1TL1B

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 114
structure length 400
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B03
2J6TA 4IQXA 5KG4A 3FDSA 2JLEA 4I2PA 4TLRA 1JLGA 4LSNB 2FLPA 5C24B 5HROB 4PWDB 2R8KA 3KNAA 1IKYA 4Q0BA 3DLKA 3H98A 4O44B 2OH2A 4M95A 1REVB 4G3IA 3H40A 2HWIA 3PW2A 2VG5A 2BRLA 4YR2A 3OL8A 3TVKA 2XI3A 3KLIB 4FBUA 3MEDA 3HKWA 4MIBA 3RB6A 2YNGB 3Q8PB 3EZUA 1EP4A 1LWCA 3KHGA 3GIKA 1EETA 2VG6B 2AU0A 2OPQB 1JLAA 3FQLA 2RDIA 3D28A 4J9RA 1T94A 3MECA 5KFDA 4IR9A 2YNIA 4URQU 3DRRB 2BRKA 5KFNA 3DMJB 3Q8SB 3C6UB 5KT7A 2V4RA 5F8JA 3QIDA 4IG0B 2W9CA 4NYZA 4F50A 3NAHA 4QW8A 2FJXA 3I0RB 4IDKA 4LSLA 4IFVB 5KG7A 3GV5B 2RKIB 2YKMA 4KFBB 2YNHA 1S1UB 3N6NA 1N4LA 1TKTB 1R0AA 2DPJA 1RT5A 5T14A 5L1KA 4MK8A 4LQ9A 4RW8B 2I5JB 2RKIA 2YKMB 3G6VA 2VG7B 3E51A 3KMSA 3M9NB 3ISND 1JLEA 2W9BB 2AX0A 4QWBA 3G6YA 3PHEA 3CDUA 4TQRA 2R8IA 1HPZB 1T05B 3PW0A 4IRKA 1HQEA 5DQIA 2XCPA 3UR0A 4ZHRB 1DLOB 5EWEA 2ZD1B 1TKXA 3MR6A 1S1WB 5C24A 4RW8A 3OSNA 4YP3A 3RAXA 4EYIB 1RT3A 1RT6A 5KT4A 1EETB 2VG6A 1C1CB 1HMVA 1RTHA 1YVFA 1HPZA 4NZ0A 2R2TA 4KFBA 4RNMA 4ED7A 3NKYA 3KLEA 4Q45A 1T03A 4Y2AA 2RDJA 1FKPA 1FKOA 3KLIA 3UQSA 1S6QA 4KKOB 1N5YA 4NLQA 3QLHA 3IGVA 4ECYA 2J6UA 4TY8B 4ZPAA 3OL7A 2FVSA 2ZE2A 2R2UA 4ECUA 2YNFA 4ED8A 3MTKA 4HYKA 1C0TA 1S9GA 4KAIA 4NLWA 5F8IA 5KG1A 1IKVA 2AGQA 2XCAA 3H4BA 3OSPA 2IM0A 1S6QB 4KKOA 4ID5B 1N5YB 4URGA 3OL9A 3KLFA 5DQGA 2YKNB 1HNVA 4NLPA 2OPSB 4R5PA 2JC1A 3SI8A 2FJWA 1TL3A 3NAIA 2YNFB 4TYBA 3H5YA 5KG2A 4K4YA 1JLQA 1C0UA 3GYNA 1S6PA 3OHBA 1TL1A 2VA2A 2QE5A 3CVKA 2AGPA 1HNVB 2OPPB 1KLMA 1BQNB 1VRUA 2OPRB 1RT7A 5KG5A 4ID5A 5I3UA 4YR0A 1S9EA 3DYAB 4ZMMA 4YMEA 1JKHB 1RTDB 3PVXA 4Y34A 1KLMB 4ZPDA 3E01A 5F8HA 4NLSA 1S1WA 5DQHA 3KLHA 4GC6A 5F8MA 3CIZA 3MEEB 5KFGA 3V6JA 5CYMA 4Y3CA 2W7OA 3G6XA 1TVRA 3GIMA 1RTJA 4NLYA 3V81B 2V4QA 1LW2A 4NCGA 4ZPCA 2F8EX 3DI6A 1K1SA 2AX1A 4URSA 5KFLA 1JKHA 1RTDA 3LANA 2ILYA 4DL5A 1RYRA 3CDEA 5K14B 3CJ3A 1HNIB 1RT4B 3FFIB 5KFXA 1QAIA 3T5KA 3QYYA 4XPEA 2B5JB 4LSNA 1LWEB 4RW6B 4FS2A 2ATLA 2HNYB 2ASJA 3MEGA 4RW7A 1W25A 4ECVA 2V9WA 4MIAA 4IFYB 4MFBB 1SV5B 1DTQB 3T1AA 5KT3A 3BQ2A 5KFWA 3DOLB 3CJ5A 5J2PA 4WZQA 1RTIB 1JLFB 5EUHA 3MEDB 5DG7A 3PZPA 2BQUA 5KT6A 3H5UA 4K4ZA 3V81A 1UWBB 4J9PA 4RNNA 4RU9A 5DGBA 3DLEB 5C42B 1C1CA 1RTHB 4R8UA 1DTTB 1VRTA 3QO9B 1JLQB 3C6TA 1JLCA 3QIPA 5JUMA 3ISNC 1S1XB 3HVTB 2EC0A 4G1QA 5I42B 4JV1A 3I5AA 4RW4B 3IRXA 2D3UA 2HNZB 3DRSA 1ZTTA 1RTIA 1U09A 2WCXA 4O3PA 4U6PA 3ICLA 3KHLA 4IRCA 5KFVA 3QLHB 1QAJA 3BQ0A 5D3GB 3DMJA 1N56A 3DM2A 2ZKUA 4MFBA 1S97A 4FS1A 4I2QA 5HROA 4K4XA 5KFEA 1JX4A 3FRZA 4K50A 3CDWA 1LW0A 4IH6A 5J2QB 4Q8EA 3I5CA 1S0NA 3ITHA 1OS5A 2AWZA 4ECQA 4H54A 2WB4A 2YNHB 3M8PB 1RDRA 4JV0A 4EBEA 1MU2A 3I0SA 2B6AA 1IM4A 1NHUA 4ED1A 1ZETA 2C2EA 1D0EA 5F9LA 1REVA 2ASDA 2GIQA 4QPXA 3PW7A 3V6HA 3MR5A 2JEFA 2FJVA 4MH8A 1SH2A 1RT6B 1TKXB 1K1QA 1LWEA 4RW6A 4QWAA 1C0UB 2WOMA 1HYSB 1RYSA 3OL6A 4ZP9A 3BSOA 4ED3A 2JEJA 3LP2A 3DM2B 3PW4A 1HQEB 5KFIA 3KOAA 2HAIA 4IFVA 3EPGA 3G86A 1LWFB 3LAMA 2V0NA 4G1QB 3KHRA 3NMAA 3H4DA 4IG0A 4NLRA 4NRUA 4KBIA 4WFYA 1TVRB 5HBMB 4R0EA 1VRTB 3PR5B 2W7PA 5DG9A 4NLOA 3JYTB 2I1RA 4I2PB 3QZ7A 3M9MB 3KK2B 2HNDB 2GC8A 2JEIA 3IG1B 3LP0A 1WNEA 1SUQB 2QV6A 4ZP6A 3MR3A 4EO6A 3LP2B 2VG5B 2WONB 3MEGB 4RW7B 3EPIA 2R8GA 1RT1A 1GX5A 3CJ4A 4ZPBA 2B5JA 1LW0B 2UUTA 5KG0A 4NLGA 3H5XA 2VA3A 2XWYA 3QGGA 1S1UA 4IOBA 1KHWA 4B3OB 4WYWA 3GIIA 1SUQA 1S9EB 4ZVHA 3DOKA 3KLEB 3V6KA 2ALZA 2W9BA 5L9XA 2OPRA 1BQNA 4QWDA 1N48A 3GQCA 5CYMB 4ECWA 1RA6A 5EWGA 2W8LA 3KLHB 5FDLB 1TV6A 1S1VB 5C25B 5KFOA 3GV8B 2R8HA 4J9LA 2UUWA 4ZHRA 4DL4A 1TKTA 1R0AB 1I6JA 3RB0A 1HQUB 4NLDA 2IBKA 2YNGA 4WXOA 4YR3A 1Z4UA 1S9FA 3TAMB 2FVQA 4H4OB 4O4GA 2C22A 1ZTWA 4PQUA 4NLUA 1KHVA 3M9OB 5KFAA 3QGIA 3M8QB 3KK2A 3V4IB 1C2PA 3H59A 3QGHA 3I5BA 1IKWA 1C1BA 5CYQA 5J2QA 4DEZA 3GIJA 1S0MA 4LQ3A 3CJ0A 2IM1A 4J9QA 2BR0A 2HMIA 1FK9A 3JYTA 2HNYA 5KFTA 4Q8FA 1JLAB 3MFIA 2WTFA 1JLFA 4RZRA 3I0RA 4IDKB 4LSLB 5J1EB 3V6DB 4MK7A 3KLVA 3KJVA 1QUVA 3D5MA 5JXSA 3NGDA 3DLGA 4H4MA 3RAQA 4JV2A 4B3OA 3DRPA 4I7FB 3MR2A 5KFYA 2I5JA 2XC9A 5KG6A 1IKYB 3LALA 4R8UB 1RTJB 4J9MA 3IN5A 2FVRA 3KK3A 4RNFA 3UPFA 4ECRA 1TL3B 2IJNA 2D7SA 4TY9A 1IKXB 1LWFA 3E01B 3VQSA 5KFQA 4IH7A 4QWCA 4TXSA 5C5JA 3KLGB 2AGOA 2IA6A 1S1TA 5KFSA 2UVWA 3DOKB 1LW2B 4NCGB 1TKZB 4F4ZA 1RT7B 1JLEB 3GILA 5I3UB 1RT3B 3BR9A 2YNIB 4PUOB 4RNHA 5FDLA 5F8LA 3T5LA 3BGRA 3NBPB 4MKAA 2FVPA 3BJYA 2CKWA 5KFCA 5EWFA 4F4WA 5KFZA 4O3NA 3TAMA 4GC7A 4KO0B 4DG1A 3IG1A 1VRUB 5J2NB 2IC3A 4IKAA 4F4XA 4X2BA 5J1EA 4WE1A 3V6DA 1SH3A 3M8PA 2C2DA 3DLKB 3NL0A 1DTQA 5L1JA 2FVCA 4PWDA 1S9GB 3BGRB 3NBPA 3N6MA 2HMIB 4TYAA 3LP1B 1N6QB 3BQ1A 4K4WA 1J5OB 5KFBA 1DTTA 3QO9A 2RF2B 4IH5A 4J9OA 4MK9A 5HP1A 1EP4B 3HHKA 2AQ4A 1GX6A 3KJVB 4KO0A 4DG1B 5EDWA 4ZP8A 4EEYA 4WZMA 5I42A 2WHOA 1JLBA 1S1XA 2XGPA 5J2MB 1JXLA 5J2PB 3DRRA 3JSMA 1TL1B 5KT2A 1TV6B 5C25A 3IS9A 2W8KA 1UWBA 2XI2A 4ED0A 4IG3B 2DPIA 4DL6A 3UDLA 1XR6A 4WE1B 5KFFA 5J2MA 4PUOA 3Q8RB 4KV8B 