1TL3B

Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
422
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 112
structure length 401
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B04
3QLHB 1HQEB 4R5PA 3H5UA 3JYTB 3QIDA 4TN2A 4ED6A 5I42A 1JKHB 1RTDA 2VA2A 1KLMB 2EC0A 4YR3A 4H4MB 2UVUA 4RW9A 3MEDA 3T5KA 1S0MA 4J9PA 2J6UA 1N5YB 1S49A 3MEEA 2J6SA 3V6KA 2W9AA 1RA7A 1N56A 3IRXB 4O3PA 2YKMB 1S4FA 1VRTA 2W9CB 2UVRA 3DMJB 4M94A 4FBTA 5KFUA 4J9RA 5KT3A 3V81B 4Y34A 4RW7A 3KK1B 1RDRA 4ZPBA 4EO8A 2YNIB 3G6XA 4EBDA 1TKZB 2ZE2A 3PR5B 3IRXA 4RNOA 2J6TA 3DLGA 2R2SA 3I5BA 5KT5A 5J2PB 4NLGA 4RW6A 3RAQA 4RNFA 5KT6A 2FVSA 4ED7A 2HNZB 1N6QB 3IGNA 1S6QA 3KLGA 3TAMB 5I3UA 3MF5A 4NLQA 1MU2A 3KMSA 5DQHA 1RTJB 5EWEA 5KFQA 3IGVA 4RNHA 4LQ9A 2IC3B 5KFOA 3DLEA 3BQ1A 4XPCA 4I2PB 3HVAA 2AGQA 4O3SA 5CYMB 4Q8EA 1HPZB 4ZVGA 1RT1B 2RF2B 4MFBB 1JLEA 5L1IA 1HQUB 3KMQA 5J2PA 4NZ0A 4NRUA 2ZD1A 5JUMA 2IMWP 2VG6B 3CJ4A 3BJYA 2FJVA 2DPIA 1MMLA 3GV7B 2B6AA 2R8HA 5F9LA 4MFBA 1QAJA 5DGBA 4G3IA 2WB4A 4G1QB 4IG3B 5KT2A 2B5JA 3PHEA 4Y2CA 5HBMA 3H40A 1S97A 3V6JA 2OPRB 3NMAA 4WZQA 3V4IB 3NBPB 1S1UA 2OPQB 3GIKA 1MU2B 4ECQA 4NYZA 3D5MA 5KG0A 3MEDB 4O3QA 2AGOA 3DRRA 4LQ3A 5CYMA 3Q8SB 1LW2A 2WRMA 2WK4A 4IOBA 1JLQA 3ITHB 4NLWA 5KFBA 3M9OB 4ECYA 4NCGB 3QLHA 1WNEA 1FK9B 1SUQA 5C42A 2OPQA 1YVFA 5C24B 4FBUA 3T1AA 5KFRA 1J5OB 1GX6A 5KFFA 4F50A 3LP2A 3KK3A 4ZHRB 1TKXA 1KHVA 2BANA 4WYWA 2C2DA 1RT7A 3DM2A 2VG7B 3G86A 3BSCA 4MIBA 2YKNA 1JLBB 3RB6A 4RNMA 2VA3A 2AX0A 2YKMA 4J9NA 3DLKA 3V6DA 3DOKA 2XI3A 1RT4A 4LSLA 5F8LA 3NL0A 2WTFA 2RKIB 5DGAA 4KV8A 3GV8B 1TQLA 3V81A 4J9SA 1HNVA 1BQNA 3PJXA 3T5JA 4JV1A 4DL5A 3BSNA 2AU0A 3NAHA 3DMJA 4RW9B 2ZKUA 3CJ0A 2XGPA 2BQRA 2JEFA 2BR0A 5K14B 4J9LA 3KJVA 4IKAA 3H4BA 5DLFA 1RTIA 4R8UA 3ISND 4ZPDA 4GC7A 1S9EB 1T05A 4NLPA 2HNDA 4IH7A 4TY8A 1TKTA 3OLAA 2JLEA 3TAMA 5I3UB 1QE1A 4J9MA 3BQ2A 5KT4A 1C2PA 3CIZA 