1TL1B

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 114
structure length 400
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1B03
4IR1A 2R2UA 4RNMA 4KKOA 4EYIB 1TKZA 4IRCA 3M9OB 1C1CA 1LW0B 2FVSA 2CKWA 5KFFA 3KHLA 2VA3A 4RW9A 4ZMMA 2ALZA 2WK4A 4KAIA 1DTQA 1RTIA 2BE2B 1HQUB 3N6NA 4QW9A 3I5BA 5J2NB 1N6QA 4KB7A 4Q45A 1EETA 3M8PB 4DG1B 2E9RX 2FLLA 3V6DB 3H5UA 4MK8A 4ZPDA 4IH5A 4IRKA 4NZ0A 5KG1A 2FJVA 3OL7A 1S1TA 2XWYA 4JUZA 2GIQA 4WFYA 5KFVA 4O3RA 3KK2B 4EEYA 4YQWA 4DL7A 2WRMA 4WYLA 3PR4A 4HKQA 3TVKA 1D1UA 3CJ3A 4J9MA 4TQRA 3RBDA 4ZVFA 5KFAA 2HNYA 3OHBA 1EETB 5EWGA 1S1XB 2B6AB 2YNFB 4TLRA 4YP3A 2YKMA 3IG1B 2FJWA 1JLCA 1YVFA 3BREA 1N4LA 5KFPA 3PR5B 4G1QB 4O3NA 5J2PB 2RF2B 1N5YA 3MF5A 4Y3CA 4J9QA 1RT6A 2ZE2A 4ED2A 4FBUA 2R2RA 3BSOA 1S97A 1QAJA 3FFIB 1S9GB 4F50A 3DOLB 3D28A 3MR6A 2VG7B 3KLGB 3NBPA 3V4IA 1S6QB 2YKMB 3LALA 4EYHB 4ED1A 2C2DA 4TQSA 2RDJA 5C25A 4LSNA 4URSA 3ITHB 1TV6A 5HROB 1MU2B 1LWEA 2FJXA 4NLWA 4IG3A 4ECQA 5HBMA 4I2PB 4NRTA 3HVAA 4LSLA 3UDLA 5HP1A 5L1KA 1HPZA 2IAJA 1N48A 2OPRB 4ECZA 3QO9B 4K4UA 1N5YB 2HNZA 4IKAA 1FKPA 5I3UB 5EUHA 3GV8B 4ECSA 4H4MA 4DL2A 3FSIA 1MU2A 4ECTA 1RAJA 2QV6A 2R2SA 1CSJA 1DTTB 1RT5B 5KFMA 1JX4A 2W8KA 4NRUA 4NLPA 3RB0A 3T19A 1TKTA 1IKXA 5KFUA 4NLOA 5KT5A 3E01B 3DM2A 1XR7A 3CDWA 4R8UA 3QIDA 4ECXA 1RT6B 2ZE2B 3T1AA 1KHWA 3NAHA 3GIJA 4PQUB 3RB3A 2W9BA 3LANA 4ZP6A 5J2QB 3CO9A 5F9LA 5KT3A 2W7PA 5I42B 1DLOB 1TL3A 2ILYA 5KFEA 2VG7A 4ED3A 4J9PA 4Y34A 4J9KA 5DG8A 3V4IB 4Q8FA 4DL3A 2QE5A 4NLUA 4QWBA 4RUAA 3H4BA 4KO0B 4WZQA 1HQEB 5KT6A 4KKOB 1LWCA 2JLEA 2OH2A 3G6YA 2C2EA 3MR5A 2UVUA 2AU0A 3IS9B 5KFQA 3HVTA 4RW8A 3IN5A 4PUOA 1VRUB 5KFHA 3CWJA 4IG3B 4FS1A 1DTTA 3GQCA 1TKXB 3T5KA 2UVRA 4IDKB 1HYSB 1DLOA 3M8PA 3QZ7A 2YNGA 5KFOA 3V6DA 1XR5A 2UUWA 3G86A 1SH3A 2ASLA 2XCAA 3LP1A 2OPRA 2XGPA 2AGOA 4K4SA 4TY8B 1S9EB 3DM2B 4K4XA 3IRXB 4H4OB 3UPFA 5F8LA 4YR3A 3GV7B 1JLGA 1S10A 2EC0A 4M95A 5HLFA 2BQRA 3KHHA 2HNDA 3KLVA 4J9NA 1JLCB 4WFXA 3T5LA 4G1QA 4MIBA 3KJVB 3H98A 5KG6A 4O4RA 3BR9A 1RYRA 1TQLA 2FVRA 3CJ2A 3LP0A 3CVKA 2W9BB 4OL8A 4TYBA 1QE1B 3V6KA 3DOKB 4NLQA 3Q8PB 2W9CB 5KFGA 4ED6A 2FLPA 4KO0A 3LP1B 2R8GA 4F4XA 1RT4B 1S9EA 3OLBA 4LSNB 3KJVA 3IGNA 3QYYA 5L9XA 1RYSA 2YKNB 3DDKA 5KT7A 1REVA 4JV1A 2IC3B 3OSPA 2D3ZA 2ASJA 5KT4A 4J9RA 3RAXA 4ZPAA 3UQSA 2JEJA 5DLGA 1RDRA 5HP1B 2VG5B 4R5PA 3KLEB 2VG6A 5D3GB 2W8LA 1JLEB 4F4YA 4ZP9A 4B3OB 4IH6A 2YKNA 3PW4A 1JKHA 5KG7A 3C6UA 2J6TA 4ZPBA 3Q8QB 4KV8A 1RTHA 2I5JA 5J1EB 5HLFB 1R0AB 2RKIA 2HAIA 2R8HA 5F8GA 2BANB 1BQMB 1TKTB 5CYMB 5C24B 3E01A 4IFVA 1LW0A 4R5PB 3MFHA 4R8UB 2JEFA 5DG9A 4Q44A 1QE1A 1JKHB 2AQ4A 5C42B 2VA2A 1TL3B 1JXLA 4ZHRB 3JYTA 4KE5A 3SI8A 3OL8A 1GX6A 4MFBB 2VG5A 4NYZA 5J2MB 5KG5A 1RT4A 1MMLA 5D3GA 4EBCA 1S49A 3QLHA 3T5JA 3IS9A 4JV2A 4RW6A 4O3PA 1C0TB 1RT2B 1TL1B 1S9FA 4I2PA 3DYAB 2I1RA 2IM1A 2FLNA 1D0EA 5KFYA 2YNFA 2FVPA 1JLQB 1RTDB 4RNFA 2WONA 3MEDA 1HMVB 4WE1A 3CJ0A 3BSCA 2JEIA 1GX5A 3Q8SB 4ECRA 1RTJA 1RT1B 2XI2A 3CDUA 2OPQB 1RT5A 1SV5A 2RKIB 3E51A 3QGIA 3DLKA 2YNHB 5F8JA 2HNDB 2IM3A 4O3QA 2IA6A 3BQ2A 3EZUA 3DRRB 3MEEB 1HMVA 4MH8A 2WOMB 2D7SA 2JC0A 3N6LA 1IKWB 2B5JB 1S1VB 5DGAA 4PQUA 2UVWA 5C42A 1C0TA 1RT2A 1BQNA 1TL1A 4IH7A 3H2LA 5KG4A 2W9AA 4KHRA 4F4WA 4DL6A 1LWFB 5T14A 3EPGA 4I7FB 3QZ8A 2W9CA 3HHKA 4K4ZA 2BQ3A 3MEDB 3IGVA 1S1TB 4URGA 2O5DA 5F8IA 3DI6B 4TYAA 4GC7A 1IKVA 1FK9A 4O4GB 3OSNA 4IRDA 2CJQA 5KFKA 1S1VA 1C1BB 3DLGB 2FVQA 1SUQB 4QWEA 3NGDA 4ICLA 2WTFA 1TKXA 4K4TA 1S0NA 1ZTWA 3SFUA 1RT7B 1T03B 2HNYB 1HYSA 4ZP7A 5F8HA 3KNAA 2YNHA 4WFZA 4I7FA 3QGGA 4YR2A 1Z4UA 3KLEA 2ILZA 4TXSA 1XR6A 3MECA 1JLEA 3RB6A 1VRTA 2VG6B 4ECWA 3N6MA 2IJNA 3QGHA 2XI3A 5KFBA 3Q8RB 3OLAA 4FBTA 2HMIB 2HWIA 5KG0A 5I42A 3C6UB 3DRPB 3KLHA 4KV8B 1HARA 2D41A 1NNDA 1RT7A 2FVCA 3KLGA 1S0MA 2JC1A 5FDLB 4IFVB 5CYMA 3MEGB 5C24A 1VRTB 1W25A 1ZETA 1S1WB 5K14A 2UVVA 4K4VA 2V4QA 3MR3A 4F4ZA 3M8QA 5KFZA 5HBMB 4RW4A 3LP2A 1LWFA 4LQ9A 3DLEB 3I0RB 4IFYB 1T94A 4GC6A 4Q8EA 1TVRA 1KLMA 4MFBA 5CYQB 1JLAA 2R2TA 1HPZB 2IAJB 4NLDA 4Y2CA 5EDWA 4QWDA 3QO9A 1QUVA 3MR2A 2ZD1A 3DMJB 3M9NB 2AGQA 1FKPB 1C1CB 1IKVB 2IJFA 4RNHA 3IRXA 4H4OA 1UWBA 5K14B 2IM2A 4Q43A 3KMQA 2OPSA 3M8QB 3KLIA 4IG0B 1T03A 1J5OA 2ATLA 1FKOA 3BSNA 1JLAB 1JLQA 4ZPCA 3GIMA 3CIZA 2WONB 4WE1B 1JLBA 2V9WA 4NLXA 1S4FA 5DGBA 3FDSA 5KG3A 4ZP8A 3CJ4A 4LQ3A 3TAMB 3DOKA 1T3NA 3BGRA 2OPQA 3LAMA 1J5OB 1SV5B 4K4YA 2V0NA 5KFIA 4RZRA 3D5MA 2BANA 1HQEA 3IG1A 4U6PA 3GV5B 2ZD1B 3DMJA 3KMSA 1N56A 2WOMA 3OHAA 3FQKA 2RF2A 1IM4A 1REVB 2IC3A 4MK7A 2OPPB 4MKBA 4R0EA 2UUTA 2IMWP 3GIKA 3DLEA 3I0RA 4IFYA 4ZHRA 3JYTB 1NHVA 3PJXA 3PHEA 1FKOB 4IOBA 4MKAA 3I0SA 2AWZA 4NLSA 2AGPA 2WHOA 1RT3B 4WYWA 1IKYB 1LW2A 3I5AA 3QLHB 3RBEA 1TV6B 4KSEB 1LWEB 1C1BA 3DLGA 1RTIB 2BE2A 4ICLB 1SUQA 4YMEA 3QIPB 1R0AA 3DYAA 3NL0A 2J6UA 3ICLA 4LSLB 4I2QB 2IBKA 2XC9A 1RT3A 2R8JA 2C28A 4XO0A 3MFIA 4ECUA 4DL5A 3KK2A 4ECYA 2WCXA 5C5JA 3LAKA 3TAMA 4NLTA 4U7CA 1RTJB 4DL4A 3PVXA 1U09A 2DPJA 4QW8A 3H40A 3JSMA 3M9MB 3BQ1A 1S1XA 3PZPA 1S0OA 3NAIA 