4KHMA 4TN2A 3Q8QB 2BQ3A 2WRMA 3HVWA 3T5HA 1T05A 4F4YA 1XR7A 2ILZA 3RB4A 4O3QA 4FBTA 2HNDA 1QE1B 1SV5A 3FQKA 3IRXB 2RF2A 2FLNA 3DDKA 4ED2A 3MFHA 4K4UA 4Y2CA 4XO0A 4ZVEA 3MF5A 5F9NA 2W9AA 3H5SA 3CWJA 4WFZA 4JUZA 4EBCA 4ECZA 3T5JA 3JSMB 2WK4A 4H4MB 3IGNA 3TQ1A 2YKNA 2ASLA 4I7FA 2IMWP 1RT2B 3KK1A 5DG8A 3HVAA 4J9SA 3DLGB 1MU2B 3I0SB 4NLXA 2HNZA 3DRSB 1HMVB 3FSIA 2D41A 3PJXA 1HARA 2BANB 2BE2A 3RB3A 1N6QA 1DLOA 3MECB 3PR4A 1T3NA 2OPQA 4DL3A 5HBMA 2JC0A 4TY8A 1TKZA 4WFXA 5KT5A 3LP0B 4PQUB 2R2RA 1S1TB 2IAJA 4M94A 3C6UA 1JLBB 4RUCA 2C2RA 4O3SA 3SFUA 2B6AB 4Q43A 1FKOB 3DOLA 1HQUA 1RA7A 4RNOA 1S6PB 4EO8A 1FK9B 1JLCB 3PJWA 1RT5B 3BSNA 1C0TB 4RW9B 3QZ8A 4DL7A 3RBEA 2CJQA 4NLTA 2E9TA 3H2LA 2FLLA 3OLBA 3RBDA 3M8QA 3V4IA 4KB7A 3KHHA 1JLGB 2WONA 4HKQA 2OPSA 4R5PB 4Q44A 3BSCA 5D3GA 5KFJA 4ZVFA 2UVRA 1D1UA 1JIHA 3CO9A 2IM3A 1QE1A 1IKVB 4O44A 5J2NA 4QW9A 4RW4A 5KFRA 4O3OA 5HLFB 3CJ2A 2J6SA 5DLFA 2OPPA 3LP1A 1S1VA 2D3ZA 3ITHB 3BSAA 4WXWA 3PW5A 2E9RX 1S48A 2IJFA 3KK3B 5L1IA 4K4VA 2BQRA 5K14A 4H4OA 4O4GB 4DL2A 1FKPB 4KSEB 1TP7A 1S49A 1T03B 4U7CA 4J9NA 1SH0A 2B43A 5DGAA 4K4TA 5KFHA 3QIPB 5KFUA 4QWEA 2GIRA 3IS9B 4IRDA 5KFPA 2ZE2B 2O5DA 4ECSA 4NRTA 5KFMA 5HLFA 1S10A 1HNIA 1RT4A 1C1BB 3FFIA 5CYQB 2XGQA 4TQSA 2JEGA 5F8NA 1BQMB 2IM2A 3KLFB 1XR5A 2VG7A 1CSJA 5KG3A 4KE5A 4ICLA 3BREA 4O3RA 5KFKA 4K4SA 3LAKA 1J5OA 4RW9A 1MMLA 1S0OA 4NLVA 5DLGA 4ZVGA 1S4FA 2ZD1A 3DRPB 4MKBA 3GV7B 4KHRA 3SFGA 3KMQA 4EYHB 1BQMA 2C28A 3DYAA 3OHAA 1RT2A 3KK1B 4RUAA 2W9CB 3KLGA 4WYLA 4YQWA 4ECTA 5HP1B 4OL8A 3HVTA 1IKXA 4IR1A 2WOMB 1HYSA 1RAJA 3C6TB 4IG3A 2E9ZA 4O4RA 2BANA 2BE2B 3MEEA 1IKWB 3DLEA 5C42A 2HWHA 4XPCA 1RT1B 4ICLB 4EBDA 1NNDA 3OLAA 4ECXA 1LWCB 2R8JA 4I2QB 2IC3B 3T19A 3DI6B 4J9KA 1TQLA 2IAJB 2UVUA 1NHVA 3N6LA 4ED6A 2UVVA 2R2SA 5L1LA 4Q0BB 4ZP7A 4KV8A 4IFYA 5F8GA
chains in the Genus database with same CATH superfamily
1ZPVA 4DQPA 3EYZA 3FDSA 1Q8IA 2FLPA 4TLRA 4U9RA 1DHMA 2DH7A 4JI8J 4LF6J 1RAIB 2CG8A 4XDCA 2R8KA 1FFSB 4PG5A 1IKYA 2ZOFA 4Q0BA 3AT1B 4HHUA 4M63A 4NL5A 4N5SA 1T9TA 2Z2ZA 4KH0B 3OVSA 4M95A 1FD8A 1GK8A 3PW2A 2HWIA 2HFSA 2KZZA 1HIYA 4FBUA 2XI3A 3GFZA 2V8PA 2QRRA 1YRUA 2JHEA 4LJMA 4C8NA 1TK0A 4ETZA 4C8OA 4QPTA 3EZUA 1EP4A 1LWCA 4NA1A 1RKJA 1EETA 2OPQB 2LA6A 2FHOB 3LTOA 1JNRB 4ZLJA 2XO7A 1PGZA 3OFFA 4PXCA 4C8KA 1T94A 2PFDA 1VGYA 4IR9A 1T9WA 3IR6B 2R7SA 1U49A 3C6UB 2V4RA 2E1MC 3MAAA 4USWA 5DM6Q 3THVA 4OZ5A 5D0RA 1UA0A 5F8JA 4ZIWA 3H8YA 2YX1A 3NAHA 2YPYA 3VCDA 1AFIA 4IDKA 3FBBA 5HN0A 2JH3A 3AODA 3D6FB 3A8KA 5B7WA 2YNHA 4I68A 3N6NA 2K3IA 5D77A 1TKTB 4CLUA 1RT5A 5L1KA 2YKPA 4LQ9A 4MK8A 4RW8B 2U2FA 5DRKA 5AE2A 1VBZA 2I5JB 3LGHA 3TZZA 4FKXA 1SCJB 4QCLA 5B08A 2HVEA 4A48A 1N88A 2C1EB 1SJFA 1JLEA 4DQIA 5I3QA 1X60A 1R7IA 1F2GA 3CB4A 4QWBA 3G6YA 1I5OB 3AQPA 3HX9A 3K2YA 2QL5B 4L75A 5EX3A 5HK4A 2R8IA 1VQSA 2KI2A 1HQEA 1CJTB 2XCPA 2VDHA 5EWEA 1NCLA 2VIHA 2ZD1B 1UPMB 5D0HA 2HAFA 4USIA 2IIHA 4WJBA 3OSNA 1PYSB 3RAXA 4EYIB 3OR2A 3TX0A 1EETB 2M9KA 4I6YA 2B8QA 2W2MP 4LR7A 4C0BA 3R1LA 1R31A 1X5SA 1N32F 3KLEA 4Q45A 2RDJA 4ITSA 4C8MA 3C16B 3IGVA 1HI0P 2J6UA 2RIJA 4J37A 4M5KA 3OL7A 2GGPA 2FVSA 1WG1A 4YB6A 3W1YC 2YNFA 5A2QY 2Z0GA 2CZ4A 4HYKA 3OSPA 4M5JA 2NXCA 4NLWA 2CJBA 2E66A 2MKSA 3DRXA 3HDSA 3WIVA 5C2CA 2AGQA 2OKQA 4USHA 2OUGA 4KKOA 1N5YB 4ID5B 4C9DA 2UUBJ 1Y5NB 2X3GA 4DR5J 4KHPJ 1HNVA 4NLPA 3KYLA 1R27B 1HBUA 3SI8A 4O0IA 2M3DA 2PD1A 2DYAA 4ZITA 2V2VA 3H5YA 1KNZA 5DZ7A 2CNKB 1C0UA 3OHBA 1VJWA 2QE5A 4GKKF 1UJ5A 1UL3A 4JYAF 2K1RB 2OPRB 3AOAA 1ELOA 2NLWA 3PCOB 4CQ1A 4TVAB 3HHEA 4DN9A 1S9EA 1M1HA 3AXKA 4PXDA 4YMEA 2IVMA 4ZMMA 1JKHB 3PVXA 4Y34A 1HI8A 2OAUA 2GMJA 1KRPA 5DQHA 4GC6A 3RU0A 1WTFA 3CIZA 1T9YA 1KTQA 5F8MA 4Y3CA 4DPYA 1P9YA 2W7OA 2VFRA 2AJ4A 3TEHB 4RX6A 3NY0A 1DQ8A 4P6QA 2HKEA 4KRWA 1RYRA 2XMMA 3S8SA 3R2CJ 1JXVA 2PMZD 2WVDA 1UFLA 3VV2B 1HNIB 1RT4B 4OZ1A 3HMJG 3ENAA 3GFXA 3BKFA 3TJAA 5ETSA 4XPEA 2B3TB 1AT1B 4OI2A 2ATLA 2YX4A 3H0PA 4M5DA 3MEGA 4EWTA 1W25A 2FTRA 2PO4A 4DS5A 4NCBA 4MFBB 2CFXA 2HK2A 2KB2A 1FDAA 2XMWA 1DTQB 4LBIA 4YEAA 1PIEA 5KFWA 3US5A 1H0HB 3KG0A 4DV7F 1RTIB 5D78A 2GCFA 3MEDB 2KXHA 3Q86A 3PZPA 1ZH5A 2A10A 5KFNA 5KT6A 2VONA 4B3MF 2YQ3A 3M2RA 3TOQA 5ETKA 4J9PA 4RU9A 1DFDA 1RHKB 3J7YU 3VAHA 3QO9B 3C15A 2DGSA 3S1TA 1RBLA 3R6LB 3W5ZA 1RUSA 3NGKA 4KYZA 1JLCA 3D7SB 4ES3A 1Y11A 2ZH7A 4G1QA 5GAHU 2VUGA 2HBRB 5LL6d 2HNZB 2KDOA 1ZTTA 2UP1A 2G1HA 2C2ZB 2V2QA 4LRDA 2QX0A 4WP3A 1E6YA 2PIIA 4ES1A 2MHEA 2RNEA 3MM5B 3TA0A 1N56A 4MFBA 4ZJQA 3CULA 1Z2ZA 3D4JA 3IBWA 4DR5F 4DCJB 2HSEB 4YHHF 5KFEA 2X1AA 2HFUA 3B6BA 4LBPA 2QZ8A 1U0HB 2YTCA 4IH6A 2IBOA 3MWBA 5HATA 4ELVA 4Q8EA 1S0NA 3R5GA 2AJ0A 4G65A 3OTBA 4BLGA 1VK8A 1QDUB 4C7QA 3M8PB 2GMHA 1RWNB 3D1HA 1MU2A 4EBEA 2B6AA 1GXUA 2FHJA 2VFSA 3CCJS 1VHFA 2C42A 4B17A 1E6VB 2C2EA 3VVTA 2M8DB 1REVA 2NREA 1XERA 4QPXA 2J9EA 3PW7A 3IR5B 2D9OA 1SL0A 5ETVA 2MZQA 2FJVA 1ZM3A 1FX4A 2BJ7A 3UCGA 4NXMF 4CLSA 4W90B 1GMUA 1RT6B 2LDIA 5D0GA 1WEXA 1K9MT 1K1QA 1Q7LB 2E5LJ 3CF5Q 3WBZA 4B3MJ 2GHPA 1UEVA 1MWZA 3BSOA 