1TL1B

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
400
Chain Sequence
b'TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 114
structure length 400
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B03
1QAIA 3IS9B 4TYBA 3C6UA 2HMIB 5CYMA 2WONA 3PW4A 4TLRA 4Y2AA 5KFUA 4J9MA 4FS2A 5EWGA 1TL3B 2HWHA 1C1BA 4O3QA 3PW7A 1ZETA 4I7FB 4RUAA 3BJYA 3CDEA 4URSA 3QZ8A 5KG1A 2EC0A 5FDLA 2FVCA 3C6TA 1J5OA 4ED1A 3PW0A 2GIRA 1RA6A 4MIAA 3RAXA 2WHOA 3G6YA 1T05A 3QIDA 3EPGA 2J6UA 1C1CA 1EETA 1MMLA 3V4IA 1HNVA 3NAHA 4F4XA 5KFCA 3LANA 5DGAA 1RT3A 4DL5A 2ASJA 1IKWA 2HNYB 4EBEA 3C6UB 4ECQA 1JLAB 5CYMB 2WONB 3DM2A 2YNFB 4URGA 5F9LA 4RNMA 3KHHA 2W8KA 4NLQA 1C1BB 5KFIA 3LAKA 3IG1A 1RT5A 1IM4A 4ZVFA 1S6PA 1JLEA 1RDRA 4NYZA 5DQIA 4EYHB 2AGOA 1ZTWA 5J2MA 5HBMA 1HQEB 1T05B 4MKBA 4ICLA 1S6QA 1S1UA 1C1CB 1EETB 4DEZA 1LWFA 1HNVB 3V4IB 5HP1B 2FLPA 4LQ3A 3NAIA 5KG4A 4IKAA 1HMVB 2ALZA 1UWBA 1XR5A 5HLFA 1RT3B 4MIBA 2AU0A 4I2QA 4IDKA 2BE2B 3KLIB 1IKWB 5J2QB 1T94A 3DLGB 1XR6A 4KV8A 2YKMA 2AX0A 1C0UB 2IM0A 3NKYA 4URQU 1JKHB 3E51A 3T5HA 3DM2B 5J2PA 4LQ9A 3IGNA 1TKXA 4R0EA 1BQMB 3DYAB 2W9BA 3GQCA 3GV8B 1FKPA 1KLMB 5K14B 3RBDA 1S0NA 4NRUA 4NLUA 1HYSA 4TN2A 2CJQA 2JC1A 3EZUA 3BSAA 3UPFA 3HKWA 2BRKA 1RT5B 4RW7A 1JLGA 2V4RA 4K50A 5KT7A 1S6PB 5F8JA 1JLEB 2UVWA 3H5YA 3KLFB 4I2PB 2OPPA 5J2MB 5DLGA 5KT2A 4DG1A 4LSLA 4RW6A 4J9SA 3EPIA 4ICLB 2YNHA 3ICLA 1S6QB 3T19A 3MEDB 3QZ7A 4MK8A 1N48A 4JV1A 5DQGA 4RUCA 4ZHRA 4PQUA 3V6JA 3IRXB 1UWBB 4ED8A 1S1VA 4MH8A 2B6AA 1NHUA 1RTJB 3N6NA 1JIHA 3BQ2A 4IDKB 3KK1A 3CO9A 3BR9A 1QAJA 4OL8A 3T5JA 3CVKA 4ECZA 2C2RA 3Q8QB 4NCGB 4GC7A 2YKMB 1QE1B 4WYWA 3MEEA 4HKQA 3DOKA 3ITHB 1RT7A 1TKXB 3CJ3A 3PW5A 1TL1A 1GX6A 1RT4A 3M9MB 2ATLA 1S10A 1S1WA 1Z4UA 2BR0A 4ZVHA 4ZP6A 3PR5B 4ECUA 4F4ZA 1DTQA 1JLGB 4KE5A 2IMWP 2WB4A 2V0NA 1RTDB 1CSJA 4NLDA 2JEFA 2OPPB 5KFEA 3H4BA 3KLGA 4LSLB 5KFQA 3H5XA 2YNHB 1S97A 4IH5A 5C24A 5KG6A 1S1VB 4K4WA 5CYQB 1RT2A 3PHEA 5F8HA 1KHVA 3NBPB 3BREA 3MR6A 2XI2A 5J2NB 4O44A 4EYIB 1N56A 3CDUA 2OPQA 2IM2A 1SH3A 3RB0A 3SI8A 3DOKB 1VRUA 1RT7B 3IN5A 3KHRA 3PR4A 3DLEA 4TQRA 3BSCA 3GIJA 3DMJB 1S1WB 4ID5A 4EO8A 3M8PA 2AWZA 4KO0B 1DTQB 1HPZA 3DRSB 5I3UA 4J9RA 3RB4A 4YR2A 3OL8A 2RDJA 1JLFB 1S4FA 3TVKA 3H5SA 1S1TA 5F8GA 4QWEA 4IFVA 4ECSA 3PW2A 4KSEB 3LALA 2XGPA 1WNEA 3FRZA 3JYTB 1HNIA 2W7OA 3QLHB 4NLSA 5EWFA 3N6MA 5C24B 4O4RA 3OL6A 3OHAA 1RT2B 3OHBA 2W8LA 5KFFA 4J9LA 4RNHA 3RAQA 1SUQB 5DG8A 4EEYA 4RW9A 2ILYA 4ECWA 4O3NA 1TV6A 2ASDA 1LWEB 1EP4B 1VRUB 2B43A 5KT3A 3DLEB 3E01A 3KOAA 4ID5B 2VG7A 3Q8RB 3BGRA 3M8PB 1D0EA 1BQNA 4WZQA 4DL4A 2YNIB 4B3OA 5F8IA 2C2EA 3OL9A 3GIIA 3BSOA 4J9QA 1S9EA 4FBTA 3I0SB 1IKVA 1S1TB 4KKOB 4K4YA 1FKOA 3RBEA 4TY8A 1VRTA 3Q8SB 2FVRA 1SV5A 2WOMA 4KHRA 3LP2A 4EBDA 1HARA 4KB7A 4WFXA 2O5DA 3I0RA 4DL2A 5HROA 3GILA 2R8GA 3KMQA 4RW9B 1T03A 1S9FA 2HAIA 4J9NA 3CJ4A 5FDLB 3C6TB 3E01B 1J5OB 4F4WA 4XPCA 5C42A 4NLRA 5DQHA 5L1LA 2BQ3A 1D1UA 2VG7B 4J9KA 3BGRB 4ECXA 1IKYA 4Y3CA 4TY9A 4G1QA 4ZPAA 4F50A 2AGQA 4PWDA 1U09A 1QUVA 5KFZA 1TKTA 4O4GA 2I1RA 4YR3A 3GV7B 3CDWA 5KFVA 2R8IA 2OPSA 2JLEA 3DDKA 1KHWA 4IG3A 1TVRA 2VG5A 4PUOA 1N4LA 2FLLA 1LW0A 1LW2A 4WXOA 2RKIA 2VG6A 4KHMA 3IG1B 3ISNC 5C5JA 4ED3A 3ISND 4IG0A 2JEGA 1S0MA 3FFIA 1JLQA 5KFPA 1R0AA 3KMSA 1S49A 4Y34A 1IKYB 3KJVA 1TKZA 5HBMB 5KG3A 2UVUA 1FK9A 1HQUA 4G1QB 3LP1A 1S1UB 4RNNA 4PWDB 1LWFB 1NNDA 3QGIA 2R2RA 1TKTB 2QE5A 3HVAA 5HLFB 4ED7A 4H4MA 4RW4A 4I2QB 5EUHA 4ED6A 4K4TA 1N5YA 4TQSA 2WTFA 4R5PA 2E9ZA 4KV8B 3KLHA 3V81A 1TVRB 4WFYA 3OSNA 2HNZA 3KLVA 5DG9A 5J2PB 2W9BB 3KLEA 4HYKA 1FKPB 1LW0B 5KT4A 5I42A 1ZTTA 3FQLA 2RKIB 2VG6B 1N6QA 1HYSB 4GC6A 1JLBA 4NLOA 4FBUA 2IA6A 4RW7B 2B5JA 1K1QA 4WYLA 4ZP8A 2W9CA 3SFGA 2IAJA 5EWEA 2RF2A 3G6VA 4RNFA 4IRKA 3DI6A 2V4QA 3DOLA 3MF5A 3BQ0A 4X2BA 3KJVB 1TKZB 4RW6B 4DG1B 1S9GA 2AQ4A 4WFZA 3MECA 5KG5A 4TYAA 2I5JA 2IJNA 1DTTA 3HVTA 4ZHRB 4DL6A 4PQUB 4MFBA 4QW8A 4U6PA 4H54A 1RYSA 4H4MB 2B6AB 1JXLA 3KK1B 1RT6A 5J1EA 1T3NA 5KFXA 4R5PB 2BRLA 3LP0A 3KLHB 1OS5A 3CJ0A 1S1XA 3V81B 3KK3A 5JUMA 3GIKA 2ASLA 4RW8A 3MEEB 1W25A 4EBCA 2UVVA 4WZMA 5KFJA 3V6HA 3DRPA 1RA7A 1TL1B 4NLYA 3QYYA 1RT4B 3OLAA 3G86A 4ECTA 4YR0A 4KBIA 2HWIA 3M8QA 4IR1A 1SH2A 5D3GA 2YKNA 2B5JB 2R2TA 5KFDA 1IKXA 3PJWA 2ZD1A 2IAJB 1C2PA 4Q0BA 3V6DA 2UUWA 5KFRA 3IS9A 3KLGB 1S9GB 4K4UA 2ZKUA 3RB6A 3T5KA 2E9RX 1DTTB 1S48A 1TL3A 5C25A 3FDSA 1RAJA 5KG7A 4YMEA 3TAMA 2WK4A 3OL7A 4IQXA 4Q43A 5J1EB 5KFNA 4O44B 5F8MA 2VA2A 2CKWA 5F9NA 2J6TA 4LSNA 4NZ0A 3RB3A 2OPQB 5F8LA 3M9NB 2JEJA 3H59A 4DL3A 2R2UA 3QO9A 5L9XA 5KFYA 3DRPB 2XGQA 4ZPDA 3MFHA 4YQWA 4K4VA 4QPXA 3PVXA 4NLVA 4ED0A 2XCAA 1RTHA 5L1KA 4ZVGA 1C0TA 1HPZB 3DRRA 5DG7A 5I3UB 4FS1A 1IKXB 3GYNA 5KFKA 3QIPA 4H4OA 2BQUA 3V6DB 4IRDA 2HNDA 1SH0A 1XR7A 2HNYA 4RZRA 1JLAA 4IFVB 1RTIA 2YNFA 2RDIA 1I6JA 3UQSA 2W7PA 5C25B 1HNIB 5EDWA 4U7CA 3TAMB 4KFBA 3QGHA 3MR5A 4Q45A 2C22A 3N6LA 2YNGA 2E9TA 4K4ZA 4NLPA 4LSNB 5KFLA 4RNOA 4MKAA 3DLKA 1TV6B 2GC8A 5KFOA 1DLOA 4JV0A 3QO9B 1S0OA 3OSPA 1HQEA 3NGDA 2J6SA 2JEIA 5KFMA 