4HYKA 1LW2B 1T05A 4J9OA 4RW9B 4NCGA 4RW6B 1S1WA 4RNOA 3KHGA 3KOAA 3DRSA 4ID5A 5KFRA 5KFDA 3H59A 4RW7A 1S6PA 1BQNB 4MK9A 3FFIA 5KFLA 4EO8A 2F8EX 4DG1A 4ZVGA 1TVRB 4Q0BA 5EWFA 4X2BA 4NLRA 5CYQA 2GC8A 5KFSA 1RTDA 2V4RA 3H5SA 2HWHA 5F9NA 4KFBB 4PWDA 3DI6A 2C22A 5DQHA 1FK9B 4O4GA 4RW8B 3DRSB 4ID5B 4Y2AA 1RT1A 4PUOB 4ZVEA 3T5HA 3KLIB 3GILA 3V6JA 4QWCA 2IM0A 1S6PB 5DQIA 3OL6A 5EWEA 2YNIB 1BQMA 3KHRA 2DPIA 3PW5A 3RB4A 4G3IA 1QAIA 5J2PA 4TY8A 4EBEA 1IKWA 2B5JA 4KFBA 3KLFB 5KFCA 4NLVA 4H4MB 4WXOA 2XGQA 2XCPA 3PJWA 1EP4A 2HMIA 1S9GA 1S1UB 3BSAA 3DRPA 3DOLA 3KLHB 3BQ0A 4ED7A 4QPXA 4XPEA 5L1IA 5DLFA 5DG7A 2AX1A 3I5CA 4JV0A 5FDLA 3PW7A 1T05B 1TKZB 1OS5A 3MEGA 1K1SA 4NLYA 4NCGB 5KFTA 3RAQA 5L1JA 2ASDA 1ZTTA 4EO6A 5JUMA 2OPPA 1EP4B 1TP7A 3G6XA 4RW4B 3EPIA 5F8NA 5KG2A 4Q0BB 4KHMA 4FS2A 4O3SA 3HKWA 4NLGA 3I0SB 4TN2A 3MECB 5KFJA 3PW0A 1LWCB 3KK1A 1IKYA 1I6JA 4ZVHA 3C6TA 1C0UA 1UWBB 3VQSA 4O44B 4M94A 3FRZA 1S1UA 3V81B 4WZMA 3QIPA 4IDKA 2R8IA 3DLKB 2YNGB 2B6AA 1SH0A 3ISNC 3NKYA 4ED8A 2BQUA 4H54A 2BR0A 3TQ1A 3H4DA 2E9TA 3DRRA 3MEEA 1HNVB 2AX0A 4YR0A 3BJYA 4ECVA 4B3OA 3FQLA 3KK1B 2D3UA 3C6TB 3GYNA 4TY9A 2BRLA 1KHVA 4IR9A 4MIAA 3BGRB 2JEGA 4URQU 1RTHB 2I5JB 5J1EA 4J9LA 3NMAA 1KLMB 3NBPB 4QWAA 1S6QA 1SH2A 3ISND 4O3OA 5JXSA 3HVWA 3ITHA 1HNIA 5HROA 5C25B 3CJ5A 3HVTB 4WXWA 5F8MA 4KBIA 2OPSB 1VRUA 2R8KA 3SFGA 2RDIA 4RW7B 4IG0A 3CDEA 3KK3A 5KFNA 4DEZA 4RU9A 1RA6A 3MTKA 1C2PA 4ED0A 4J9SA 1K1QA 3V6HA 2GIRA 1WNEA 5J2MA 1HNVA 5KT2A 2E9ZA 2HNZB 2WB4A 4PWDB 5DQGA 1JLBB 2ZKUA 3GIIA 4EBDA 1C0UB 5I3UA 1JLFA 2C2RA 4O44A 5L1LA 1JLGB 1DTQB 3V81A 5KFXA 1RA7A 2BRKA 2J6SA 3H5XA 1S48A 3UR0A 3PW2A 4K4WA 3KK3B 4K50A 2YNIA 4XPCA 3G6VA 4I2QA 1IKXB 2W7OA 1HNIB 3KLFA 2B43A 3LP0B 4IQXA 1JLFB 4RNNA 4RUCA 1HQUA 5J2QA 5J2NA 1N6QB 3LP2B 1NHUA 5KFWA 1JIHA 3JSMB 3H5YA 3OL9A
chains in the Genus database with same CATH superfamily
3QJJA 4IR1A 2RE1A 2R2UA 1RU2A 1FRIA 2CPDA 5IS2A 3D6FB 4KKOA 4C98A 2ZNZA 3M9OB 4ZLLA 3AQPA 2RU3A 2ALZA 3HHNB 3SSQA 2FZGB 3A3PB 4KAIA 2Z2YB 2BE2B 1NDCA 2V4JB 4PPDA 3UVJB 1VC6A 4P2XA 3I5BA 2DEJA 1N6QA 2POKA 5HVHA 2EFVA 3G82A 3V6DB 4DV4F 3R5BA 4J91A 3LH2S 4DUYF 1QSLA 1RTZA 2M0GB 1JWWA 4QIWD 4DQIA 1S1TA 4NZ7A 4B3MF 4NCBA 1X7VA 5KFVA 4QBUA 3NY0A 3VF0B 4EEYA 4FXWA 4JBCA 1NJWA 4F3OA 4WYLA 2KI2A 2AJFE 1BHNA 4ZKAA 2WBMA 5KOXA 3A8JA 3TX8A 1S6OA 2HNYA 5LT5A 1GFWB 4YN3B 2B6AB 1RAIB 1BLUA 1LFPA 3BREA 1YVFA 1N4LA 1EKSA 1YJRA 5KFPA 1H2TZ 5SZTA 4DSIA 2Y1IA 5J2PB 3JAMU 1WC3A 3CCQS 1NH8A 2J7UA 1HNZJ 4ZCKA 5IT9Y 4DQSA 1NZ8A 4FBUA 1M5KC 2IVMA 2EI5A 3FFIB 1S9GB 2KFYA 3ZZOA 2JFKA 4F50A 2E29A 1RHRB 3KLGB 4LRCA 2QT7A 4DFJA 2YKMB 1RAHB 2A1BA 2LU1A 4P6QA 1T02A 3FSXA 2HFNA 2BYCA 3K57A 2RDJA 4URSA 3ITHB 4Y2MA 3AJ2A 2D74B 3OTOF 3UO0A 1FT8A 3T3FA 4AYBD 3TZYA 4I6AA 2VDHA 4MTPA 2DNYA 4J90A 3HVAA 3NNAA 3CMQA 4LSLA 1PCAA 4F4AA 3W8GA 2PEHA 2IAJA 1N48A 3CCZA 3L7PA 5A8WB 2CPFA 4JI4F 1N5YB 4DMZA 4ECSA 5EUHA 4F36A 1RAJA 1VBYA 2IVFB 1DTTB 1C4CA 3MAQA 1FNXH 2HGMA 2VH7A 2MKYA 2IHR1 4DBQA 4GKJF 3RB0A 3QT5A 4JYAJ 2X3GA 1NMEB 3T19A 1NEEA 1VHIA 2XHCA 1IKXA 4YB7A 4ANCA 4DJBA 3PIOQ 2RQ4A 2Y9HA 1U6BA 3E01B 1HHSA 3DM2A 1XR7A 1WC1A 3QIDA 1Q82T 3NAHA 1KHWA 4DR1J 4UQTA 1S72S 3RB3A 1IWAA 3E8OA 2W9BA 3TVYA 5J2QB 5KT3A 2P8IA 4KPCA 1JXEA 5BR8F 2HHHF 2GQ2A 1TL3A 1UVKA 1ZAVA 5KFEA 3MI7X 4Q7AA 4Y34A 4J9KA 3V4IB 4MKYA 4Q8FA 3MM7A 2UU9F 2B7BB 2YXLA 3QPIA 5KT6A 2UVUA 1Q95G 2FDNA 4F3QA 2AU0A 1VJQA 2EEYA 4RW8A 2XSJB 3BGLA 3EZOA 3M2RA 5KFQA 4PUOA 3CSKA 5KFHA 4FS1A 3RBXA 2CPIA 3EGNA 3T5KA 3DLHA 4S0MA 3GONA 5EX0A 2AP6A 4IDKB 1FXDA 1S59A 4Z7YA 4LF4J 2N7CA 2YNGA 2NSBA 3W7BA 3QRPA 3V6DA 3K5PA 3LPEA 2CAJA 1SH3A 2V2KA 3FCVA 4LF1A 2XCAA 3SZ2A 2ASLA 2M9KA 1X9WA 3DM2B 2PI4A 2OSRA 2QLWA 1O8BA 4OHYA 1H2VZ 3UPFA 4YR3A 3GYXB 3FMWA 3W66A 3A4TA 2G2YA 4BC9A 1DARA 4PABA 3VV2B 4FXVA 2C3MA 1UCNA 1NJIT 4M95A 2AJ1A 4PXBA 5HVGA 4DFKA 2JSXA 3AD7C 4JI3F 3KHHA 3W9IA 2W1BA 3T5LA 3DLJA 4E8UA 3H98A 5HSPA 4V19J 2NPIA 2M2BA 1ELOA 1U2RA 2DHXA 2FVRA 3AD9C 1RWMB 4UW2A 2ZH5A 2F65A 2W9BB 1RWNB 4OL8A 1E6YA 1PBUA 2DK2A 3H8YA 4MT1A 1CS4B 2GJ2A 3S8SA 1S79A 1WD6A 2PMHA 1L5UA 3RR8A 2RNEA 2FHJD 2W9CB 4FVMA 4KO0A 2R8GA 4NASA 1RT4B 4WIQA 3OLBA 1MW7A 5KAKA 5L9XA 3DDKA 3M05A 5KT7A 1H38A 1RISA 4YFUA 2CQ1A 2HQFA 4MKVA 3KKFA 2GAHC 2ROEA 4KGZB 3LWMA 3RAXA 3TARA 3R5GA 2YKPA 5JMNA 2VQEF 3NEKA 5IQQA 4MMOA 3VAMA 4R5PA 2OD6A 1XC9A 3QJLA 4B3OB 3H2UB 3OFFA 1N52B 2RRBA 1VC0A 4CTAB 1JJCB 1RHKB 3OV7A 4HACA 2YH1A 1HBMA 4DR4F 2DTJA 3POTA 2C2OB 2MY8A 4R25A 2I2YA 4XDCA 1XMOF 2HAIA 5HL7Q 2H9ZA 1RHQB 2RKIA 5F8GA 3Q8UA 4CM2A 2BANB 1U1KA 2EKYA 1Y5NB 1LW0A 3MFHA 1PAUB 4F2RA 3BGUA 5CXTA 1IXKA 3CB4A 3SDEB 2NXCA 1MROA 1QE1A 2HRTA 2AQ4A 3JTOA 4RUBA 1RADB 3AA8A 4OYAA 4ZHRB 1KBRA 1TFYA 1U25A 2ROGA 1HHTP 1GX6A 2LQJA 1F6TA 5EN1A 1RUSA 1MMLA 5D3GA 2XMMA 3GCXP 1QVGR 1S49A 2F63A 3T5JA 1HWJA 2RMLA 1LNQA 3PDNA 3F44A 4JI6F 5LSLA 4UZBA 2GV1A 2ZH6A 2M88A 1WOSA 4UOFA 4V1Ak 1M5HA 2R7SA 1TL1B 5L46A 4I2PA 2IM1A 2CDQA 2LLZA 4ZPWR 5E33A 2XB2D 2DISA 2N4DA 1PC5A 