5F8MA 4DL2A 2C28A 1LW2B 4PQUA 2YNFA 3IS9B 3LP0A 2FVCA 5F8IA 4O3OA 1IKYA 2I5JA 3DLGB 3CDUA 1KHWA 5KT7A 4WXOA 2IJNA 4J9OA 2E9TA 3M8PA 1DLOA 4KKOA 1ZTTA 3LAKA 2VG5A 2GIRA 3BSAA 4NLRA 4WFXA 1HNIB 5KFLA 3KJVB 3CVKA 4B3OB 1TL1B 3DYAB 2R2TA 5DLGA 4M95A 3KLEB 3VQSA 1S1VA 3PVXA 1ZETA 4ECRA 2B6AB 5KG5A 3T5HA 4MIAA 1CSJA 4MK9A 1NHUA 4KFBB 3T19A 2AX1A 3OL6A 5HLFA 5HP1A 1HYSA 4IR1A 2YNFB 5L1LA 2QV6A 3EPGA 4ZP8A 4ED2A 2JEJA 4ICLB 2IJFA 4O3RA 2BRLA 4ED1A 2D3UA 1DTTB 3H98A 2O5DA 3UDLA 2IC3A 3I0RB 5FDLA 4ZPAA 2I5JB 3QZ7A 2R2UA 1SV5A 1RAJA 4O3NA 2C2RA 2XCPA 1Z4UA 5KG7A 4KE5A 4K4XA 3CWJA 1XR6A 4DL6A 3I0SA 1FKPA 5DQGA 1RYRA 1C1CB 4RW4B 3KLHA 3JSMA 3BREA 5F8HA 3I0RA 4KFBA 5FDLB 1SH3A 4EO6A 4XPEA 2HNDB 4KV8B 4PUOA 5L1JA 3Q8RB 1IKXB 1ZTWA 2JC0A 3KHGA 2OPSA 3HVTB 4YMEA 4RW8B 1BQMA 1EETA 1TL1A 3DYAA 4RW8A 2BRKA 2HWHA 4KHRA 4URQU 5KFDA 4ID5B 3KHRA 1HMVA 5J2NB 3GYNA 2HNYA 2R8GA 4DEZA 4IRDA 2WONB 4IFYB 2UUTA 4U6PA 4PUOB 3KK3B 3LANA 4EBEA 4ZVFA 3PW7A 2FLLA 2WOMA 3KLFA 2IA6A 3D28A 3QGIA 2IAJA 4DL7A 1N5YA 2IBKA 4NCGA 3KHLA 3ITHA 2ATLA 1S6PB 3FQKA 4MK8A 2D3ZA 3IN5A 5EWGA 3OSPA 1JLCB 4EEYA 5KFWA 3DLEB 5EUHA 3PW2A 2W7PA 5F8JA 4TQRA 3MECA 1T05B 3MEGA 4DL3A 2YNGA 4K4YA 1JLQB 4Q8FA 4MKBA 5K14A 4Q44A 3GILA 4ZP7A 4KB7A 2B5JB 2FLNA 3E01A 4K4ZA 4IDKA 5JXSA 3MR6A 3OL8A 4KAIA 3DRPB 2UVWA 4ECZA 2RDJA 2UVVA 2FVRA 2QE5A 1S9EA 2ALZA 1JLGA 3KHHA 2WONA 4O44A 4ED8A 3KOAA 1IKVB 1XR7A 2HAIA 1IKWA 2ILYA 4FS1A 4NLXA 4IQXA 1UWBA 5KFKA 1BQMB 1EETB 4TLRA 1TV6B 5L9XA 3HVTA 4ZMMA 4I7FA 4B3OA 1TVRB 5KG1A 1JLAA 2R8IA 3QIPB 1TVRA 3FFIB 3SI8A 1RT5A 1N48A 3FRZA 2BANB 1XR5A 2RKIA 5DG7A 4MH8A 4RUAA 3NKYA 4K4WA 3OL7A 3UQSA 1QAIA 4ECWA 4JUZA 1IKVA 2JEGA 4ECSA 3LALA 4TXSA 2YNHB 1RT3A 4LSNB 5KFIA 5J1EA 3M8QB 4Y3CA 5EDWA 1KLMA 4IRKA 1DTQA 2R8KA 3FSIA 1R0AA 3N6LA 4YR2A 4WYLA 3MECB 4WZMA 3CJ3A 4QWCA 3RBDA 4URSA 4ECVA 1TKZA 2ZE2B 2GC8A 4Q0BB 1W25A 4PWDA 4QWAA 3M9NB 