H7WA 2O1PA 3MM8A 2HPUA 2GGPB 1HQ2A 1X7VA 1F0XA 4BWMA 4DN9A 1SKSA 2F4VJ 3CCJS 1SC1B 1QM9A 2VG6A 1FDBA 2I9SA 1X31C 2L9DA 2ROGA 4P75A 4HYKA 3IRXB 2DH7A 2DR9A 2R7TA 2E7VA 3J7AN 1SJQA 4MIAA 4IFYB 1NK7A 2YPZA 2WB1D 3UDEA 3DOLB 2AHOB 2WVEA 2OGUA 3TARA 4PG8A 3O6QA 4AT1B 4EZ6A 3A13A 4ES3A 4NCBA 3H42A 3TAMA 4P73A 3ITHB 1NAQA 3PHEA 5AXKA 2VFVA 4I0WA 1FA0A 1OPIA 4C97A 1LWCA 3CC7S 1IKYA 3R97A 1IBKF 4DCOB 1L3SA 1JNRB 3W1YC 1KQSR 3PCOB 2QL5B 2M70A 1Y00A 1WC1A 3OT9A 5H9FJ 3UW1A 3MECA 2MMYA 4OX7A 1IKXA 1ZM3A 2R9LA 4OFZA 4B9TA 1E6VA 5CABA 1C4CA 5CCMA 3LGMA 1XNQJ 1JLAB 2MKJA 5HBMA 4IKAA 4DUYJ 1OYDA 1HWUA 4HEA9 2W9CB 3SV4A 4RBTA 1V5VA 2Z2LA 4L75A 2DGTA 3C6TA 5G0RA 1R8AA 1S1TA 3PYGA 2HHTA 2DGWA 1CULB 2QLBB 4U96A 5KFFA 3Q2TC 4GKJF 4DV7J 3X1LB 2APOA 1RTDB 3CJ2A 3H2LA 3O44A 5HMYA 1FEEA 2WW4A 2AD9A 2J6TA 1UPMB 2J7UA 2VPWB 1VS3A 2W9CA 2NS1B 1M5SA 2WVFA 1S7IA 4PXBA 4FYYB 1S59A 2NYHA 2V9KA 2FJVA 1FNXH 2W7AA 1RT1A 1P1TA 1BWEA 1HI8A 1SPBP 1WEXA 4DQQA 2HVHA 2G0CA 4FYWB 3DRRA 1VK8A 3ET6B 8ATCB 3RAXA 5EUHA 3CCVS 3HX9A 4H4OB 2YNGA 1XQIA 2EBEA 3V6DB 3HDSA 4ZHRB 3MTJA 4J5OA 4LF8F 4MKYA 2R42A 1PIEA 3TW0A 1FRHA 1S57A 1UKUA 5A2QU 3IA0A 2GVDA 1TVRB 5IC6B 1VQ5S 4LSLA 3GMGA 5H9EJ 1NDKA 2EPIA 4KPYA 4O44B 3T1YJ 1N8RT 4O3SA 1LFPA 4NMLA 3LP2A 2UUTA 2CJXB 4WJBA 4ZPBA 3MMCA 4DV4F 3P4UB 4DEZA 2XB2D 2CZ9A 4WE1B 3V5RA 1RUSA 4NLPA 2W2QP 4CO1A 4RW4A 3Q89A 2OPQA 2AJ4A 3OVAA 5KFUA 1GEHA 2R8HA 4DS5A 3NG8A 5F8GA 2ATLA 1FJEB 3G8TA 1QLNA 4O44A 2E7WA 2OD4A 1IUJA 3CT9A 5DZ7A 3QLHB 2BRKA 5K5MA 2HBRB 2KKHA 4NLXA 5HATA 1FJGJ 2VFSA 3M2UA 1S1TB 2AYBA 1FHTA 1RHQB 1R0BG 2OTJS 2ABYA 2GFFA 5GAEU 4JBCA 4C4WA 1YG0A 3NBPA 3OLAA 3BO3A 3JSYA 2DNZA 4KB7A 4EBCA 4NLQA 2RHQB 4NYZA 2EFGA 4LBHA 2HK3A 3TNVA 4KH1B 2ZZMA 3HJFA 2Y9HA 1UEKA 1F1BB 4WWSA 1S6UA 2B8QA 5CD4A 3NCPA 2AYMA 2VG7A 2RVJA 2QA4S 2VBYA 5M2UA 2YWKA 2DJWA 2CPDA 4KHRA 5KG2A 4QIVA 1T05A 3ELHA 1YJWS 2Q6CA 1RTIB 5KFKA 3L4BC 1ELOA 3MMBA 3H5XA 4WFBQ 2WRMA 2ZBQA 5B0EA 1NLKL 1YJ7A 3DC2A 3EJMA 2U2FA 4YQWA 5C2GA 3CCSS 2W2PP 4KT0C 1IR2A 4J9OA 5HQ8A 1NHKL 5FLXU 1K8AT 1T9YA 4M5IA 2PT0A 4ZIVA 3MMCB 5DM6Q 3PIPQ 4CT9A 4K4UA 2BOAA 3CJ3A 3UDLA 4X65J 2VU5A 2J0QD 4JI0F 1JLGB 1WHYA 1XEZA 4LSLB 4GO7X 3VGSA 1VQ6S 3BPSP 3NWGA 2JHEA 4B9VA 1TL7B 2E1RA 2LVWA 1SJFA 2GCFA 1XK8A 1RB0A 4R0EA 4Q2LA 2D9OA 3DOMB 3NGTA 4WZQA 5ETTA 1ACMB 3LAKA 2QIFA 1L5UA 3FGVA 2XO7A 1VQNS 4OI0A 3IWNC 3SCJE 3ISND 2GHWA 3O3LA 2XS5A 4OHZA 4NMXA 3R2CJ 2C2ZB 2ZZTA 2E5HA 2IVMA 1N32F 1VQYA 4I56A 4K4YA 4FF4A 3FC9A 1ZM9A 1KS2A 5BXIA 1GMUA 1SJRA 2FZKB 4X62F 1RQ0A 2P9EA 2KXHA 4BHQA 2J0SD 2KHCA 1DTQB 4DZ6A 3TJ8A 1UP1A 2OPRB 3CCTA 3OLBA 2CZ4A 2OJ3A 2P5VA 4IDKA 3W60A 4C3LA 4K4XA 3PW4A 1RBOB 1NSKL 5A2QY 1FFWB 3BGUA 1P1LA 1SH3A 2VDIA 4MIBA 2DR5A 4PAAA 4WBFA 4LQ3A 3LUYA 4U67Q 4QQBA 2RS8A 3A3PB 4DLGA 1U6BA 4QWCA 1SIWB 4JI3J 1EETB 4DG1A 1KTVA 2H4YB 3IO1A 3FBCA 1MWZA 1RU2A 5GMDA 5HQMA 1HBOB 2R7RA 3FFIA 2RDDA 3S1TA 3HCXA 3PDNA 3GILA 4C11B 2CQHA 3H5SA 1M90T 1B0VA 3CTRA 1M5HA 2AV5A 3TVZA 2HHWA 2IAJB 1VBKA 1EETA 2CA9A 2EK1A 4P2FA 4F7VA 2YXLA 2BA9A 5D77A 1X4DA 4Y2KA 4KE5A 1S4EA 4EO8A 2LQ9A 1F2GA 2YNFB 1QY7A 2CQPA 1TV6A 4O3RA 4O4GB 3FEZA 3KNGA 5LMNJ 2EG2A 2CKWA 1DLOB 4WK3A 1JLFA 3LF0A 1RBAA 4G1PA 2KXNB 1N36F 