5DGBA 3UR0A 5HP1A 1RTHB 4WE1A 2UVRA 1BQNB 1C0TB 1HMVA 3HVWA 3DRRB 4B3OB 3KNAA 4ZVEA 2FJWA 3PJXA 3QIPB 4H4OB 3GV5B 1JLCA 1S9EB 2HNDB 4IFYA 2BE2A 3KLIA 5J2QA 4M95A 1IKVB 3DLGA 2D7SA 4JUZA 1FKOB 1C0UA 1VRTB 4TY8B 2XI3A 1JKHA 1RTIB 2XWYA 3V6KA 5KFWA 4Q44A 2DPJA 1SV5B 2QV6A 1BQMA 2WOMB 3DYAA 3LP2B 1REVA 1KLMA 3OLBA 5K14A 2JC0A 4KFBB 3H4DA 4O3PA 4O3RA 3CWJA 3I0RB 2FLNA 4ED2A 2UUTA 5HROB 2YNGB 3BQ1A 2ILZA 4NLWA 4QWBA 3DLKB 4XO0A 4NRTA 4QWDA 1DLOB 4I2PA 3KLFA 1T03B 4WXWA 4J9PA 2R8JA 3KHGA 2OPRA 5C42B 1LWCA 3MEDA 1TP7A 4EO6A 2FVQA 3D28A 3BSNA 5F8NA 4WE1B 1RT1A 3CJ2A 4ECYA 3IRXA 3H2LA 3MEGA 5JXSA 1RTJA 2R2SA 4M94A 1JLCB 5KG2A 2IM1A 4IR9A 3MFIA 4IFYB 2VA3A 4O4GB 4ECVA 4NCGA 3CIZA 5T14A 4JV2A 1QE1A 4O3OA 2XCPA 4K4SA 3ITHA 2ZE2A 5KFBA 2OPSB 2IM3A 5KFTA 1REVB 1GX5A 2F8EX 4ZP9A 4IG3B 2VG5B 4PUOB 3D5MA 2IJFA 5KFSA 2OH2A 1LW2B 5KT5A 3CJ5A 2W9AA 4TXSA 3KK2A 4MK9A 1RTDA 4QWAA 4IG0B 3H98A 2OPRB 3MTKA 4KAIA 1LWCB 1JLQB 3FFIB 1R0AB 2FJXA 2FVPA 2V9WA 4O3SA 4ZMMA 4Q8FA 1RT1B 3FQKA 3Q8PB 4J9OA 4F4YA 4NLXA 1FK9B 1HQUB 3MEGB 3LP1B 5CYQA 2XC9A 5KFHA 3G6XA 3NBPA 3UDLA 2IC3A 5J2NA 4IH7A 3MR2A 1MU2A 3IGVA 3H5UA 4QW9A 2C28A 3SFUA 4Y2CA 3GIMA 4RW4B 1YVFA 4IH6A 2ZE2B 1N5YB 4R8UA 1TQLA 3M9OB 3NMAA 4YP3A 2BANA 3DMJA 3VQSA 2D3UA 2HNZB 4KO0A 4K4XA 3DRSA 3KLEB 3TQ1A 5DLFA 5I42B 4Q8EA 2FVSA 1N6QB 3KK2B 4ZP7A 5KFAA 1JLFA 3T1AA 3LAMA 1JLBB 2AX1A 2D41A 3T5LA 3JSMA 3I5CA 5L1IA 1NHVA 2W9CB 4MK7A 2RF2B 2DPIA 4RU9A 3DI6B 2IBKA 3DOLB 1RYRA 3QGGA 3JYTA 1K1SA 4ECRA 3QLHA 2HMIA 2D3ZA 3FSIA 3MECB 2R8KA 2I5JB 4ZPCA 2IC3B 3HVTB 5L1JA 4IOBA 1MU2B 2GIQA 4MFBB 2C2DA 1SUQA 4I7FA 3NL0A 2WCXA 3KHLA 2FJVA 4R8UB 1LWEA 1EP4A 1RT6B 4G3IA 2R8HA 5KG0A 2BANB 3LP0B 5KFGA 1S1XB 4NLGA 3KK3B 4QWCA 3H40A 4RW8B 3I5AA 1JX4A 4NLTA 2WRMA 4IRCA 2YNIA 4XPEA 2BQRA 4ZPBA 3MR3A 3M8QB 3JSMB 3I0SA 2YKNB 5D3GB 4KKOA 3I5BA 5KT6A 4DL7A 2ZD1B 4Q0BB 3PZPA 2AGPA 3HHKA
chains in the Genus database with same CATH superfamily
4LVNP 3HJVA 2YWEA 2V8VA 5IOLA 2WVBA 5KG1A 1PJ5A 3IXQA 1AW0A 2LCWA 2HHWA 4M5KA 3V4IA 1VQYA 4M5MA 2ASJA 2FC9A 4EBEA 4P72A 2JSXA 4DFJA 1MG7A 1IM4A 2B9EA 1JMTA 4EYHB 2R7WA 3I56S 4MKBA 4ICLA 4ZN1A 3V4IB 1XR5A 3IO1A 4CLZA 2M4MA 1GTEA 2BJ1A 2CG8A 2YKMA 3A4TA 5EN1A 3IGNA 1EQ0A 4LUBA 1WOOA 3TR5A 3PXGa 5D0GA 3H5YA 1F9EB 1ZS6A 2PFFB 4J9SA 1QVFR 4ICLB 4RUCA 1NHUA 1V6HA 4ECZA 2X3DA 2YKMB 4HI1A 3L09A 1LFPA 2V94A 3IBWA 2BR0A 5HK4A 4DR3J 2BA9A 3H8YA 4F67A 5LJ3Y 1I94F 1KVKA 4J9UE 5JMNA 4WK1A 4ZPTR 4E8UA 3M2VA 3GIJA 1O51A 1Q8KA 3WX8A 3RB4A 1GMWD 2RDJA 2EBGA 2QL7B 3OJSA 4ECSA 3GCWP 3TZXA 4ATNA 2QN6B 2UV8A 4A4JA 1CULA 5CCMA 4F04B 2ZVSA 4KIAA 3M2VB 5I3QA 5LMNJ 3NWRA 1S9EA 4FXWA 3I0SB 1IKVA 4OYXA 4KHPF 1G3OA 2J9DA 2OLWA 3JQKA 2DNQA 5ETNA 1IR2A 2FZCB 3OR2A 2ZVIA 4PRFA 3AOBA 4F4WA 5C42A 2V4JB 4J9KA 2MYFA 1QUVA 1MWQA 4NL5A 4C2MA 2HG4A 1A0OB 1NPRA 1B0VA 1R8PA 2PA3A 3FFIA 1OYDA 4NASA 2RU9A 3CCZA 1FK9A 4RNNA 1NNDA 3D1OA 3T1YF 2PGCA 3TEHB 2RRAA 1B4SA 1WDDA 3A8IA 3TNVA 2VU5A 4N8OA 3GSDA 4TLQA 3G8SA 1IM6A 4YY3J 4ANCA 4KPCA 2AQ4A 2CQGA 2AKWB 4ZVQB 3TVYA 4OMFG 1RT6A 1SC3B 3IWLA 2HIYA 2RD5C 2C2MB 1GXUA 2CDQA 2VPWB 4CLSA 2FTRA 3V6DA 2FUG9 3MI7X 2ZKUA 5EHHA 1T9TA 3X3UA 2MHNA 3N9UC 2OHDA 5A8WA 4I67A 4CQ1A 2DR9A 4JI6F 3FBBA 4OIXA 4JV5F 2QLJB 3V6DB 3BKTA 2HFUA 3TAPA 2RDIA 5T7LB 2ERRA 3IM9A 4QIFA 1YITS 1PC4A 2FJBB 1UETA 2V8DA 3DHWC 1UJ4A 3NGDA 3N79A 3UR0A 2A18A 2UVRA 4WE1A 1S5ZA 4UZBA 1REVA 2XM3A 5CXTA 4OI1A 2FLNA 3QAEA 3JSYA 2DNLA 2XS7A 4MMOA 1HR0J 2OPRA 1LWCA 2F3JA 4LVOP 4WE1B 2HPUA 1CEZA 2CUYA 4IUFA 3GWCA 2B4UA 1REVB 5I3PA 4E0DA 4LBHA 4U8VA 1PBAA 2ZZTA 1KR4A 2FHMA 5HMWA 3PJ9A 2OPRB 1LWCB 1FVQA 4NZ6A 1MU2A 4N8NA 1D09B 3GIMA 3E2EA 4IH6A 1XN9A 2HNZB 5IFMA 4ELVA 1TL4A 3KFWX 3FBFA 4RU9A 2XBPA 1RWPB 2R8KA 2A6OA 4RBVA 2BABA 1MU2B 1NH7A 4CNYA 2DHGA 1LWEA 5KFGA 1JXEA 2KB2A 1FRKA 4GO7X 3H20A 1HWLA 4XPEA 1QD1A 4I6WA 1JNZB 3AH6A 2AGPA 3WBZA 3HHKA 3NLCA 2VQFF 2V67A 3W60A 1C1BA 1NHKL 2HS3A 2PSZA 2BOAA 5FDLA 5DDPC 3IA0A 4NI2A 2C42A 2N3OA 4FF3A 2HLUA 3G6YA 4I68A 1QSLA 1GMUA 3D0IE 4OI6A 3HMJG 1B64A 4EGLA 1C1BB 5IC4B 2RQ4A 4M5LA 3SMZA 4WKRA 4NYZA 1RACB 2PC6A 4RJVA 3I82A 2RQMA 5J2QB 3T5HA 1CLFA 3DXSX 1HYSA 2GW8A 2H1YA 1E6VB 2OMOA 2VASA 2H3EB 5KT2A 4RW6A 4C8ZA 1BD6A 2HHPA 1T11A 2MKKA 3TUIC 4X84A 2ABYA 1CG2A 3I4HX 1GX6A 1B7YB 4E2FB 3F56A 2XHWA 1DTQA 5DDOC 1VQOS 1RHUB 2A0FB 2APOA 2DBBA 3VZIA 2V0NA 3KDOA 2Q79A 3H5XA 3G4SS 4C3KA 4W90B 2RIJA 3FEZA 5CYQB 3PHEA 4I4BA 1NXIA 4O44A 4JI4J 3GJTB 2CQIA 4WF9Q 4DPYA 1DTQB 5J1PA 3GE9A 5F8GA 2BJ7A 4M5HA 1HNXJ 1HBNA 1WNEA 1LOUA 4NLSA 1FWLA 1EB0A 4DR4F 4C0BA 4EEYA 2G0IA 1DQ8A 3Q23A 2V69A 1PYTA 4LF4F 3AHPA 2FJEB 4FF1A 5L38A 5AT1B 4ERDA 3IR5B 4USMA 2AYGA 3J81j 5E3AA 3RU0A 1DBDA 1NH8A 3UD5A 3CJRA 1FJEB 2R8IA 2OPSA 2DGQA 3A8KA 4PUOA 3IC1A 5K8MA 1VC5A 4MAKA 2VG6A 4KHMA 1HHSA 2WVEA 4DQSA 5KG3A 3AB2B 4B02A 3KTQA 2HHSA 4RPFA 4LFBF 3ZXWA 2DITA 2A2CA 4YFUA 1RXOB 5I42A 4DR7J 2VG6B 2K3IA 4RNFA 4J9VA 2WB1D 2CNNB 1S9GA 2EFNA 1S0VA 4HACA 3KK1B 1AT1B 2IVMA 4ILMA 3CCRS 2WBRA 1X0PA 1M1KT 4IR1A 