5C25A 3MFIA 4I7FB 3ISNC 5D3GA 3TQ1A 3RB3A 2ASJA 2IAJB 3C6TB 4K4UA 3KLFB 5KG3A 1LWFA 1IKWB 1JX4A 2OPRA 3T5LA 3BSOA 1LWCB 3H5YA 3MR2A 1RTHA 2AWZA 4G1QA 5KFVA 3FDSA 4WFZA 1JLAB 3LAMA 3MFHA 1S0NA 4KBIA 5CYQA 4OL8A 4K4TA 3KNAA 4ZHRA 1RTDB 5EWFA 2WCXA 1S9GB 4O44B 4NLVA 5KFHA 3UPFA 1S1XA 3QO9A 3E51A 4O4RA 1C0TB 1SUQB 4H4OB 1HQUA 1R0AB 3CJ2A 3QZ8A 2AGPA 1JLEB 4RUCA 1C1BB 4NRTA 3PR4A 4IDKB 5J2MA 3N6MA 1FKOB 3M8QA 3KK2B 1S0OA 4Q0BA 3CDWA 1JKHA 3JYTA 4GC6A 5KFEA 3HKWA 4TY8B 3G6YA 4WE1A 4IRCA 3HHKA 5HROB 4QWDA 5J2QA 3Q8PB 1S6QB 3KLGB 3KK1A 3KK2A 4NLTA 5J1EB 3PW4A 5J2MB 4WFYA 4F4WA 1S48A 4KHMA 1LW0B 1S6PA 4URGA 4DL4A 1JIHA 3PJWA 2IM3A 1BQNB 4F4ZA 3SFGA 2XI2A 1RT2B 4NLSA 2W8LA 4RW6B 1VRTB 4YP3A 2BE2A 3DI6A 5KFPA 2ASLA 4EYIB 1NHVA 2FJWA 1RT6B 3Q8QB 4EYHB 2YNIA 4O4GA 3IG1A 4RW7B 3MEEB 1NNDA 3QGHA 2HMIB 2V4RA 2AQ4A 1JLBA 2OH2A 2W7OA 4QW8A 3KLEA 1LW0A 2XWYA 1S10A 5DG8A 3DRSB 1TV6A 3E01B 2DPJA 4H4MA 4JV0A 5KFYA 3GQCA 2F8EX 4I2PA 4R0EA 3LP2B 4ZP6A 1HNIA 1LWFB 2VG5B 4K50A 1T94A 1SV5B 3BQ0A 1RA6A 4KO0A 3OL9A 2JEIA 3N6NA 3EZUA 3OHBA 1DTQB 3KLIA 5KFXA 1FKOA 3I0SB 2B43A 4F4XA 4FS2A 1LWEB 1HQEA 1S1WB 4R5PB 3MEGB 1S1XB 3QO9B 3GIMA 2I1RA 1S9GA 4IG0A 5KFAA 5KFNA 3RB0A 4IH5A 3QYYA 2D41A 3HVWA 2FVPA 5C5JA 1U09A 5HBMB 1RTIB 4Y2AA 1RT5B 4Q43A 3CJ5A 1D0EA 4RZRA 3QIPA 2XGQA 1C0UB 2W9BA 1T03B 2FJXA 1REVA 5KG2A 1TL3B 2W9CA 3DRSA 2FLPA 5DG9A 2WOMB 3H4DA 2C2EA 1RYSA 4ZVHA 3C6TA 2GIQA 4ZPCA 3DOLA 3IG1B 4O4GB 3LP1B 3RBEA 4TYAA 4LSLB 3BGRA 4IR9A 5KFSA 4ED0A 1S1VB 4ID5A 1C1CA 3KLHB 2CKWA 1QUVA 2XC9A 4PWDB 1TL3A 3UR0A 4EBCA 1RT2A 3EPIA 2BQ3A 1K1SA 3NAIA 4RNNA 3RB4A 4NLDA 5L1KA 1RT7B 3DM2B 4KKOB 2IM0A 1TKXB 1JLGB 3H5XA 2V4QA 4DG1B 1VRUB 4DG1A 4IG0B 5KFCA 1IKYB 3PZPA 1JLCA 3CO9A 3H59A 1S1TB 1LWEA 3I5AA 2V9WA 3OHAA 3DRRB 1EP4A 3CDEA 3MR3A 5F9NA 2E9ZA 5HP1B 1TKTB 1IM4A 4JV2A 4TQSA 2IM2A 4IFVA 1D1UA 4ZVEA 1S9FA 1C0TA 1JLFA 1S1UB 4H4OA 