2ALYB 4FNIA 1TMJA 3MPDA 4HVZA 2V8PA 3BPDA 3WDOA 3SYZA 4JI4J 5J1PA 3X3UA 4X4SA 2H48B 1IXKA 2IM2A 2VJUA 4L72B 4OX8A 1FKPA 2DNHA 2YWGA 4WPAA 3QSIA 1BGXT 7FDRA 4EZ9A 4ELUA 2ZOGA 1XBWA 1XWLA 3KLGB 2JRSA 2QMXA 2VFRA 3KHRA 2MZJA 3CCUS 1CULA 5DG9A 1U1PA 2NR0A 3HKWA 5FD1A 4DSIA 2DNYA 3Q23A 3E3XA 5CYQB 2CQ3A 2RU9A 5DDRC 3E01A 3V4IA 4R8UB 4ZVUB 2OHDA 4FPRA 2OUGA 3OTBA 3PYEA 3DGPB 5C2CA 1S1XA 1QUPA 1YK9A 4RNHA 4JI0J 3L3CA 2NZ4A 2ZJPQ 1AYEA 3U1MA 5FJ4A 3CXCR 2HQCA 2BVZA 1K9MT 4OX6A 1RT6A 5D4PA 4B08A 2OPSB 1S1UB 1Q4RA 2MDAA 4JB8B 1HR0F 4ED0A 1VIOA 1WHWA 2QTWA 2FC8A 4C8MA 1BY9A 1TAUA 1TK8A 1HARA 3C16A 1K73T 3D67A 5DLGA 3FSYA 4UOFA 1XNQF 3C6UA 2M5YA 3OBIA 3U1LA 4M5NA 2ROEA 2Z56B 1RHMB 2QMUB 4LVNP 3KWMA 3CW2C 2V69A 3DDNA 3L7OA 2LDYA 3BQ0A 1HMVA 1N0VC 2HQFA 4CM2A 2F9DA 2HWHA 3BR9A 2GS8A 2GNKA 1S4FA 5KFRA 3PFEA 2PIIA 2KL8A 3IAS9 3QT6A 3QQCD 2QGFB 2FLPA 3KLGA 4B3TJ 4I2PA 4TQSA 4ZP7A 4RW6B 2YKOA 5DS7A 5DGBA 1LK5A 1RTZA 3NP5A 4DQPA 2DPIA 4OYPA 2XMWA 4B17A 4MK7A 3W9IA 3QZ7A 2DHAA 3MOJB 1CG2A 5DQHA 1IQTA 2W9AA 3BO4A 1NKBA 4LFAJ 3PX6A 1HNWJ 2RF2B 3R5DA 1QJHA 2JEFA 2R7XA 1YBUA 4RNFA 4L74A 1SL1A 3IS9B 4H4MA 5HL7Q 5GADU 3IBFB 2PMWA 2N7CA 4YB7A 3MR6A 2QT7A 2F8MA 4MJKA 4DQRA 2ALZA 4U95A 3RAQA 2MGZA 1HL6A 2M2BA 1VR6A 4TYBA 1S9GB 3LALA 2CPIA 4YY3J 4A8SA 1KD1T 3V81A 3LW5C 4KHPF 2L3MA 4HKQA 3K0JA 2VV5A 4ZVFA 1HBUA 1D8ZA 2HRUA 5IQQA 1RCOB 2QE5A 5IS2A 3MDFA 2CPJA 2KH9A 4ANEA 2KM8C 2HLTA 2GAGC 2YNGB 1O8BA 5AE2A 3AT1B 3I6PA 1HBNB 2HFSA 3RB6A 3QO9A 2C3YA 1KOOA 2B9YA 1RT1B 2NPFA 1RKJA 3IR5B 4ITSA 1S5ZA 4U9RA 4ZCIA 2YKPA 4I67A 3G6VA 2YBVA 2Z0GA 3JYTB 3QRQA 4KYZA 2ZH1A 3KK2B 1X5TA 4USJC 1J5EJ 1MNEA 2X1BA 3DXBA 3IBCB 3HSJA 2ZDOA 2KO1A 1JLEB 4DPYA 3F44A 1FDNA 4CLKA 2K3KA 3HSGA 1WTBA 4W92B 3A3NB 1UFWA 3MEKA 3M6VA 2ZBPA 2RS2A 3FJ2A 1PAEX 5KG0A 1BMQB 3B78A 2HAFA 5DO2A 5EN1A 5KFDA 2B3TB 1KKHA 3Q86A 2HZAA 2D41A 2UUBF 1KWMA 2UU9F 1N5YA 4Y2AA 1NNDA 2ZH2A 1D9FA 2IA6A 1UETA 2JWNA 3DM2A 5C42B 4DSLA 1VBXA 4ELTA 4LREA 3OXGA 5A8RB 3KUGA 2FQQB 4WTYA 3HHEA 1FRJA 3OUYB 5DLFA 1N88A 3GSDA 3Q8UA 4TY8A 3UCUP 4IUFA 1HNXF 1HBMB 3W2WB 2UUAJ 2V2QA 2RD5C 4QIWD 3TJAA 3ZO7A 5T14A 2MB0B 4NLRA 5F8MA 2HBYB 4IQXA 2HZVA 3R7SB 2RDJA 1Q53A 4CO5A 4DPUA 4TU9A 3HFKA 1U1LA 3UWTA 3Q8QB 4KJIA 1K1SA 1IJFB 1WKKA 4DL5A 5B0CA 1IBLF 1CJKB 3RB4A 1SL2A 2YQ0A 2ZWOA 4LFCJ 2DNOA 1EB0A 5KTQA 3E01B 5ETLA 4JI6J 2YNHA 3CDWA 1KLMB 3EWGA 4P10A 3ITHA 2LEPA 4ZP9A 2ZH8A 3J7Z5 2B7CB 3DDIA 4G65A 4WP3A 2DGVA 4RO0A 3IC1A 3NAHA 3GV5B 1APSA 2LEAA 1V3SA 1CVJA 3KJFB 1S77D 3T5LA 1FRLA 1U8SA 5M2RA 4DFMA 1EKRA 3QMQA 3D5MA 5DDQC 2OPPA 5J1EB 3KG4A 3KHGA 2E66A 4QJVA 4I7FB 3DI6B 4NCGA 3ZNUA 5IQ6A 1JWWA 3IFEA 3IAM9 4N8OA 1VOMA 2VFTA 1Q7YT 2IRYA 1ZTWA 4NA2A 5A8KA 3KHHA 3I5AA 2WVDA 1D9DA 2MY8A 3ILOA 4J9VA 1MWYA 1EHWA 2ROPA 2CYYA 3CJKB 4EBDA 1U1QA 1F9FA 2BE9B 2I5JA 4DV6J 2HK2A 2LXUA 4DZDA 4DR6J 5H9EK 1FWKA 4ZP8A 1SUQA 3BDEA 4HTIA 5J2MB 2ZH5A 2UVWA 4XO0A 3I0SB 3J7YI 1T9VA 2CPEA 1TL5A 2MSTA 2P9CA 4AXJA 2D3OR 4LF4J 2FHJA 3KDOA 5B0GA 3M8QB 1IM4A 2O01C 4OYMA 2M4MA 3OUYA 4HLBA 2W8LA 1X5SA 5B0BA 1KHWA 1NK4A 4OYZA 4FVMA 4X65F 4NZ6A 4EEYA 3QIPA 4GVBA 4PWDB 1JLCA 3BH7B 2BQUA 3ET6A 1IBMF 3NMRA 2NSCA 3POTB 3C15B 1N5TA 2DGOA 2HGNA 1KHVA 4TKTA 5E3CA 