1PJ7A 4NA1A 4DX5A 2DHSA 1C2PA 1S9GB 1HNWJ 1RI7A 4KY3A 4B3MJ 4CI0B 4NZ0A 1RGVA 2RSQA 5F8LA 1AB8A 4YQWA 4ED0A 2DRAA 1U1PA 5DG7A 3A8JA 3J81Y 1WHXA 2J7UA 4RZRA 4IFVB 1N32J 4NEZA 3UQSA 2HVZA 4ETXA 3QGHA 1RLCL 4PQAA 3N6LA 4RNOA 4PG4A 4CO3A 1VJQA 5ITHA 3RAMA 2A3JA 3QNWB 2BE2A 2OFGX 2YPZA 1CJVA 2XI3A 5KFWA 1BQMA 1VBXA 2J9DE 1X7VA 1RSCA 2ILZA 4QWBA 1YHQS 2QMWA 3DOMA 2QJ3A 2KZMA 3NS7B 2KKHA 4ECYA 3TUPA 3D0HE 1CJVB 4K4SA 3MEKA 4QIVA 4ZCIA 3J7YU 2E1RA 3H0PA 4IG3B 4TXSA 4N76A 3DOMB 2V9WA 4GKJF 3FQKA 2YQ0A 4DQPA 2CQ0A 4QW9A 2BKOA 3DLJA 5CA5A 4R8UA 3EUNA 2BANA 3QSYB 1JLFA 4DR5J 2HVHA 3K59A 4MK7A 2G13A 2XEXA 2I5JB 2J9CA 2BOPA 4R8UB 5K5MA 1WKKA 2BANB 3LP0B 4CT9A 3H40A 2NPIA 4DL7A 2B9YA 4V19X 1DHMA 2EFVA 2RDDA 2CNKB 2N4DA 4EZ9A 1FCAA 3EGZA 3JAMY 3KDNA 5DGAA 1WF1A 1X4FA 2GFFA 2HNYB 1N5TA 3KHHA 3OFGA 2M88A 2FLOA 4HLBA 1BE4A 3OXGA 1NDCA 4DR3F 2ZH4A 4I2QA 4GVBB 4QR1A 3SSSA 4URQU 1JKHB 2NREA 4PZVA 1FKPA 5K14B 1OJ4A 3MDFA 3R1HA 3B82A 4NEYA 4RW7A 1H2VZ 1R6VA 4I6AA 2K8GA 1RCOB 2E5GA 3AA8A 3QBCA 1MW7A 2ZH1A 3VQTA 4PQUA 4EI2A 3T5JA 3CD6S 2UXBJ 4C8MA 1H0HB 4UTGA 1ZAVA 3EX7B 2D9PA 3NGRA 3KWMA 4F4ZA 2KG1A 1H7WA 4N47A 4OYAA 1RTDB 5KFQA 4NYPA 2BXJA 4FZVA 3C2PA 5LMNF 2KFNA 1KHVA 1RWNB 4YB1P 3PX4A 3UNYA 2O67A 3BYPA 3KHRA 3BSCA 4W92B 3CCMS 3DRSB 2W4PA 3THTA 5DM6Q 2HFZA 3EGWB 1X4CA 1O5JA 4P6QA 2AJ0A 4C8YA 4DSLA 4P52A 3MM9A 3MURP 2CRLA 2E7VA 2VKZG 3BGRA 3PTWA 2AYEA 1YIJS 1UA0A 1JNRB 1FKOA 4TY8A 2H4YB 3VAGA 5FLXY 4NMLA 4B9UA 2ZH6A 4A8YA 3BV8A 3HSDA 4DL2A 5HROA 3GILA 2R8GA 2YY3A 4J9NA 2WSFC 4K4UA 2ACMA 3BGRB 1IQTA 3CD7A 4YY3F 3W2VA 3BDPA 3R8YA 3TA0A 2V2QA 2X7IA 2ZJPQ 1UAWA 1MMNA 4IG0A 1Y9OA 4Y34A 3T6BA 3RYLA 5HBMB 1WD6A 4C98A 1SPBP 3W2VB 2E9ZA 2XQCA 2IYIA 5J2PB 3MMCA 4JP8A 5KAKA 4DR1J 1N6QA 2IA6A 1SIWB 3QJJA 2W9CA 4ZOSA 3BQ0A 2DO0A 1WG5A 4WFZA 1ZH5A 3UN2A 3CF5Q 3BPDA 4YN3B 2EK6A 3MGJA 2HQIA 3NGSA 5DETA 4YR0A 1TL5A 1SH2A 5D3GA 3FCHA 2FJAB 5AE1A 3UVJA 1IXKA 3AA9A 3UN3A 4Q43A 4LSNA 2OPQB 3KJQB 4P2FA 3G96A 3PVXA 2XCAA 3VAJA 2WW8A 3QQCD 1JLAA 1HR0F 4DR6J 1KQKA 3UVJB 4N5SA 4LSNB 3UN5A 4QYZK 1KEKA 4PYDA 3DC2A 1FJGF 3IWNC 3EYZA 3MAHA 2OFHX 1R0CB 3GB0A 1C0UA 1WTFA 1RU2A 1W26A 3MM8A 4XTTA 4Q44A 3S1TA 1SV5B 4YUDA 5B0CA 4TKTA 3M1VB 4LF8J 2NS1B 3FSXA 5K8OA 4NRTA 1R7IA 4L72B 1AUSL 2VD3A 2FVQA 2DGSA 2HVEA 3IRXA 4OZ1A 1U0HA 2VA3A 4O4GB 1EX8A 4KGZB 2VOOA 2ZE2A 4HI2A 1UVNA 2VC0A 1GX5A 3LA0A 2HFVA 3D5MA 4KH1B 1N5SA 1Q5YA 1E6YB 1FXDA 3MUMP 1UZHA 4Q8FA 2ZH9A 2GCFA 2XLJA 2ZDPA 1YRTA 4MJKA 3HZGA 2ZE2B 3DFEA 3E3XA 1TQLA 1Z2ZA 4P71A 3OTBA 1N0UA 1S76D 1P6TA 4ZP7A 1N48A 1YX2A 3DI6B 3DOLB 1S99A 5GMEA 3AFGA 1SUQA 4I7FA 1WHVA 2AEFA 1UZDA 4C0HA 2C2ZB 3CJQA 3SZ2A 2VF3A 2PEHA 4PXDA 4RUHA 2ZFHA 4O3QA 1VQNS 1U47A 4I7FB 4C8KA 2EC0A 1TK0A 2K3KA 1NCLA 3VZHA 2GIRA 2NSCA 5JJBA 3LF0A 3D3CJ 3RAXA 2W7AA 4JI7J 1S77D 2HKEA 3SIPB 4UY8T 5MLCV 3MCOA 1JWWA 4DS5A 4KQZA 3RBXA 3W62A 1CS4A 2EFOA 3CUNA 2FY8A 2WZ1A 3PEJA 3IG1A 4DV5J 3HHLD 2DJWA 4JYAJ 1AFJA 5J2MA 5IT9Y 5F8JA 4RLEA 1FESA 3AOAA 3VCDA 4A48A 1CS4B 3RBDA 3D6FB 3UPFA 4HHJA 3OFEA 1N88A 2CPZA 1QSSA 4JI4F 2VFTA 3ULHA 5J2MB 5DLGA 2YNHA 1S1VA 4ID8A 3HSJA 4B9TA 2C2RA 3M8WA 3CJ8A 3ITHB 2G1DA 1HNXF 3IBCB 3P5BP 4MIWA 3G71S 4HL9A 5D4NA 1NK4A 3PDNA 3M2UA 2YNHB 3D6TB 5JVHQ 1WKJA 3F0NA 5C24A 1S1VB 4X4VA 2J9EA 4ZJLA 1SJ3P 2MQOA 2YWKA 4DDFA 2ZWPA 4FYXB 2GJ2A 2XGPA 1SJ4P 5C24B 3OJUA 4J9LA 3CO0P 3RAQA 1BMQB 1FRMA 1TV6A 4O3NA 5A0YA 1WC6A 1LV5A 1PILA 2ZOFA 4CWBA 3UCGA 4F3QA 5GADU 2E1AA 3PKYA 2R4FA 1BWVA 2QX0A 3LP2A 4FYDA 4DV3J 3C14B 5FJ4A 3OVBA 5A0YB 3A8EA 3ZZYA 1XMOJ 1AZSA 3W9JA 3KG4A 4TY9A 1CVJA 1RWMB 4DR7F 2CQBA 1BLUA 2OGUA 2V5HG 5KFVA 1NLKL 1NZAA 5H9FJ 3PYDA 3GJSB 4C11B 3A1YG 1S49A 2MDAA 1RKIA 1S1UB 1LWFB 3CCQS 1UWAA 4F25A 3FUYA 2VZ9A 4H4KC 1UA1A 5AE2A 2EBEA 4HYKA 2N7CA 2F65A 1ZTTA 4B3MF 3G6VA 2PFDA 4EUVA 1K47A 3HVTA 4OYWA 2VQEJ 3QFWA 4QR2A 2E1MC 4FNHA 2UVVA 4EBCA 4ZLNA 1N32F 1RT4B 4KBIA 3AT1B 2MQMA 2CQ3A 4D3HA 1LK5A 1ZYQA 3IS9A 5BYQA 3LQVA 3IAM9 2ZHBA 1T9YA 1RAJA 4LR9A 5KG7A 3C3LA 1KOHA 1U1MA 2JEJA 2DK2A 4DU7A 1EKRA 7AT1B 4J5OA 5AXKA 1URNA 2DGOA 2D69A 4J91A 1VBZA 1S7HA 4UUXA 4Q45A 2C22A 2YNGA 3DLKA 5LXRA 1BQNB 1IN0A 3RBZA 2HHUA 5E3CA 2BJ3A 3PNIA 3H4DA 2FY1A 3EDRB 2DR5A 1KQSR 2YNGB 1H73A 3DLKB 4B9LA 2R8JA 4I2PA 2R7TA 2R2SA 2XO7A 1IJFB 4DR5F 3CIZA 2L9DA 1Q95G 4BLGA 5KFBA 1AROP 4U67Q 2FGCA 3CTRA 1OY8A 3KK2A 5A6WA 4YOEA 5B0AA 2FVPA 4CH1A 2FJXA 4O3SA 3CDAA 1CJKB 3VTIA 2C28A 3SFUA 1N5YB 3M9OB 4FYYB 1VQSA 4BDPA 4DPXA 3O1LA 3KK2B 3VALA 2AX1A 1J5EJ 3GLJA 1AXQA 2LU1A 3AAWB 4JI8J 3RR7A 4LBPA 4DV0F 1W2BR 1T9VA 2ZUGA 4M5DA 2BQRA 3TI0A 3R97A 3NNAA 3PO4A 3AD9C 4ITSA 4MT1A 2CPJA 3R3TA 4UOCA 4EMDA 4LT6A 1LKZA 2RAQA 4Z2XA 4TLRA 3FGVA 4Y2AA 1TK5A 1H38A 3Q86A 4URSA 3HSGA 3PW0A 2DT9A 3G82A 2WHOA 5B0DA 4M5DB 3ISZA 5CD4A 3LANA 4AL5A 4OV1A 2M0GB 6AT1B 1QTMA 4DV2J 5GADI 3HHLC 1RT5A 2QMXA 2UXBF 3HFVA 3TARA 3K57A 1Q4RA 3G82B 2HQFA 3HF5A 1SJRA 2IY5B 4A8KA 1UWBA 4BC9A 3C16A 1K8AT 1FD2A 4AL6A 4ZCKA 3VGTA 4NRUA 3HM9A 5B0EA 3HKWA 1RT5B 2VONA 2UVWA 3L7PA 4QZVB 