4ED3A 1BWVA 2JEJA 4N76A 4DBQA 1HQEB 1CJTA 1DY3A 4GKJJ 1RAEB 4OJ1A 5FLXY 1VQ7S 3NNHA 3KOAA 3BH7B 3TVYA 2ZNYA 3AD7C 4J9UE 2KH9A 1D9DA 4OHVA 4ANDA 3SCLE 3KHRA 2V0NA 1WC6A 1CEZA 4OHZA 2LQ9A 3ZZUA 2LKZA 3CTRA 1WHXA 3VAIA 3PIPQ 1TVRB 1FNMA 4R0EA 4PEOA 2W7PA 2WZ1A 4K5RA 1UJ6A 2AHOB 3TX8A 4NLOA 1NEEA 3JYTB 2NZCA 2WVFA 5DG9A 1SC1B 2ADBA 2I1RA 5D4LA 1VBKA 3CCZA 3EGVA 8AT1B 3QZ7A 3QRQA 1T9UA 3M9MB 1GMWA 2DHGA 2FZGB 2BKNA 3FEYB 2HNDB 3CJQA 2M0GB 2JLFA 4EO6A 3G96A 1WG4A 2EFNA 2F4FA 4LF4J 2DRAA 4AUKA 2GV1A 2LXUA 3J80U 4TU7A 3OR1B 2R8GA 1RT1A 3CJ4A 4L74A 4X4OA 3OTOF 2UUTA 2OMLA 2W4CA 5M2RA 3RAMA 1U48A 1Q86T 2UUCF 3DC2A 1T11A 3H25A 3NCQA 1S7HA 3M8SA 2EKYA 1CJKA 4J91A 1AA1B 1RAFB 5L38A 1SUQA 3R6GB 4IYQA 4CNZA 3KLEB 3V6KA 5BYSA 4LFBJ 1RAOA 1IQTA 2OPRA 1M5OC 2G0JA 3GQCA 2WBMA 3Q2SC 5EWGA 2FGCA 4UOHA 2W8LA 4OLOA 5CA5A 3TVZA 1QVGR 3GFHA 4DL4A 2DHAA 2OTLS 1SIZA 3RB0A 1HQUB 5M2UA 4GKKJ 2IBKA 2X1GA 3N01A 2RD5C 2YNGA 1WUUA 4KIAA 4MKYA 3VALA 2GHVC 1S9FA 2FVQA 1N5VA 2RSQA 4LF7F 4MYUA 4NLUA 2XNQA 3D6MB 5KFAA 4DUTA 5HVGA 3M9OB 1BC6A 1WWHA 2V4JB 1NK9A 2DTJA 1KSPA 3R8YA 3U1LA 3GIJA 5J2QA 2YXLA 1UVNA 2Z57B 5GAGI 3CJ0A 1D9FA 2IM1A 2KL8A 2HFZA 1FK9A 1JJCB 2Z30B 3AOBA 4CT8A 2MZ1A 1NJYA 2F1FA 2R7QA 1JLAB 3VF0B 4MYTA 3MUVP 2WTFA 1I51B 4FDFA 5D0EA 4B9UA 4LSLB 3V6DB 5GAHI 1CQNA 1RWVB 3HJVA 4GKJF 3EDRB 1OY6A 3JSBA 4ATNA 3RAQA 3M8YA 2VQFF 4JV2A 3MCMA 4C48A 2KT5A 2KFYA 2XC9A 4FZVA 3WIUA 1VQ8S 2OFGX 1RTJB 3MMCA 4RNFA 1NDLA 4W98A 4ECRA 2IJNA 2D7SA 2V4JA 2FYXA 4LFCF 5IOLA 1LWFA 1FVQA 3C14B 5L39A 2FHJD 1S1TA 5KFSA 3D1OA 3DOKB 5D8HB 3MM6B 3ZZTA 1SKWA 1JLEB 1UVMA 2QL7B 2ZH1A 3Q23A 4FYWB 3A8EA 4DHVA 3T5LA 3SV3A 3BGRA 1FD2A 4KT0C 3M2VB 4Y65A 5LXYA 5IWAF 1NJZA 2FVPA 1UWAA 2RS8A 2YWWA 1X31C 1XBWA 1F2HA 1KN6A 3MM7A 5EWFA 3EGZA 3FC9A 2MKKA 1NRKA 5KFZA 4RL1A 1R8HA 2W2PP 3UNGC 5EHHA 2WAQD 3TAMA 5J2NB 1AB8A 2IYGA 2VBWA 3M8ZA 4O23A 3MM9B 3QSYB 1NB2A 1U24A 2HIYA 2SXLA 1RACB 2C2DA 4DI6A 3DLKB 3HLUA 2CXEA 1EHWA 4AL5A 1S9GB 5LMNJ 3D3BJ 3M05A 2CDQA 4K4WA 1RTZA 1DTTA 4CO1A 2RF2B 4J9OA 2HEKA 3P4UB 4MK9A 5HP1A 3FUYA 1PYOB 5IZHA 1IBKJ 3W9HA 1GMWD 2AQ4A 5HQLA 1GX6A 3W3SA 2DB1A 3OTCA 2ZOGA 4RBUA 1SJQA 3BS9A 1WOSA 2EK6A 1HWJA 2IRYA 2AIRB 3AB4B 3IXQA 3M6WA 1GTHA 3MHYA 3R27A 4NMXA 4LFAJ 5J2MB 3W2VB 4F4AA 1NK7A 3FBEA 3L95X 3JSMA 1TL1B 4OMFG 7FD1A 3FRYA 1YK9A 5CZXA 2XLKA 1TV6B 5C25A 1G4CA 2JRSA 1UWBA 4IOCQ 1U25A 4DL6A 2Z2MA 3UDLA 4WE1B 2VKRA 3AJ1A 5J2MA 4NXNJ 5JVGQ 4KV8B 2GVDA 2ZHAA 1DAXA 3ETOA 3NWRA 5A8WA 4F4YA 3T5HA 1F3FA 3S01A 3RB4A 2AYBA 4RBTA 1RHRB 2OELA 1U8SA 3MAAB 4OX7A 4P52A 3BDEA 5AXNA 1VQMS 1YJTA 1JJHA 2AJ2A 1J5EF 2RF2A 2A6OA 1VS3A 4OZ3A 4K4UA 2AV5A 2LA4A 4Y2CA 4DPUA 4FYYB 4XO0A 2OEKA 4ANEA 4A8OA 2CNLB 4HLBA 2W9AA 3H5SA 5E5NA 1VMBA 5GMKa 1PAEX 4WFZA 2LQJA 5E2QA 3R7NB 5L8RC 3JSMB 4EBCA 4ECZA 3KUGA 3NNAA 2ASLA 1XMQF 2YKNA 4X66J 4I7FA 4I56A 1TFYA 2V68A 1IR0A 1HHQA 1MU2B 2HNZA 2M2BA 3DHXA 1Q95G 3R1HA 1NPPA 3KXDA 2B0GA 4F0MA 2VHGA 1SQFA 4DXLA 1U26A 1DLOA 1ULRA 2W25A 2OPQA 3WQPA 1T9VA 2DGWA 1Q8BA 4BWMA 4F7VA 2OSQA 1X0FA 2HQGA 4DR6F 4PWUA 4CTAB 2DNPA 3DDNA 4CO3A 5T7LA 2CPIA 4F3OA 4DCPB 4M94A 3C6UA 4RUCA 4O3SA 4FKYA 2C2RA 2B6AB 3PTWA 5GADU 1HQUA 2M4MA 1G1XA 3ZZPA 4ZLPA 4ZLLA 1RB0A 1UTAA 1EX8A 2O67A 2QG9B 4QZVB 3PJWA 4K2XA 3BSNA 1AW0A 1C0TB 3MM8A 3QZ8A 2AP6A 3GYXB 4DL7A 2CJQA 2CJXB 4XDDA 1NAQA 3OLBA 3JXOA 1ZM9A 2WONA 4Y6IA 2K8GA 4ES2A 3BSCA 1X4FA 1NO8A 2CQDA 1VR6A 3BR8A 4R0JA 3R97A 3VAMA 1NJWA 5G0RA 1DRZA 4ERDA 2H5EA 2G0IA 4QW9A 1H38A 3CJ2A 3VAFA 3W62A 4JI1J 2W1BA 1C4CA 3M30A 4I1TA 3BSAA 3ITHB 1YLXA 3HFZB 3KFWX 4Y2KA 3FBFA 4C6AA 5IM0B 4OZJA 2IJFA 5ETQA 4X4NA 2DNHA 3KK3B 2OD6A 3CD6S 1F5BA 2ZVSA 2XLJA 4FPRA 2MGZB 1SBRA 4QYZJ 2HFNA 5K14A 2VJUA 2ADCA 4FF1A 1NUEA 1FKPB 4ILLA 1TP7A 5H9EK 1S49A 2EBEA 1U1KA 3S7RA 3BO3A 4FYVB 5KFHA 4ER8A 4OYBA 1SB6A 5KFUA 1X5OA 1OSDA 3CCWA 1G3OA 3IS9B 4IRDA 3I9ZA 1YKWA 2ZE2B 1V6HA 2CPDA 1IN0A 4BC7A 1Q78A 3FFIA 1Y4ZB 2EFGA 2BV3A 3C8YA 1KQSR 4JI3F 5FLXU 4HT5A 1F6TA 2DXEA 1BMQB 2PE8A 1PAUB 2HQ3A 2V50A 1QAYA 3NGUA 3MMAB 4JI0F 1LK7A 2HBYB 2JFKA 2QC3A 4CZCA 1S12A 4P10A 4UZBA 1VLOA 1OQ3A 2QN6B 3H20A 3PEHA 3HD2A 2DXFA 1SC4B 4ILRA 4DR1J 5CXTA 1RK8A 3BGFA 1PILA 1KS2A 2Y1LB 4NLVA 3ZTQA 1Q4RA 5HMWA 2J0WA 1UZHA 4JI1F 4F02A 2BE7D 4DV2F 2V6AA 3DNCA 1GAOA 5D15A 3RYLA 3SFGA 3KMQA 1RHQB 1RWWB 3O1LA 4M5IA 4EYHB 2MJUA 2C28A 3OHAA 3RW7A 3NOCA 2LEAA 2W9CB 3KLGA 3NXZA 3OVBA 1RADB 2RQMA 3GB0A 1YJ7A 1RSCA 3FCVA 3G82B 5ETOA 3T9NA 4YQWA 3J7ZT 1HYSA 2VQEJ 1XEZA 3DGVA 4CM0A 3C6TB 4IG3A 3JB9k 1U2RA 4MJKA 1YJNS 5DJBA 4C3KA 1IKWB 3P5BP 1N32J 1RT1B 2LDYA 1T7PA 4K59A 4ZS6A 5CYJA 3CJTA 4PRFA 1CC8A 3A4TA 1NHVA 2R8HA 1PBAA 2R2SA 3HT3A 1ITPA 4JB8B 4UZCA 1HQ2A 4KV8A 3A3NB 3UN5A 5F8GA 2F9DA 2OHDA 5CAAA 2UXBF 2JLEA 4I2PA 1JLGA 4LSNB 2DRBA 2HZVA 5A8KB 5HROB 5HAOA 5HSPA 4PWDB 3KNAA 3G71S 1FRLA 1FWKA 3PG9A 3AA8A 1CS4B 3GJRB 1LFWA 4ZJLA 4GVBB 1WJ9A 5AXMA 3H40A 2A2DA 1TK8A 1WOOA 2CG4A 3CCVS 1IR1A 3L4BC 3JAMY 4R25A 3HKWA 5IS2A 5BYQA 1Y3JA 4DS4A 4WWSA 3U27A 2ZZNA 2E44A 