3OL6A 4DR2F 1T9UA 1RAGB 3Q24A 2ASDA 2MKKA 3KLEB 3M8QA 1GTHA 4UF4A 5L1JA 2LECA 2L08A 4RW9B 1T3OA 3AOCA 2B4UA 4RJVA 3PX0A 3RB0A 3R6GB 1R8PA 3EXYA 1R8CA 5A0YB 2BJ1A 1VLOA 1RI7A 4YS2A 2XG8A 3ZZZA 4ICLA 4F0HA 3PW2A 1UA0A 3C2PA 2Y8YA 1N32J 1G3OA 1S9EA 2HAIA 5L1LA 2H5EA 3J7YU 4RBVA 3P8BB 2AGOA 3IGNA 4RWXA 4F3QA 4CLLA 4FP9A 4Q44A 4DUTA 2LDIA 1VGYA 5A0YA 3MM5B 4N8NA 4ZPAA 4JV0A 1ZPWX 4OYAA 3KLVA 1PJ5A 1N6QA 4DI6A 1VQOS 1DTQA 4OIXA 3NS6A 4P6QA 3UDVA 4K0KJ 4RW4B 1ZAWA 4X64F 1BQMB 2C2OB 2E5JA 2FVRA 4KGZB 5KFAA 3ULHA 3UO0A 3PY8A 4RKUC 1IR1A 3JSMB 4PXEA 4XIUA 2WSFC 4HHHA 4DV0F 3CMES 2NUUG 4LF9F 4IG0B 4N47A 4YR2A 5KG3A 3I9ZA 4GC7A 3DMJA 2VB6A 3NCRA 4ECZA 2YKMA 1M5OC 4PYDA 1J27A 2J6SA 1FRIA 1CJUB 4OJHA 2DYAA 4OYBA 5DM7Q 2K7JA 4OZ3A 4YUDA 3W66A 2M88A 1VLYA 3NLCA 4FVCA 3VF0B 4YR0A 4V19J 1F6TA 1F60B 1UVLA 5KG6A 4BDPA 4KQZA 4X4RA 5EHHA 3Q8YA 3OR2A 1S1WB 5D0HA 4DR5F 3UNGC 2E1CA 1KN6A 4B9UA 2V63A 4ZVRB 1LW2B 4UQGA 4DR6F 4PRFA 3NMAA 3ZTRA 2FY1A 3T1YF 5E41A 1S9EB 3VAMA 3AB4B 4CH7A 3MFHA 4PUOA 2PGCA 3EICA 2PFDA 2OEKA 3IM9A 4NRUA 1HNZJ 4AD6A 1RAJA 4NYPA 2V68A 2CDRB 5CYMB 3ISZA 5E0OA 3HI9A 5BYRA 6FDRA 2G2ZA 2DO4A 3IM8A 2FUG9 2DCUB 4RPFA 1SKWA 4K0KF 3NNCA 1LW0A 2K1RB 2SXLA 4OHVA 5A8WA 2IIHA 5GMKa 5F3ZA 1YI2S 1RA6A 1IBMJ 4I68A 1IKWB 2MQ8A 4JYAF 1JXVA 2DO0A 1H6KX 1U1NA 4DV5F 1QTNB 5KFIA 1F9HA 2POKA 3F73A 2GMJA 2YWEA 4P2SA 5IZHA 4CIOA 1S76D 1TELA 2G1DA 2MPUA 1YSJA 2F7VA 2LLZA 4P7VA 2BDPA 2ZZNA 2ZE2B 4W90B 3UN5A 3TAPA 1J5OA 2QZ8A 4QIGA 1U2RA 1J2VA 1M0SA 1YZ6A 1D9AA 3KUEA 4CYUB 2IAJA 3AAWB 3R5AA 4DV1F 3QJLA 1SJ3P 1YWXA 5DQIA 3JAMY 1MWQA 3BYRA 3J80Y 1U1KA 4Q0BB 1FXLA 3RW7A 2KJVA 1UVIA 5FDLA 2V67A 1RA7A 3QGIA 4NLSA 1J5EF 2HHUA 2LCWA 1KFDA 1GFWB 4ENOA 1G6BA 2B7BB 1GQEA 5KOXA 5KT6A 2OSQA 4YDDB 3G8SA 3J7ZT 3CULA 3CCES 3F0NA 3NOCA 1PJ7A 2AYEA 3GB0A 1YBAA 1S79A 1X8DA 4QIFA 5AXLA 3ENVA 2VG6B 1OMSA 2MEWA 3EVWA 3AFGA 2BJ9A 4URSA 4P52A 1NDCA 2CXEA 3TUIC 1RU1A 2HURA 1Z4UA 3D6TB 1U2CA 3NXZA 4XDCA 2BX6A 3OL9A 3RG6A 2KRBA 4JUZA 4MH8A 1YJRA 1MN7A 3PO5A 2DT9A 1TL1B 1TAQA 4DBQA 1TKTA 4DV6F 2GQ2A 4LVOP 5I3UB 1U09A 1JMTA 3BSNA 1Q79A 2HKEA 3PW5A 1XMQJ 4KGKA 2C42A 4U6PA 1VC0A 1X5PA 3QWPA 5HVFA 1FKOB 1RBLA 2GVZB 4Z7YA 1S99A 3HFZB 1RHKB 2YX7A 1RWKB 4P2MA 5L1KA 5KFQA 4ETZA 3FZBA 3DU5A 1T9XA 1IJEB 4I64A 3T5HA 4PQUB 3VR1A 1NM2A 4QW8A 4CO3A 2HFNA 2NZCA 4YY3F 4P72A 2CQCA 3OL8A 5KFOA 3N01A 3R9LA 1YTYA 5HROA 2AGQA 1SKUB 2VA3A 2B56A 4J37A 4DR2J 4QOTA 4P9SA 2D3O1 3JQJA 2N4DA 4M5DB 5IT9Y 3B6BA 3DRSB 1NZAA 4DPOA 3MPVA 1OSDA 5D0EA 2Q66A 3CDBA 2OEMA 3UCZP 3LQVA 1N52B 1RWXB 2BM1A 2WBMA 3HFVA 3R6LB 1VQ7S 1TVRA 1BLUA 4Y3CA 4ZA1A 2HHXA 2LU2A 4F4WA 2CG8A 1LWFA 3JSMA 2XGPA 2ASYA 2E1AA 3QBCA 3EVOA 3ENWA 3HULA 4WK1A 5HSPA 4K4ZA 3GYXB 4O3QA 5I42A 1D09B 1WD6A 4J90A 4J9UE 3DNCA 4OHWA 3KMSA 4ED1A 4O4RA 2ZBRA 4DV5J 3W5XA 4CLSA 3M2RB 1U0SA 4NXMJ 1EZZB 2HGLA 4ER8A 4ZLNA 5CH7B 2H3EB 2Y0BB 3QYYA 1Q81T 4GRSA 2RAQA 4AL7A 3FBFA 2LQJA 3DCAA 5KFVA 4S0MA 2R7QA 3CGIA 3GFYA 4DV1J 4DQSA 3RBEA 1WF0A 5I3PA 3WC2A 2BE2A 3HVTA 1TL7A 3SBMA 2HEKA 4HT7A 4KGMA 4NLUA 5D8HB 4EK2A 1RWNB 2XZWA 3HD2A 4DUYF 1HFEL 2XZTB 2ZUAA 1HNVA 4OL8A 3AY0A 4ZCMA 3JAMU 3DRYA 2GMLA 3N79A 3J80U 3TZXA 5HMZA 2PC6A 4WCEQ 3H59A 2P6SA 3MM9A 2E9TA 