5H9FK 4ZHRA 4LR8A 3V6JA 1UWBB 1FJCA 3RW7A 3C16B 3CVKA 1QE1B 3H7HB 3MEEA 3DOKA 2N82B 3MD3A 2BKPA 4K8RA 1S10A 3MM6A 3GMGA 4OHXA 3D67A 1UVMA 4Y2IA 2HW3A 3SSQA 4V19J 1Y00A 3QSIA 4DSJA 5KG6A 1TR0A 5D8HB 5EX3A 3DOKB 5CH7B 2C2KB 4JI1J 1Y5NB 1X4AA 1OWXA 3AXMA 1KFDA 4Y28C 2R7QA 4WTYA 3JYTB 1HNIA 3RJMB 3OHAA 2HBZB 2G2YA 1CQMA 4WFNQ 4HH0A 2W2MP 2BW7A 2HZVA 4LIWA 4B3OA 3U1NA 1WEYA 4OZLA 2CZVC 1NAQA 2C3UA 4KHRA 6FDRA 2ZOMA 3MWBA 4FXVA 3R7SB 2XS5A 3N01A 1U8WA 3FMWA 1J5OB 1M0SA 5D0RA 1F9FA 3TX0A 4PWDA 4DR1F 1U09A 2I1RA 3BO3A 1XJWB 1R3NA 1VQ7S 3J7ZT 2I38A 2JX2A 2FLLA 3SCJE 4GO5X 1RP5A 1FRLA 4ED3A 2JEGA 3KMSA 1FDNA 5GAHI 3LP1A 1V3RA 4PWDB 2RUGA 5ETVA 2ZKTA 4B3TJ 3DKDA 3C66A 2DGUA 2WTFA 3JQJA 4DV7J 2EXUA 1UCNA 5M2RA 5LT5A 1OYEA 4UUWA 4LSZB 2ZZNA 4FYWB 4IRKA 1GQEA 3CC4S 5KG5A 1TUVA 1X5PA 3PV8A 5J1EA 2BRLA 4LFAJ 5KTQA 3EDQB 4OLPA 2BJ8A 4DR6F 1RZMA 3SBMA 2GO8A 5EX0A 3O6QA 4WBFA 2R2TA 2MQQA 1RABB 5B0BA 4DQRA 1F5CA 5D0HA 3KLGB 3ET6B 4G1IA 3FDSA 2W01A 2W2PP 3OTDA 5J1EB 3QO9A 5L9XA 2B4OA 1P1LA 3L4BC 2MTLA 4ZVGA 4LF8F 1ACMB 3OTCA 3GYNA 4WCEQ 4H4OA 1SL1A 2IRXA 2YNFA 1U1KA 3CCLS 5IT0A 4KFBA 3CD0A 5IM0A 5LL6d 1WOPA 3QO9B 4DLGA 2BDPA 3PO5A 3VVTA 2I8EA 1WI8A 1AYEA 1JB0C 4H4OB 4MYUA 3DLGA 4MYTA 3OBIA 3S7RA 3UDCA 2WOMB 4KFBB 2PIIA 5IM0B 3CC2S 3R1LA 2QZ8A 4XO0A 2HBRB 3LOUA 1GTHA 3MOJB 2NZ4A 1B0PA 1IBCB 2VKRA 4P7VA 4CYUA 3HPOA 5ETLA 1UFLA 2RT3A 4MK9A 4ZMMA 4FPIA 2UXDJ 4NLXA 2M3DA 2MZQA 2OELA 4IH7A 1XWLA 4M5IA 2PMZD 3T3FA 2KT3A 3PFEA 4CYUB 1KQGB 4K4XA 3CC7S 3KLEB 4G1PA 2FVSA 3HD1A 3CCVS 5L1IA 1HI1A 2NQPA 3I96A 3CW2C 1S57A 3HO1A 3VV2B 3A3PB 3BYRA 1RAEB 4IOBA 4MFBB 4AD6A 4R25A 2GO9A 4RW8B 3UDVA 3ETOA 3WHIA 1SVDA 3U7JA 2MY8A 1ICEB 2NCKL 4JYAF 3C6UA 4USVA 2GVZA 1IR1A 1YG0A 4DHVA 2VH7A 4GKKJ 1PYOB 1RA6A 2H48B 3L7OA 3MMBA 3C6UB 4ECQA 2GVZB 2I9SA 2RHSB 2AEMA 5IQQA 1SL2A 3JS9A 2LQ5A 2E5LJ 5M2PA 3FZ2A 4DEZA 2ALZA 2Q43A 4F3MA 1G2EA 2Z30B 3DYAB 1IBLJ 1JLGA 5MAOA 5HVHA 2PD1A 2LA4A 3KLFB 3GG0A 2E1CA 3FC9A 4JV1A 1SQFA 2VJUA 2ROPA 1J27A 4MKVA 3UR3C 3CNQP 3PW5A 1TL1A 4PR6A 1JLGB 2WVFA 1PCAA 3H4BA 2CPIA 1VQ9S 4TU9A 3GR0A 3MAAA 4IO1A 3PR4A 4EO8A 1HPZA 3GJQB 4DV3F 1WACA 4WIQA 1JJHA 1F9HA 3LALA 3MMAB 1XMOF 2DNYA 4O4RA 2V68A 5KFFA 3TYTA 2ASDA 2NXJA 3CE8A 3GIIA 1S12A 1S72S 4X4QA 1VBKA 2EG2A 4OQJA 1LNQA 1KQFB 2BW2A 3Q22A 3CJ4A 3UCUP 2DR8A 4ZVPB 2MHEA 4I1TA 3LWMA 4ZPAA 4CDIA 3AOCA 2VOPA 2HGNA 2JLEA 1P9QC 4I56A 2QG9B 2O1PA 5HJYA 1GFWB 3BB5A 2RKIA 5ETKA 5LSLA 2VQEF 2IA0A 1AUDA 3P96A 3DRYA 2VBYA 3QRQA 1X4HA 2DH7A 3DLBA 3PYEA 3W66A 1GXLA 2XY5A 3S01A 4DPOA 1NDKA 3D54A 2CPXA 2QSWA 3KLHA 2RKIB 5DJBA 4ZLPA 1JLBA 3J81U 2KRRA 4LMZA 2V4QA 4C7QA 2GVDA 5B7WA 1FNMA 3VAFA 4DG1B 3CXCR 1M5KC 2HGLA 2W4DA 4D3GA 4CLLA 4WP8A 3BM7A 3KLHB 2FQQB 5LM7E 3KK3A 3Q8YA 1U1NA 2DH9A 1CQNA 3K5PA 5KOXA 1K0VA 4Q0BA 2GVDB 1YKWA 2LQJA 1UJ5A 2VL1A 5F9NA 1KTQA 2FD2A 2B8QA 4KT0C 3H59A 1YQHA 4LBIA 2Z0GA 1C0TA 2Z58B 5KFKA 4LF5J 4IRDA 3QFHA 3M8RA 4PAAA 1RHRB 4OYIA 2MXYA 3M2RB 4Y65A 1ZBTA 4LF9J 4NA2A 4CO1A 5HP1A 2ASYA 1C0TB 4XIUA 3KLIA 4M95A 3CIMA 5THWA 1RAAB 1KLMA 1FDDA 1ZAXA 1HD1A 3I0RB 2ZZMA 4M5GA 4PCQA 4K2XA 4DSKA 3D6MB 4IR9A 4ECVA 5T14A 1J5EF 4ZIVA 2F8EX 1X4DA 1ROFA 2HHXA 3ZTQA 4JI8F 1WF2A 4ZJOA 2HRTA 3M32A 4B3RF 1ZZNA 3O44A 2IMOA 4AQYJ 4F4YA 1ITPA 1YRUA 5KFHA 3SSRA 1YDLA 2V8HA 3HFZB 1KDNA 1SKWA 3DMJA 1X9MA 2QFIA 1F0XA 3IM8A 3I31A 3JAMU 3M32B 4ED5A 2YTCA 3K5NA 1EZZB 2MZ1A 3NL0A 2AJ2A 1EP4A 3U27A 4G3IA 2VPYB 4DV2F 2YNIA 4NMXA 2DHXA 2KHCA 3ILJA 2K1RA 4UOGA 2PE8A 2VPXB 2MGZA 4DFKA 1BY9A 5KFUA 4J9MA 2QA1A 4OI2A 2XULA 5AJ3J 2OP5A 1P8GA 1BWEA 4ED1A 4DUTA 1WG4A 3PYGA 3QIDA 1DRZA 4CM0A 2WSEC 1MMLA 3W8GA 2BKNA 2BACA 5KFCA 4F4XA 3GG1A 4JBCA 2MGZB 2NPFA 2F4FA 3IFEA 3HVRA 5LJ5Y 5ETMA 4WJBA 3SEOA 4OJGA 2VPZB 1HQEB 4WP9A 2OEJA 1HMVB 1XR6A 2IM0A 1ZPVA 1YBUA 2B4VA 3CJTA 1PBUA 4LSLA 2M2BA 3FBEA 3ICLA 3T19A 4FN5A 4JI1F 1RTJB 2LQBA 3CO9A 3BS9A 1SJFA 4NCGB 2RNEA 3DGPB 2PDAA 1H72C 1LXJA 2B51A 4LSLB 3MM5B 5FLXU 2Z2LA 4DCPB 5IC6B 2XZTB 3FEXB 2GMLA 3MR6A 3BREA 1R27B 5J2NB 2EK1A 5HI7A 2MKSA 3NRBA 2GQQA 2BVZA 4TQRA 2AWZA 5ETQA 3HHDA 2F63A 1DJ0A 1S1TA 2XMMA 5D4LA 3WIVA 2CFXA 2G9OA 4RW9A 4HR2A 1R8AA 1NB2A 3LTOA 2HYIB 3L7UA 2F4VJ 1FWKA 4ELUA 1S1TB 4KKOB 2HQDA 3O3LA 2A6MA 2EKNA 2ROGA 2HHQA 4J90A 2O5DA 1NK6A 1GH8A 3W9HA 4RW9B 2DGVA 4B3TF 1S9FA 2YKAA 2CQCA 3MM7A 4DV7F 4A8WA 3IAS9 3NS6A 2L3MA 2FHKA 4O0NA 4YR3A 2DNGA 1D8ZA 1XQIA 1Y4ZB 3CB4A 1KHWA 1TVRA 4OYOA 1YJNS 3CULA 3Q2SC 2HBYB 2Z56B 5F3TA 3ISND 2PI4A 2EFQA 4LFAF 1HQUA 2QE5A 5HLFB 4YB5A 5CYJA 2HK2A 2ZHAA 4R5PA 1SB6A 2ROEA 4KV8B 1TVRB 1UW4A 2W9BB 1SKUB 5D4OA 4DPWA 3MPDA 4FBUA 2RILA 4PXCA 4ZP8A 3MF5A 1QM9A 3BKFA 1RYSA 4FNIA 1PC5A 4R5PB 3CJ0A 1S1XA 4YEAA 2ASLA 3V6HA 4HHUA 1VFJA 4OYZA 3GFHA 2ZD1A 4RWWA 2YX1A 4B9MA 2B3TB 2WK4A 3MPUB 5K8NA 1VQ4S 2KHDA 3RB3A 1KOOA 4CM2A 1Q7YT 2XYPB 1YBTA 4DFMA 1JJCB 1VQKS 2QLBB 3B54A 5HO4A 2J8AA 2DYAA 4I6YA 1FX2A 2AYBA 2P2CB 3HT0A 3UD4P 3KYLA 1FRXA 4F8RA 4X65J 3VAHA 1NKCA 3GV5B 2MKIA 4KPYA 2XWYA 3V6KA 2BE7D 3GSIA 2UXDF 3ILLA 2GHWA 