3EGNA 1OY8A 4DCOB 4F26A 3GIKA 4YDXA 1NM2A 3J7YI 4AL7A 2B9XA 3H7HB 1R6VA 2KZMA 3LUYA 2Z2YB 4KY3A 1K73T 3MPVA 1PO6A 2BRKA 1FNOA 3DMJB 3ENQA 2VZ9A 3P45B 3PJ9A 4WU3A 4CRJA 4DJBA 1JNZB 3NS5A 2GS8A 2GW8A 5A0YB 3MUMP 3M2UA 2CQIA 4UOGA 3BB5A 5E3RA 4F50A 4C98A 2HURA 4X66F 3I0RB 4N47A 1MSWD 3GIRA 4PZVA 3W2WB 2MKIA 1LNQA 2XNRA 4FYXB 2VFVA 5DDQC 2JZ5A 1S1UB 1N4LA 1R0AA 2Y3YA 3JTPA 3MXHP 4K5SA 4B9MA 1WORA 2DCUB 5HQMA 2DGXA 2P6TA 1B64A 1QTMA 4E8UA 3NGSA 2RKIA 2ABYA 2VG7B 1YSJA 1NK6A 2L9WA 2DNOA 1Q1KA 2XZWA 3G87A 4DR6J 3PHEA 1TELA 3CDUA 4TQRA 2DR8A 4UW2A 4X64F 2Y1JA 2JEIA 4L72B 4ZHRB 1S79A 3G6ES 1TKXA 1IBLF 1S1WB 1P1LA 3ILJA 3ZZ0A 1QTNB 4USJC 1RT6A 3AXMA 2VG6A 1YVFA 4CNYA 4NZ0A 3QSIA 3EICA 5GAGU 3RG6A 3NKYA 1NSPA 3HHLC 4Y2AA 5K8OA 4K8RA 3N4WA 1FKOA 4NASA 1OQ6A 4A8WA 4LF5F 4KKOB 1N5YA 2VODA 3QLHA 2J5AA 2Y1RI 2Z2LA 4A8YA 2CWKA 2EEYA 3J7A1 4JI6F 2I6WA 4TY8B 3RUBL 4ZPAA 3VGSA 2R2UA 2EVZA 4L73A 4ECUA 3IP0A 2KM8B 3J81U 1WHVA 1VRQC 4DSEA 2J0XA 1C0TA 3HFKA 5LXRA 1S9GA 4P7VA 3WC0A 5F8IA 3MCNA 1N36J 4C8LA 1UVLA 2J0QD 2V5HG 1CULA 2Q6CA 3MI7X 1FDBA 3H4BA 2RHSB 4UQTA 3SEOA 3V4MA 1RBOB 2GJ2A 4URGA 1L3TA 3ILOA 4HI1A 2HQCA 5DQGA 1BWEA 3E8OA 1IR2A 4R5PA 3AFGA 3GE9A 2JC1A 5AXLA 2FJWA 3KJNB 4BCAA 2AYEA 5KG2A 1SC3B 4UY85 3SCKE 2PSZA 3FCHA 4JBCA 2ZEJA 1KKHA 3CCTA 2MZRA 2AGPA 1WDTA 1RT7A 4C8YA 1LK5A 4RWXA 5KG5A 4ID5A 4F36A 1UA1A 3DYAB 1VBXA 3JSRA 4QYRA 4NXMJ 1PKUA 1R89A 1YJRA 3NLCA 5HVFA 2XZDB 4OV6A 2MEWA 4AXJA 2VD3A 4LBHA 3M8WA 3MEEB 1B7YB 3QMQA 7FDRA 3LQVA 3V6JA 3WX4A 4JI6J 1TVRA 3BZQA 2VBXA 1RTJA 2W2QP 3ADAC 1VIXA 4HR2A 3TA1A 2V67A 2V4QA 4UQGA 1RU1A 1IM6A 1WD6A 4ZVPB 3DI6A 2BKPA 2AX1A 4URSA 5KFLA 1RTDA 4AXIA 3LANA 3DU6A 4QIVA 4CDIA 1CJUA 5K14B 1F60B 1HWIA 1NZ8A 3CDEA 3CJ3A 5H9FJ 4A47A 1IXKA 1W26A 2GJIA 5JJBA 1MW7A 3ILIA 4LREA 4DSFA 3J81Y 4CO2A 2FHKA 1RHMB 2H1YA 4PR6A 2V9WA 2AZ1A 1FCAA 4OJGA 1V3ZA 4PXBA 3T6JA 4YOEA 1SV5B 2YWFA 5KT3A 2MXYA 2DO0A 3CJ5A 5J2PA 5HANA 3DCAA 1PSDA 2PFFB 2HGMA 5EUHA 2I38A 1WSRA 2MLXA 5DG7A 4DQSA 2BQUA 4CLPA 1EKSA 3OTOJ 3CPWR 2ZVIA 4RNNA 4N77A 5F0WA 1FHTA 3CJSA 5D4OA 2AD9A 5A76A 4PYAA 5GAEU 4P2FA 2R7OA 3C6TA 1F9HA 2GFFA 3QIPA 1S1XB 1XWLA 1FX2A 3G82A 3Q83A 3OVAA 3EDQB 1VC6A 1N54B 3GLJA 5I42B 4JV1A 4RW4B 2C2OB 3IRXA 2H4WB 2BX6A 3DRSA 1U09A 2WCXA 2EG2A 4MKVA 4O3PA 2EFVA 4X4PA 3ICLA 2YY3A 2G2YA 2RRBA 1Q8KA 3DMJA 3DM2A 1KC8T 3RBZA 1U2CA 1S97A 1RWOB 1D09B 5ETPA 2XZTB 1V9OA 4UF4A 4K50A 2E5IA 2JSXA 3CDWA 3TI0A 4CP5A 2P8IA 4IUFA 2KFZA 5EX0A 4MAKA 1OS5A 4CO4A 4ECQA 2O1PA 4TU9A 3MD3A 2WB4A 4H54A 1SC6A 3GSDA 4JV0A 3I0SA 2DH9A 1CJKB 1NK0A 3U1MA 1K47A 2B9WA 1D0EA 3DLJA 2ASDA 2GIQA 2EK1A 3V6HA 4QJVA 1S7IA 1X0PA 3F73A 3O44A 3TRGA 1SH2A 1NH7A 5B0CA 1U0HA 4ZPTR 1LWEA 4OYIA 1VQNS 1HYSB 2OP5A 3EJMA 4ZP9A 3VAGA 3DM2B 5KFIA 1TR0A 3THTA 1XMBA 1F5AA 3OQ2A 4OX8A 1QSYA 2UUAJ 3L9ZA 4IFVA 1LQ9A 3EPGA 1LWFB 3C14A 4PG6A 4NRUA 4KBIA 2V69A 4WFYA 1ACMB 5HBMB 2BM0A 3PKMA 1AUSL 3PR5B 4L3KA 4I2PB 3ZFVA 4CH1A 4ZDNA 3UNYA 3ZNUA 1DQAA 1BLUA 1IBMF 2HHWA 3GPAA 3KK2B 1PC4A 3HP6A 3CCSS 3T1HF 1TUWA 3IG1B 4WIQA 1WNEA 2QV6A 1WG5A 1FDNA 3MR3A 3LP2B 2VG5B 2R42A 3BPDA 3A3PB 3O3LA 4DV3J 1VC0A 3MEGB 3K89A 1YJ9S 4EUVA 3PACA 4Y2IA 4ZPBA 5KG0A 4NLGA 1LW0B 1KWMA 2MTLA 1P27B 1VQYA 4X84A 3SSSA 4BBYA 4DR4J 1U1RA 4PCQA 2FJBB 5GVQA 4BC9A 5CQGA 3FSXA 5M2PA 3MOZA 1RHUB 4FVMA 5C7PA 1X7VA 2BYCA 2QL9B 2CQBA 3M1VB 3VHQA 1SL2A 1S9EB 2HHHJ 3CD5A 2N3OA 3ISZA 2CPFA 2G1DA 3NRBA 5AXKA 5L9XA 1F3VA 3W8PA 2MQPA 4DX7A 1RA6A 1RAHB 1TAUA 4HH0A 3HHLD 3M30B 1NK4A 3GV8B 2ACYA 3L7UA 4G6VB 4J9LA 2UUWA 1R0AB 3CCUS 2ZC4A 3QFHA 2JJ4D 3ILLA 4KHPF 4YR3A 4OYMA 1AFJA 1S0OA 4CLFA 1WC0A 3RRKA 3K5MA 2C22A 4WKYA 2LEPA 1KHVA 4RUBA 5T7LB 3QGIA 3M8QB 3KK2A 3V4IB 1C2PA 5IWAJ 3T1HJ 1S0MA 3GTYX 1C1BA 5CYQA 4DEZA 1EQ0A 1YIJS 3OTEA 3UFCX 4J9QA 1GH8A 1KOHA 2H65B 5DDOC 3JYTA 1FO1A 2D1CA 5IC6B 2ZUAA 1NJIT 1Y5IB 4AT1B 4RZRA 4MK7A 2YWHA 2KN4A 4DX6A 3D5MA 5JXSA 1EJ7L 4AQYF 4MIWA 3SSQA 3I55S 1HLWA 4C11B 3QATA 3DRPA 4I7FB 5LMNF 2HHUA 2HHHF 2QYGA 3GCXP 3THPA 4IOAQ 2NR0A 3J81j 2I5JA 3AJDA 1OSCA 2CNNB 4J9MA 4R8UB 1O6XA 3IN5A 2FVRA 3KK3A 2FGOA 2QIFA 5F3ZA 5RUBA 3FMWA 1YBTA 2MKHA 1XMQJ 4C4WA 4LFAF 4TY9A 1B70B 3VQSA 3E01B 2M52A 5KFQA 4J9VA 4TXSA 5C5JA 2ZJPQ 1OPZA 2UVWA 2QMWA 3CCRS 1Y9OA 4NCGB 4RJVA 4CWBA 4F4ZA 1UEUA 1YZ7A 2GHWA 1IJFB 5I3UB 4PG8A 4PYDA 1M1GA 2HIQA 3ENVA 3D0HE 2A18A 2Y8WA 2FPHX 2QFJA 1KDNA 2QGFB 4O0NA 4MKAA 3IAS9 2HQDA 3BJYA 3EVOA 4QR0A 5KFCA 4OYZA 4AD6A 4FPIA 2X1FA 2VQFJ 3W9JA 4DQRA 4DR4F 2J7UA 2XMTA 2PI5A 5AE3A 4F4XA 1HR0F 1VRUB 1GFWB 2FDNA 3HZGA 4YB7A 4ZN1A 4YY3J 4A4JA 4B3TJ 4X2BA 3PM9A 3NL0A 4DSJA 5L1JA 4C2MA 3SXLA 2BEFA 4DUYF 3TAPA 3JTOA 3BGRB 2YWKA 3N6MA 2HMIB 2C2NA 1U7LA 2CPJA 3Q8YA 4TYAA 4YHHJ 3SYZA 1FRIA 5LJ3Y 1S72S 2GJFA 2XTJP 3NWGA 4B3SJ 1EP4B 2EKNA 2ROPA 2HWTA 2XEXA 3HHKA 5HMZA 3KJVB 3CE8A 5EDWA 4EEYA 4ZP8A 4RKUC 4NCAA 5I42A 4WZMA 1HBOB 3KG4A 3R2DJ 1S1XA 1JXLA 5J2PB 2HGLA 3ELHA 4RBVA 2J76E 1C4AA 1U1NA 1ZOTA 3H2VE 1MROB 4PWWA 4RUHA 2NXNA 5AE1A 1IQZA 3IS9A 2XY5A 2XI2A 