5KFNA 3FRYA 4ZCLA 3K89A 3RAMA 4NI2A 3DOLA 1UZHA 2GAHC 1HQUB 3VAKA 2IVFB 4C8ZA 4ZLLA 1NJIT 3V4MA 2OI2A 2HMIB 3MR5A 2KT3A 2MQNA 3FBEA 3IRXA 2KG0A 1HD0A 4F04B 4DX8H 3UN3A 4DX6A 1IQZA 5DRKA 5JVHQ 4USIA 3W2WA 4RUHA 5E3AA 4WF9Q 2LXIA 2D7SA 3FEYB 4FXDA 2HYIB 2FHMA 5DDOC 1JX4A 1XIQA 3OSPA 1D0EA 1IBLJ 3W3SA 4X4QA 3EE3A 1PBAA 3Q8PB 1FO1A 1SI9A 1Z2LA 3BGLA 1FE4A 4FYDA 1WC6A 1V9OA 1NJZA 1FI4A 2MLZA 4B9MA 3SQGA 2KVIA 2K3IA 5D6GA 4GO5X 1GNKA 5GMEA 2ZKTA 2VKZG 3K5OA 3V4IB 3MPWA 1LWEB 4C8YA 1U6FA 2BKNA 1RWUA 1FNMA 4MKVA 1PYTA 4D3GA 2MXYA 1G2EA 3V6KA 4MMOA 2Z30B 3RBZA 4G1QB 3UD5A 2QFIA 5K8NA 1RTHA 1DQAA 2A0FB 2I1RA 2KVQE 2MYFA 2E29A 2BANA 1AA1B 1IN0A 3JSBA 3EPGA 2AJFE 2JH3A 3W8GA 2LU1A 2PMZD 4Q2MA 3MCOA 2HLUA 5L38A 1CJVB 2O3DA 3D7SB 4LF9J 5CCLA 5KT4A 4C8LA 4LIWA 4DL0C 5DQGA 2CVEA 1FNOA 2BEFA 3CDAA 3T9NA 1WKLA 3BN4A 4P2XA 3IN5A 2CQIA 1RE1B 4WIQA 1X0PA 2J9DE 1TTHB 4QPXA 3RYLA 5HVHA 1KRPA 1G1XA 1UVNA 1ZPVA 4ED5A 1HKAA 3DOMA 4DMZA 3I82A 5BJRA 4FS1A 4TNOA 4Z37A 1C4AA 2DXFA 2J76E 1DURA 3H90A 2QG9B 4F26A 2HMIA 2W4CA 4IH6A 4A8OA 1HBOA 1KTQA 1RSCA 4ECQA 4GKJJ 3CJTA 4FXWA 1Q8LA 3THTA 1S1XB 2KYXA 2X3GA 3NWRA 4JOUA 1C1BA 1PC5A 5AXMA 2R2SA 3FMWA 4Y34A 4A8XA 2HRYA 2N7YA 4HACB 3GJQB 2HVDA 5CZVA 3K59A 4OZ5A 5CYJA 3DLJA 2I5JB 8RUCA 2WSEC 2WK4A 4OZ0A 1HYSA 4J7CA 3M1VB 1OS5A 2QLXA 4LIRA 1KR4A 3DLKB 2RH3A 2GO9A 2UVVA 3OTCA 3CO9A 4L3KA 3E8OA 2QL7B 3D6MB 3OSNA 2FHKA 2K2PA 2HQGA 3TA0A 3WX8A 4ECVA 3MR2A 2F40A 4C8KA 2OLWA 4ZVSB 5KG1A 4QWEA 3PTWA 1RAOA 3FVYA 4BS2A 4RLEA 4RNOA 1M1HA 3D4JA 1CJTA 4DOZA 4AL6A 4UY8T 2UXDJ 1Q7LB 1RHRB 4ZPWR 4I6AA 5AXNA 3GIJA 3HHLA 1VISA 3NKYA 4K59A 2E9RX 5KFMA 3DXSX 4WTOB 4DR3F 4MKAA 4DL6A 3D6HB 4B3OA 1S0MA 4I7FA 3DOKB 1WUUA 2MZTA 1H72C 4X2BA 2AZ1A 2GVDB 3M6WA 2FB0A 4RUCA 2C2RA 1NKEA 2DRBA 2EW9A 3LP1A 2OD6A 4M1KA 2OMLA 5CZXA 3PJWA 4LF7F 1PBUA 1D3WA 3NOGA 1T9WA 2ZM6F 2B9WA 3I9V9 1VRTB 3EPIA 1EP4B 2K06A 3FDSA 3VAIA 3BR8A 5HLFA 3FQLA 4EYIB 3GTYX 3QRRA 2UUAF 2E9ZA 3VVTA 1S9FA 3M9MB 2DTJA 4LR8A 4DU8A 4DR5J 3ZZYA 4C8NA 2QLWA 3LOUA 2IDEA 1FRXA 1F5CA 3MCNA 2CFXA 3MR7A 4FKXA 4ZDNA 1BUXA 5F8IA 3WC0A 4DS4A 3MM6B 1GMWD 3ZZUA 2JFDA 3PG9A 1L3VA 4ZPVR 4A8KA 2CIMA 1N5SA 2FJEB 3K8WA 4GC6A 4LSNB 4N7TA 3OR1B 2X3DA 2BRLA 4ZVHA 2AJ2A 2IJRA 2V2VA 5KG7A 3UE2A 2QJ3A 3CD7A 2OP5A 1K44A 2WBRA 3LTOA 3MR3A 2E7XA 4RBUA 2VDHA 3MEDA 3N5BA 1QE1B 4F0KA 5B0AA 4JYAJ 2XO6A 4OJGA 2B6AA 1OY9A 3NY0A 4C0BA 2CPFA 1QVGR 4C6AA 5F9LA 4ZCKA 5LSRA 7FD1A 3RBXA 3GWCA 2KM8B 1IWAA 5K14A 3QPIA 3MF5A 4E98A 1WC5A 4M94A 3G87A 5F0WA 3A4TA 2A6MA 4Q43A 1SCJB 3THVA 1NDLA 1A9NB 2JOQA 3MD1A 2W2NP 4USHA 3MFIA 2PFFB 1RTJA 2J8AA 4KGXB 4OZNA 3US5A 2PO4A 1HI0P 3AJDA 3LPEA 2CJQA 2MHEA 5IV4A 5IFMA 1XERA 1AZSB 5MLCV 3H8YA 4FDFA 2VG7B 4H4OA 4NLDA 4Q8FA 2WVBA 4ZHRA 2VC0A 2KFNA 1RT5B 1I1GA 1X4GA 2PN6A 1H73A 4IG0A 2FPHX 4I69A 4ZVEA 1VRTA 1ZA1B 3PJ9A 2ADBA 4LRFA 1R31A 1YGYA 3R5BA 3CJQA 4LMZA 3GP9A 3TA2A 2OFGX 5A6PA 4TU7A 2UXDF 1G7CB 3KMQA 3IS9A 4H4MB 1B0PA 2V8DA 5HROB 1MLAA 1T03A 4QW9A 3D68A 3K57A 1ZAVA 3RRKA 2CNKB 1ZA2B 2MGZB 2VBWA 3JTNA 3KG1A 1YJUA 1JLEA 1LXNA 3FEXB 3O8WA 3UPFA 2GV1A 4LFBJ 3HMJG 3M8WA 1FFSB 3Q8SB 2CJAA 1VMBA 2BJ7A 2KRRA 1VBZA 1K0VA 2ZFHA 3PRVA 4TY9A 3I31A 2CQ4A 4WKRA 4B9SA 1FEHA 4HHUA 