4JYAF 2JJ4D 4WF9Q 1OWXA 4LUBA 2K7JA 3B78A 2WONA 4WE1A 3BSCA 4CNYA 1GX5A 3UI3A 1HKAA 5A2QY 2LP4A 2OMLA 2CADA 2Z0GA 1M0SA 1SIZA 4B02A 3GFZA 1MN7A 3CDUA 1UVJA 1NB7A 1X9MA 1L3KA 2EC2A 1U0SA 3D1OA 1F60B 3ZTQA 1ZBTA 3I4PA 1N36F 2UUAF 1U1OA 1VOMA 4USIA 4DX7A 5F8JA 1EB0A 5FD1A 4Y0FA 3DRRB 2O01C 4WBFA 3R1HA 2WOMB 1Q5YA 2DITA 3N6LA 2B5JB 1PSDA 5B0DA 3R7NB 3EICA 1S1VB 2BBEA 4DU7A 2B56A 3MMJA 1NJZA 1C0TA 2IBKA 2UVWA 4JI5F 4LF2A 1VLOA 4DL6A 2YWHA 4F4WA 1LWFB 4M5MA 4OLPA 3SEOA 5T14A 1FTRA 3EPGA 1J5EF 3QZ8A 3CD6S 2VV5A 4ES3A 4ZJQA 3C16B 4K4ZA 2BW7A 4URGA 4LF6J 3CEDA 5CCMA 3DI6B 2ZBPA 4O4GB 4IRDA 5H9FJ 4F0KA 2OFHX 3R1LA 2R7WA 1YRXA 3DLGB 2FVQA 1F3FA 1SUQB 1FD2A 2VF3A 3N28A 3KNGA 4OYOA 3K5NA 3VALA 1S0NA 3KOAA 3KNAA 2I8EA 5CZVA 2E5JA 3TJ8A 2YKOA 1SC4B 1WF0A 5F8HA 4CT8A 3KLEA 1OSCA 1S7IA 2MQOA 5HQ8A 1JLEA 2PDAA 1VRTA 2VG6B 2RUSA 3M6UA 4YY3J 3I56S 1AFJA 1V3RA 3HDSA 2QTWA 1S4EA 3CJQA 3QAEA 2HMIB 2HWIA 5KG0A 1X4DA 3JXOA 2FB0A 1HARA 3GFXA 2FVCA 1WEXA 2MHEA 3HO1A 3FKBA 5HMZA 3G96A 5LMNF 3HZGA 1TMJA 1K9MT 1TTHB 1UVIA 2HS3A 2KZZA 2DB1A 3BO4A 2CZVC 3S1TA 3FZBA 5T7LB 1YITS 4HTJA 4AD6A 5KFZA 2E5HA 2ZVSA 1CJUA 4RW4A 1FRMA 4G65A 5LJ3Y 3QBCA 3LP2A 3D7SB 3OUYA 1QAXA 4OV1A 1TR0A 2VJVA 2FGCA 1TVRA 3DGPB 2DNNA 3Q24A 1SQFA 4MFBA 2YQ3A 1JLAA 3IMQJ 4DU8A 3MGJA 5EDWA 3MM9A 4ITSA 2EWHA 2PD1A 4GC7A 2ZD1A 3M9NB 1FKPB 1C1CB 1RZMA 2JVRA 4H4OA 3KMQA 4WWSA 1NK5A 3C14A 1IQTA 1N5TA 2D69A 1Q79A 4CM0A 2Z2MA 2P9EA 4LSZB 4DQRA 3AJDA 1FKOA 4EFAC 3BSNA 1IVZA 2XMWA 2BKNA 4ZPCA 1JNRB 4X4SA 4EI2A 5IOLA 5GMDA 1T0TV 2XO7A 4A8FA 1T9WA 2VC1A 3OPKA 3OXGA 4OHVA 2ZHAA 2AF6A 2KKHA 1VBXA 2OPQA 1L3TA 5IV3A 2JOQA 1GMUA 4DV2F 4OI3A 4ZK7M 2XS5A 3GFYA 5KFIA 3TJ9A 2J8AA 1HQEA 3IG1A 2W2OP 2ZWPA 2ZD1B 4OI2A 4USJC 4U6PA 3KMSA 3CCUS 2WOMA 1HWLA 2CXEA 2NLWA 1HI0P 2CJKA 3P49B 2PIIA 3JS9A 2HHXA 1SB6A 3HFVA 1AFIA 2IC3A 4MK7A 4IOAQ 1NKCA 2GQQA 4TLQA 3JYTB 1VRQC 1NHVA 3ET6A 4NZ6A 1UEVA 4MKAA 4B08A 4FYVB 1VQ9S 4B9LA 3TP2A 4ZJOA 3HK2A 2AGPA 2WHOA 3SIPB 2EG1A 1RT3B 4ERDA 4OHZA 1MN9A 1U6ZA 4DR5F 3I5AA 2OEJA 3NGKA 3EXCX 5BJRA 5IFMA 4LF8J 1RE1B 3N9UC 2BJ9A 1YX2A 3DGVA 1NK9A 1RTIB 4OYPA 5HJYA 2HHTA 1YG0A 1H74A 3N4WA 5A8KB 1C4AA 2JDJA 3MPYA 2HQ3A 4FYWB 1RT3A 1VIOA 4ZVUB 1G4CA 2C28A 2OGUA 3BKFA 2KL8A 2BXJA 1HNXF 2LFVA 1P1TA 4GVBB 1IWGA 5C5JA 3E3XA 4DL4A 3PVXA 4P10A 4LRBA 2CPJA 2QX0A 4QW8A 3HT3A 3GSDA 2NZ4A 4KHPJ 2YH0A 4DV7J 3IFEA 4GO5X 3PZPA 1MSWD 2DHAA 2OO4A 1S0OA 2CYYA 4HYKA 2RRAA 2VPZB 4J9OA 2ACYA 3N5BA 4RW6B 3ZNJ1 3Q22A 4M63A 4UY8T 3QRQA 4ID5A 3OD2A 1JMTA 1L3SA 2HK2A 2IMOA 4B9VA 5T41A 4NA3A 2A18A 1VR6A 4MK9A 2HFUA 2X3DA 1OYEA 1UEKA 1XK8A 4DG1A 5CYQA 5KFSA 3MOJB 8ATCB 2HVDA 4FDFA 4PZVA 4UOHA 1RU1A 2V4RA 3GB0A 4DXLA 1M1HA 4KFBB 3A8IA 5F9NA 2O1PA 2C22A 5DQHA 4DFPA 4LF7J 1F9EB 3GJTB 4ID5B 4ZVEA 1Q86T 2DCLA 1H2UX 3T5HA 1V6HA 2CNOB 1PIEA 4P71A 2Z4PA 3W60A 4X65J 5EWEA 1N34F 2H3EB 1RACB 2V69A 1BQMA 2DT9A 2SXLA 2V8VA 2V34A 2OIHA 2OJ3A 3RB4A 2BA9A 5J2PA 2V6AA 1ACMB 3BH7B 3KLFB 4A8QA 4U7UK 1YJVA 4X4NA 2XCPA 4ZN1A 2B4PA 2RUGA 4DX5A 1S9GA 1NAQA 1J5EJ 4ED4A 3SQOP 4KTQA 4QPXA 4XPEA 5DLFA 2ZH8A 5DG7A 2NXUA 2KJWA 4DPOA 5H9FK 3CCTA 4CI0B 4F0MA 2L41A 4U96A 3M8SA 5IC4B 3SCJE 2LEAA 2KRBA 1TKZB 1PO6A 2F4VJ 5EX3A 1UKUA 2XQCA 4K59A 1V5VA 2XEXA 3WQPA 1MWYA 4F04B 1FD8A 2MKJA 1RWOB 4R0JA 1MMDA 4A8SA 3FZ2A 1N88A 1OQ3A 1GH8A 4O3SA 2MZQA 2GVZB 3OBIA 1VJWA 2W2PP 2YX7A 2PEBA 3D54A 2B4VA 3PX4A 1UJ4A 3LUYA 3EGVA 1YQHA 2HZCA 3TYTA 2GCFA 5DETA 1LWCB 3UCUP 1VQYA 2HVZA 1B0VA 3IXQA 3EVOA 2ASYA 1C0UA 2XNQA 4C7QA 3DU6A 4C8MA 4M94A 2DGVA 3FRZA 2O66A 3L09A 3ZZUA 2B9EA 1CJVB 4WZMA 1UTAA 4IDKA 2UU9J 4ZITA 3FNNA 2B6AA 5D78A 3ISNC 2CQ4A 5HQMA 4H54A 1KQFB 2Y1RI 1WG4A 2N4CA 4M5GA 4CLSA 3DRRA 1WDDA 3W3SA 2BOPA 4YR0A 3X1LB 4B3OA 4C8ZA 2DGXA 2A10A 3MM8B 3SMZA 3GYNA 3M8WA 1TAQA 4ZLNA 1KHVA 1RAFB 2GHPA 4QZVB 2K8GA 1SXLA 3EZ5A 3GMGA 4MIAA 1Y3KA 1HBUA 1LQ9A 1Q8LA 2OEKA 2ZOFA 2I5JB 4HR2A 1NK4A 2BJ3A 4J5OA 1KLMB 4KT0C 2F8MA 5K8MA 5LOQA 4QWAA 2RHSB 4NXMF 3ISND 3HZEA 4O3OA 1NLKL 3M8ZA 5HROA 2AMCB 1TK8A 2CQCA 5C25B 1GXTA 3CJ5A 4WXWA 3ILJA 4B3RJ 4KBIA 2CQGA 1HW9A 2I9SA 2ZUAA 4NMLA 4PQAA 3HT0A 5H9EK 2HHPA 4JI1J 4C11B 4IG0A 1AT1B 2JNJA 2WW4A 2YWFA 3P45B 4LR7A 3T41A 1RA6A 3EX7B 2QYGA 2DNKA 4J9SA 5F3TA 3V6HA 3LGMA 2GIRA 3T1HF 1HNZF 2E9ZA 3LTOA 4ZDNA 3GIIA 2WSEC 4PWDB 4C97A 2ZKUA 5AXNA 5I3UA 2C2RA 3CCRS 2ZHOA 8RUCA 1SPBP 1JLGB 3CC4S 3GR0A 3H5XA 2KFZA 1S48A 4ANDA 2M8HA 4K4WA 3KK3B 1HBOA 4KGKA 1VS3A 4MJKA 3CC2S 3J81j 5GAHU 3QT8A 3CCES 2R7UA 3CC7S 2AEFA 2YY3A 1HNIB 1VCTA 2M52A 3NS5A 1SJRA 3NLCA 4P75A 5HJXA 3ILLA 3OL6A 1NK8A 3A8EA 4IQXA 3BKTA 2H54B 2VOPA 5J2NA 1FWPA 3LP2B 1NHUA 3NOCA 3POTB 2QL9B 2EPIA 3ILOA 3OR2B 2UXDJ 3OL9A 1UPMB 2VFTA 1S12A 3DFEA 4P52A 1K44A 4RNMA 1SKSA 3FBEA 2Q3PA 2ZBQA 4EYIB 3D3BJ 2FY1A 2VA3A 2FVSA 3D4JA 3KHLA 2DNPA 2A6MA 1MLAA 4ZMMA 2NQPA 2WK4A 3D2WA 4U7UD 2KT2A 1RTIA 3DHXA 3CUNA 1HQUB 2GVDB 3N6NA 5E5NA 2ZJPQ 2DNZA 3NMAA 1AROP 5J2NB 4KB7A 5ETMA 3DU5A 2PMWA 3O1LA 1EETA 3M8PB 4JB8B 5CABA 2ZM6F 4QCLA 3H5UA 1SKUB 