4ED0A 4IG3B 4OX6A 1X5TA 2J8AA 1BXNA 4Z37A 5KFFA 2UV8G 1W2IA 3U02A 3Q8QB 4OI0A 1JWWA 3HVWA 2JVRA 1XR7A 4FBTA 2QFIA 4O3QA 2IVFB 3CXCR 1IUJA 1SV5A 3UCZP 1FF2A 1OMSA 2UUAF 2KTQA 3IRXB 2COLA 2ZOMA 4NMLA 3I32A 1FJGJ 3BYRA 3D6HB 4DLEA 2FY8A 2DCLA 2XO6A 3MF5A 4IO9Q 3ZNJ1 2AEJA 2DNMA 4KTQA 1FXDA 3QWPA 1BHNA 5AT1B 3W7BA 3T5JA 4LMZA 2K7KA 4OYOA 3JAMU 2HQIA 2DISA 1TFWA 3K0JA 2H51B 2IMWP 2QA1A 3KK1A 5DG8A 3HVAA 4D3GA 2XB2D 3DOMA 2DGTA 1WOPA 2ALYB 2WSCC 1T02A 1HMVB 5IXUA 3RTVA 2I2YA 2C3PA 1KVJA 2ZBRA 4JI5F 2PT0A 2D41A 3I4HX 5ETRA 1T0TV 3RB3A 3MECB 3AD8C 5HBMA 2O3DA 2RMLA 2IDLA 3BN7A 3PEJA 3PRBA 2EFQA 4DPTA 2JC0A 3DGPB 1EAYC 5BYRA 2H48B 5LSLA 3LP0B 3OFHA 3O2IA 1S1TB 3MGJA 4F25A 1UJ4A 1JLBB 4M5GA 2CPZA 4M5HA 1FKOB 1BUXA 3QJJA 3DOLA 2XMUA 1S4EA 4X65J 4Z2XA 4RNOA 3Q24A 3LW5C 1FK9B 2BUNA 1JLCB 4EO8A 1HNZF 2DR9A 4JI7F 1B0PA 1FA0A 1N52B 2XMAA 1N36F 3M2VA 1B0VA 2E9TA 3H2LA 3RBDA 3M8QA 3V4IA 2PMWA 1CQMA 4KB7A 2X7IA 4WKRA 2OPSA 1X4DA 3RBXA 4Q44A 5D3GA 4NZ6A 1D1UA 1NDKA 3AH6A 3CO9A 4LVNP 4ZK7M 1VQLS 1QE1A 1H7XA 1VFJA 4FF3A 1YITS 2IRXA 4FF4A 1AZSA 1EQMA 3U1NA 4O3OA 3PRDA 5HLFB 2Q66A 3DGPA 5DLFA 4YUDA 3LP1A 5IV3A 2XG8A 2J0SD 1RLCL 2CQ4A 4LRFA 2Z8QA 2XHWA 3Q8UA 1KQFB 4DX5A 4QIEA 1WEZA 4B9TA 3MMCB 1SJRA 2JDJA 3LO3A 5L1IA 1HNWF 5E3AA 1SJ4P 2C3UA 2LP4A 1VHIA 3SQOP 5HJXA 4DSLA 2LU1A 2BW7A 2V9KA 1SXLA 4KSEB 3BF4A 3BO2A 2DY9A 5CD4A 2RUSA 1I94J 4Q7AA 1F5CA 2FJAB 4J9NA 1F1BB 4U7CA 4KR0B 1TL4A 4TLQA 5A0YA 5K9FA 1X4BA 2CADA 4CYUB 3RR8A 5DGAA 2NCKL 4K4TA 3B78A 1W2BR 2ROEA 5LMUF 3CCMS 1U0SA 1DJ0A 4OZ0A 1NJXA 2CQCA 5E3PA 3O8WA 3UI3A 5KFPA 4B08A 2O5DA 4NRTA 3UVJB 4F3MA 1TUVA 4JI7J 2VF3A 2A6MA 3BPSP 1HNXF 1WHYA 2B4OA 3OUYB 2JEGA 3W5YA 3VVUA 1FERA 2B7BB 5F8NA 1BQMB 2AMCB 3NEKA 2EWHA 1L5UA 3KLFB 3EZOA 2VG7A 3V5RA 3G6VA 4H4KA 2ZH5A 2XYPB 3VWSA 2WSFC 4OQJA 2XMJA 3BREA 2CWXA 2RUGA 3VGTA 1MLAA 1WF0A 3MM8B 4CM2A 3CMQA 1V5VA 4U96A 4U7UK 5D4NA 1IBCB 2M7SA 2VV5A 5E41A 5DLGA 4JI5J 1S4FA 2FY1A 3DRPB 4LRAA 4LT6A 4F0HA 1E6YB 2C2MB 2GO8A 1WC4A 1FNXH 3MOJB 3HM9A 1RT2A 3SCIE 4X64J 3CEDA 4FP9A 4PAAA 2E5HA 2CJKA 1U6BA 5KOWA 1MN7A 3BKUA 4WYLA 1ZA2B 5LT5A 4OL8A 3G8TA 2ATCB 1XQIA 1Q16B 1CG2A 3K5LA 2E9ZA 4ZPWR 3MEEA 1LOUA 3TR5A 3ULHA 5H9EJ 1HA1A 4P71A 3F44A 2QYCA 4EBDA 4ECXA 1Q81T 3QGPA 3LH2S 3QT6A 3OLAA 1MG7A 2LXIA 2QLJB 1BE4A 1S6UA 2IC3B 2DJWA 4V19X 3T19A 1TQLA 2IAJB 2DHSA 2DIVA 2EC2A 2UVUA 2UXDF 3ZZRA 1FRKA 1HNXJ 4M5NA 3OUYA 4X4TA 2HPUA 2UVVA 4Q0BB 2MQ8A 1FEEA 2CAJA 3CT9A 4U8VA 5CABA 4DR7F 1FRHA 3NS7B 1KFDA 2CIMA 1R8BA 1VOMA 2J6TA 1SQEA 5E3QA 1LXJA 3QAUA 1PYTA 3I56S 4DV2J 5C24B 2QT7A 2DD8S 2DNLA 4GMKA 4NX9A 4P9SA 5IQQA 5L9NA 2CYYA 3ZZYA 3TUZC 2W2NP 2RRNA 5KTQA 4EZ9A 4GRSA 3TZWA 4O44B 3NGTA 2OH2A 1REVB 4G3IA 4ZCKA 2DK2A 3OL8A 1YRTA 3ETMA 3IC1A 3TVKA 2AF6A 4YR2A 4P7TA 4OIXA 1IJEB 3VR1A 3RB6A 1X9MA 3MMJA 3IAM9 1IBLJ 2HBZB 4F0KA 2ZWOA 3GJQB 2RRAA 2F3JA 5B0GA 1NMEB 1JLAA 3FQLA 2P6SA 3CNQP 3W9IA 5IM0A 4J9RA 2W7AA 3QJLA 1HWKA 3P8BB 5KFDA 3LOUA 5G4DA 3R5DA 4LRBA 3PV8A 5KT7A 1TK5A 2B4VA 2H5JB 3QIDA 2FLOA 1OYEA 4IG0B 1RP5A 2W9CA 4Q2LA 4NYZA 4C3LA 2FJXA 2PGCA 5KG7A 3GV5B 4IFVB 3LGNA 1ZAXA 2YKMA 1UVJA 4KFBB 3TNVA 1NSKL 1Z2LA 2LMIA 2VPYB 5B0FA 1ZM4A 2UV8A 2HFVA 5T14A 2EBGA 2HLTA 3QQCD 4ZLNA 1TU0B 2VB6A 2PMHA 4A8XA 2BZ2A 1Y5LB 4QIGA 1YJWS 3WC2A 2UXCJ 2YKMB 1YQHA 3HSZA 3E51A 4N8OA 3KMSA 3A12A 3ISND 4PPZA 4DDFA 3M9NB 3BDPA 3UR3C 2CPXA 3K17A 4Y00A 2AX0A 3FCWA 2KRBA 3P3DA 2ZC3A 1HPZB 4HL9A 1T05B 2R7WA 2NXUA 4XTTA 2H4YB 5DQIA 1FWLA 1DLOB 2XULA 1F0XA 3QJPA 2K1RA 2HS4A 2LCWA 2NUHA 4OI3A 3UD4P 4JP8A 2AZ3A 2QA4S 1RT3A 1SKSA 1C1CB 1HMVA 4RNMA 3VQTA 1HPZA 2YVSA 5LM7E 4KFBA 1D3WA 2IMOA 3PNIA 4ED7A 1W7WA 4FNHA 2MLZA 4C3MA 2HRTA 1FKPA 2M70A 1H98A 1NSQA 3KLIA 2RE1A 3D68A 2CPYA 3BH6B 4DSIA 1VQ6S 4JYAJ 3Q0AA 2VFUA 1U45A 2YWEA 4ECYA 1T8EA 2HVHA 2XY7A 2BDPA 3OD2A 1TMJA 3GJSB 2MSTA 2ZE2A 4WBFA 2I9SA 3EVWA 1PC5A 4ED8A 2LFVA 1RBAA 1UEKA 1HW9A 2F40A 1ZZNA 4K0KF 3MMBA 4KAIA 1FTRA 2AYMA 5KG1A 5G0RB 3I31A 4HI2A 2IM0A 1S6QB 3OL9A 3MZIA 3DXSX 2YKAA 1UMJA 4BWJA 2BW2A 2H54B 4FXDA 1S5ZA 2OPSB 1FRXA 3BKTA 3IBCB 1TL3A 2HBQB 3CIMA 3NAIA 5GMDA 1RGVA 4S0MA 4K4YA 2WBRA 5A8KA 3GYNA 2PA3A 2LVWA 2P9CA 2ZWPA 3B4DA 3CVKA 1HNVB 3KUHA 3KKFA 1FTCA 2MMYA 1BQNB 3QFWA 2FUG9 5I3PA 4ZIVA 4OZLA 4YR0A 4CO5A 2DNKA 1XMOF 2KHDA 3GP9A 3LWLA 1RTDB 2BJ8A 2DITA 3WX8A 2MQOA 4KPYA 2P9EA 3FGVA 4LSZB 4K0KJ 3PHTA 3HZEA 4ZPDA 3A1YG 5F8HA 3PFOA 4JI0J 4NLSA 1S1WA 2GAGC 2KKHA 5J1PA 3K7RA 1URNA 2M88A 3I82A 3LPYA 5KFGA 4DZDA 2N82B 2IRUA 4I67A 1N33J 1M5SA 2B7CB 3GIMA 3KJFB 3EE3A 3V81B 3MTJA 1LW2A 2F8EX 4CLYA 3MM5A 4Q2MA 4EK2A 2MQLA 3QWUA 1XIQA 4DL5A 5CH7B 1ZM2A 1VDHA 2HHQA 3HHNB 3E3XA 1RQ0A 2C3MA 4KH1B 5ETTA 2R7RA 2IHR1 3QYYA 5BJRA 2B5JB 1RWUA 3D0IE 4LSNA 1LWEB 4RW6B 1H6KX 3TWZA 2HNYB 2BVZA 1R3NA 5HI7A 4ZVUB 4IFYB 1S57A 3AQOA 4DMZA 3LWMA 3T1AA 1AXQA 2EPIA 4WZQA 1VC5A 1JLFB 4F04B 3TUJC 1NZAA 2QSFA 1ZZFA 3H5UA 3K5OA 3Q2TC 4K4ZA 2UXDJ 3V81A 1UWBB 1YJUA 2FHMA 2VH7A 4ZVSB 5DGBA 1RZMA 1P9QC 1VLYA 2CJ9A 1RTHB 2R4FA 4R8UA 1DTTB 