1U26A 2V8VA 3AB2B 1XTZA 4GMKA 3VAGA 2P9GA 3UN2A 4ZVOB 4B9NA 2FTRA 4F25A 3M2VB 3Q8VA 5ITHA 3IR6B 3NBPB 2ZC3A 1GMVA 5KG5A 3P49B 1TUGB 5C24B 1JKHA 1YBTA 2ZH6A 4USWA 4N41A 4DPTA 3B8HA 4YHHF 4C9DA 1PC4A 2RRBA 5E7OB 2DH8A 2J9DA 3TYTA 1UVMA 1UAWA 3BSCA 2MLYA 2IVYA 1B99A 5DZ6A 5JXSA 2ZUGA 3MMBB 1C2PA 3QIPB 2R2UA 3KLHA 4GVBB 3ZZPA 1P27B 1BWVA 3LP0B 1GX5A 4ZVQB 1S49A 1NSAA 2YNFA 2WVCA 5A76A 3H2VE 3IR7B 3HXMA 2VIHA 1WC4A 1AUDA 3TAMB 3NS5A 2UV8G 1B4SA 3PKMA 4KTQA 4UQTA 2N82B 4TLQA 1C0UA 3B4DA 2YKNB 3RGIA 2ZEJA 3RB3A 5F0UA 3ILLA 5ETMA 4DSFA 3V2UC 5KFLA 4ERDA 1VRUA 2B4VA 3CMAS 2A2CA 4FF1A 2BV3A 3R27A 4NXMF 2BMBA 2ILZA 3C19A 5D15A 3W2VA 1L3UA 4DQIA 2R7VA 1QSLA 4F50A 1FDDA 2KB2A 4MT1A 3BREA 2X1AA 1S1VA 3LA0A 3AD8C 1N34J 2OH2A 3NS7B 1DTTA 1FTCA 1FVQA 3UD4P 2A3JA 3KFWX 5DDPC 1NDPA 4UY85 2N3LA 5ETRA 1HQEA 3RTVA 1U45A 2IY5B 3QIDA 4IOAQ 1R43A 3P3DA 2HG4A 4W4MA 2ZJRQ 4WXOA 3H5UA 1TP7A 3N5FA 3MHYA 2BANB 5KFTA 3SFUA 4UOGA 1RT2B 2E5GA 3CD5A 2IPOB 2W01A 3FMBA 4Y6IA 3NGSA 4ED8A 2UVRA 1NH7A 2XCPA 1P9QC 3QLHA 2GW8A 3CE8A 5F8HA 2DNKA 3CB4A 4OYXA 3J81j 4LRAA 1M1KT 3G6YA 1KP6A 1R89A 4ILRA 4IDKB 2BBEA 3S7RA 2UU9J 2MZ1A 3OR2B 2HHSA 1WI8A 4LSNA 2CZVC 2H5IB 2O66A 2R4FA 4CWBA 2RNEA 3V6DA 4OZJA 4U7CA 4AUKA 4CQ1A 2RRAA 1TK0A 1KC8T 1RT3A 4C11A 3K58A 5CXTA 4UW2A 2MZRA 5D3GB 3IG1B 2DY9A 2I0XA 4LR7A 5ETSA 4LF6J 2DBBA 1MMNA 1XR7A 3FZ2A 3ZZOA 1QTMA 2RQMA 3MUMP 1N56A 3M9NB 2H4WB 3M7VA 1FERA 2IMOA 2UXCJ 1KFSA 4ZPTR 5BR8F 1MMLA 2DNMA 4FXVA 4DHVA 4GVLA 2EKYA 2EC0A 3IP0A 4X4UA 3KLFB 1DFDA 4I4BA 1TFYA 2JL9A 3AQOA 2RF2A 4KY3A 2ZH9A 3DLEA 1JB0C 1UCNA 3ZZRA 3QAEA 2Z8QA 1VRUB 1BC6A 2JEIA 4HACA 5B0DA 1IVZA 2JX2A 4DV3J 3DYAA 3KK1B 1VQKS 3DLHA 4AFFA 1EARA 3ADAC 4WFYA 1SQFA 3QRPA 3EGWB 4N77A 5I4MA 2IDLA 4F4XA 3MEGB 4ZITA 1PKUA 4PWDA 3CNQP 4KIAA 4NWBA 4RR5A 5KFYA 4E0DA 5AE1A 2CJKA 2J0XA 1UFLA 4CI0B 3BM7A 1T05B 2BM0A 4KGVB 1L3TA 2VA2A 4B3MF 1I6JA 3BSOA 1N33J 2Z58B 4N5SA 4OJ1A 2HFUA 2X51A 1HPZA 5D0RA 3PR4A 1WDTA 4ID5A 2CPXA 4OLOA 4EMDA 4FKYA 4Q0BA 4QWDA 3IWLA 1NJWA 3TUPA 4ANCA 4BBYA 4CLTA 4TN2A 4YOEA 2GHVC 1R6VA 1WOPA 5SUHA 5KT2A 2J9CA 2XI2A 3TRGA 3FBBA 5B08A 4B3SJ 1X0FA 3CDUA 2W4DA 4MKBA 1UJ6A 1R0CB 2QN6B 3OTDA 5E5NA 2KG1A 2UUBJ 1TL3A 5ETVA 2G9OA 3QGGA 4ZK7M 1UMJA 2FJBB 4ZPDA 4PG4A 4UOCA 2OSRA 2FIUA 3SDEA 2A10A 3SSSA 5L9NA 2V4QA 4UOHA 3V6JA 1MROA 3K5PA 2EI5A 4Q7AA 2DGUA 1VQ4S 1NEEA 2D3UA 3RUBL 3UQSA 4DPXA 1FKOA 1NK5A 2Y1LB 3AXKA 5KT7A 3NGDA 3EMTA 3D1QA 1KEKA 2DHHA 2PSZA 4C0OC 2DXEA 4OYOA 4WYLA 2CVIA 2XLIA 2BE7D 2PI4A 1WI6A 2AIRB 2GJIA 1WOOA 3MWBA 5B09A 1K47A 3O1LA 5ADZA 2CNOB 4DV3F 2BACA 2EKNA 2DRDA 3RW6A 1JNZB 5KOWA 3SFGA 1X4FA 3R5GA 3E2EA 2V9WA 2ZNZA 4JI7F 3O5TB 1ZM2A 2XHCA 3PYFA 2EC2A 5E3RA 4CRJA 2YKAA 3OR1A 2XCAA 1ZETA 3ENAA 4QCLA 4LFCF 3QZ8A 1SJ1A 3DI6A 2DHGA 4PEOA 1NK8A 1RT4B 1W26A 1RADB 1SIZA 2A18A 2XYPB 3MM6A 2CRLA 4Z2XA 1FRKA 1LXJA 2OPQB 2V2KA 4A47A 1VQSA 2C2MB 2CPHA 5KG4A 1CC8A 1NK9A 1BQNB 4Q8EA 1HD1A 2WZ1A 3EM1A 4IO9Q 1ZBTA 3EZOA 2UV8A 2XHWA 3MEEB 1T11A 2CWKA 3AXMA 4HH0A 4M5KA 1PG5B 3BQ2A 1RTHB 1UTAA 1ZAXA 1S9GA 1IKXB 4LUBA 1O6XA 2KI2A 2FHOB 2XEXA 3K5LA 4K4VA 3OXFA 4NRTA 2KZMA 5BYSA 3TEHB 4X64J 4LRDA 3QT7A 3QAUA 2Q6BA 2AJQA 4IRCA 1RAAB 2VFUA 1IKVB 2D69A 3UDCA 1YJVA 