4ZJLA 4ZPDA 1N34J 4IRKA 1L3UA 1NPKA 4OZ0A 5HI7A 2KM8C 5THWA 3W65A 3AOCA 5D8HB 3TX0A 1EARA 4D3HA 3MM6A 4DZDA 4DL7A 1I94F 4IQMA 1JXVA 2RJZA 1ZAWA 4HKQA 5HAOA 3TVKA 3CDBA 4IO9Q 4KHPF 2YWKA 1ZM3A 3THPA 2BJ1A 4ZVFA 3RBDA 2CG8A 1EETB 4WJBA 5ETKA 4YP3A 1KVKA 3IO1A 3IG1B 1X4HA 1JLCA 2R3VA 3U27A 4O0IA 2LCWA 3Q23A 2QA1A 3PTWA 1RHMB 2L08A 2H4YB 2RHQB 4O3NA 4BLGA 1N5YA 3MF5A 2LEBA 3PY8A 2XMUA 5A8RB 4BS2A 5FJ4A 3KUEA 2NR0A 2HBZB 3MR7A 4WU2A 1S97A 1CS4A 3LW5C 3V2UC 2KYXA 3DOLB 3D28A 3MR6A 2VG7B 3ONQA 1FRKA 3A8KA 2CA9A 4F7VA 1GMWA 1TZ0A 2DH7A 2C2DA 4ALZA 7FDRA 1NO8A 1TV6A 2DGSA 3M2VB 3H2VE 3MMCB 4YY3F 1LWEA 3MMAA 4ZVOB 5HMYA 2FJXA 2F3JA 5CD4A 2MKKA 4NLWA 1WWHA 4DV6J 3TI0A 3HJVA 4DR6F 3V4MA 2M70A 1NKBA 2G2ZA 4C8OA 2CJAA 3G87A 3QO9B 1RAGB 1RKIA 2MEWA 2HNZA 4IKAA 4DL2A 5I3UB 5E3QA 3GV8B 4CLYA 2RQMA 2M5YA 2KXFA 2F7VA 2QV6A 4BBYA 2N3OA 4DPUA 2E1RA 3CCJS 1RT5B 5KFMA 1Y5LB 1QLNA 1KTVA 4N47A 4YB5A 4ZVSB 3W64A 2KTQA 2AIRB 5K8PA 1FDBA 2OELA 2U1AA 5KFUA 4BC7A 4TU7A 4NLOA 2ZZMA 3BH6B 4AQYF 3IA0A 2ZZTA 3CDWA 2DRBA 2AZ3A 3GG1A 1RT6B 2ZE2B 3FGVA 4DPXA 4PQUB 2DHHA 2JZ5A 2RIJA 4ANEA 2GFFA 2W25A 3CO9A 1HBNB 1X4FA 3HHDA 3L7UA 5F9LA 2W7PA 3G71S 1TKDA 4AL5A 2ILYA 4P74A 4ED3A 3VHQA 3RG6A 4DL3A 2QE5A 4X84A 3H4BA 2LDYA 2VU5A 2XULA 4KO0B 3I31A 2LMIA 2Z57B 1HQEB 3KUHA 4USWA 1MWQA 4KKOB 4UTGA 3TA2A 4DF8A 4A48A 3G6YA 2C2EA 3AXKA 1B4SA 5DM7Q 3FJ2A 2XS2A 1R0CB 1Y4ZB 1A6LA 1VRUB 4GVLA 1UL3A 3WHIA 1DTTA 2BJ7A 1TKXB 3F0NA 3JSBA 3M30A 3HHLC 5CHCB 4DDFA 3GQCA 4B3SJ 1DLOA 5BYSA 3QZ7A 2HW3A 2Q79A 2Y3YA 1YIJS 3GYGA 3RRGA 2IDLA 1O5JA 3G86A 1PKUA 1WI8A 4X66F 3LP1A 4K4SA 3HCXA 1S57A 2BKOA 3BO2A 1S9EB 3IC1A 4K4XA 3CF5Q 3IRXB 3CULA 2JX2A 5F8LA 3AA9A 2QIFA 3HP6A 3GWCA 2XZTB 2OMOA 3M2UA 1S10A 1LXNA 1U4BA 4L72B 4M1KA 2IDEA 3HLUA 9ATCB 2IYGA 2OAUA 2AD9A 4J9VA 2IRYA 4WFXA 4Y2KA 4OYMA 3BR9A 2MSSA 1U1LA 1TQLA 2VZ9A 3CJ2A 3I9V9 4I6WA 3LP0A 4DS4A 2L3MA 2LYVA 1CJUB 3M32B 3WIUA 4F26A 3VGTA 3V6KA 1GMWD 3UD3P 3P5TL 3TQEA 4DV5F 1U2FA 3VVUA 2CUYA 5KFGA 4PG8A 2MB0B 4DHVA 1U8WA 3J80Y 2GGPB 1FNMA 1PC4A 2CNNB 2QYCA 3IGNA 3QYYA 3R7BB 4NMXA 4CRJA 2P2CB 3ZTRA 4E98A 5LMUF 2CQPA 1VI7A 1REVA 1WEZA 2MMYA 3PHTA 3IWLA 1B64A 2IC3B 4UUXA 3OSPA 2VC0A 2ASJA 1YSJA 4YHHJ 2BV3A 4C4WA 1LV5A 4WK1A 4DV3J 1X0PA 3UFCX 3UQSA 1RDRA 1QD1A 5HP1B 2YWWA 3LPYA 3KLEB 1NUEA 2W8LA 1R8HA 4F4YA 1CLFA 4WIIA 1AXQA 3CD0A 2NXEA 4IH6A 5D77A 3CD7A 1RJJA 1WOOA 2DCUB 2VKRA 3SQGA 4ZPBA 4DSFA 1GXUA 3IR7B 1UVNA 3M6VA 3LGHA 4I68A 1R0AB 1BY9A 2R8HA 2WW8A 3K58A 2DKOB 4OLOA 2RS2A 1PYOB 1BGXT 2VHGA 4CLTA 3IAS9 1ZM4A 1TKTB 2H51B 4JI2J 4R5PB 4IFVA 2HEKA 3OTOJ 4QYZJ 3PRVA 5DG9A 1M5PC 2FZCB 3EVWA 1A7GE 1W7WA 4WP3A 3RAMA 4Q44A 3KJFB 3W5XA 1HQ2A 1TL3B 2I0XA 3D0HE 3BPDA 3TR5A 4UY85 3GZ7A 2KFNA 3OL8A 4MFBB 1RT4A 1WELA 2VFRA 3AJ1A 2HFSA 1XBWA 3AT1B 3P4UB 4FPRA 1F1BB 4OX7A 4K0KJ 2DNRA 2Q66A 2Q1LA 3PX0A 4OJHA 4DV0J 5B0EA 1UMJA 1WG1A 1RT2B 2HIQA 2LA4A 4CLUA 3GIRA 1FJCA 4X4VA 3A1YG 2B7CB 2YNFA 4P2MA 3RR7A 2HHVA 2FVPA 1JLQB 2CIMA 3IM9A 4KY3A 5DJBA 2R7VA 1K0TA 3M4XA 3PG9A 4LFCF 3UWTA 4JI0F 5LSOA 4DN0A 3DOMB 1HNXJ 3ZZTA 4OQJA 1IBKF 1Q1KA 4U8YA 1RT1B 4FZVA 2EFQA 4CWBA 4JI4J 2AHOB 4PCQA 3AOBA 1RT5A 5B0FA 2AYMA 2CG4A 3E51A 3MCOA 3Q8VA 2BM0A 3JQMA 2IA6A 2IM3A 1ZM2A 4OJ1A 4MH8A 1VBKA 4C2MA 3HHEA 4DQPA 4U95A 4C3KA 1K47A 4P73A 3R9LA 2KVQE 1A0OB 2V4JA 4PQUA 4OI4A 4XDDA 3U02A 1QY7A 2WVBA 3H2LA 5DDRC 1KC8T 4JI3J 3R3TA 4AFFA 3EGZA 3GG0A 3HHKA 2KO1A 2MZTA 2BQ3A 2HHQA 4K2JA 5D4NA 2QGFB 4UQGA 2F9DA 2LA6A 3H90A 2YKQA 4HTIA 1S1VA 4W4MA 2ADBA 4QWEA 5D0HA 4ICLA 1FESA 1TKXA 3OXFA 2XMJA 1RT7B 3MAHA 4ZP7A 1HYSA 2VQEJ 4BDPA 4OZNA 1RAOA 4XK8C 3QGGA 5IT0A 3PV8A 1Z4UA 1UVMA 1YJ9S 3MECA 2HURA 3T9NA 4C6AA 1VGYA 1TU0B 1UJ6A 4ECWA 2ERRA 4PG4A 4QU6A 3W9HA 2XI3A 4A8XA 3CTRA 2DGQA 1VK8A 3OLAA 2RVJA 4LVOP 3C6UB 3DRPB 2NSCA 4XAKA 3VGVA 3W2WA 2OKQA 2D41A 1F2HA 4A46A 1RT7A 4B9NA 3KLGA 3EYZA 1HR0J 1NZAA 4I67A 3MTJA 3OFGA 2IRXA 2MGZB 2JC1A 4LFBF 5K8NA 5GMKa 1IBLJ 5CYMA 5C24A 2P6TA 4USUA 3UD5A 3RRKA 5DRKA 5K14A 2PMZD 1KLNA 1FFSB 2CQBA 2QLBB 1BWEA 3Q8YA 3CJ8A 3K8WA 2V8HA 4M5KA 4IFYB 3OR2A 4Q8EA 5H9EJ 4KGMA 2IAJB 3KYLA 1DFDA 4QWDA 1K8AT 3QO9A 1QUVA 3DRXA 2AGQA 3SSSA 4G1PA 2L9DA 1IKVB 2DNQA 2GJIA 3VWSA 2O3DA 4USTA 1IBLF 2OPSA 2ZC3A 2QA4S 3HM9A 3QRRA 1O6XA 3PKMA 5CZXA 4F4KA 1T03A 1D09B 3KDNA 2MQLA 3U1MA 2B9YA 2ATLA 4OX9J 4MYTA 5A0YB 2UP1A 2ACMA 1JLAB 1CJKA 2CZ9A 2W7AA 3CIZA 3PO5A 2WONB 4WE1B 3BYRA 1GTHA 1X31C 3NGRA 5IM0A 4W90B 2JH3A 4NE9C 4NLXA 5D4OA 2V9WA 1U1PA 4LQ3A 2QMWA 1Q7LB 2QMUB 2ZZNA 2H5EA 2QL7B 2AZ1A 4NX9A 4ZCMA 4DSKA 1TL7B 2UXDF 2E1PA 2XYPB 4K4YA 2V0NA 3MM7B 4RZRA 1CULB 3VGSA 4JI6J 1UWAA 3EDRB 2ZVIA 1AB8A 3Q89A 4OX6A 4DV1F 2PFDA 3QMQA 2RF2A 1N5VA 1U24A 1IM4A 1WC5A 1BWVA 4N8OA 4ZVTB 2PE8A 2Q43A 3QGPA 4Z2XA 5IQ6A 5GAEU 3R97A 4B3TF 2VB6A 2HHWA 2J9CA 1XMQF 1SL2A 3EMTA 1U0HA 1FJGF 2IY5B 1GT8A 2FJAB 3I0RA 2G0IA 2DGTA 2IVYA 2MSTA 2IJRA 4M5NA 3I0SA 4XIUA 4NLSA 4DPWA 5BYRA 1LK5A 2UUCJ 1AW0A 4O0NA 2R7XA 1TV6B 2HBQB 4KSEB 2LXFA 2QFIA 3M2VA 3QSYB 2M7SA 