3DDKA 3ICLA 4IFYA 3GIJA 2RDIA 4J9QA 3PW5A 3RAXA 3FFIA 4ECTA 3V6DB 4XO0A 5DQIA 1SH0A 4I2QB 2IM1A 4K4VA 1REVB 4QWEA 4QWBA 1T03A 3V6HA 4HKQA 5HLFB 4NLYA 2R2RA 2JC1A 4TYBA 5KFGA 4H54A 4HYKA 1RTHB 1DLOB 4ZP9A 3H5SA 1LWCA 3DOLB 2BQUA 4RU9A 2ASDA 1RT6A 1RT4B 1J5OA 3OSNA 2VG6A 3DRPA 3DLKB 1HMVB 5J2NA 2HWIA 2ILZA 1TP7A 5F8NA 3IS9A 1EP4B 1FK9A 5C42B 2FVQA 5KFZA 1T3NA 5I42B 2YKNB 5C25B 2YNGB 2UUWA 3GIIA 1IKXA 4YR0A 3M8PB 4K4SA 2E9RX 3KLIB 4TY9A 5J2QB 3PW0A 5HROA 4NLOA 4RW4A 3JSMB 2CJQA 1OS5A 3I5CA 3NBPA 1JXLA 4R8UB 2R8JA 3C6UB 4ICLA 3M9MB 1S1TA 4J9KA 1K1QA 1QE1B 2HNZA 1N4LA 1N6QA 1HYSB 1C1BA 4ECXA 1RT3B 4LSNA 1HNVB 1VRUA 5KFJA 2YNHA 4KO0B 2HMIA 4MKAA 3LP1A 1HARA 2OPPA 4ECUA 4MK7A 3V4IA 4WXWA 4ED3A 4Q45A 2HNYB 3DOKB 2ZD1B 3DI6B 4QW9A 3OLBA 5KG4A 5CYQB 3KLVA 4IG3A 5F8GA 4I2QA 4F4YA 2OPSB 1C0UA 4YQWA 2W9BB 4U7CA 2VG7A 3BGRB 3QGGA 1HPZA 4KSEB 3MTKA 1JLFB 2OPPB 1UWBB 4IFVB 5KFTA 5KFMA 2W8KA 5C24A 2BE2B 3H2LA 1FKPB 1SH2A 3FQLA 4PQUB 1I6JA 3BR9A 5D3GB 1S1WA 4X2BA 5KG6A 4IH6A 3C6UA 1RT1A 2RF2A 4NLUA 2C22A 5T14A 3G6VA 2WHOA 2XCAA 3GV5B 2V0NA 3SFUA 4QPXA 4WE1B 1GX5A 3TVKA 3MR5A 1RTJA 2D7SA 3NGDA 3LP0B 1DTTA
chains in the Genus database with same CATH superfamily
4DMZA 1HQEB 3QIDA 2YWEA 1N34J 1HNZJ 2HSEB 4KY3A 2GVZB 3HLUA 1HI8A 1NK5A 1SCJB 2DIUA 2HAFA 3JSYA 4CLTA 4CTAB 3LUYA 1S49A 3MEEA 3V6KA 2CQ2A 3FBCA 3MM5B 4QPTA 4FXVA 3VGVA 2DHSA 4CLWA 4P2XA 1S4FA 5IFMA 1VRTA 2DR8A 2Z2YB 4L6V3 5KFUA 2PD1A 5T41A 3MCMA 2BJ1A 2LECA 1M5OC 4Y34A 3W5XA 4YHHF 5A2QU 4EO8A 2C2ZB 3THTA 5A8WA 4GKKJ 4QYZJ 1PJ7A 2DK2A 2WBRA 3IRXA 5ETKA 5LMUF 1QTNB 4A8SA 3ILOA 2F4VJ 2ZVSA 5KT5A 1HNWF 2UUBF 4NLGA 4RW6A 1RB0A 2BJ3A 2V69A 1VLOA 2NXCA 2XMMA 2FHOB 1N8RT 4DSIA 2HNZB 1N6QB 2R8GA 2RH3A 2HZVA 1XNQF 4Q2LA 1Q0NA 3IWLA 5J1PA 3R2DJ 2GV1A 4JI1J 1NJXA 2DRAA 4M5LA 1AROP 5GVQA 2XSJB 2BJEA 2V4JB 3LPYA 1V3SA 4RNHA 2IC3B 4TQSA 3DLEA 5L8RC 2HQFA 4I2PB 2AGQA 2P6TA 