2MKYA 2VQFF 2ADCA 2RRNA 1RACB 2QA1A 2IMWP 4JI8J 4O3PA 1NB7A 1KSPA 3QT5A 3VALA 2UUCF 5C5JA 2YWFA 3GFZA 4ELVA 4ZLPA 2YNIA 4XTTA 3G86A 2F65A 5JMNA 2ZE2A 4IFYA 2MZQA 2I8EA 5KFCA 1H98A 3NEKA 4LF4F 1I94F 2IFXA 3JQKA 1C0TA 1LWCB 2FC9A 5J2NA 2VUGA 3JXOA 1U24A 1M5VC 3DRPA 1TKZA 1TL1A 2PA3A 2J6UA 3EGZA 1FJ7A 2FVQA 2DB1A 1FT8A 2XSJA 4A8YA 3W9HA 3T3FA 2BKOA 2V94A 3BKUA 4D3HA 4UZBA 5L1IA 1UJ5A 3CC4S 2DISA 4MTPA 1CBKA 2LQ5A 4YP3A 2MKSA 3C15A 1ZOTA 3A3OB 1REVB 1B7YB 2B9EA 2H51B 2Y1RI 3LP2B 2HFOA 5DJBA 4ECSA 3R1HA 2R7UA 4UUWA 1GH8A 3PEHA 1ZH5A 4X4NA 1F5BA 2EXUA 2J0WA 4QU7A 1F3VA 3M30B 1TK5A 4DR1J 2ZVIA 5L46A 3H7HB 3UNYA 1JXLA 2Y8WA 2YKMB 1LEOA 2DGSA 2ILYA 3BGOP 4NLOA 1TZ0A 1YJ9S 2PEBA 2W2OP 1RT6B 1A0OB 4MK9A 1H0HB 4ZVPB 2OTLS 2EFPA 3T9ZA 2ZH4A 2R2TA 1HNVB 3C8YA 2VBXA 3AA8A 4CH0S 5D3GA 3AA9A 3IWXA 5I3UA 1ITPA 1X60A 4QYZJ 1U47A 1TFWA 3OXLA 1S10A 1GXLA 4F4YA 3NNAA 4MK8A 4H4KA 2HHHF 4ILMA 5LJ3Y 3U27A 1ZZNA 4OHYA 2BZ2A 1LWFB 5IT4A 4R5PA 2R7OA 1H3DA 2I38A 1QVFR 3DOKA 1RAEB 3F56A 5T7LB 2FJDB 4XPCA 4AYBD 3G71S 2JFKA 4CLWA 3A12A 3R1LA 3MEDB 3NAIA 1KDNA 3PNIA 4HDGA 1HWJA 2YWWA 3CVKA 4O23A 4PR6A 2I6WA 4CLPA 2Z2ZA 1IM6A 4EYHB 1VBYA 4NA3A 4LFBF 4DL4A 2C2EA 3L95X 3CJSA 1Y5LB 1KBRA 4QR0A 4B3MJ 2V50A 3U7JA 1N33F 1MROB 1RXOB 1JLFB 2QC3A 2WSCC 3PACA 1NHVA 3R7BB 5GAGU 3PKYA 3SI8A 5J2NB 1U48A 5DG8A 4G3IA 4ZS6A 2X7IA 3MM7A 3QGHA 4O4GA 5IXUA 4IFVB 4KO0A 4DX7A 2DD8S 2BQRA 1UEUA 4FYXB 2HFZA 4JI8F 3G96A 3DFEA 1VK3A 1YKWA 5BYQA 4EBEA 1YQHA 4O0IA 3NGKA 4BC9A 2XMAA 2YY3A 3VGUA 1GXUA 1MN9A 2BJ3A 2ZD1B 2YVSA 3BYPA 2FVPA 4DR7J 4NASA 1HNZF 2UXCF 5DG7A 3BBCA 3HP6A 2WB4A 2XZDB 3AD9C 2FZGB 2RQKA 2HQDA 2XMUA 3OHBA 4QZVB 5KFZA 3LWLA 3Q0AA 4AQYF 3N28A 4AL5A 2QYCA 5LSOA 1HBUB 2GIQA 1YJNS 1RT7A 3OJUA 1N36J 3CJRA 2ATCB 3GJTB 3BBFA 4IO1A 4ANDA 1MU2B 5CQGA 3C6TB 5IWAJ 2VC1A 1TKDA 5K14B 2QLFB 2QV6A 1HWIA 3GJSB 3W5YA 2RILA 3EXCX 2KYZA 1WF1A 2J5AA 1RKIA 3DN9A 3OVSA 3OW2R 5F8LA 3PW7A 1N34F 3OFGA 2IRUA 3OPKA 1SC6A 3DU6A 1SH2A 1UWBB 4A46A 1OSCA 2RIJA 2PI5A 4ECWA 2GHPA 1OPZA 2ZITA 3OHAA 1DLOA 2RUSA 3I5CA 2YPYA 1R0AA 2A1BA 2F5GA 2Q3PA 3QWUA 5T7LA 3SXLA 4CO4A 2GJFA 4KC5A 4J9QA 1LWXA 2ASLA 4O0NA 5D0GA 3EYZA 3RU0A 1NB2A 2FJAB 1R7IA 1KQKA 4K8RA 2YKQA 4EI2A 1H2VZ 4OV6A 5GAEI 1UPPA 3ZC4A 1JLGA 3AHPA 2ZHBA 4J9NA 4RU9A 3HVWA 4NEZA 4DSEA 2BJ8A 4OZ1A 3BQ1A 5HJYA 3GR1A 1BQNA 4OZLA 4I2QA 2XMMA 2AW0A 3VGTA 2FVCA 1NRKA 2BJEA 4LQ9A 1QDUB 3DGVA 4Y2IA 3NGRA 3RZAA 4YR3A 3SV3A 2BXJA 2VQFJ 3A8JA 5SZTA 3GIMA 4IG3A 3DMJB 1FX4A 2M9KA 3FNNA 4M5GA 4PKDB 2HWTA 4HI1A 4CCHA 2FYXA 1SKRA 4DR4F 3ISNC 1Q5VA 1WORA 2PE8A 9RUBA 4FPIA 2OPSA 2D9PA 2PDAA 5GAGI 3SZ2A 1GT8A 3PFOA 4OX9J 4TVAB 2QL9B 4C3KA 5D4NA 3TQEA 4L73A 3WHIA 2IM3A 5EWGA 4K2JA 2WTFA 1I94J 4GKKF 3I0SA 2F1FA 3G4SS 4C48A 1RDRA 1HW8A 2CUYA 3GU0A 4URGA 4KBIA 3WIUA 3A1YG 3H0PA 3I0RA 1X4HA 3TEGA 1FWPA 3HSZA 3LH2S 4MYUA 4RX6A 3KLFA 3CF5Q 4QR1A 3L9ZA 1DZ5A 1VFJA 1HYSB 2BQ3A 4P71A 3M32B 2BJDA 1OY8A 2RE1A 4UTGA 1QE1A 1JLCB 2BE2B 3HVTB 2AEJA 1B3TA 2R3VA 1HA1A 1WDDA 4R5PB 3LWMA 1URNA 3G8QA 2HNYB 3DLGB 4NE9C 3RR8A 2CNLB 4UT4A 2R2RA 1NHUA 2KU7A 2YKNA 4EUVA 3K17A 1HI1A 2QLJB 3OFFA 3VVUA 2EFVA 4OI3A 4NEYA 5IT9U 4KHPJ 4RW8A 2DIVA 2DHXA 4K4WA 1GAOA 5IWAF 4KAIA 3BH6B 3ZTQA 1Y5NB 