3DLGA 2NYHA 3GR1A 2BE2A 4ICLB 2W4DA 3IWXA 3OTEA 3UVJA 2FHJA 3QIPB 1S6UA 4YMEA 1R0AA 3NL0A 4EUVA 1SCJB 2RH3A 3OVAA 2J6UA 4OZ3A 3ICLA 3MURP 2DH8A 4LSLB 4I2QB 2VQFF 2HK3A 4RO0A 4ZPTR 3W1YC 4IUFA 3ZZRA 1Y00A 5ETPA 1Q7YT 5DM6Q 3M7VA 3PFOA 5D4LA 4QYRA 1WC0A 3B54A 2ZEJA 2H5JB 3RRHA 3EJMA 3LAKA 3TAMA 4U7CA 4F67A 1U09A 4JI2F 4CH1A 3MM5B 4NWBA 3KTQA 4GKJJ 3M9MB 2AV5A 2OUGA 3VCDA 1S1XA 3J80U 1NDPA 3R5JB 2GHWA 3VAGA 3NOGA 3R7SB 3R5CA 1LW2B 1WTBA 1S1WA 3KHGA 1F9FA 1NK6A 1BXNA 3EVMA 5KFRA 3H59A 4RW7A 1CBKA 1U0HB 3PEJA 3PYEA 4RL1A 2RD5C 4WPAA 5KFLA 4ENOA 1M1KT 2F8EX 3GJQB 1TVRB 4Q0BA 3DGPA 3IR5B 4ZVGA 3FCHA 2B8QA 3ELHA 5AJ3J 2AYBA 3BR8A 3NMRA 2FYXA 2VUGA 3H5SA 4K2XA 4OZ1A 4F02A 4F3MA 3QJPA 4CTAA 3HFKA 5B0AA 3GSIA 2DIUA 3RBZA 2Y0BB 1FK9B 4RW8B 2XSJA 3DRSB 2HQGA 3M2RB 1RT1A 1RWKB 3V6JA 1NPRA 3KLIB 3M6XA 3ZTPA 4WFAQ 4W92B 1D3WA 2IM0A 2WVDA 5DQIA 2J5AA 2XY6A 3C19A 4RX6A 1UPPA 5KOWA 4HDGA 4LF5F 2J76E 3PO4A 1CJTA 4DLGA 1M1GA 3U1NA 3KHRA 2XS7A 4PWWA 5CQGA 2ZKTA 1H6KX 4H4KC 4WP8A 4KFBA 1XNQF 5KFCA 3PX6A 4NLVA 4M5IA 5D0EA 3PJWA 1I51B 1EP4A 1HD1A 2ZDOA 3BSAA 4NYOA 3MM5A 4OFZA 4WFBQ 3KLHB 3DOLA 1SIWB 3TUZC 4NXMJ 3T9ZA 5L1IA 4ZCIA 1YRUA 3SCKE 3CIMA 2J0SD 3I5CA 1OSDA 1HNWJ 4RU2A 4AXIA 2C2KB 1T05B 1OS5A 2O67A 1K1SA 1QDUB 4NLYA 5KFTA 1WDTA 3PW7A 2GA7A 2B9XA 3TWZA 2PSZA 2BVZA 1M90T 1ZTTA 1WJ9A 1NU4A 1LKZA 2AJ0A 5F3ZA 2EW9A 1EP4B 5F8NA 1HR0F 4FYXB 4KPYA 1IR2A 4KGXB 4KHMA 1N0VC 4FS2A 2MPUA 3HKWA 4TN2A 4ILLA 1YRTA 1UZDA 1YBAA 1KP6A 5AE1A 5M2RA 4NPOA 4QR1A 1FFGB 1RBLA 2VFSA 5IXUA 1IKYA 1I6JA 2DHGA 5ETNA 4C3MA 3IRWP 3VAFA 1EZZB 3VTIA 2UXBJ 3SBMA 2Q6BA 2DR8A 1VQNS 4EU0A 3QNWB 4BWMA 3VAJA 4DSJA 2CPYA 2DNLA 2K3IA 2R42A 2YNGB 2R8IA 3NKYA 4P7VA 1TL4A 4QJVA 2Z2LA 5IWAJ 5C7PA 3Q83A 1JJ2R 2R4FA 2FJEB 1E6VB 3MEEA 3RU0A 1HNVB 1N0UA 3BJYA 2V8DA 4DV1J 3FQLA 1KTQA 3KK1B 4PYAA 3RW7A 2HAFA 4TY9A 2BRLA 3N0VA 4IR9A 1X8DA 1FERA 2JLFA 3PYGA 1F5AA 2BJ8A 1R89A 2DD8S 2J0XA 4URQU 2FGOA 3IAM9 3CCSS 1HLWA 2G0JA 1UW9A 3NBPB 1KOHA 4WK3A 4NOHA 1S6QA 1MG7A 4OYWA 3NCPA 4RWXA 1SH2A 2OTJS 3BGFA 5JXSA 3HVWA 3K2YA 1HNIA 3TEGA 2LQBA 3R5DA 2AYEA 3HVTB 1BE4A 2P9GA 4EK2A 4B3TJ 1NH7A 1U02A 3QATA 5AXLA 3RW6A 2R8KA 1GK8A 1EQMA 2HRYA 3M32A 2QSWA 2ZH7A 2LDIA 1H73A 3KK3A 1HBOB 4DEZA 4DF4A 1NSAA 1VMBA 1Y0HA 4DV5J 2PA3A 4C8NA 1C2PA 4QIEA 4ED0A 3G82B 3BB5A 3HD1A 2ZJQQ 3O6QA 4KGVB 2J8SA 5J2MA 3K5MA 2VQFJ 1HNVA 5CA5A 4HH1A 5D0GA 7FD1A 5DQGA 4HEA9 1U45A 2KG0A 3R2CJ 2C2NA 3G8SA 1CQNA 4O44A 2WVEA 4B9TA 1DTQB 3V81A 2K2PA 3MAAA 2BRKA 2EXUA 1LEOA 4DV3F 1KSPA 1YBUA 4K50A 3TOQA 1SJFA 1JJHA 3FBBA 2AEJA 4XPCA 4I2QA 1XTZA 1Y9OA 1E6VA 1IKXB 4WTOB 2V2VA 5GAGU 2W7OA 1JK9B 1VQOS 3KLFA 1T9YA 4LBHA 2WVCA 4OX8A 5GAEI 2ZH3A 1JLFB 2HGNA 2XYHB 3CMES 2XNRA 4RUCA 2VBZA 1IBMJ 2E7WA 1H72C 1N6QB 4X65F 3PYFA 3MPWA 2QZ8A 2QA2A 2ZDPA 3G6ES 2FD2A 5JVGQ 5B08A 3BN7A 1VQMS 1U8SA 1EJ7L 3EGWB 2GMLA 1R27B 4QIVA 2BE7D 1C1CA 4IRCA 4B9SA 4LFAF 2X51A 3AFGA 4RW9A 2IPOB 3ENVA 3MWBA 4FP9A 4CH0S 2L9WA 4UT4A 1FE4A 1DTQA 4FN5A 3FC9A 5A6PA 4QW9A 1U1QA 4Q45A 4DG1B 2E9RX 1IBMF 3CE8A 4NZ0A 5KG1A 3MZIA 1H98A 4FYYB 2QSFA 5E7OB 4JUZA 1FJ7A 2GIQA 4WFYA 4TU9A 3P5BP 3JSRA 3UNGC 4CT9A 1FDDA 2QLFB 3PR4A 3F56A 1D1UA 1AUSL 3MXHP 2E1MC 4LR8A 4DPTA 1RQ0A 2AKWB 1U1RA 1RWXB 1Q5VA 4OZ5A 1GMVA 2MLYA 3D0GE 5KFAA 3OHBA 2AJ4A 5EWGA 1S1XB 4K8RA 5HK4A 2CPHA 4TLRA 2YKMA 2FJWA 1Q8IA 2K1RA 4PPZA 5C2CA 1FO1A 2CJ9A 4G1QB 2RF2B 4DV0F 3HHLB 2KT5A 2MLZA 2YPYA 1DY3A 4Y3CA 3R8YA 1RKJA 4J9QA 1TFWA 3MMBA 4ED2A 4DSLA 2R2RA 3AODA 4RLEA 2FPHX 4M5DB 3EWGA 2GJFA 4X66J 2APOA 1HWKA 2QO3A 3NBPA 3V4IA 2HG4A 3D6HB 2DXEA 3PYDA 3BN4A 4HT5A 4USVA 4EYHB 2MGZA 2GGPA 4DR2J 2H1YA 4I4BA 3G4SS 4ED1A 2LQ5A 2VBXA 5C25A 4LSNA 1AUDA 5HROB 3DNCA 2D9PA 4A8MP 5CCLA 1MU2B 1OIAA 2LU2A 2KXHA 3ADAC 2EG2A 1CC8A 2KH9A 5AJ3F 4IG3A 5HBMA 1IBCB 1FRHA 3T1YJ 1VQ4S 3H0PA 1XIQA 2GS8A 4NRTA 4GKKJ 3J81U 2E5GA 3ZZPA 2ZFHA 5L1KA 2HS4A 1G6BA 3W2VB 2D3O1 4K4UA 3DXBA 1QVFR 2BUNA 2BZ2A 4M5HA 4H4MA 2LVWA 3FSIA 1MU2A 1XEZA 2CJXB 3CCMS 1R6YA 5B0BA 4PRFA 2R2SA 4DX8H 3DC2A 5E2QA 1QSSA 2FHMA 4NYPA 4QIFA 3CMAS 3UD4P 4NRUA 1ZZFA 1U49A 3F41A 4DPYA 2JLGA 4B3SF 3UDEA 2AYGA 4ZOSA 1TKTA 4C8LA 2VOOA 3BKUA 4N5SA 2ZITA 2QG9B 3GCWP 3PFEA 3QFWA 4R8UA 3CPWR 2ALYB 2LECA 1PBAA 1ZA1B 3AH6A 3M30B 4NI2A 5LM7E 2V94A 2F40A 3RUBL 3VAKA 4ELUA 2GO9A 4DQQA 5DG8A 5K20B 1YJWS 5HMXA 4RUAA 1VQKS 2JHEA 3WC0A 4WZQA 1K73T 2HBRB 1LWCA 2OH2A 3TRGA 1DHMA 2HZAA 3GJSB 4P7TA 2MXYA 1JQGA 3IS9B 3HVTA 1X4CA 3IN5A 5DDQC 3CWJA 4IG3B 2KM8B 2MYFA 2CQ3A 2PA8D 4YDXA 3ZXWA 1IM6A 2UVRA 1MWZA 1NSKL 1HYSB 3M8PA 1P9QC 2RRNA 3FMBA 1FTCA 4PR6A 4JV5F 1XR5A 1YBTA 2AEMA 2UUWA 1FJGJ 3ENQA 2OPRA 2B8PA 1IR1A 2RS8A 3FBCA 2PO4A 2AGOA 4CLKA 2Z8QA 1NJYA 1FX4A 5G4DA 1XWLA 1JLGA 1DQAA 5E3PA 5LXRA 4J37A 2ZM6J 4OI1A 1DAXA 2ZH2A 2XMAA 5HLFA 4DR3F 2BQRA 1HI8A 2HNDA 2C42A 2K1RB 1IJFB 3JTNA 5F41A 4CNZA 4MIBA 3EM1A 3KJVB 4C0HA 5KG6A 1RYRA 1FCAA 4WCEQ 3D1QA 1Q16B 2HGLA 4TKTA 3OJUA 1NDLA 3CVKA 5GADI 1NDKA 4Y65A 3TVZA 3SCIE 2CNKB 3DOKB 3UE2A 3M2UB 4NLQA 2MLXA 3PIPQ 