1VRTA 3D3CJ 1JLQB 2BBEA 3ZTRA 2F7VA 2CVEA 3ZZZA 4ZCMA 3WZ0A 7AT1B 4DV1F 2NQPA 1RWKB 4OYPA 2FB0A 2UU9J 3HVTB 1U6ZA 3IM9A 2AJ1A 2ZZMA 3I5AA 3D1QA 1LFPA 1JQGA 1O8BA 2ZFHA 4C0OC 4E98A 4OLPA 5BR8F 3Q22A 1Q82T 3QLHB 4NA2A 1QAJA 1APSA 5D3GB 2POKA 4P2XA 4JI2F 1HI1A 2ZKUA 3RRGA 1FDDA 2F63A 2F9JA 2Q43A 2DNQA 5CCLA 4I2QA 3GJTB 5HROA 5GAEI 4XAKA 1DQ9A 4K4XA 4FS1A 1JX4A 2V63A 2ERRA 4DPOA 1LW0A 2BKOA 3V2UC 4Y2MA 3M7VA 3K5NA 2KT3A 3MM9A 2CPHA 2YNHB 1UVKA 4V1Ak 1RDRA 1X9SA 1I1GA 3SV4A 3FBCA 1IM4A 1NHUA 2KHCA 4ED1A 1ZETA 1KQKA 1XK8A 3BEGB 3MR5A 4Z7YA 1VISA 2XYHB 3TQEA 1RABB 1RU2A 1TKXB 2Y8YA 1ZBTA 1KVIA 4QWAA 3A8IA 5B0AA 4F67A 1XJWB 2HVZA 4NEZA 5IQ6A 4DUZF 2ZITA 1MWYA 2IYIA 4ZOSA 2V2ZA 1CJVB 3HVRA 2NXJA 1TMMA 4OX9F 1M5KC 2UXCF 3PKYA 2HAIA 1KLNA 2YH0A 3GU0A 3H90A 3KWMA 2PA8D 3G86A 2A1BA 4RR5A 4G1QB 1F9EB 3H4DA 4IG0A 2HZCA 3OFGA 4M1KA 4NLRA 5JVHQ 4A8QA 1CJVA 2NZ4A 2HW3A 4HTIA 4EGLA 2W4PA 5A2QU 3GG1A 4QR1A 4ZJOA 4D3HA 3NCPA 2GQ2A 3FEXB 1WACA 2BM1A 2WVBA 3N5BA 4ALZA 1HHTP 3K8WA 3F41A 1WI8A 1R6YA 2I0XA 5KAKA 1YRXA 3PYDA 5CCMA 2HVIA 3QRRA 3QT7A 3LP0A 2AJQA 2LLZA 1DZ5A 2WONB 4HVZA 1A7GE 4RW7B 2ZH8A 3MCOA 1TZ0A 1WC5A 3IFEA 4LF7J 1GX5A 1V5IB 2MGZA 4Y0FA 1GT8A 4F4KA 1NDCA 2VA3A 3QGGA 3H5XA 3TEGA 3JQMA 1XNRF 1HBUB 3R5CA 3E2EA 3EWGA 4PQAA 4P75A 1M5HA 4ELTA 3GG0A 3CD0A 2B4UA 2E5GA 4LRCA 4HACA 4WYWA 1QJHA 2QLWA 1KONA 2FD2A 4ZVHA 2CQ2A 2M5YA 2HVDA 2KM8C 5KFMA 1U02A 2CQPA 4TU8A 4QWDA 1BQNA 1NU4A 4NE9C 3A8JA 2PN6A 4DV0F 1MNEA 1N48A 4B3RJ 5CYMB 1VYAA 3RJMB 2N4CA 3KLHB 2A3JA 2J9DA 2QSWA 3AHPA 3EVMA 1FVSA 1X4HA 3DXBA 2GGPB 1FXRA 5KFOA 1MROA 1VBYA 1TKTA 1I6JA 1U1MA 3DLLQ 4I64A 2J9CA 3IM8A 5ETNA 4AFFA 4WF9Q 1TL5A 4KQZA 2MJNA 4WXOA 3OXGA 1RAAB 2RQKA 1VQKS 1YJVA 1Z4UA 1SJ3P 4O4GA 3GWCA 4QIFA 1ZTWA 3TW0A 3BGLA 3TZYA 3GCWP 1D8ZA 3CSKA 3H59A 1ZS6A 3IRWP 3W61A 1IKWA 1NXIA 2MQQA 1JK9B 3G2XA 2JVOA 2C3YA 2BR0A 3CC7S 4DR3F 2HMIA 3OXFA 3QRPA 3I96A 5KFTA 4P2MA 2RDDA 3I0RA 1K0TA 1OY9A 1X4EA 3MMAA 3KJVA 3N28A 5U47A 3KLVA 2MYFA 3ZC4A 3NGDA 3DLGA 1QSLA 2UZAA 4DUYJ 3CJ8A 2HHSA 4KGMA 2WB1D 3W5XA 3MM7B 1UAWA 3MR2A 4CLWA 5KFYA 4DLGA 1VQPS 1AROP 5KG6A 5E7OB 3LALA 1NH8A 1MMNA 4QBUA 1ZYQA 2C3OA 3HJFA 5GMEA 1TL3B 2AEMA 2K7JA 2L08A 4FNIA 4A8MP 2DGOA 3W2VA 4QWCA 4IH7A 1N5SA 4FF2A 4WP8A 3KLGB 4LF1A 1WHWA 5DETA 2AGOA 1SL1A 3A13A 1TKDA 3C46A 1S0VA 1LW2B 2DRDA 1TKZB 3FZBA 2AJFE 3MCSA 1ICEB 2RS2A 4TNOA 3GILA 2OI2A 2NPIA 4YN3B 3BR9A 2YNIB 4DFKA 2WSEC 4JI4J 4RNHA 5FDLA 1QSSA 2DHHA 4J5OA 4UUWA 3HULA 3T1YJ 2OSRA 2CKWA 1B7FA 4PXEA 2LQ8A 3W60A 4AQYJ 3MPUB 4IO1A 3W64A 2GVZB 2LU2A 4ANCA 2ZH4A 1SKUB 2CQGA 4GC7A 4DG1A 2BOPA 3IG1A 2MZSA 3LF0A 2IC3A 2OJ3A 5D4PA 3M6VA 3V6DA 4WE1A 3M8PA 1HWLA 1CS4A 1DTQA 3MD1A 2FVCA 5DDRC 4PWDA 4DV0J 3NBPA 3J80Y 2FJDB 1EZZB 1H3DA 3LP1B 1N6QB 3BQ1A 1U1LA 2HGNA 3N0VA 1KD1T 4EFAC 5KFBA 3QO9A 3C15B 4ENOA 4IH5A 5HQ8A 1YHQS 2LYVA 1SKRA 5C2GA 4UY8T 4B9SA 1NSAA 1WKLA 3HCXA 1FE0A 4KGZB 5DO2A 4KO0A 2ZBCA 2WHOA 1N34F 1JLBA 3LPEA 2WVEA 1NBEB 1T9XA 2KVQE 3DRRA 4FXVA 1SVDA 2E7XA 2KJWA 4OHWA 4P73A 5B0DA 3D6TB 2KXFA 2H3EB 2W8KA 1RJJA 3C66A 3M2RB 4YFUA 3DU5A 4DF8A 4CT9A 3SCJE 2DPIA 1XR6A 3KDNA 3I6PA 1YBAA 2A2CA 3L7OA 4LVOP 3VGVA 2XY6A 2J7WA 4KHMA 4TN2A 1HR0J 1EIYB 2BQ3A 2G0CA 3G4SS 3T1YF 4LF9J 1A9NB 3HXMA 2YPZA 2DEJA 3QNWB 5K8MA 1QE1B 3CC4S 3J7Z5 2FC9A 1Q7YT 1HD0A 4M5MA 1WF2A 4U95A 2FLNA 4Z7CA 2XWXA 4ED2A 4KGXB 2K3KA 4OHXA 1HBNA 4ZP7A 3SDEA 4YB5A 4CLZA 4DV6J 3A3OB 4HDGA 1IBKF 4V19J 2HHXA 2DVIA 3WDOA 2VICA 4ZVTB 2ZBPA 5GADI 1A0OB 1NKCA 2E1AA 3CWJA 1JB0C 3EXYA 1OWXA 4L6V3 4DQQA 1M5VC 2F65A 2W24A 2WK4A 4H4MB 2IFXA 2LQBA 3QAEA 4OYXA 4DU8A 2ZM6F 5SZTA 3HKZD 3M1VA 1RT2B 2KO1A 4E0DA 4NLXA 3DLBA 3SSRA 1REGX 1KP6A 3JS9A 3CO0P 4K7QA 2DT9A 1B3TA 4NXNF 2ASYA 1HBMA 2BANB 2JWNA 3OV7A 3PR4A 1WSVA 3MEKA 2XLIA 1YWXA 2LQ5A 1L3SA 4TY8A 5KT5A 2OMOA 2Q3PA 4DV4F 4PQUB 2Q79A 1J5EJ 1M5PC 2IAJA 1R8PA 3UN2A 1FJGF 4Q43A 3D0GE 3GFYA 2LEBA 1S6PB 3EM1A 1UFKA 1XNQJ 1HFEL 2ZKTA 1RT5B 3W65A 1FKAF 1JXEA 3OR1A 2GNKA 4HKQA 2ROGA 1NPRA 3ONQA 3KHHA 4R5PB 4N8NA 1ZAWA 3UE2A 2UVRA 4ZVFA 1JIHA 3QT5A 4MMOA 1YGYA 4O44A 1ROFA 1UCNA 2CZ9A 1RCOB 2Y0SD 4JI3J 2QJ3A 2J6SA 3G8SA 4DFMA 2OPPA 1S1VA 2D3ZA 3PW5A 1HW8A 1Y10A 4WXWA 3HSJA 3GYGA 2E9RX 2MQNA 3OR2B 1PG5B 2ACMA 4QU7A 2DNGA 3TUPA 1CLFA 1J2VA 1FRMA 2GMLA 4H4OA 2DNRA 3DKDA 1X9WA 3TARA 1X4GA 3C16A 5ETLA 1V3RA 2AEFA 2YX7A 2MSSA 1HNZJ 2HS3A 1WI6A 4YS2A 2VBZA 5FD1A 2OLWA 3SIPB 3EUNA 1SH0A 1Y0HA 2B43A 2X3DA 2N3LA 1TTHB 2XMVA 4ZA1A 3DRYA 2KJVA 3UWTA 3HD1A 4ZVRB 3QIPB 3CCES 2HYIB 4WFBQ 1JJ4A 2RVJA 2CA9A 3VGUA 2VQEF 3O5TB 2ZNZA 2D3O1 3DDIA 2MY7A 2XYGB 2MHNA 3HSDA 3HHDA 2HZAA 4ECSA 2ZHBA 2XGQA 4C8ZA 3DFEA 4OZNA 4TQSA 3BO4A 5BXIA 1CJUB 2E1RA 4A8SA 4DR7J 1HL6A 2O66A 4AYBD 4KE5A 1O0PA 4A46A 5JMNA 1Y00A 2XM3A 3K59A 2F8MA 4M5LA 3BM7A 5KFKA 2QTWA 3LAKA 2DY1A 2HRUA 1J5OA 4RW9A 3CDBA 2C2KB 2FQQB 3M4XA 2V8GA 2AW0A 1DURA 3HK2A 1RHJB 3PX4A 2QLFB 5DDPC 1UETA 2ZD1A 3GV7B 1G2EA 5IT4A 2K06A 4KHRA 5K8PA 4LF6F 3SMZA 1HBOA 1BQMA 3CMAS 4ZN3A 4QOTA 3KK1B 2ZBQA 