1BE4A 4A48A 4W98A 3CPWR 1U25A 4OHXA 4DF8A 4C8OA 4HR2A 4U7UK 1I5OB 1NJXA 1A7GE 1QAYA 2F3JA 2Z2YB 4NLYA 3M6UA 2C2DA 4DJBA 4EWTA 2V8GA 2G13A 4J9MA 2VPZB 3KJQB 3MD3A 4RW8B 3D1HA 5IC4B 4A8WA 4E8UA 3MEEA 3D1OA 3SCLE 4TXSA 5C25B 3UVJA 3THPA 4RW9A 2AX0A 1LQ9A 2YWHA 3K8VA 1HBMA 4ALZA 3OL7A 3KHLA 1BQMA 1VQPS 4DR3J 1Z2ZA 1FKAF 1S72S 1EAYC 1RTDA 5A8RA 2BW2A 2E1PA 2ZKUA 1U49A 3FCHA 2JSXA 4RNNA 2VICA 3W8PA 1XNRF 1SJ4P 4V19X 3M32A 1TU0B 4QU6A 1DQ9A 3RRHA 1NKCA 4QYZK 5HN0A 2XQCA 3OV7A 3R2DJ 4Z7CA 4B3TF 5K20B 2LXFA 1JKHB 4QYRA 5K8PA 3P45B 2XMTA 3DLGA 4KKOA 3M8PB 1RK8A 3HT0A 4Y2MA 5C7PA 2XBPA 3HHLC 3TQ1A 2KHDA 1KVKA 2MSSA 2M8HA 5EGYA 3JS9A 4U8VA 3KLHB 3SCIE 4F4ZA 2VD3A 3MPYA 1JQGA 1TL3B 4FF3A 4LFAF 1HNXJ 2CWXA 4MIWA 4OX9F 4CO2A 1B0TA 5KFWA 1HNWF 1LW2A 4K7QA 2R8JA 2KDOA 1UVJA 3BV8A 3D3CJ 2LMIA 4R0JA 2DKOB 1T3NA 2QX0A 4DLEA 3M8SA 1N5VA 4KV8B 1FX2A 4WFZA 1RWMB 2ZHOA 2RQ4A 2HW3A 1N54B 4I6WA 2VASA 3RRGA 3FFIB 3MUTP 1KQGB 2DHSA 4DDFA 2Y0SD 3I87A 5JJBA 2MQPA 2XM3A 3M8YA 1YRTA 5A8WB 3KXDA 2HBQB 2V5HG 5C25A 1OJ4A 4WU2A 3UVJB 2C2KB 2HRTA 5ETPA 3MAQA 3EDRB 1UJ4A 3M30A 4FBTA 2R7SA 1RWVB 2OKQA 2UP1A 4USKA 3G6XA 3NL0A 3W65A 5AJ3J 5G4DA 4XPEA 3NGUA 2ZHAA 2ERRA 1JK9B 1JJ4A 2OMOA 3HF5A 1DHMA 2V6AA 1FRMA 3TA1A 2XWYA 1N5YB 3MAAA 2Z57B 1WJ9A 1TKXA 1ZM4A 2HNDB 4EU0A 2ZM6J 4NOHA 2VHGA 2DRAA 3ILIA 1RISA 1VCTA 4OYIA 3ONQA 1JLAA 4YB6A 4DU7A 3AOBA 3KJNB 1SV5A 3ZFVA 4Y2CA 4RL1A 1FD2A 2RJZA 3TR5A 1Y7PA 4PABA 2NXNA 1CJVA 1NBEB 5EX3A 4WFAQ 3LAMA 3DGPA 3HHDA 1CPZA 1XN9A 3FUYA 4K4SA 2CAJA 1C0TB 1EKSA 3MXHP 3MAAB 1KONA 2ZBCA 3QT8A 5CYQA 1UW9A 1MW7A 2IC3A 1Y3JA 2RSQA 3K5MA 3BBBA 2ZWPA 4K2XA 1VQ8S 4NXNF 4ICLB 1VC5A 1RTJB 5AE3A 1MG7A 1HW9A 3DRXA 2KJWA 2B9XA 5HJXA 3ZTPA 2QYGA 2UVUA 2FZCB 2R8KA 3MAHA 1C1CB 1QD1A 2K8GA 2IBKA 2HNZB 3BGRB 2FD2A 4FNHA 4AQYJ 3PW0A 1WWHA 2IJFA 5JVGQ 1R27B 2BOPA 3I0RB 2XI3A 3QSYB 5C24A 1TMMA 2C2NA 3IMQJ 5KFHA 3T5JA 1B70B 3TJ9A 2DNPA 1FK9A 2VKRA 4IOBA 4YMEA 2HNYA 2MQOA 3AJ1A 3IG1A 1L3KA 1P8GA 3VAFA 3MECB 4QPTA 1QUVA 5J2MA 2HS4A 2JZ5A 4AE5A 1SL0A 3KG0A 4NCAA 5EWEA 1RLCL 2DNRA 2IRXA 4Q5VA 1O5JA 4DUZF 2UUWA 2FVSA 1ZZFA 1DBDA 2M52A 3C14A 5E3QA 2XY5A 4USVA 3ETOA 3IGVA 3ZNJ1 2KXFA 5D4OA 4TYAA 3C46A 1FXRA 5FIIA 5HMXA 2R7WA 2OAUA 3FK4A 5LMUJ 3PX4A 4LF6F 3UR0A 4A8FA 1EP4A 2NPIA 2CG4A 4EFAC 3WZ0A 2HQ3A 1A6LA 2F4VF 2VL1A 2JDJA 2XMJA 4XK8C 1NSPA 3SSRA 3G9CA 4M5LA 2BKPA 3DYAB 2W9BA 5KFXA 1JLBB 3EZUA 2JNJA 1U8WA 1WNEA 3WIVA 2VPXB 3GIKA 2IHR1 2GC8A 2D3ZA 2V2ZA 1YHQS 2ACYA 3FQKA 2HHVA 4LF7J 4PZVA 3UD3P 1WTFA 4ZPCA 4CZCA 4USMA 4PPZA 2XNRA 5KT3A 3RR7A 1LWEA 2DK2A 3KJVA 1VYAA 4NYOA 2DPJA 5M2PA 1Y0HA 2FY8A 1REGX 2PA8D 1IWGA 4HTJA 3HHKA 2RB7A 2Z4PA 5LM7E 1SC4B 3QATA 3Q8RB 2X1GA 2DNGA 3B4MA 5ETKA 3TP2A 3WBZA 2H1YA 3EUNA 1SVDA 3SQOP 1DJ0A 4A4JA 1ZYQA 2G4BA 1S0VA 2WONA 3CEDA 5AJ3F 4RW7A 4XAKA 3PIOQ 1X4AA 1FF2A 1KLMA 3FSIA 1PYOB 1WSVA 1X5OA 1TV6B 2QA2A 2W24A 3DHXA 4LSZB 4YDXA 2L48A 3I5BA 4WFNQ 1Q8BA 1KQFB 1S0OA 3R5CA 4UUXA 3H20A 1C1CA 4RUAA 4NLGA 5F9NA 4N56A 2VBZA 1WELA 3GPAA 3SMZA 3BSAA 1VHFA 3KK3A 1S48A 3G2XA 3K2YA 2C3OA 2WW8A 3TOQA 1NPPA 3W9JA 4Y28C 5GVQA 5HK4A 1RT3B 1H2UX 4NCGB 1FD8A 3DRSA 3KLIB 2W4PA 4I6YA 2CQGA 5FLXY 1C1BB 4DV7F 3MM9B 4BLGA 1Y3KA 2CDQA 5LSLA 8AT1B 