2XY7A 1SC4B 3I9V9 1HWJA 3D28A 1R8BA 3I9ZA 4JV2A 3SQOP 2KG0A 1EHWA 4UF4A 4OYMA 1Q82T 3JSBA 2ZOGA 1RAIB 2Y8YA 2RS2A 3T9ZA 5K8PA 2DNPA 5GMDA 2OSQA 4ES2A 3R7BB 3KUEA 2I6WA 4C3MA 2Q1LA 5KFAA 4ILRA 1TL7B 4DV1J 3TWZA 5GAGU 5GAEI 3QT7A 4GKKF 4E98A 2HMIA 3M6WA 5H9EJ 5L1JA 2YKOA 2HFNA 1JX4A 3RRHA 1KWMA 5IT9U 2AZ1A 3I0SA 4PPDA 3HSZA 3P4UB 2E5LF 2HMIB 1TL3B 3K8WA 3A3NB 3LGNA 1ZETA 4Y00A 4QR0A 4RUAA 2CNOB 1GMWA 5A8RB 2V4JA 4N41A 4U7UK 2ATCB 3TOQA 1IBLF 3ETMA 1T3OA 5E33A 1U6BA 3DM2A 5D78A 5HJXA 3T9NA 4ZVFA 3J7A1 4CCHA 3B78A 2AGOA 2A10A 3SYZA 3AQPA 4A8SA 2HRUA 3K58A 3N5BA 2C2NA 1FERA 1HLWA 3DM2B 2ZM6J 3GQCA 1UPPA 2AJFE 4NLUA 2CJQA 3O8WA 3W5XA 2OPPA 4FDFA 1Q7LB 2XYGB 1T9XA 4IOCQ 2C3OA 3SCLE 4HVZA 2NXEA 1NM2A 3SV4A 4ZPWR 1PIEA 3M9MB 2ATLA 5CHCB 1FJ7A 3CMES 1ZOTA 1NSAA 1CSJA 2OPPB 5RUBA 3CSKA 2FB0A 3VF0B 3CJSA 5F8HA 2GV1A 2YWHA 3SQGA 1ZM2A 4CO4A 2YXLA 4DX7A 1G4CA 2OO4A 1DFDA 2HK3A 2ZH5A 5T7LA 3N6MA 4L76A 1JQGA 2LEPA 3ELHA 3E01A 3SQGB 3RRGA 3QRRA 5F8IA 1WOSA 3OL9A 1B99A 4AXJA 4OFZA 3J80Y 2CQ2A 3T41A 1YJUA 5CD4H 1RWVB 4UY85 1YK9A 2GHPA 2E5JA 2DY1A 3C6TB 3E01B 3VVUA 1D1UA 2X51A 8ATCB 4ECXA 4USUA 4G1QA 3SCKE 5HL7Q 4P2SA 3BBBA 2CPYA 4BHQA 3ISNC 2WVCA 2PI5A 4YHHJ 3K7RA 4OZ0A 4ELTA 3OFHA 4G1QB 4FP9A 1SC6A 3WX4A 3JQMA 4TQSA 5LSRA 1FJGJ 1VIXA 1LK7A 1UW9A 4WFYA 2HNZA 3LUYA 4DSEA 2CPHA 4NLOA 1K1QA 2IAJA 3DRXA 2CXEA 1WHYA 1V5VA 4DLEA 4ILLA 1JK9B 4U6PA 4KH0B 2XTJP 2QLFB 4LF5F 7FD1A 1UFWA 3W9IA 3P49B 3GIKA 1F60B 2V6AA 1EJ7L 1RA7A 1TK8A 2F40A 1NJIT 1FD8A 5KFDA 2IAJB 2DGXA 2GMJA 4LF9F 5C25A 1OQ6A 2F1FA 5F8MA 4K7QA 5GAGI 2J6TA 5H9EK 2IJRA 5B0FA 5B08A 1FFGB 4DSIA 4X4UA 3PX6A 3NOGA 4EK2A 1XR7A 3SV3A 3MMJA 1R8CA 3FCVA 1NK0A 1N52B 2CJAA 4IO9Q 5C25B 3Q89A 2Q66A 5FIIA 1U26A 1L3TA 5KFLA 5KFOA 2YX4A 2OD4A 3EXCX 4Z7CA 1RK8A 2FJWA 4CLUA 1HL6A 5J2QA 2WBMA 2D7SA 3AB4B 9RUBA 4AQYF 2JJ4D 3R2DJ 4USJC 4DZDA 2ADCA 1E6VA 4NLWA 4OJ3A 1RB0A 3P45B 2Y1LB 1UVIA 1Z2LA 5KG2A 2CADA 3DLHA 3GPAA 5E3QA 2W1BA 3CGIA 5KFTA 2VG5B 2LECA 4CH0S 1LW2B 3SDEB 4QIGA 4C97A 2EFGA 1LFWA 3H2VE 5CYQA 1KLNA 4I64A 1GXTA 3UDLA 1FO1A 2I2YA 3MR2A 4C8LA 2AT1B 4Y2CA 4RW4B 2RUSA 3M30B 4CO0A 5HMZA 3VQSA 2C2OB 1IBMJ 3TX8A 1DURA 1Y7PA 5AJ3F 2D41A 2R7SA 2Z8QA 2WAQD 3OXLA 2GAGC 2D3ZA 1FDAA 1NK9A 3MECB 2FDNA 4AFFA 3F44A 1AFIA 2HAFA 5DZ7A 2WRMA 4EU0A 1KN6A 4ZVSB 1A6LA 3W7BA 3M8QB 4KGMA 4M1KA 5KT6A 2ZJQQ 3NG8A 3RUBL 1NJXA 2QL5B 1YTYA 2V2VA 4FS2A 5EWGA 3LWLA 1NDLA 5F3ZA 2ZITA 4ANDA 3I4PA 1F3VA 4ZITA 4DR2J 5HQMA 2MQNA 1BXNA 3MTJA 1HNVA 1I5OB 1SI9A 3C8YA 2RE1A 4ZVRB 2LP4A 4WP3A 2LXIA 2V8GA 5IXUA 2ZEJA 3W2WA 1VK3A 5F9LA 1GEHA 1VOMA 2QFJA 3AODA 4PYAA 4NCBA 3QT6A 3A12A 4QIWD 4DPUA 4YDDB 1HNVB 5U47A 1IQZA 4NXMF 1RCXB 3W2WB 2W2OP 4OLOA 4TN2A 2QO3A 3FKBA 3U02A 3A3OB 3C46A 3LPYA 2KJVA 3QZ7A 3MEDB 2YPYA 1X8DA 1QDUB 1GAOA 4CLFA 2DCLA 3KK1A 1EQMA 3Q8QB 3RW6A 1Z4UA 4ZVHA 1H7XA 1FFWB 1V3SA 2BM0A 2RU3A 1S97A 2M52A 2HZCA 4K4WA 1RT2A 2JFDA 2F4VF 2B7CB 4EYIB 3CDUA 4DV6J 4L75A 3G6ES 1NKBA 3DLEA 3SCIE 2E5IA 1FRIA 3EGNA 2Y1RI 4YR2A 3TVKA 3BH6B 4X4PA 2HQ3A 4IFVA 4X4SA 1HBOB 1OSDA 1NU4A 3QLHB 2D9OA 1RT2B 2KH9A 1KC8T 4OJ1A 5E41A 4ECWA 3HDSA 4UZCA 1RBOB 2G4BA 3DLEB 2NLWA 1YBAA 4A8OA 2C3YA 2XO6A 1NB7A 4WKYA 3CMAS 4J9QA 2BV3A 4QJVA 3TQEA 1F5BA 4KB7A 3DGVA 2Z57B 1AA1B 2HAIA 4L74A 1IKYA 1OO0B 2AGQA 3D1HA 2ZDOA 2K06A 1TAQA 5IV3A 4PXEA 2VV5A 1RAOA 4IG3A 2Y0SD 1EAYC 2MKYA 2LXUA 1NJZA 1HWUA 2LYVA 3KUHA 1IKYB 2UVUA 3I87A 3ENWA 4H4MA 2Y1IA 3FQLA 1SIZA 3V4MA 2DIVA 4ZVUB 3NXZA 1S6UA 2Y8WA 1V5IB 4TYAA 2I5JA 3DDIA 3Q2TC 2ZH2A 4H4MB 2B6AB 2FGOA 2B56A 3LP0A 1OS5A 4ZLJA 5KFJA 3G86A 4ECTA 5FD1A 3M7VA 3M6UA 2HEKA 1A9NB 4DX6A 5D4PA 4X65F 4IQXA 1RQ0A 3M05A 2XMKA 2AV5A 4RR5A 2VFUA 3MFHA 5F0UA 3WC2A 3HZEA 2IRYA 1G6BA 4JI2J 3DRRA 1DQ9A 5I3UB 4OZJA 1R31A 2HNYA 4NZ7A 2CQPA 4QYZJ 3Q8VA 1U45A 4WU2A 1VQ6S 1ZM3A 4M5JA 2MMYA 1Y10A 1ZA1B 3TZYA 1XNRF 3DRRB 4GVBA 2W4CA 4DV0J 4F0MA 1VRTB 1B70B 1JKHA 2QV6A 1U1RA 5K14A 2L48A 1YJWS 1U2RA 2VHGA 2KM8C 4ED2A 3HX9A 3J7Z5 1T03B 1WSRA 4DOZA 2QL9B 3KHGA 2FHJD 5JVGQ 2DB1A 9ATCB 4DV1F 3TUJC 3UE2A 4NOHA 4ZP9A 3RG6A 4MKYA 2VFVA 1FX4A 2W9AA 3H42A 1RTDA 4P9SA 1JLQB 1R0AB 3MD1A 3CT9A 4DCOB 6FD1A 4XDDA 3LGMA 3NGTA 1S4EA 4Y6IA 3PX0A 1U1OA 4CH7A 3DRSA 5DLFA 5E3PA 1OY6A 4L3NA 1L5UA 3JSMA 2MJNA 5D77A 4U95A 2RF2B 4ECRA 3FSIA 2V2ZA 2GIQA 2C2DA 1HQ2A 1W7WA 1TMMA 2A1BA 2R8HA 5KG0A 1O6XA 1HBUB 3PRVA 1KD1T 4NLTA 3ZNUA 1GMVA 3JSMB 1U6FA 2YKNB 3I5BA 3N0VA 1CBKA 3LW5C 2UU9J 2CDRB 4P75A 2YH0A 3GJRB 1VLOA 3NEKA 1O8BA 4TYBA 2H9ZA 2B7BB 2HWHA 3MUVP 1RHJB 1RU1A 4G6VB 2VODA 4MIAA 2ZM6F 3VAIA 1C1CA 4DL5A 3OPKA 3TVZA 5D15A 3DDNA 4WIIA 2W8KA 4LR7A 3OR1B 4DF8A 3VHQA 1Y0HA 2DNNA 3A13A 1XNQF 2QRRA 5E5NA 5HBMA 1DARA 1C1CB 4F0HA 3NAIA 2DRDA 1T94A 4OZ3A 3V2UC 5KOWA 5J2PA 3QJLA 1H2UX 2YWWA 1RHQB 4U7UD 3W65A 3THPA 2KT5A 1D3WA 5DQGA 2DH8A 2O01C 2DIUA 4MH8A 2GJIA 1SC1B 1DZ5A 3NCPA 1TFWA 3KJNB 2LQ9A 5IZHA 2F8MA 4UW2A 2GNKA 1VISA 4LRDA 1B7FA 3SXLA 4KE5A 1T02A 3J7YI 4AXIA 4I0WA 5KFEA 4DXLA 3UW1A 2WSCC 3NBPB 5GMKa 1SCJB 2OPQA 7FDRA 1QUPA 