2EBGA 2NS1B 1TMMA 2MZSA 4FVCA 3LP1B 4C8KA 2EFPA 3UDVA 1S9EA 2IA0A 4LSNB 1UAWA 1YKWA 1SL1A 3NS7B 1REGX 2OSQA 5B0GA 3M8YA 3TW0A 1RYSA 2N3LA 4FF3A 2H4WB 3L9ZA 1HBMB 2ATCB 3ENWA 3KWMA 3SQGB 4FPIA 4X62F 2XLJA 4F2SA 4J9RA 2DXDA 5ETVA 1FEHA 4ID8A 4ZVRB 5DLGA 4NA1A 1NRKA 2VG5B 1F2GA 5D3GB 1T9TA 2NZCA 4OZLA 4V19X 1GQEA 5HMWA 1M5VC 2YKNA 3WDOA 4H4KA 3UR3C 1UFWA 3HHLD 1JKHA 3LF0A 2XZWA 5KG7A 3C6UA 1QAYA 3Q8QB 3HXMA 1DURA 2J6TA 4KV8A 2QLXA 3DKDA 2HQDA 2I5JA 5HLFB 4QR2A 3B8HA 3P8BB 2CVEA 2BABA 1RGVA 2V67A 1U6FA 1CULA 1CJTB 1IJEB 3MPDA 3ZO7A 2KXNB 2MZ1A 3C66A 1VHFA 2FZKB 4TVAB 2JWNA 3SYZA 1FDNA 2ZNYA 4WP9A 4DL0C 1SJ4P 4OZJA 3MMBB 4CYUA 2FIUA 2VA2A 4ZVPB 5A2QU 1JXLA 3JYTA 1OY6A 4ETXA 1FHTA 3H20A 3SI8A 2R7RA 3P3DA 5J2MB 1B7YB 2QC3A 5KG5A 1WF1A 4KYZA 4EBCA 2HLTA 4XTTA 3WBZA 2V9KA 3QLHA 3IS9A 1RWPB 4YB1P 1F3VA 4JV2A 1Y11A 2V2QA 2F8HA 2DGWA 3TJAA 1RB0A 2D9OA 1GNKA 4FNHA 5G0RA 1FDAA 3P6YC 1G2EA 3DYAB 3AXMA 3GTYX 5GADU 3JQJA 3MUMP 5AT1B 3FEXB 3GLJA 3DN9A 1SC6A 1RTDB 4OMFG 3RYLA 1WACA 3MEDA 1HMVB 3CJ0A 3MOZA 4RBVA 3NWRA 4UF4A 1FFWB 2BJEA 2W2QP 2M8DB 1K0VA 3C15B 4ECRA 1F5BA 2XI2A 2OLWA 1PAEX 2YKAA 1WKKA 2UUBF 3D6TB 2MKSA 1J2VA 2OPQB 1XMOJ 1PJ5A 1SV5A 2MQ8A 2RKIB 4JI8F 2XLKA 2YNHB 1RABB 2C2MB 2EK1A 3CJTA 1GXLA 4ZPVR 4ZA1A 4QQBA 5ETRA 5D6GA 3U7JA 4O3QA 1SI9A 3IBWA 5HQLA 3EZUA 2JC0A 2B3TB 1HMVA 1F9HA 4CO0A 2D7SA 4N41A 2CWXA 2MQNA 5DGAA 1TK5A 4BWJA 2YX1A 2CQHA 5C42A 3QSIA 1RT2A 3W5ZA 1BQNA 4LVNP 1P27B 5LSRA 1EQ0A 4KIAA 4I7FB 3QWUA 3FEZA 3R6LB 2PT0A 2W9CA 3Q0AA 3R2DJ 2AW0A 3MEDB 1FVSA 1XJWB 2GMJA 2V50A 2O5DA 3ENAA 5F8IA 1L3VA 1SJ3P 4TYAA 1XNQJ 1NKEA 1FK9A 1UFLA 3D3CJ 5KFKA 5J1NA 3MUTP 4NEYA 3BEGB 1ZTWA 3FCWA 4ZS6A 1P1LA 2HNYB 2VBWA 3K8VA 3SFUA 4CO4A 1W2BR 2YNHA 4WFZA 3VR1A 4EGLA 3O2IA 1Y5IB 3DDNA 2E1CA 3ZZZA 4I56A 4LRAA 1B0TA 2DR7A 3U1LA 1XR6A 4JI7J 1N5QA 3UCGA 4Z37A 3N6MA 4M8LA 3K5LA 3QGHA 5IM0B 3Q8RB 2Y1JA 4C9DA 4DI6A 4FBTA 1R31A 1FEEA 1I1GA 4KV8B 2N7YA 3MCMA 3X3UA 1NNDA 1KFSA 2NXJA 2G1DA 2MJUA 2XHWA 3H42A 4YS2A 1S0MA 1XN9A 3ZTOA 3CCLS 4DR4J 1SKRA 5FDLB 2BJDA 3MEKA 2DNGA 1VRTB 3D9BA 1ZETA 1S1WB 2CJYB 1Y10A 3FBFA 4K4VA 3B82A 2ABYA 2V4QA 3FEYB 1OO0B 3R6GB 3MR3A 5E41A 3EUNA 3OQ2A 2GHVC 2HWTA 3D67A 1N33J 4RUHA 2ZH9A 1RLDA 2K7KA 4WTYA 1LWFA 5A6WA 4LQ9A 3DLEB 4F25A 4DR3J 3J7A1 1FWKA 3BZQA 5CYQB 3MR2A 1HPZB 2XMVA 1XMQJ 1N33F 1R43A 1R6VA 4EWTA 3DMJB 3HF5A 5A8WA 3UN2A 4RBTA 1S99A 3J7Z5 3Q2SC 3KFWX 4OIXA 3IRXA 1WG5A 1WF2A 5K14B 5EGYA 3Q2TC 2HKEA 2COLA 1AA1B 5E3CA 2J0QD 1Q81T 2UUAJ 3M8QB 9RUBA 4B9UA 4IG0B 4CH7A 1J5OA 6AT1B 4DR7F 2YQ1A 4CO1A 4X4RA 4DR6J 2ROPA 3N5FA 5D0RA 4A4JA 1VQ7S 1S77D 4JI0J 4JI5J 1HWIA 4B17A 1JLBA 3G8QA 3ZNUA 1NK7A 3BM7A 2RSQA 1S4FA 3L95X 1DQ9A 1X4EA 3FDSA 5KG3A 4HH0A 3C14B 1SJQA 3TAMB 3DOKA 2CDRB 3P96A 4ZP8A 3TA0A 3G9CA 4MYUA 4FF1A 2UXCF 1J5OB 5B7WA 1SV5B 3TUIC 1O51A 1Y3JA 3MPUB 1KWMA 1RAEB 3MM9B 1N56A 3DMJA 2OP5A 1OYDA 3DLBA 1FXRA 3OHAA 5HATA 2B0GA 3BO3A 1IBKJ 4N7TA 3DCAA 4CDIA 1FI4A 2OPPB 2RU9A 1A9NB 1T9VA 3NGSA 1IQZA 5GAGI 3QT6A 2IMWP 3LO3A 3DLEA 2DGUA 3QQCD 4ZHRA 1JJ4A 1TL7A 4IOBA 1TAUA 5GAHI 2AWZA 3D1HA 4NXNF 2GZOA 1EX8A 4HHUA 3KXDA 1LW2A 3G2XA 4WYWA 3QLHB 2G4BA 4ES1A 4X4TA 1LWEB 1WEYA 3MMAB 1C1BA 1X4AA 4TNOA 3S6EA 1SUQA 3IP0A 5LMNJ 3DYAA 2EKNA 4HHHA 3D6MB 2KG1A 1U26A 2PI5A 1GEHA 1YDLA 2DBBA 2P9CA 4CP5A 1U1NA 3MFIA 1NJXA 1RAAB 3JQKA 4AE5A 3DOMA 1FF2A 1M5SA 3HX9A 1NSQA 2WCXA 2J9EA 4NLTA 1RTJB 2BOAA 3GJRB 4OI6A 4DCJB 4UOGA 4AL6A 3I55S 1QSYA 4BHQA 3FK4A 1RI7A 3AB4B 1N32J 2RQCA 2RT3A 2KZMA 2MQMA 3NAIA 2XYGB 5FLXU 2DXFA 4RW9B 4NCGA 2B4OA 5KTQA 1PG5B 2I38A 4RNOA 2V8PA 1YTYA 1ZS6A 1DRZA 1M5OC 1DZ5A 2GIFA 1RP5A 2CQ2A 1BQNB 2C3PA 1P8GA 4EO8A 4EZ6A 2YWGA 5EWFA 4GKKF 1QTNB 1VQSA 2GW8A 2GC8A 1T7PA 5K9FA 3UN5A 2DR5A 3ULHA 3D66A 3W61A 2HWHA 2R9LA 3ETMA 2HVIA 4PWDA 4CO2A 3DI6A 2DRDA 1X5SA 2JFDA 3NGTA 3O3LA 2ZUGA 2ZWOA 1KQKA 4L74A 3SSRA 5A76A 2CPZA 3GILA 1TUWA 4LFBJ 4Q2MA 5U47A 4OYXA 3JSYA 4C0OC 3TEHB 2CWKA 2YNIB 2YVSA 4W98A 1ZPVA 3T6JA 2QN6B 1I5OB 3FUYA 5RUBA 1CC7A 5ETOA 1NK0A 1XNRF 2HIYA 4HI2A 3BPSP 4HL9A 4TY8A 4C3LA 4DLEA 2C3YA 2F4FA 2B5JA 2WZ1A 3VAIA 1PGZA 4LF8F 1KONA 4KC5A 4H4MB 2H65B 3ZFVA 2XGQA 2U2FA 1S1UB 3CD5A 3BQ0A 4ED7A 1T11A 4G6VB 2G0CA 2DNHA 4YHHF 4A8WA 3BYPA 1X4GA 3MDFA 4P2SA 2HFZA 2UV8A 1OPZA 2PGCA 5FDLA 1Q78A 4LF9J 2JVOA 4LRFA 1SL0A 3UNYA 5L1JA 5LMUJ 4B3MJ 5E3AA 4CLFA 4YUDA 2OPPA 1TP7A 3G6XA 2GVDA 2VBYA 4RW4B 2XM3A 2J9DA 2CPEA 3NP5A 4Q0BB 1EHWA 3DRYA 1RXOB 2QMXA 5D15A 2HYIB 4HVZA 4JOUA 1KOOA 2CQ0A 2F1FA 3JAMY 4NLGA 2HHUA 2KU7A 3CGIA 1ZAXA 4ILMA 2DYAA 1P9YA 1YWXA 3KK1A 1LOUA 1UWBB 3EE3A 2QLJB 5LXYA 3JB9k 5CH7B 1GAOA 1S1UA 2YX4A 1UETA 4CIOA 1H3DA 1OQ6A 2ZJRQ 1JB0C 4IOCQ 4DR7J 4LMZA 3DLKB 1SH0A 2VICA 2BR0A 1N36J 4ED8A 5A0YA 3K7RA 3TQ1A 4ZVQB 2E9TA 1KQSR 1T3OA 4Y2IA 3GP9A 3HFZB 3N79A 3PACA 2UZAA 3C6TB 2X1GA 3FVYA 1VLYA 3QT7A 1KDNA 3HI9A 3CO0P 3MD1A 4AUKA 4LFCJ 1VFJA 3O5TB 2MHNA 3L4BC 1Y7PA 4QPTA 1G7CB 3UDCA 4AXJA 3J7ZT 4ES2A 3ITHA 2VASA 1U47A 3CCWA 4E0DA 5F8MA 2BMBA 4L6V3 5ETLA 4ZN3A 