4DL2A 1XC9A 2HVZA 3N6NA 2F63A 5DGAA 3MPUB 3N0VA 3N9UC 4DF4A 3NRBA 1NK0A 4B9LA 2YTCA 1QSYA 2B6AB 4DFPA 3T41A 1N5QA 2DGQA 3H5YA 3M05A 5HO4A 1F5AA 2GMHA 3MI7X 1T0TV 1N4LA 1UFKA 2QFJA 1FVSA 3BKTA 5HP1B 5L8RC 2EVZA 2AX1A 3OD2A 2AU0A 4JV5J 3MM8B 3VWSA 1B64A 1JLQA 1T03B 2HQIA 2ZJQQ 2RMLA 3NNHA 1UW4A 2W9BB 3T1HJ 3JTOA 2W7OA 1OIAA 2J7KA 4FS2A 3U1NA 4CLZA 1W2BR 4DSKA 3TZWA 2GZOA 2HS0A 4USUA 1PJ6A 1E6VB 3QO9B 2DIUA 2GIFA 2Q43A 3PRBA 2HSEB 2IBOA 4DUZJ 3QJJA 1RP5A 4NPOA 2DR6A 1RABB 1WC0A 4LRCA 5T41A 5KFGA 1LFWA 1F3FA 1PAUB 4ED2A 4K5SA 2VG5B 1YDLA 3KK2A 3HJVA 1NO8A 3KLEA 4OZ2A 2W8KA 1S1UA 2VJVA 1VJQA 5CHCB 2Y1JA 4FYVB 1KLNA 4NLWA 2EFQA 4G1QA 4L6V3 1RWPB 5IT0A 3C16B 3CCZA 2IYIA 2WONB 1CC7A 1S6QA 4PXCA 4ID5B 2K7KA 3HHLB 4DCJB 2NCKL 3DKDA 4HDHA 4J9LA 4DR4J 3GV7B 1FJGF 3MURP 1I3OB 1U1OA 3KLIA 3R8YA 2HHQA 4YN3B 2E5LF 1X4EA 2DEJA 1S6OA 2OIHA 2FLOA 1IBCB 4CLFA 4ZOSA 2UXBF 1SBRA 3GFHA 3VZIA 2JEJA 3LGNA 2DNLA 3TWZA 1TL4A 1UWAA 3MCSA 1VQ9S 3P6YC 1B7FA 3VGVA 2F9JA 2MTLA 4FBUA 4K50A 1P9YA 1BD6A 2KT2A 4C2MA 3TUJC 3J81Y 1M5PC 4RW6A 1Y5IB 2C3MA 1T7PA 5HP1A 3CO0P 1U02A 2B4OA 3KOAA 4F4KA 1NH8A 3M2VA 5A8KB 3MZIA 4J9KA 1RHJB 1XMQF 2OO4A 2VZ9A 1H7XA 5B7WA 2M7SA 4CTAB 5LOQA 3BDPA 1PO6A 1SV5B 2O5DA 4RU2A 1R6YA 3EVMA 1Q16B 3P5TL 3HHNB 3UFCX 5J1NA 1FE0A 2EWHA
chains in the Genus database with same CATH topology
3VTIA 4JV5F 2LQBA 4DWIA 2RU3A 3OJSA 2JLFA 1S1VB 5LJ5Y 4BCAA 5JUMA 2ZOFA 1Z1ZA 2QMWA 1GXTA 1WEYA 2C3PA 2YNHB 4PG7A 4EGLA 2VOOA 3FSXA 4C98A 4JI4F 1S6PA 3CD0A 1HMVB 2JVOA 2WHOA 2ZOMA 1T02A 5HBMB 3JB9k 1JJ2R 3HZGA 2E5IA 1M5KC 3S01A 3IRWP 4ED6A 1O0PA 3CCLS 2XSJB 3K5NA 4PPDA 4DL3A 3T6BA 4Y00A 4PQUA 3GFXA 4NZ0A 5L39A 1YRUA 4IR1A 4KV8A 2B51A 2QSWA 2GIRA 3L7PA 4J9RA 3E51A 3CJKA 3KJVB 2X1FA 4MFBB 3MUVP 3TX8A 1AXQA 3D54A 4O3OA 1IR0A 4IYQA 2QRRA 4ECTA 1IKWA 1Q78A 5D4LA 4X4TA 2YX1A 3PM9A 2Y1IA 2ASJA 2RT3A 3D28A 1JLBA 4R8UA 1VIXA 1Q8IA 2B0GA 1N6QB 1CSJA 1HWKA 3TI0A 1RT4A 2CPZA 3DLEB 2V8HA 3CDEA 4HHJA 3UR3C 4TU8A 4OI6A 2KN4A 2PEHA 2ZH7A 2AJ1A 1LV5A 5J2PB 2XNQA 3T5KA 1HHTP 2E1MC 4WE1A 3UI3A 1H38A 3I4PA 3R3TA 4M8LA 3DLLQ 3MGJA 4PWUA 4CNYA 3VCDA 3H2UB 3GYNA 2FLNA 4JV1A 1KOHA 1PILA 3O2IA 4ES2A 5U47A 1MMDA 3OVBA 4ZMMA 3M2UB 5LMUF 4JI5F 4CT8A 1JLQB 2EFOA 1WG4A 3MTKA 2XULA 5HLFB 4IRDA 3MM7B 3LP0A 2MJNA 1Q86T 3CJ4A 3C66A 4NLVA 3M9OB 2XY6A 4DR7F 1LK7A 2M0GB 2UZAA 3KYLA 1ROFA 3TUZC 2GJ2A 1WACA 4NA1A 1N48A 2V4JB 3J7A1 3M8PA 5K8MA 3CIMA 4WU3A 2DCLA 2FDNA 4OV1A 4QBUA 5K8OA 1S6QB 3T1HF 1E6YB 2JC1A 4KRWA 2L9WA 1TKZB 1T94A 4BWJA 2P6TA 3KKFA 4H4KC 2IJNA 3PR5B 3GR0A 2HNDA 3GG0A 4I1TA 5E3PA 2H9ZA 4Q45A 4ED3A 1QSSA 1K0TA 1JXEA 3LO3A 3SQGB 4KHMA 1IKYB 5GAHU 4B3SF 3JYTA 2XS2A 2EFNA 4PG5A 1HQEB 2GA7A 4FN5A 4F02A 5GAHI 3ICLA 1SH0A 1SQEA 3U02A 1D1UA 3GQCA 1HPZB 1DTTB 3DLKA 3TANA 3OFHA 2LEBA 2DH9A 2D74B 5KAKA 1HNIA 2V0NA 2COLA 5EX0A 2MJUA 3DDKA 3H4BA 3CUNA 2HGMA 1U6ZA 4PUOB 1SXLA 4R25A 5GADI 2HHPA 4YEAA 4OMFG 4P7TA 3K7RA 3VQSA 1YJTA 2B4PA 1TUVA 2AJ0A 3AQPA 1RT2A 3BN7A 2AQ4A 5KFJA 3L09A 1HNIB 5D78A 5FDLB 1LOUA 3TO8A 4QWBA 3NCQA 1WG1A 4ILLA 4XDDA 1S6PB 4KFBA 3GE9A 2FGOA 3PZPA 2QO3A 1S97A 2MQQA 1HQUA 4LF5F 1BQXA 2DNNA 2NYIA 1UEVA 2IC3B 1VJWA 4Y0FA 4OLPA 3BZQA 4QWAA 3I56S 1Q7YT 3A8EA 2UUAF