4FKYA 3PIOQ 4KO0B 2IDEA 2ZH8A 1NK7A 3N5FA 3QWPA 4Y2MA 2POKA 1BC6A 4P2XA 1NKEA 1XIQA 5DG8A 2QGFB 1B3TA 1X5SA 4MTPA 3Q8RB 1EIYB 2C2EA 1Q81T 3R5GA 4NX9A 1RAHB 4FBTA 1VGYA 1APSA 4YHHF 1SV5A 2BYCA 2L08A 1FHTA 3M1VA 1DAXA 5DRKA 2NYHA 4WU3A 1HNZJ 2LQ8A 1O0PA 2DD8S 4O4GA 3T1HJ 4BWJA 1U4BA 2JWNA 1YZ6A 3BR8A 2P9GA 3BGUA 3WC0A 3PCOB 5HN0A 3Q8UA 1E6YA 3BEGB 3AXKA 3KXDA 4C8OA 1U8SA 4OHZA 4F4KA 2M8HA 5EUHA 4K4TA 2GA7A 4LIRA 5DO2A 5DG9A 1M5SA 2ZNYA 5KT4A 1HHTP 3G8TA 4IYQA 3GU0A 2JZ5A 3DI6A 3DOLA 3HD2A 1RHMB 1YJ7A 2LVWA 4C3LA 1JXLA 2DISA 2AJQA 3LO3A 3OW2R 1W25A 1VBYA 2QIFA 5AE3A 1UTAA 5KFRA 2PN6A 3RB6A 2BJEA 5A2QY 5KFNA 1QLNA 2OAUA 2VA2A 3R7NB 2R2UA 4UT4A 3PACA 4ZPDA 4K4VA 2GZOA 5T41A 1KP6A 2X1AA 4FS1A 4ED4A 4FYVB 1RWXB 2G2OA 4X4TA 3BN4A 4PG5A 2LFVA 4Z37A 4LREA 2RMLA 2AIRB 2J7WA 1R8HA 1X5TA 3TJ8A 4K4ZA 1NEEA 1CULB 3QWUA 1HKAA 1L3KA 5DGBA 2NXUA 2NXCA 3ZZZA 1F2GA 3ZTOA 1S9EB 1MMDA 1IKVB 4JUZA 3HJFA 1WHWA 1RE1B 2V34A 1EKSA 4ZN3A 2YH1A 2VC1A 3OR2B 4J9PA 2JLGA 2V8PA 5C42B 2YWGA 2XYHB 1IBMF 3OXFA 4O3OA 3HHLA 2XCPA 3ITHA 3RZAA 1X4EA 2IVYA 1Z1ZA 5K9FA 3WDOA 4DF4A 4OX7A 1WC5A 2DEJA 3H98A 2VDHA 2IFXA 3FFIB 1M90T 1WI6A 4J9OA 4FF2A 1FK9B 1VIOA 2FJDB 4ZIWA 3HHNB 4LFCJ 3HHLB 1Q1KA 1URRA 3N28A 1KONA 4C9DA 4PWUA 3T5LA 4CLWA 4DN0A 1YGYA 2AP6A 3BDEA 1RYRA 2HQGA 2M7SA 4DR2F 5G0RA 1RT6B 4QWCA 2DXFA 4BWMA 3GR1A 4LRCA 2LDIA 2EC2A 1VI7A 3GP9A 4ZPBA 4DSFA 4ZLLA 3UCZP 2E29A 2X1GA 2ZHOA 3C14A 5ETTA 3BJYA 3CDEA 2GX8A 5G0RB 5A8WB 3BKUA 4ZKAA 4QU7A 1X9SA 1IWGA 2HBQB 2XZDB 2E1PA 3K5LA 1YSJA 3FVYA 3GIRA 3PIPQ 2KVQE 3EICA 4C11A 4B08A 3HT3A 2DGWA 3G2XA 4OHVA 4M5NA 1S1UA 1LWFA 3U1LA 2VB6A 4IKAA 3I32A 5HSPA 3VGVA 3TW0A 4DV6F 1U7LA 2XMJA 2QA4G 3K8VA 4ED8A 3N6NA 2C3PA 2DHAA 3NCRA 4S0MA 4GC7A 1RT7A 3CJ3A 1RT4A 1T95A 4ES3A 1N34J 5D6GA 5DDQC 4NE9C 3FNNA 1MSWD 2R7OA 1ZZFA 2G1HA 2HGMA 1OY9A 2OMLA 4AYBD 3SI8A 1RT7B 2CQHA 3AJ1A 4DJBA 4ALZA 3R5DA 3VGSA 2MJUA 5HMXA 4PKDB 5LXYA 1XMBA 4USKA 2DO4A 3Q24A 1WORA 2KI2A 4RNHA 1RTZA 1DQAA 1LWEB 5KT3A 2I0XA 2VG7A 1BQNA 1FT8A 1TAUA 5HQ8A 2XG8A 1NMEB 4IOAQ 2F9JA 3KMQA 5FDLB 4DI6A 1U2FA 1YLXA 4NI2B 2VG7B 4Y3CA 4ANEA 3GCXP 3EZOA 4K5RA 1WSVA 1VQPS 3CDWA 2EKYA 3DDKA 3MOZA 1PO6A 3OVAA 3W5ZA 2KFYA 4CLYA 1RISA 2NZCA 2RHQB 3EZ5A 1TKZA 1CJKA 1S6OA 4JOUA 1HW9A 3KKFA 1N5YA 3FRYA 1KVJA 3KLVA 1U0SA 1HYSB 2H4WB 5DM7Q 1TKZB 4RW6B 8RUCA 1M5OC 3ZZUA 3FZBA 4JI2F 1FNXH 2MLYA 3CD5A 1H2TZ 1TELA 2LEAA 1RWUA 1PYSB 2MQ8A 2QLXA 2GHVC 4DN9A 1UMJA 2E5HA 2WVDA 4F02A 3VR1A 4B3RJ 4O44B 1YI2S 2CKWA 2HQCA 5LOQA 2IDLA 4K5SA 3D6HB 2GQCA 3CJKA 3EMTA 1TKDA 3KG1A 3MCSA 1HBNB 3UWTA 3QMQA 1WKLA 3WIUA 3WQPA 1FRHA 3KNAA 3PJXA 4U96A 2DVIA 2MSSA 1JLCA 2UZAA 3IRWP 4IQMA 3CJKB 3WZ0A 2HLTA 2AW0A 1U48A 1GNKA 2UUTA 1G1XA 4WXWA 1JJ4A 4ZS6A 1VCTA 3MEGA 3RR8A 1JLCB 1UP1A 1J2VA 2E44A 1QE1A 1TFYA 2OPSB 2D3O1 3ZTSA 2AMCB 4PUOB 3JTOA 1SKRA 4N56A 2DY9A 4J7CA 3BBFA 1IR0A 2MZJA 1T9UA 2D1CA 3MEGB 2XC9A 3IP0A 1N0VC 3EVOA 4LF7J 2UU9F 4QPTA 3DXBA 4B17A 2UUAJ 3GFYA 5AXMA 2BUNA 5I42B 1C4CA 1RBLA 1WF0A 3RTVA 2GMHA 5HATA 3JYTA 1OQ3A 3HHEA 1QSYA 3NNCA 2Z2ZA 4HACB 3KHLA 2AHOB 4ZA1A 5IV4A 2N4CA 3MZIA 1KTVA 4JI0J 1W2IA 2CZ4A 4N7TA 5F0WA 3W61A 1QAIA 1SKSA 1UFKA 5CYMA 3F73A 2PO4A 4F7VA 1YJTA 3MHYA 1J5OA 4C0OC 1YJVA 2H5JB 1T05A 2RQKA 4GRSA 2OTLS 1T9WA 1BHNA 2CJ9A 1IKWA 5CYMB 2J0QD 3JTNA 3M8YA 3LAKA 4Q5VA 4RUBA 1JLEA 3OTOJ 1I51B 2QT7A 1T05B 4OZNA 4KGXB 3MPVA 2FLPA 2E7XA 1B0TA 3BGFA 4PWWA 2BE2B 1IKWB 1SXLA 3QT8A 3NKYA 2Q6CA 3JXOA 2PMWA 1IBKJ 1K9MT 1M5PC 4R0EA 1BQMB 1X9WA 1VR6A 2JC1A 1JLEB 2JHEA 5AXLA 4HDGA 4GVLA 4NCAA 3R9LA 2FZKB 1QAJA 4L73A 1VS3A 3MXHP 1S1WA 3ZNJ1 4ZP6A 4ECUA 4AE5A 2WB4A 2JEFA 4J37A 2IBOA 1QAYA 3KLGA 3ET6A 3J80U 1C4AA 2GJFA 1L3SA 2PT0A 3TJ9A 4DMZA 2LKZA 1N56A 1FF2A 1VRUA 1S1WB 4J9RA 3ZO7A 1JLFB 1V3ZA 5LMUJ 1HNZF 1FTCA 2AZ3A 1TTHB 2W8LA 1RKJA 3ZZTA 4FXDA 2LMIA 1VRUB 3UNGC 3T1HF 1PJ6A 3KOAA 3DU5A 4L3KA 2UUBJ 1BUXA 3TA1A 1CJUA 3Q8SB 5I4MA 2MKJA 3VAKA 1PKUA 2WOMA 4PEOA 1HARA 3TZWA 3OV7A 3UD3P 3HCXA 1N54B 4QIEA 3MPWA 5DQHA 1ELOA 5EGYA 2NSBA 3CPWR 2CJYB 4A8MP 1NDPA 4HHHA 1CJUB 1GT8A 2M8DB 1BGXT 2RS8A 3QJPA 4CLTA 5KFPA 3P6YC 2P5VA 2PEBA 4JI3J 2BMBA 1RLDA 3M8SA 4B9SA 4I2QB 8AT1B 4ED6A 2MLZA 2MQLA 4HT5A 1F6TA 3KLEA 1FKPB 2H65B 3FMBA 3PHTA 2J76E 1RAGB 2HS4A 3O5TB 4CO2A 4YB7A 4RW7B 2B5JA 3G87A 3IBFB 3SFGA 5EWEA 1HFEL 2BX6A 1XERA 2ZBQA 3UI3A 4PQUB 3BO2A 4MFBA 1IUJA 4QW8A 4H54A 3ZTRA 1T3NA 2ZUAA 1P27B 4DU8A 4RW8A 1OPIA 1NSQA 3K5MA 3DRPA 1MLAA 3OLAA 1TUWA 1RHKB 1NRKA 2B5JB 3PJWA 3QT5A 4XAKA 2DNHA 4PG7A 1NK5A 2UUCJ 3RRKA 1GK8A 4ES1A 5KFYA 3DRPB 2XGQA 3ILIA 3RGIA 1H74A 3GZ7A 1NZ8A 2LLZA 1RAFB 2Y0BB 2RH3A 3P8BB 3D2WA 2E9TA 3MM9B 4FPRA 1VQMS 2VFSA 1RBAA 2JEIA 3CMQA 4ZK7M 2YWFA 4QYRA 3CCTA 1T7PA 2HVDA 1FKOB 2RRBA 4TY8B 3TP2A 3IR6B 3DYAA 2JC0A 3M4XA 2RJZA 4QOTA 5HROB 1X0FA 2W24A 4LFCF 3KLFA 1IWAA 2JL9A 2J8SA 4EO6A 3BSNA 3C15A 3DHXA 3CJ2A 5B0GA 2CJBA 4OYPA 4F36A 2IM3A 4NXNJ 3UDEA 3HK2A 5KFSA 1KS2A 1HWKA 4IG0B 2SXLA 4USWA 3BPSP 3C15B 2DHHA 3Q8PB 2IVFB 2NXNA 2KO1A 2F5GA 3B6BA 5SZTA 