3CMES 2DR6A 2RU3A 4ECTA 5HP1B 3FNNA 3PO5A 3IBFB 3TANA 2N7YA 2WOMB 3IMQJ 1RAJA 5HJYA 4AE5A 3K57A 3BGUA 2BE2B 4PG7A 2HWHA 2PEHA 4XPCA 1H74A 2EW9A 3GMGA 2R8JA 4P74A 3CUNA 2RAQA 3AJ2A 1AUDA 4NOHA 1B0TA 1R0BG 1YDLA 3N6LA 4CI0B 4DR1F 4KGKA 5L1LA 3B8HA 4C0HA 2V2KA 1SQGA 1RLDA 4JV5F 2BJ9A 1GQEA 2FC8A 3HFVA 4NI2B 5KG4A 5K8NA 4IQXA 3P49B 3KNGA 1X5PA 2HLUA 3F0NA 2MDAA 1TL7B 3DLKA 3IO1A 3H98A 3TAQA 2B8PA 2HQFA 2RJZA 2V8HA 5A6WA 1BY9A 5A8RA 3VZHA 1U4BA 2G4BA 2VG5A 2BRLA 1VK3A 2VASA 3CC2S 4DR2J 3KLIB 1CPZA 4WK1A 3MEDA 2NYIA 3AB2B 4MIBA 2YNGB 5F3TA 3Q8PB 3D67A 1KOOA 3KHGA 2BMBA 2VG6B 4OFZA 2AU0A 2AKWB 2Z58B 2RDIA 2E1PA 2VPWB 3D28A 4KPCA 1OJ4A 2MQMA 1GMVA 4USVA 3MECA 4CLTA 4U7UD 2YNIA 2JNJA 4URQU 3UDCA 3H2UB 3DRRB 4LIRA 3Q8SB 4USUA 2OO4A 3UCUP 3T41A 4C11A 1XMOJ 2D74B 3D66A 3OPKA 1FEHA 2ZM6J 1DARA 4QW8A 1PJ6A 4LSLA 2GVZA 4OYWA 3C3LA 3MPWA 2N7CA 5LSRA 1YTYA 2RKIB 1H2VZ 2XS2A 2MKJA 1FE4A 2KVIA 3FMBA 1CVJA 2IJRA 3CW2C 3POTB 4QIWD 2DPJA 1N33F 1GEHA 4GO7X 1H2TZ 3NOGA 5HO4A 4ZPVR 1FI4A 4NPOA 4X4RA 1KQGB 2X51A 3W2WA 3N79A 5IC4B 4DPWA 3SDEB 4JI8F 3KJQB 4N41A 3R5JB 2W9BB 2JX2A 3O6QA 3UDEA 1S99A 2VDIA 2KYZA 4HDHA 1QM9A 2XQCA 1U6FA 2GO9A 3OJSA 3PW0A 2E1CA 4IRKA 3ET6B 5ITHA 3UR0A 2UUBF 4F2RA 1S6OA 2DNZA 2YWGA 3LGMA 3MR6A 3RW6A 3MPYA 5C24A 4RW8A 4YP3A 4WP9A 4TKTA 1O5JA 5KT4A 2Y1IA 1RTHA 4AL6A 1M1KT 3RRHA 2R2TA 3FVYA 5MLCV 1QVFR 1Q79A 1T03A 3NG8A 1FFWB 2DEIA 2OEMA 3NCRA 6FD1A 2ZDPA 1R0CB 1S6QA 1HKAA 2IA0A 4NLQA 1HWUA 4P2SA 3UQSA 2HRYA 5IT9Y 4X4VA 1P6TA 2QO3A 3N5FA 1HD1A 3M6XA 2NUUG 1VJQA 3OW2R 2D3OR 1X4CA 2Q6BA 2CVIA 4G1PA 2UUCJ 2AT1B 2CZVC 2V8DA 4JV5J 3MTKA 2QA2A 2U1AA 4DX8H 2V34A 1LXNA 1T95A 1BQXA 2GX8A 4RWWA 1FXLA 3MURP 1IKVA 2KT2A 2XCAA 5HMYA 1X8DA 4JI2J 4PKDB 3PDNA 4LFBF 4LR8A 3KLFA 4NYOA 5ETMA 3B54A 2YKNB 1I94F 4FN5A 2GA7A 4TYBA 2YNFB 2JL9A 3RR7A 2QEXS 1JLQA 2NXEA 3NS6A 1S6PA 1IVZA 1TL1A 2VA2A 4LF5J 3U7JA 4P72A 4GVLA 3PY8A 2X1BA 2OPPB 3R9LA 1KLMA 2KFNA 1VRUA 1T3OA 3TUIC 2G2OA 3HF5A 1KVKA 5I3UA 2ZJRQ 1U1QA 4PPDA 2DR5A 1RXOB 5EN1A 1VCTA 4N7TA 4X4QA 1P8GA 1NPKA 1L3UA 4DFJA 2DO4A 5A8WB 4DV1J 5CZVA 2IDEA 3W66A 1OO0B 1KLMB 2DGUA 3E01A 5KOXA 3BGOP 2XMKA 3KLHA 3M6UA 2R7UA 5IT0A 3EX7B 5CYMA 4J7CA 3G6XA 1WDDA 2DBBA 3MAHA 4NLYA 4WK3A 4NCGA 2ZH2A 2P5VA 4ZPCA 1ZPWX 3L09A 4I0WA 1RAGB 2BJ1A 4JOUA 3VAKA 1YBUA 1K1SA 4UT4A 2G13A 1VQ9S 1JKHA 2ILYA 2V8VA 2B51A 2F4VF 6AT1B 1P1TA 4PABA 2AYGA 3FFIB 1RI7A 4WFNQ 5KFXA 1QAIA 2ZBIA 3AD9C 3T5KA 2L41A 3AY0A 4A8FA 4DFPA 3K5PA 2YKQA 3R7BB 3C2PA 4FS2A 1SI9A 3OTDA 2MY8A 2ASJA 4LFCJ 4RW7A 4ECVA 1KR4A 1GXTA 4MIAA 5F0UA 3B82A 3HPOA 4USMA 3HO1A 1S77D 2ZZTA 3TJ9A 3BQ2A 4DN0A 3DOLB 3UO0A 1DBDA 2JLGA 4HEA9 3FEZA 2DR7A 2BXJA 2CRLA 4CTAA 4ED4A 1PJ5A 5HMXA 1WEYA 3OXLA 3AA9A 5A8RB 2F4VJ 5E3CA 3DLEB 5C42B 1H72C 1C1CA 3CJKB 4G1IA 3W8GA 2QA4G 1OIAA 1ZA1B 1XNRJ 3N9UC 3MR7A 2LECA 5JUMA 3ISNC 2GAHC 1FJCA 3OJUA 2EFOA 1CBKA 1AZSB 2D3UA 2J7KA 2XSFA 2KRRA 4ETXA 1RTIA 4U6PA 3KHLA 3EZ5A 1S59A 4IRCA 4ELUA 2EXUA 5KFVA 4OJ3A 3BQ0A 1KTVA 2GIFA 3QPIA 4FVCA 1JJ2R 1I3OB 2E7VA 1Q0NA 3ZTOA 2VKZG 1G6BA 1H2UX 2J9DE 4PG4A 3FRZA 5FIIA 4B02A 1GTEA 4C97A 2R7VA 3TYTA 3FJ2A 4I4BA 5J2QB 4USTA 3I5CA 3ITHA 2N4DA 2AWZA 1FT8A 2CJAA 5LOQA 2DKOB 3T9ZA 2VPXB 4NA3A 3NGRA 3FK4A 1CC7A 2ZHOA 4HACB 1WKKA 5F9LA 5IV4A 4Y28C 1TL7A 2VOOA 1WTBA 2F8HA 3QT8A 5B09A 2JEFA 4K2JA 5DM7Q 1V3SA 4MH8A 3K58A 3SQGA 4GO5X 2UU9F 3R5AA 4RW6A 4LF4F 1C0UB 2WOMA 1RYSA 3OL6A 1YI2S 2YBVA 4ZKAA 3LP2A 5BR8J 4WFAQ 3PW4A 1Y7PA 3HT0A 4OI4A 2DNNA 2P9GA 2VU5A 3DOMB 4B9NA 2CJYB 4U67Q 4RPFA 3LAMA 2H9ZA 4A8KA 1QUPA 2Z4PA 4OZ2A 3NMAA 5H9FK 2E7WA 2L48A 2EI5A 3R5BA 2YH1A 2O01C 1MWQA 4RU2A 4NWBA 4NYPA 3CCQS 3L3CA 4OI6A 1VRTB 4N56A 1Q5VA 1RWPB 4CH7A 3IWLA 4M8LA 2RQ4A 5L46A 3IWXA 3CJRA 3EXCX 2NSCA 3Q89A 2A0FB 3GZ7A 1RISA 2RT3A 4ID8A 3ZTPA 2PDAA 4EMDA 1KFSA 2BE9B 2GC8A 2CQ3A 3BV8A 1F9FA 3OBIA 1SUQB 4ZP6A 4DU7A 1JMTA 9ATCB 3EGWB 2MKCA 4HH1A 4UOCA 2VL1A 1J27A 4JI4F 1QLNA 4DUZJ 4ZVOB 3EPIA 2CQ0A 2B5JA 4DF4A 1PJ7A 3JTNA 2BACA 2L3MA 4J90A 2CQHA 2EG1A 2G9OA 2L9DA 2XWYA 2HS0A 3T6BA 1S1UA 3VZIA 3F56A 4IOBA 3W63A 5I4MA 1NK8A 3VAJA 3ET6A 3M32A 2RILA 1KHWA 4B3OB 3GIIA 1N0UA 1MMDA 3HSGA 4OYAA 3DOKA 1SIWB 2ZH3A 3CDAA 1LWXA 2ALZA 2W9BA 5HVHA 5F41A 1PBUA 4ZVQB 3NMRA 3X1LB 4B9VA 3M32B 4ECWA 1WKJA 3QBCA 2BJ3A 2PEBA 3P5TL 4W4MA 3PX6A 5FDLB 1TV6A 1S1VB 5C25B 1UP1A 1NDPA 2MZTA 2EFPA 4ZHRA 5LJ5Y 1ZAVA 3POTA 5MAOA 4LR9A 2OGUA 1EB0A 4HHJA 4NLDA 4I69A 3L7PA 4Q5VA 1N8RT 2ZUGA 1EKRA 4UUXA 1MN9A 2XBPA 3G9CA 1RWXB 4DV3F 2QLBB 3TAMB 1WF1A 4H4OB 3GONA 2GVDB 4PQUA 1L3VA 4QQBA 4LF8F 2XHCA 3QGHA 2HHPA 3I5BA 4LQ3A 2MZJA 2APOA 3CGIA 5HL7Q 3M8RA 3T3FA 2HNYA 1HBNB 2DGQA 3TO8A 2E5LF 2QLXA 1UPPA 4XIUA 3MFIA 5CD4H 4Q8FA 2D69A 1Q8LA 1U8WA 1FFGB 1JLFA 2VPZB 4IDKB 5J1EB 2BABA 1K44A 3BBCA 3SBMA 4DL0C 4YDDB 4B3RF 1QUVA 3PFEA 4CCHA 4X4SA 2VFTA 3UN3A 1GXLA 4EU0A 4H4MA 2QMUB 4B3OA 1UZDA 3BYPA 1KEKA 4QU6A 1BD6A 1Q53A 4WTYA 4ED5A 2NS1B 3DN9A 2XS5A 3VTIA 1IKYB 1HBMB 3BBFA 4FXWA 3UPFA 3GSIA 1B99A 1UW9A 3PXGa 4U8YA 3PRVA 4WTOB 