1VRUA 2MZRA 1Z1ZA 4CLWA 4OV6A 5DZ7A 2LQ9A 2RDIA 4CZCA 1ZZNA 3F73A 4K5SA 5KFNA 2EK6A 5M2UA 3NXZA 4RU9A 3MTKA 4K0KF 4OZ2A 3DHWC 3TNVA 4ELTA 4CO5A 1WNEA 5KT2A 1UW4A 2NCKL 2WB4A 4O23A 1C0UB 1JLFA 4RPFA 2JRSA 1RK8A 4DN9A 2W2NP 2CRLA 5L1LA 1UA0A 4P72A 3VAHA 3W62A 1RA7A 2XBPA 2J6SA 1CJVA 2RQKA 2BACA 2X7IA 4Y00A 4FXDA 3BS9A 1BD6A 3GU0A 3ZC4A 2DR9A 3EXYA 1T9UA 1X0FA 3IBFB 3KJNB 3PNIA 2XY5A 3G8TA 3LGNA 3HHLA 3LP0B 3TAQA 2AT1B 1P6TA 4D3GA 5M2PA 4HACB 2L48A 3S7RA 1VDHA 4N56A 3A13A 5DDOC 5J2QA 4M5LA 5ETQA 4M5DA 1JIHA 1VQ8S 1RBOB 3MPVA 2CZ4A 4LREA 4IO1A 2XMKA 1UJ5A 1TKZA 5J1PA 1LW0B 2CKWA 3WX8A 5KFFA 1NBEB 4DWIA 1NXIA 1W26A 4CLZA 1SC3B 5K5MA 2MKIA 1R0BG 2MKHA 4DR2F 3CCVS 3CJKB 5CAAA 2JL9A 2ZH1A 1SBRA 1ZYQA 1RWVB 4Y6IA 5IC6B 4ELVA 4FNIA 3M8RA 3B4MA 2FLLA 4MK8A 1U7LA 4Y28C 1PJ7A 2WB1D 4IH5A 5EHHA 2KJVA 3RZAA 3TZWA 2FJVA 1WOPA 3OL7A 2HHSA 5LL6d 2XWYA 3QAUA 1HD0A 3I96A 4O3RA 3KK2B 3I82A 4YQWA 1AZSA 2WRMA 4Q5VA 1URNA 1XQIA 3MAAB 3CJ3A 4J9MA 4TQRA 1XMBA 5F0WA 1HFEL 3CW2C 1RHUB 3C46A 4RR5A 2YNFB 3US5A 3LOUA 5E0OA 3HSDA 1LK7A 2DO4A 5B09A 3PR5B 2BDPA 1BUXA 5GVQA 4UZCA 3BF4A 1WORA 1RT6A 2ZE2A 1WHXA 2YPZA 1QJHA 5CD4H 1YJNS 3BSOA 3JTPA 1D8ZA 1QAJA 1KS2A 2AJ2A 1FRLA 2HVEA 4DUYJ 1B70B 4JI8J 1KVJA 1IN0A 3GE9A 4QIGA 4OYIA 1OY9A 1TUGB 1S6QB 3LALA 3HJFA 2LXUA 1Q0NA 3BV8A 5SUHA 4TQSA 4ER8A 1KD1T 1ITPA 3AD8C 4LJMA 3NS6A 1CEZA 1HHQA 3OJSA 5HN0A 2GAGC 2FHKA 2FJBB 1URRA 3A3OB 3ISZA 3CJKA 1DBDA 5I4MA 4I2PB 4ECQA 3MCNA 1X9SA 1N54B 5AE3A 3TZZA 3WIVA 4GRSA 1PJ6A 3L7OA 1X5OA 5HP1A 3UDLA 3VZHA 1H7WA 1HPZA 1TELA 4J7CA 2XG8A 2OPRB 3KG4A 4ECZA 1V3ZA 3J7AN 1FVQA 1FKPA 2YWEA 4PXDA 1YI2S 3HSZA 3MMCA 4ECTA 1CSJA 2FLOA 1HBNA 1GTEA 2FUG9 5IWAF 2XLIA 1N8RT 2XO6A 3FSYA 1FRJA 1JX4A 1WC4A 1VIXA 3H7HB 3HSGA 2W8KA 1PILA 2KN4A 2E44A 4NLPA 3RTVA 2LKZA 2DR6A 1MNEA 3AHPA 2HZVA 1QUPA 3MUVP 4DUZJ 5KT5A 3CT9A 3O44A 3IBCB 4ECXA 3T1AA 5I3QA 2J7WA 4ATNA 3GIJA 1S76D 3LANA 4ZP6A 5DDPC 1YHQS 4ZIVA 1Q53A 2BE9B 3M1VA 4JP8A 5I42B 5AXMA 2QFJA 1DLOB 3AAWB 1D9DA 2K3KA 2VG7A 2Y8YA 4J9PA 3HVRA 2YTCA 1X5PA 1FWLA 3MCSA 4NLUA 4QWBA 1S0VA 4N76A 2HRUA 1B0PA 2JLEA 4DR1F 4DFMA 4F8RA 4JV5J 3MR5A 3BBFA 4I69A 4N77A 2UUCF 4DV6F 1SVDA 3BBCA 4LIRA 2B9WA 4DUZF 6FD1A 2MDAA 1FJEB 4E2FB 2W4PA 4I6YA 2CJBA 5KFOA 1D9AA 1SQGA 2F9JA 1Q8KA 4YEAA 1WSRA 4X62J 1WI6A 2XGPA 1R8CA 3R27A 3UN3A 1RLCL 4TY8B 2HQIA 1VK3A 6FDRA 2MZJA 4PWUA 1FE0A 2OI2A 2VPYB 3MM6B 1KR4A 2E66A 3MM8A 4H4OB 2DO0A 1KFDA 4M5JA 2F4VF 2XMTA 2G13A 3BDEA 3GV7B 3SXLA 2E7VA 1W2IA 3IWNC 1ZOTA 2EC0A 3SV3A 1ICEB 2UXCJ 1YZ6A 1TUVA 1S5ZA 2OFGX 3KLVA 3K59A 4J9NA 1JLCB 1B7FA 4G1QA 1X60A 4A47A 1RSCA 4O4RA 3ZZ0A 1G3OA 2K06A 2FQQB 4AL7A 4TYBA 1QE1B 1VQ6S 2Z58B 2MY7A 1PYSB 5L8RC 3Q8PB 1YZ7A 3WZ0A 1H7XA 2DNOA 4FKXA 4BCAA 4ED6A 2EFNA 3ZZYA 1B3TA 2FLPA 3D0IE 5BR8J 2HHHJ 4F4XA 1UVLA 3R5AA 4CLPA 3KJVA 3T6BA 1SJ1A 1H0HB 2YKNB 3NCQA 4AT1B 4JV1A 4Q2LA 4OYBA 1MROB 3C8YA 2D3ZA 1UP1A 3OTDA 3PJ9A 4LFAJ 3V5RA 5KT4A 5MLCV 4DOZA 2L9NA 2WBRA 4ZPAA 2JEJA 4P2FA 4I64A 3C2PA 1QM9A 2A2DA 1XERA 1KQGB 5L9NA 1YJ7A 3ZTSA 2VG6A 3HULA 5FIIA 1JLEB 1EKRA 1FX2A 4ZP9A 1WHYA 2QL5B 2BX6A 2A6OA 3PW4A 3WC2A 1SQEA 3THTA 2WVFA 3D68A 4KH1B 2P5VA 3AB2B 4P9SA 4I1TA 3W2WB 4K5RA 4LF5J 1RTHA 5J1EB 1YJTA 2E7XA 2QA4G 2UUBJ 1BQMB 2Y1LB 1F0XA 2EVZA 1R8BA 1IUJA 4FF2A 5CYMB 5C24B 3E01A 2CVIA 3CXCR 5IT4A 3PRDA 1APSA 4R8UB 2JEFA 4OJ3A 3PCOB 4WKRA 4LRDA 1RWWB 2ADCA 2MKCA 1NCLA 1JKHB 5C42B 3NNCA 2E1AA 4MIWA 2B4UA 3EDQB 2GNKA 1B99A 1CPZA 2MJNA 4DCPB 4KE5A 1Q8BA 1X5TA 4NYZA 2VG5A 3DLLQ 5CYJA 5DZ6A 5I3PA 3IR6B 4WFNQ 1FXLA 2XSFA 4PXCA 2FTRA 1HI1A 3BDPA 3CDAA 1AZSB 4RW6A 2CQIA 3KG1A 2HVHA 2QJ3A 4O3PA 1WUUA 2IYIA 1Z2LA 1C0TB 1S9FA 2WAQD 2FLNA 2I1RA 4UOCA 1D0EA 2C1EB 5KFYA 2VL1A 4FKYA 2BW2A 2GVZA 2NREA 4FF4A 1CJKB 1WSVA 2OHDA 4RNFA 3TAPA 4KH0B 1D8YA 2JEIA 1U1MA 2VIHA 2DRAA 3W9JA 4K7QA 3Q8SB 2FHOB 1RTJA 2VD3A 5G0RB 2Q6CA 4EMDA 4OHXA 1S7HA 4DV4J 3KUGA 3QGIA 3DLKA 1NB2A 1WKLA 1R8PA 1ZPWX 4DS5A 1T9XA 3I4HX 2HNDB 1R3NA 4NCAA 3BQ2A 3MEEB 4KR0B 1TK0A 2DH9A 4LF9F 1IKWB 1RHJB 3SDEA 3PM9A 2M3DA 4DR5J 2E5LJ 3PKYA 1N5SA 3AQOA 5HO4A 1TL1A 2R7OA 4IH7A 4PG5A 5KG4A 3I32A 2W9AA 2VODA 2Z56B 4KHRA 2X1AA 3OVBA 2KT3A 3ET6B 2OD4A 4OX9F 2MTLA 1VQ5S 1FKAF 4RJVA 3IGVA 1S1TB 4OJGA 2NUUG 1IKVA 3OSNA 2GX8A 2CJQA 8AT1B 2VFUA 1C1BB 2WTFA 3NGDA 3UW1A 2LXIA 3AOAA 3NCRA 4OHWA 4K4TA 4X4UA 1HIYA 1T03B 2N82B 2V5HG 4I7FA 2LQ8A 2LEPA 4HHJA 4YR2A 2ILZA 4LIWA 1X4BA 4TXSA 3S01A 3RB6A 3OW2R 2IJNA 2RB7A 5A8RA 5LJ5Y 4KQZA 5KFBA 1I94J 5ITHA 3NNHA 2XY7A 3C15A 1BQXA 3LA0A 3OTBA 1IR0A 1U2CA 2OEMA 5I42A 4U9RA 3KLHA 1T8EA 1WHWA 7AT1B 1OPIA 3GFHA 4L76A 3TO8A 2VPWB 2V68A 2HLUA 2FY8A 2KRRA 2XTJP 1D9FA 3W5YA 4IFVB 2NPFA 3MEGB 2X1BA 1W25A 4X4QA 2PN6A 1CVJA 2UVVA 4F4ZA 3ILIA 2IIHA 3O8WA 2VJUA 2W24A 4LF7F 3M8QA 2J9DE 5HBMB 4NXNJ 4PYDA 3VQTA 3I0RB 1T94A 5K8OA 3OR1B 1KLMA 3I9ZA 2R2TA 1RBAA 4NLDA 4Y2CA 3W2VA 4GC6A 1YK9A 5BYQA 4GO7X 2IJFA 3SCLE 4RNHA 2IM2A 1UWBA 4NA2A 4Q43A 4B9MA 1PYTA 4X64J 2GQCA 5T7LA 3TUJC 4WU3A 4A8YA 2H48B 4LF6F 3KLIA 1N32F 