3NMAA 2OEKA 1VC0A 2CWKA 1Y3KA 3W5YA 3MMCB 5A6PA 1N6QB 3LAMA 4CZCA 3I5CA 3KUGA 2W9CB 3MMAA 2BBEA 1JXVA 3QGGA 4FVCA 2W2QP 4U8YA 3PEHA 1BQXA 4PXBA 4DCJB 2OTJS 4F2RA 1FKAF 2C1EB 5D3GB 3HP6A 2CQDA 4EFAC 3MCNA 2XB2D 2HZAA 2WONA 4C4WA 1K73T 2KU7A 1WEZA 3EPGA 1YWXA 2QLWA 2QA4S 2R7UA 3AY0A 1FA0A 1JLAB 2WONB 1XBWA 4RNMA 3HKZD 1OIAA 3LGHA 5DQIA 1KBRA 2P6SA 2H5EA 2J0WA 4LQ3A 5KG4A 1N34F 4KC5A 4F0KA 1IVZA 1VLYA 4IDKA 2AX0A 1C0UB 3MM8B 5CZVA 3TEGA 2BRKA 4DG1A 3IRXB 1JIHA 1Q78A 4IDKB 1U0HB 4WK3A 1NSPA 1VC6A 4HKQA 4BCAA 3I6PA 1CPZA 2IMWP 5IQ6A 3R6GB 2R3VA 5ETSA 1P1TA 2M70A 3BGLA 1UPMB 4L6V3 4X64J 1UEUA 2EFPA 3QAUA 3K5OA 4Q2MA 2NR0A 2DXEA 2CVIA 2LXFA 3M8PA 4OX9J 4DUZJ 4O0IA 3OL8A 3G9CA 4QWEA 4C48A 3THVA 3EVMA 1KRPA 5EWFA 2OUGA 3M2RA 5G4DA 1SUQB 4DX8H 3HFKA 3NNHA 2CAJA 4X62J 1XMQJ 1SQEA 4QCLA 1Y11A 3FK4A 2FPHX 3M8PB 1D0EA 3GTYX 4WZQA 4JI5J 1FTRA 1XTZA 3ADAC 3BSOA 4KR0B 1UVJA 3PFOA 2DNZA 1S7IA 3I0RA 1WC0A 1T0TV 2KXFA 4U9RA 2CJKA 2MEWA 4XPCA 2RVJA 4NLRA 4NPOA 5L46A 1U1QA 2YKQA 4PABA 4RU2A 2ZC3A 5KFZA 1TKTA 1M1HA 4DUYJ 2B0GA 2P9EA 1YRXA 1LW0A 4QU6A 4WWSA 3IG1B 3OFFA 3MR7A 2CYYA 2WW4A 2QC3A 2R2RA 1TKTB 2ZNZA 3OSNA 3PRDA 4X66J 3AJDA 3D7SB 1LW0B 3K0JA 1HW8A 2MZTA 3TRGA 4GC6A 1WTBA 2O66A 4WYLA 5E0OA 2C3MA 3P5TL 1HI8A 2EW9A 1DTTA 1MNEA 3ZZ0A 5KFXA 2G2ZA 1D8YA 4NLYA 4W98A 2HWIA 3MPYA 3TANA 2FZGB 1IKXA 4NWBA 4NA3A 1HHQA 2UUWA 3M2UB 3ENAA 1DTTB 4YMEA 1Q8IA 3R5JB 4K0KJ 4DL3A 5BYSA 1NK8A 4QPXA 5L1KA 1FEEA 1IKXB 4F3OA 3POTA 4NYOA 1OPZA 3MR5A 2JLFA 1TV6B 3T6JA 1DLOA 1N5QA 4JV0A 2XNRA 1HQEA 3B8HA 3W3SA 4Z7YA 1HMVA 2XS2A 2VUGA 4FVMA 3POTB 1Y3JA 3LP2B 3OQ2A 2B9WA 1F5AA 1QJHA 5H1SV 3BQ1A 1I3OB 1DLOB 1FDBA 3JB9k 4LF7F 1AZSB 2UUAF 1TP7A 4KGVB 5F8NA 3H2LA 1RTJA 3MFIA 4NCGA 2DCUB 3DGPA 5M2UA 2HFOA 5CZXA 1UEKA 5CQGA 1HNWF 1WC4A 3CJ5A 2N3LA 3MM5A 2UP1A 4ZJQA 1ZM9A 3NOCA 2H51B 5J2NA 2VJVA 4OZ5A 4JI0F 3NMRA 3NWGA 4P73A 2V63A 2YVSA 4NXMJ 4Q7AA 3MAQA 1FEHA 5D0EA 2KTQA 4OHWA 2HS0A 2NUUG 3DU6A 3HVTB 4QQBA 2WCXA 1VHIA 5E7OB 4OI3A 4IRCA 1KKHA 1P9YA 4HTJA 3MR3A 2KFZA 4KKOA 2LA6A 3OTOF 2X1BA 3IS9B 4A47A 3K17A 3EE3A 4HTIA 4USHA 5DS7A 3QZ8A 1SQGA 3EXYA 1IBKF 1PAUB 1RT3A 2DNOA 3AD7C 4ETZA 3FEYB 2J0SD 2U1AA 4URGA 3DNCA 4NLQA 5GAHU 2Z2MA 2KVIA 3CCWA 2FYXA 1Q86T 1M5HA 2MQPA 1G7CB 5HLFA 1RT3B 4MIBA 2QMUB 4KV8A 4DFPA 1N8RT 2XLKA 3S8SA 4LQ9A 2H54B 2W9BA 3BBCA 2NYIA 4PPZA 3TJAA 5KT7A 1U25A 2R7RA 2BEFA 4I2PB 2VBXA 1ZPWX 4WFAQ 1FNOA 4MK8A 4LF6J 2ZH3A 4OL8A 4LRFA 5IT4A 5LMUF 3PR5B 2D74B 2AJ1A 2OJ3A 3UFCX 2GGPA 1VHFA 4NLDA 1U24A 2MSTA 4IH5A 2MKHA 2RRNA 1UL3A 2JVOA 2XI2A 2UUBF 5A76A 4CTAA 1SH3A 3R6LB 3RB0A 2R42A 3ZC4A 2KXNB 2MZSA 4EZ6A 4OZ2A 2G0JA 3EVWA 2GGPB 3H5SA 1YZ7A 2PA8D 4DZ6A 1N33J 3FRZA 3PZPA 2W7OA 4HEA9 3R2CJ 3OHBA 2ILYA 1LQ9A 4CTAB 4KRWA 1PG5B 3W8PA 5ETOA 4QBUA 2BJ9A 2RQCA 4K4YA 3RBEA 1SL0A 1YJ9S 1IJEB 4F26A 4JI3F 5E2QA 2CZ9A 3F41A 4WFXA 2DR6A 4LF1A 4ZVTB 1NJWA 1SBRA 5L1LA 4K59A 3QATA 2KJWA 2JH3A 2KYZA 3LPEA 3Q83A 3GYXB 3NGUA 2YKPA 1KSPA 3R5BA 1FI4A 2ADBA 3OUYA 1L3VA 4X4OA 1WEXA 2EPIA 3ZZOA 4DWIA 3QGIA 5IS2A 5A2QU 4UOHA 3HVAA 3GFZA 4OI4A 4P7TA 4KTQA 1XNRJ 2DTJA 3OUYB 2HHHJ 2UUCF 1TL7A 1U6ZA 3PY8A 4WTOB 3VGUA 2QTWA 4C8NA 2IPOB 4XDCA 3ONQA 1U49A 4DBQA 1PGZA 4ZHRB 1H6KX 3M8ZA 1VMBA 2F8HA 4CLKA 3CDBA 4WPAA 3CCES 3MEEB 3EGVA 2W25A 4OV6A 4WZMA 3QYYA 3MM6B 3GONA 2P9CA 2GQ2A 4ZVOB 3R5CA 2GS8A 3T5KA 2E9RX 1TL3A 3TAMA 5BR8J 3KNGA 1JJ2R 5A8RA 4UQTA 4NLVA 3N4WA 2BQUA 4HT7A 2HNDA 1UKUA 4XK8C 1RTIA 4BS2A 1LWXA 2W7PA 1HNIB 5EDWA 3D9BA 4U7CA 3TAMB 5HVFA 4USIA 4R0JA 1X4BA 3HI9A 1HI0P 3B4MA 3OSPA 5KFMA 4ZPVR 4NXNF 2AD9A 5ETPA 4B3OB 3AD8C 4DQIA 2HNDB 1RTIB 2DEIA 2DPJA 3OLBA 1RUSA 4KGKA 4Y0FA 2P8IA 4QWDA 1WG1A 2R7XA 1KNZA 2MB0B 2OI2A 1RT1A 2YQ1A 3KG0A 1UEVA 2IM1A 4B9NA 2Z4PA 5L39A 3OVSA 4ZDNA 3US5A 2OH2A 1N36J 4ER8A 3IR7B 4UOFA 1SJQA 3W1YC 3MTKA 1NSKL 3TA2A 1RT1B 3LP1B 4G65A 3TAQA 1XNQJ 2YQ3A 1K44A 2O3DA 1QTNB 2D3UA 3OD2A 2U2FA 2DR7A 2HFSA 3BZQA 4DV4J 1ZM4A 2IBKA 1K1SA 4B9VA 2L9NA 3KJFB 1FRJA 4RL1A 4A8FA 2OD6A 2R7VA 4CIOA 1DY3A 1VK8A 4C6AA 4LF2A 1NUEA 2HVIA 2UXCJ 5IWAJ 3S6EA 4N77A 3PW4A 4Y2KA 2XMUA 2H5IB 4B3SJ 3C6TA 2IYGA 2J6UA 1EETA 2R9LA 1H98A 4LJMA 2CG4A 3VWSA 2YNFB 4AUKA 5BXIA 4LRBA 1RWWB 1S6PA 1XK8A 1S6QA 1EETB 3CCSS 3MCMA 2ACYA 3M6XA 1M1GA 1X60A 3V5RA 3DLGB 1R89A 3E51A 1TKXA 1S0NA 3GV8B 2G0CA 4CO5A 3EZUA 2V4RA 4K50A 1S6PB 4X64F 2ZBIA 3EPIA 5CCLA 1S6QB 2EVZA 4ZCMA 1RJJA 4OX9F 4DUZF 3BQ2A 3BR9A 2VICA 4WYWA 1TKXB 2JOQA 2BM1A 3UO0A 5DZ6A 4M63A 2HHVA 4X62F 3ZZRA 1XMQF 2ALYB 3ZTPA 4TU8A 5L8RC 2ZBCA 2IIHA 4JI5F 4JI7F 1KFSA 1RWOB 2CQ4A 2OIHA 3IN5A 2XWXA 2XY6A 1HBMA 5HVGA 4ID5A 4OX6A 3QPIA 1R6YA 2OSRA 3CCUS 3M6VA 1H3DA 1S4FA 4BC7A 2JFKA 4DV5F 3E8OA 1MWYA 3PW2A 4KSEB 4RKUC 1D9AA 4Q2LA 2VIHA 1QY7A 3EWGA 4V1Ak 1VQ5S 3C19A 1FFSB 4DUYF 1I94J 3R27A 2W2NP 1VDHA 1FXRA 1TUGB 1HBMB 4ID5B 4PG6A 3H25A 1CC8A 4DS4A 1WELA 4EBDA 2LDYA 4X4NA 3PYFA 2M9KA 2GIFA 1UVLA 2V50A 2CPDA 2BZ2A 4X66F 3MMBB 3QRPA 3GV7B 1WWHA 2VG5A 1CJTA 2F7VA 2KN4A 1LW2A 2CNLB 3SDEA 1D9DA 4KHPJ 4LRAA 4P10A 