4CIOA 1U2FA 1YX2A 3D9BA 1SPBP 3BN4A 1N34J 4BS2A 1IKXB 2W01A 2BOAA 3I9V9 1QY7A 2IA6A 3CD7A 2ZH6A 2J8SA 2CPEA 4WIIA 2KYXA 1CULB 1RT7B 2KU7A 3IWNC 4DR3J 3HHLA 4BDPA 4ZCLA 3RZAA 1RT3B 2WVCA 1YZ6A 4M5DB 2I8EA 8RUCA 3MAQA 4PUOB 2GQQA 2OFHX 5F8LA 1IBMJ 4LF8J 3NBPB 3NNCA 1FWPA 2CDRB 3D54A 5EGYA 5E33A 4OHYA 3PYEA 5THWA 4H4KC 2ZJQQ 1D8YA 2G2ZA 4F4WA 3ENWA 2FJEB 2GQCA 1UW4A 2D9PA 4O3NA 4EZ6A 2B56A 2F5GA 2NYHA 2VC1A 4KO0B 1E6VA 1IWAA 4QR2A 3C19A 4IKAA 1WC3A 2P2CB 2W4DA 5J1EA 1G7CB 1SH3A 5B0BA 5E0OA 1UFWA 2IPOB 2K2PA 1D9AA 1QD1A 3MMBB 5DZ6A 4X62F 3AAWB 1H73A 4KGVB 2LXFA 1K0VA 4NI2A 1J5OB 1YG0A 1RCXB 3HHLB 4W92B 4CH0S 2M8HA 1L3KA 3G8QA 2XS7A 3RGIA 3DLHA 4DG1B 3TP2A 4NEYA 2OD4A 3ZO7A 4HHHA 2UXBJ 2XGPA 1LKZA 1OPIA 2HFOA 2B9YA 1M90T 2KXNB 2YQ0A 5KT2A 2ZH9A 2NSBA 2HHVA 4CLLA 3KG1A 3K8VA 5IFMA 3PYFA 4DV4J 1WELA 1AYEA 5T41A 4PUOA 3Q8RB 1VQOS 4YY3F 3KDOA 4B3TF 3IA0A 8ATCB 2WRMA 3FZ2A 2JOQA 1T05A 1Y3KA 3UDVA 2ILZA 5K20B 1U47A 4F3QA 2HNDA 2IVYA 4USKA 4OX9J 4QYZK 3DHWC 2BJDA 2B9EA 3FQKA 4HTJA 4E2FB 3MPDA 4LIWA 3CCLS 2IY5B 3DDKA 1FJEB 3MFHA 2OTJS 4DPXA 2Y9HA 2MKYA 2MPUA 4WPAA 4B3SF 2WW4A 1R43A 4ZVEA 4X65F 2VC0A 1FRJA 5F9NA 3MUTP 4JUZA 1TAQA 2DH8A 4UTGA 3P96A 2MLYA 3IGNA 1N5TA 3TQ1A 3I87A 1OYDA 1NLKL 4J9SA 3DLGB 4GVBA 3I0SB 2L9NA 3DRSB 2CNOB 4LUBA 1GNKA 2RHQB 3ZZOA 3PIOQ 4YB1P 3FSIA 2HG4A 2JFDA 3FSYA 3PJXA 4X4UA 1O51A 1HARA 2BE2A 1RKIA 3GR1A 4IQMA 5K5MA 1N6QA 1URRA 2H5IB 1T3NA 4LF9F 4HT7A 4DL3A 4B9LA 4OV1A 4BHQA 2XSJB 3B4MA 1XTZA 1TKZA 3HI9A 2DIUA 3KUEA 3MDFA 3Q8VA 4WFXA 1IWGA 2R2RA 3M2UB 4CLKA 2BA9A 5IT9U 3TA2A 4DV6F 3UW1A 3SFUA 4RLEA 2YKOA 2MB0B 1RA7A 3NP5A 4FYDA 3UD3P 2V94A 1FESA 3R3TA 4RW9B 3JSYA 2RB7A 4DWIA 3RBEA 4NLTA 4KC5A 2FLLA 2BJEA 3SQGB 1NKBA 5LSOA 1JLGB 5LMUJ 4NZ7A 2R9LA 4DV5F 5KFJA 6FDRA 4CO0A 4F8RA 1VQ4S 2IM3A 5ADZA 1VQ5S 3KTQA 1IKVB 1BGXT 1FJ7A 5J2NA 1UVIA 2NPFA 4RW4A 5KFRA 3AOCA 4KJIA 2XSJA 2B4PA 1NHKL 5J1NA 1LV5A 4DOZA 3P6YC 1S48A 2Q1LA 2WW8A 2E29A 2CQ1A 2Y0BB 4ILMA 4K4VA 2BQRA 1KBRA 2DNYA 2HHTA 4DL2A 4O4GB 3PYGA 1S76D 4XK8C 2R7TA 1Z1ZA 2YQ1A 4OI1A 1XNQF 3TJ8A 3MM6A 5A6PA 1NK5A 1T03B 1R8AA 1N5QA 1A6LA 4MTPA 3SZ2A 1U1OA 4I6AA 4L76A 4QWEA 4OJHA 2GIRA 3LA0A 4DZ6A 5H1SV 4UOFA 3ZXWA 5FJ4A 3JQKA 9RUBA 5HLFA 2ZDOA 4L3NA 4CYUA 1HNIA 1RT4A 1C1BB 5CYQB 5D6GA 1S10A 5AJ3F 1RWMB 1EARA 2KG0A 2R3VA 1VIOA 2RH3A 1Q5YA 2FZKB 3GR0A 4I6WA 2IM2A 2EC0A 2QMXA 1XR5A 1CSJA 5DS7A 1TUGB 5KG3A 4DV5J 4ICLA 1HNWJ 1HHSA 4O3RA 4K4SA 3X3UA 2DGVA 3ZTSA 3OT9A 2KG1A 3PO4A 1B4SA 2PI4A 4F2SA 3OFEA 1MMLA 1WC1A 2CUYA 3H42A 3IR7B 4ZCIA 4ZVGA 2R7XA 1X4AA 1SJ1A 2GZOA 4MKBA 4DR2F 2DXDA 2Z56B 4RO0A 2FZCB 3PX0A 1QAXA 2W2OP 3WHIA 3TZXA 5B0EA 4DSKA 3DYAA 1LEOA 1H7WA 1R8CA 5SUHA 3BBBA 4MT1A 4LF2A 4WCEQ 5CHCB 1PCAA 4RUAA 1NB7A 3UVJA 3HVTA 1IKXA 4IR1A 2RQCA 2VOPA 1K8AT 4O4RA 2BANA 3S6EA 2PC6A 1NKEA 3DLEA 5C42A 3EMTA 2DHXA 3CJKA 4X62J 2OIHA 4ICLB 1NNDA 1U1PA 1LWCB 1UKUA 3UD5A 4WU2A 4DV7J 4I2QB 1N0VC 1VI7A 2HK3A 3J7AN 3FKBA 2VJVA 4J9KA 3DI6B 1XN9A 3I4PA 1RE1B 2OEJA 2RU9A 3R7SB 1M0SA 3D2WA 4ED6A 5AJ3J 1XC9A 2FIUA 3JQJA 2VBYA 4IFYA 2E5JA 4EI2A
chains in the Genus database with same CATH topology
1ZPVA 4DQPA 3EYZA 3FDSA 1Q8IA 2FLPA 4TLRA 4U9RA 1DHMA 2DH7A 4XDCA 2R8KA 4PG5A 1IKYA 2ZOFA 4Q0BA 4NL5A 4M63A 4N5SA 3OVSA 4M95A 1FD8A 3PW2A 2HWIA 2KZZA 4FBUA 2XI3A 3GFZA 4C8NA 2QRRA 1YRUA 2JHEA 4LJMA 1TK0A 4ETZA 4C8OA 4QPTA 3EZUA 1EP4A 1LWCA 4NA1A 1RKJA 1EETA 2OPQB 2LA6A 2FHOB 2XO7A 1JNRB 1PGZA 4C8KA 3OFFA 4PXCA 1T94A 1VGYA 4IR9A 3IR6B 1U49A 3C6UB 2V4RA 2E1MC 3THVA 5DM6Q 1UA0A 5F8JA 4OZ5A 3H8YA 2YX1A 3NAHA 3VCDA 1AFIA 4IDKA 5HN0A 2JH3A 5B7WA 2YNHA 4I68A 3N6NA 2K3IA 5D77A 1TKTB 1RT5A 5L1KA 2YKPA 4LQ9A 4MK8A 4RW8B 2U2FA 5DRKA 5AE2A 1VBZA 2I5JB 4QCLA 5B08A 4A48A 1N88A 1SJFA 4DQIA 1JLEA 5I3QA 1R7IA 1F2GA 3CB4A 4QWBA 3G6YA 3AQPA 3HX9A 3K2YA 5EX3A 2R8IA 1VQSA 2KI2A 1HQEA 2XCPA 5EWEA 2ZD1B 4USIA 4WJBA 3OSNA 3RAXA 4EYIB 3OR2A 1EETB 2M9KA 4I6YA 4C0BA 3R1LA 1R31A 1X5SA 1N32F 3KLEA 4Q45A 2RDJA 4ITSA 4C8MA 3IGVA 1HI0P 2J6UA 2RIJA 4J37A 3OL7A 2GGPA 2FVSA 1WG1A 4YB6A 2YNFA 5A2QY 2Z0GA 2CZ4A 4HYKA 4NLWA 2CJBA 2E66A 2MKSA 3DRXA 3HDSA 2AGQA 2OKQA 4USHA 4KKOA 1N5YB 4ID5B 4C9DA 1Y5NB 2X3GA 1HNVA 4NLPA 3KYLA 1R27B 1HBUA 3SI8A 4O0IA 2M3DA 2PD1A 3H5YA 1KNZA 1C0UA 3OHBA 1VJWA 2QE5A 4GKKF 1UJ5A 1UL3A 4JYAF 2K1RB 2OPRB 1ELOA 2NLWA 4CQ1A 4DN9A 3HHEA 1S9EA 4ZMMA 4PXDA 4YMEA 2IVMA 1JKHB 3PVXA 4Y34A 1HI8A 2OAUA 2GMJA 1KRPA 5DQHA 4GC6A 3RU0A 1WTFA 3CIZA 5F8MA 1KTQA 4Y3CA 2W7OA 2VFRA 2AJ4A 4RX6A 1DQ8A 4P6QA 4KRWA 1RYRA 2XMMA 3S8SA 2PMZD 1UFLA 1HNIB 1RT4B 4OZ1A 3HMJG 3GFXA 4XPEA 2B3TB 4OI2A 2ATLA 2YX4A 4M5DA 3MEGA 4EWTA 1W25A 2FTRA 2PO4A 4DS5A 4NCBA 4MFBB 2CFXA 2KB2A 1FDAA 2XMWA 1DTQB 4YEAA 5KFWA 3US5A 1H0HB 3KG0A 4DV7F 1RTIB 5D78A 2GCFA 3MEDB 2KXHA 3PZPA 1ZH5A 2A10A 5KT6A 2VONA 4B3MF 2YQ3A 3M2RA 3TOQA 4J9PA 4RU9A 3J7YU 3VAHA 3QO9B 2DGSA 3S1TA 3NGKA 1JLCA 4ES3A 2ZH7A 4G1QA 5GAHU 2VUGA 5LL6d 2HNZB 2KDOA 1ZTTA 2UP1A 1E6YA 2PIIA 4ES1A 2MHEA 2RNEA 3MM5B 3TA0A 1N56A 4MFBA 3CULA 1Z2ZA