4RBUA 3I87A 5A8KA 2DEIA 5FLXY 1DQ8A 1JLQA 1Z2ZA 3GPAA 3GIMA 4QOTA 2EBEA 1LWXA 3AY0A 4LT6A 2MQQA 3KG0A 3OT9A 4AQYJ 2DVIA 4CCHA 2V2ZA 1SC1B 5DGBA 2UV8G 4LBPA 2F5GA 3CJ4A 4TU8A 3BGRA 4USKA 1T3NA 1VQLS 1HL6A 2DNMA 3IM8A 3LAMA 3OFEA 5DS7A 1T95A 4L3KA 3LWLA 3D5MA 2BANA 1AYEA 2FC9A 3PXGa 2D3OR 4OI0A 5MAOA 4JI1F 3K0JA 3FQKA 2NYIA 3A12A 3MD3A 1REVB 1BMQB 2I6WA 1KN6A 3HKZD 2C3UA 2BEFA 2Y0SD 4U67Q 4MKBA 4R0EA 3J7YI 5IT9U 1EAYC 2UUTA 4RKUC 1VBZA 3GIKA 2BM1A 2A0FB 4IFYA 4C0BA 3PHEA 3PJXA 4F0HA 2OTLS 1FKOB 2WSFC 3C16A 2UXBF 4QR0A 4FYDA 2G9OA 1OMSA 2R7QA 2PFFB 2HSEB 1IKYB 1CG2A 3K5OA 4GMKA 5D4PA 3RBEA 3N01A 3VZIA 5B0CA 4QU7A 1ROFA 3HD2A 4USHA 4UUWA 3T1HJ 2ZBCA 4ZLPA 4J9UE 1I3OB 1R7IA 3OTCA 4CO3A 1XNRJ 2DY9A 2V8GA 1LFWA 5IV4A 2DJWA 3A3NB 1YLXA 2X1FA 1WHVA 4ILRA 3B4DA 2XC9A 2CQDA 2J0WA 1WTFA 2R8JA 2IRUA 4NL5A 4XO0A 4ECUA 4DL5A 3KK2A 1OY8A 3RGIA 4ECYA 1E6YB 2NXNA 4NEZA 1KRPA 1U48A 2DPJA 4ETZA 3I6PA 2CFXA 3H40A 3JSMA 2J7KA 2KYZA 2VONA 1KKHA 2E5IA 3BQ1A 4YOEA 1V5IB 2W4CA 4ED5A 4U8VA 4KJIA 1VYAA 1T05A 5L38A 3CJSA 3TUPA 2KHCA 1ZA2B 3DRSA 1KNZA 4C8YA 4GVBA 3UCZP 2GMHA 5IZHA 5KFDA 2PC6A 1S6PA 3FFIA 1VC5A 5ADZA 2HQCA 4ZLJA 1Q4RA 4X2BA 4L3NA 2CPXA 4NLRA 4PKDB 5L39A 3OR1A 1RTDA 1NSPA 2BKPA 2YBVA 3MHYA 1RWUA 2Z2ZA 4O4GA 2IBOA 3NG8A 2NUHA 1TL5A 2VDIA 4PUOB 2ZBIA 3DXSX 4Y2AA 2VKZG 4YDDB 3LQVA 3Q86A 2Z30B 3KJQB 1S6PB 4DCOB 4QWCA 4ZIWA 4L75A 4X4PA 3H25A 2G2OA 5C2GA 4HDHA 2GO8A 5H1SV 2DPIA 3HSJA 3PW5A 4G3IA 2DHSA 1QAIA 2FJDB 4G1IA 1HWUA 4PAAA 3M6WA 1IKWA 3HMJG 4KRWA 4EBEA 3HPOA 2QEXS 3GV5B 2AJQA 4WXOA 3W63A 2IFXA 4CYUB 1DJ0A 4DV7F 4A8KA 2HMIA 4Z7CA 4JI7F 3J81Y 3DRPA 4L73A 1FA0A 1O0PA 1F5CA 2AX1A 1ZM9A 2HS0A 1MMNA 2E5LF 1VISA 2RILA 2ZBRA 2ZOGA 4HI1A 4JV0A 2DIVA 1CQMA 3MEGA 3RAQA 4NCGB 2ASDA 1BC6A 1J27A 1NPPA 2B51A 2MQPA 4PG6A 4EO6A 5JUMA 1HA1A 5BXIA 1RCXB 2W01A 4NI2B 3EPIA 5KG2A 3DDIA 3OUYB 3THVA 2DY1A 2XZDB 5GMEA 1SKWA 2VFVA 1YGYA 3I0SB 5JVHQ 2WSCC 4DX6A 3MECB 1LXJA 2A2CA 5KFJA 3TANA 3NWGA 3PW0A 4LF4F 2CNLB 4HT7A 4ZVHA 1HW8A 5AE2A 1JNZB 3C6TA 3OVSA 2DGOA 3VQSA 4O44B 3V81B 1WC6A 2D1CA 2YQ0A 3TZXA 4PXEA 1R8AA 2P6SA 3QIPA 3BGOP 5ETSA 4C48A 3BBBA 4USMA 3RJMB 4DSEA 2BQUA 4N8NA 1EIYB 2EFGA 2KDOA 1YJUA 3FRYA 3H4DA 2ZHBA 4DUTA 2AX0A 3K17A 1V9OA 2ZC4A 2KB2A 3ETOA 4LBIA 4PEOA 4ECVA 4ZCLA 2D3UA 4I0WA 2VPXB 3PRBA 4RWWA 1UEUA 5F0UA 3W8PA 3BGRB 4CLLA 3WX4A 2JEGA 3C3LA 3CJRA 1WKJA 1RTHB 5J1EA 2HFVA 3QFHA 3QWPA 3PEHA 3CNQP 4OYZA 4DZ6A 4J9LA 3OFHA 2KHDA 5DO2A 2A3JA 3KDOA 3VGUA 5JJBA 5HANA 2ZH4A 5HVFA 1G1XA 1QTMA 1V3SA 2OPSB 4CQ1A 4A8OA 3SFGA 2C2ZB 1VQPS 4RW7B 3CDEA 2V63A 2HBYB 2XWXA 1OJ4A 1UA1A 5AXKA 2ZOMA 1K1QA 4DV2J 4LR9A 4HLBA 4X64F 4MAKA 3T1YF 3VVTA 1ZH5A 4QYZK 4B3RF 2HNZB 1NHKL 2KVIA 4EBDA 1JLBB 1UFKA 3K89A 1KEKA 3L3CA 1FNOA 2HPUA 3SV4A 2W2MP 1NM2A 4X4OA 3B6BA 3NRBA 5KFXA 4C11A 1HBUB 2RDDA 4WKYA 3UR0A 3PW2A 1ULRA 2RAQA 3TA1A 2M4MA 2C3OA 3OXLA 2YNIA 2Y8WA 4IYQA 1RCOB 3G6VA 2EFOA 2HFOA 1FRXA 4PG7A 2QRRA 4YB6A 2FC8A 2B43A 5E3RA 3J7YU 2H5IB 1KVIA 4RNNA 3E2EA 5ETTA 1HQUA 3M1VB 3NGUA 5KFWA 1UZHA 1HNWF 4EZ9A 2R7TA 3JSMB 3H5YA 2G1HA
chains in the Genus database with same CATH topology
3QJJA 4IR1A 2RE1A 2R2UA 1FRIA 2CPDA 5IS2A 4KKOA 4C98A 2ZNZA 3M9OB 3AQPA 2RU3A 2ALZA 3HHNB 3SSQA 4KAIA 2BE2B 2V4JB 4PPDA 1VC6A 3I5BA 1N6QA 2POKA 2EFVA 3V6DB 4DV4F 3R5BA 4DUYF 3LH2S 1QSLA 2M0GB 1JWWA 4QIWD 4DQIA 1S1TA 4NZ7A 4B3MF 4NCBA 1X7VA 5KFVA 4QBUA 3VF0B 4EEYA 4FXWA 4JBCA 1NJWA 4F3OA 4WYLA 2KI2A 2AJFE 4ZKAA 2WBMA 5KOXA 3TX8A 1S6OA 2HNYA 5LT5A 2B6AB 1BLUA 1LFPA 3BREA 1YVFA 1N4LA 1YJRA 5SZTA 5KFPA 1H2TZ 4DSIA 2Y1IA 5J2PB 3CCQS 1NH8A 2J7UA 5IT9Y 4ZCKA 4DQSA 4FBUA 1M5KC 2IVMA 2EI5A 3FFIB 1S9GB 2KFYA 3ZZOA 2JFKA 4F50A 2E29A 3KLGB 2QT7A 4DFJA 2YKMB 2A1BA 2LU1A 4P6QA 3K57A 1T02A 3FSXA 2HFNA 2BYCA 2RDJA 4URSA 3ITHB 4Y2MA 3AJ2A 2D74B 3OTOF 1FT8A 3T3FA 4AYBD 4I6AA 4MTPA 2DNYA 3HVAA 3NNAA 4LSLA 2PEHA 2IAJA 1N48A 3CCZA 3L7PA 5A8WB 2CPFA 4JI4F 1N5YB 4DMZA 4ECSA 5EUHA 1RAJA 1VBYA 2IVFB 1DTTB 1C4CA 3MAQA 1FNXH 2HGMA 2VH7A 2IHR1 4DBQA 4GKJF 3RB0A 2X3GA 3T19A 1NEEA 4YB7A 4DJBA 1IKXA 3PIOQ 2RQ4A 1U6BA 3E01B 1HHSA 3DM2A 1XR7A 3QIDA 1Q82T 3NAHA 1KHWA 1S72S 4UQTA 3RB3A 3E8OA 2W9BA 3TVYA 5J2QB 5KT3A 5BR8F 2HHHF 1JXEA 2GQ2A 1TL3A 1UVKA 1ZAVA 5KFEA 3MI7X 4Q7AA 4Y34A 4J9KA 3V4IB 4MKYA 4Q8FA 3MM7A 2UU9F 2B7BB 3QPIA 5KT6A 2UVUA 2FDNA 4F3QA 2AU0A 5KFQA 4RW8A 2XSJB 3BGLA 3M2RA 1JJ4A 4FS1A 4PUOA 3CSKA 5KFHA 3T5KA 4G3IA 2CPIA 3EGNA 3DLHA 5EX0A 2AP6A 4IDKB 1FXDA 2N7CA 2YNGA 2NSBA 3W7BA 3V6DA 3K5PA 2V2KA 1SH3A 2ASLA 2XCAA 3SZ2A 2M9KA 1X9WA 3DM2B 2PI4A 2OSRA 2QLWA 1O8BA 4OHYA 1H2VZ 3UPFA 4YR3A 3GYXB 3FMWA 4BC9A 1DARA 4FXVA 2C3MA 1NJIT 4M95A 2AJ1A 4PXBA 4DFKA 2JSXA 4JI3F 3KHHA 3T5LA 3DLJA 4E8UA 3H98A 4V19J 2NPIA 2M2BA 1ELOA 1U2RA 2DHXA 2FVRA 4UW2A 2ZH5A 2W9BB 4OL8A 1E6YA 3H8YA 2DK2A 3S8SA 2GJ2A 3RR8A 1S79A 1WD6A 2PMHA 1L5UA 2RNEA 2FHJD 2W9CB 4FVMA 4KO0A 2R8GA 1RT4B 3OLBA 1MW7A 5KAKA 5L9XA 3DDKA 3M05A 5KT7A 1H38A 1RISA 4YFUA 2CQ1A 3KKFA 2ROEA 3LWMA 3RAXA 3TARA 2YKPA 2VQEF 5IQQA