5CABA 3KJVA 1V9OA 1FVSA 5GVQA 2JVRA 2FC8A 4ED7A 4RW4A 3M30A 5ADZA 4A8XA 3V81A 3O2IA 1CJTB 4DQQA 4OJHA 3D68A 3NY0A 3NP5A 3L9ZA 4K0KF 4X2BA 3D3BJ 3CCJS 3KJVB 1U1LA 3MECA 4W4MA 2IJNA 4DL6A 3J7AN 2QA2A 2KM8B 1TU0B 4P2MA 3V81B 4ZCLA 1TL1B 4WFBQ 3T1YJ 3M8QA 1X4GA 3P3DA 4YDXA 1WC1A 1U02A 2XMTA 4EWTA 1S48A 1HIYA 4P74A 1HD0A 3MAAB 3M9NB 4M8LA 5HANA 1NO8A 3D4JA 1RTHA 5BJRA 1HPZB 2HIQA 4I69A 1NPKA 3ENQA 3U1MA 4O23A 4TU7A 5HAOA 4NLPA 4TNOA 2GC8A 2J0XA 3TUZC 3EM1A 2J6SA 3AQOA 1RTHB 3I55S 3HVWA 5B09A 2F9DA 3BN7A 2HRYA 4JI6J 4JV5J 4O3PA 1S59A 2D3OR 2IHR1 3CWJA 2OEMA 3DN9A 2Y1JA 1PSDA 1R0BG 2CA9A 3MEDA 2X3GA 4AL7A 1F2HA 2ZC4A 1HWIA 4M94A 4K2JA 1YJRA 2VFRA 1I1GA 1QAXA 5KT5A 3W64A 1RADB 3HLUA 3OTEA 4QWAA 3FCWA 1UJ6A 4RX6A 2XMVA 2DNMA 2GAHC 4JB8B 2L9WA 3BGOP 3G6XA 1Q53A 2IC3A 1WC3A 5J1NA 1YVFA 2FHOB 2LEBA 4FKXA 2COLA 4Q8EA 1ULRA 2DNKA 1VJWA 3T1AA 3FBCA 1JLBB 2KT2A 3HULA 1VYAA 2AYMA 2Y3YA 1HBOA 2DPIA 3QLHA 5AXNA 2IC3B 2M5YA 2HURA 2XNQA 2FJVA 2CWXA 4CLPA 1LEOA 3PRBA 4NLGA 3KK3B 2B9XA 3I5AA 5SUHA 3OT9A 1SJ1A 2NUHA 4CP5A 1EARA 4OHYA 2CPEA 1A7GE 4Q0BB 3FSYA 3PW7A 2KYXA 1MROA 3FJ2A 2V2KA 1NJYA 2FVCA 3ILOA 2JDJA 1FWPA 3G8QA 3IMQJ 1Q5VA 1M5VC 2DXDA 3NAHA 3D1QA 4DL0C 4KYZA 1XC9A 4ENOA 1MROB 5KFIA 2HHTA 2DRBA 4AT1B 4LF6F 1TMJA 2VQFJ 1RDRA 2MZRA 1ZTWA 3IWXA 5L9NA 2JNJA 5HP1B 1OMSA 2QYCA 2AU0A 2MKCA 3JSRA 1FE0A 2IRUA 3D66A 4RO0A 3KLIB 5C2CA 1Q16B 1KLMB 4F2SA 3BSAA 3ZFVA 4OI0A 2AEJA 3NS5A 1PAEX 2K7KA 2X1FA 3Q0AA 2CPFA 1VQLS 2B6AA 5LSOA 2XSJA 2P6TA 1N33F 4DPTA 3JTPA 2ZH7A 1LXNA 2PMHA 2MPUA 2EWHA 3DLLQ 3ZZPA 2XSJB 1VQ8S 4FF4A 2IM2A 3DCAA 3PKMA 1MN9A 1WDTA 3DMJB 4YS2A 2DGTA 5I3UA 3PG9A 2K2PA 1MN7A 2L41A 2YX7A 1OSCA 4YB6A 3QGPA 3OL6A 1X5OA 2V9KA 2MLXA 1EP4B 2B43A 3VAMA 4DL4A 2YNIB 3W63A 2K1RB 3GYGA 1VRTA 4HDHA 2FVRA 4A8QA 2KZZA 1ZA2B 2Z2YB 3B4DA 3D0GE 1D9FA 1T03A 2A2DA 2BQ3A 3BH7B 1N5VA 1TZ0A 2HSEB 2VBWA 2OKQA 2K7JA 3H90A 5C7PA 4F50A 4DR4J 1NPPA 1FXLA 2HHHF 2XZWA 1KVIA 4F4AA 4PG8A 4LF4J 1N4LA 2ZBPA 4WXOA 2N7YA 5C5JA 3LH2S 1S0MA 2DKOB 1JLQA 1R0AA 3X1LB 2RB7A 2BE9B 3R5AA 3L3CA 2YBVA 1MWZA 1ZAWA 2J7KA 1R43A 1UVKA 5GAEU 2FHJA 2Y9HA 1Q0NA 4UQGA 4BBYA 5BR8F 2QSFA 2EI5A 1NBEB 2RF2A 2EEYA 1Y5LB 3NGKA 1FE4A 3H2UB 2FIUA 1X31C 2LU2A 5JUMA 2ZJRQ 1HBUA 2KL8A 2BJDA 2XHCA 1U2CA 2YKNA 4LFBJ 5HMYA 2CJXB 2CQ1A 1K0TA 3AJ2A 3GFXA 3CEDA 3OL7A 4A46A 2VDIA 2E66A 4RBUA 1QVGR 2UV8G 2VBZA 1RWKB 1Q8BA 1L3UA 4GMKA 2DNRA 2XSFA 4CNZA 3QIPA 1SH0A 2KXHA 1F3FA 3PM9A 2QYGA 2J5AA 1I6JA 5BYRA 2AF6A 3OR1A 5C2GA 4CRJA 4MKAA 1VRQC 2JRSA 2ZBRA 1S0OA 1F1BB 2ZWOA 1T8EA 1CC7A 1XEZA 4HH1A 2B8PA 5A8KA 4ZVEA 2Q3PA 3QIPB 1N36F 4IFYA 3K2YA 4CT8A 3HXMA 2HWTA 1WUUA 2EG1A 4O3RA 5ETRA 1WJ9A 2Q6BA 3TO8A 4X4RA 4OX8A 1HA1A 3MM7B 4TVAB 5A8KB 5CAAA 5JXSA 5DDRC 2XLIA 4IFYB 2E7WA 3NCQA 4RBTA 4DV4F 3BF4A 3TZZA 2CVEA 2XMWA 4RWXA 2IJFA 1Q8LA 3L95X 3BO4A 5HQLA 4KAIA 5K20B 3EJMA 1HQUB 2KRBA 3NBPA 2MY7A 3IGVA 4USTA 1Q79A 3H5UA 2UXCF 5IWAF 4YP3A 5F41A 3MUTP 2KDOA 4KO0A 3TQ1A 3K89A 1Y5IB 2XMAA 1NHVA 4OYBA 4B3SF 5E3RA 4H4KA 1REGX 2QEXS 4ZPCA 2CIMA 2B4PA 4KJIA 2AJ4A 1S79A 1S1XB 4GKJJ 3ENVA 2ZD1B
chains in the Genus database with same CATH topology
4EFAC 4LVNP 4LT6A 1NJXA 2XB2D 2YWEA 1LKZA 1YTYA 4Z2XA 2WONA 4TLRA 3FGVA 4Y2AA 1TK5A 4FS2A 5EWGA 1K73T 4C4WA 2V8VA 1H38A 3LWLA 2KU7A 5F3ZA 4URSA 2ZITA 5KG1A 3IXQA 3PW0A 2DT9A 3I4PA 1AW0A 1WEZA 2LCWA 2WHOA 5B0DA 3EPGA 4M5DB 2HHWA 1YWXA 2MQNA 2QLWA 3V4IA 1HNVA 3ISZA 1VQYA 3MTJA 1SI9A 2QA4S 3C8YA 2RE1A 3LANA 4AL5A 2LXIA 2V8GA 2ASJA 4OV1A 2FC9A 2R7UA 2M0GB 3AY0A 1FA0A 4EBEA 1JLAB 5IXUA 2WONB 1XBWA 2JSXA 1QTMA 3W2WA 1VK3A 5F9LA 4RNMA 4DFJA 1VOMA 5GADI 2QFJA 3HHLC 1RT5A 1IM4A 3HKZD 4NCBA 1OIAA 2QMXA 2UXBF 1JMTA 5DQIA 4EYHB 3TARA 2P6SA 3K57A 1Q4RA 2R7WA 2H5EA 3HF5A 4MKBA 3I56S 1SJRA 4ICLA 4QIWD 2J0WA 4YDDB 3V4IB 1HNVB 4A8KA 4LQ3A 5KG4A 1N34F 5U47A 1UWBA 1XR5A 1IQZA 4KC5A 4NXMF 3IO1A 2M4MA 1GTEA 1VLYA 4IDKA 4BC9A 1K8AT 2AX0A 2YKMA 1C0UB 1FD2A 4AL6A 3MM8B 5CZVA 4ZCKA 5EN1A 3W2WB 3IGNA 4NRUA 4LUBA 4OLOA 3HM9A 4TN2A 5B0EA 3HKWA 2BRKA 1RT5B 2QO3A 3PXGa 3TR5A 2VONA 2UVWA 3U02A 3L7PA 3H5YA 3C46A 4DG1A 2PFFB 4J9SA 1QVFR 3LPYA 4ICLB 2KJVA 4QZVB 3QZ7A 3MEDB 4RUCA 4ZHRA 3V6JA 1X8DA 3IRXB 1UWBB 1GAOA 2DCLA 1NHUA 1JIHA 1Q78A 4IDKB 3KK1A 1V6HA 1FJCA 3RW7A 4WK3A 3CVKA 4ECZA 3Q8QB 2YKMB 4HI1A 1QE1B 3L09A 1VC6A 3MEEA 4HKQA 1LFPA 3DOKA 2V94A 4BCAA 3I6PA 2N82B 3MD3A 1CPZA 3IBWA 1S10A 3RW6A 1Z4UA 2BR0A 3MM6A 4ZVHA 2BA9A 3GMGA 3H8YA 4OHXA 4F67A 2IMWP 5IQ6A 1H7XA 1V3SA 5LJ3Y 1UVMA 1I94F 4Y2IA 2BM0A 2RU3A 1S97A 1P1TA 2M52A 2HW3A 3SSQA 2M70A 3BGLA 2HZCA 4V19J 1Y00A 4DSJA 5KG6A 4K4WA 1RT2A 1TR0A 2JFDA 2F4VF 2B7CB 4L6V3 4EYIB 4WK1A 5D8HB 3CDUA 1UEUA 5EX3A 2EFPA 3DOKB 3QAUA 3K5OA 3G6ES 4ZPTR 4Q2MA 4E8UA 1NKBA 2NR0A 3DLEA 3SCIE 3M2VA 3GIJA 2E5IA 5CH7B 2CVIA 2LXFA 3M8PA 1FRIA 1O51A 3EGNA 4O0IA 1Y5NB 2Y1RI 4YR2A 3RB4A 1X4AA 3OL8A 2RDJA 1OWXA 3TVKA 2EBGA 1KFDA 3G9CA 4X4PA 4QWEA 4Y28C 2HQ3A 4IFVA 2R7QA 4WTYA 4X4SA 3OJSA 4ECSA 3THVA 1HBOB 1OSDA 3JYTB 1HNIA 1NU4A 3QLHB 2D9OA 4ATNA 5EWFA