5CYMB 3FK4A 2BW2A 4ZVGA 1NH7A 1DQAA 3P4UB 1I5OB 1AZSA 4UF4A 3MM9A 1VJQA 3ZTOA 4NZ0A 1VI7A 1XBWA 2VG6B 2W4DA 3H20A 3CJ4A 3D0HE 3BJYA 3PM9A 2QYCA 2K7KA 2FJVA 4USHA 3K58A 2DXEA 1YI2S 2ZM6J 2IY5B 1N52B 4IUFA 1TFYA 1PKUA 5AXKA 5F9LA 2V8PA 4G3IA 1UEUA 2V2VA 2WB4A 4IG3B 1I1GA 3W61A 4Y2CA 3MEKA 2CXEA 3GJRB 5GAHU 1VQMS 4Y00A 2M9KA 1IQTA 3DGPB 2YWFA 3NS6A 4ILRA 4WZQA 2A0FB 4LF7F 2UXDF 3D6FB 3M2RB 2IDEA 2CPEA 3GR1A 4NYZA 3D5MA 3HHLA 4ECQA 1RP5A 1KQFB 1UPPA 1RK8A 2B9YA 1R31A 2F8MA 3BN7A 3DRRA 3SQGB 2GJ2A 2M0GB 3R5BA 1IVZA 4ECYA 1NU4A 4NLWA 5E3CA 3M9OB 2KZMA 2HQ3A 1FK9B 2MGZB 2DNPA 4A8YA 1YVFA 3ENVA 4LMZA 3H0PA 1APSA 4FBUA 3T1AA 3UO0A 3VWSA 5IV3A 1YBTA 4ZHRB 3P5BP 2BYCA 1K44A 1KHVA 3KJNB 5LM7E 1RT7A 2VG7B 2WSEC 4I6AA 2YKNA 4PG6A 2G1DA 3UD5A 1FFSB 1LOUA 2QT7A 3L7PA 3G96A 4LRFA 1S77D 4PPZA 1X4BA 2FGCA 4Y28C 1AB8A 1ZAVA 4ZVRB 2G4BA 1SI9A 3O3LA 5AE3A 2ROPA 4DSLA 2GJFA 3QRQA 1R27B 4ES2A 2WTFA 2RKIB 4NEYA 4KV8A 3HM9A 3L95X 1BQNA 1CJUB 3NLCA 3T5JA 2DGSA 4DL5A 2FZKB 2AU0A 2J9DE 3O8WA 1KRPA 2JEFA 3CCMS 1X4CA 4QBUA 3K7RA 2BR0A 4J9LA 2V4JA 4R8UA 3ISND 2DT9A 3BGOP 3OBIA 1S9EB 1T05A 4GC7A 2HNDA 4TY8A 2Q6CA 4LFCF 1KSPA 1FCAA 1P1TA 2M70A 2JLEA 1Y3KA 3UVJB 4JI6F 2KVQE 3QATA 3BQ2A 1VBXA 4TU8A 1SL1A 2QEXS 4FXDA 1C2PA 3UN2A 2FHKA 1Q78A 3MMCB 4DL2A 1CQMA 2EKYA 3W60A 1LW2B 5B7WA 4B02A 3EGZA 2I9SA 2GAHC 1EZZB 2I5JA 4J9VA 2HBQB 3ZZRA 2HS4A 4C48A 2DYAA 2V50A 4J9OA 4N56A 2GIRA 4ED5A 4X2BA 3NOCA 5DJBA 1HNIB 1XK8A 3HSJA 3G9CA 1WTFA 2PSZA 5CZVA 5LSOA 2R7SA 2Q79A 3NS5A 3MPVA 3ILLA 2OSRA 2JHEA 3HFZB 3AB2B 1Q8KA 4M5DB 4LF7J 4LT6A 4MIAA 2HQGA 1SXLA 1CSJA 4MK9A 2A2CA 3HZEA 2HW3A 5KTQA 3ETMA 4OI1A 1HR0J 4YB1P 3OT9A 5GAHI 1HL6A 2KG1A 1U0SA 4O3RA 2XMAA 2BRLA 2VHGA 4ZPWR 4ED1A 2OJ3A 2CPHA 3QAUA 4PQAA 3J7AN 2BABA 4C0HA 2IC3A 3I4PA 5FDLA 2CUYA 3CC4S 1FA0A 1P8GA 1UW4A 2DH8A 2DNMA 3D66A 3TJAA 1SV5A 4CM0A 3EVMA 2XCPA 2ZH7A 5KG7A 3DC2A 1OY9A 2KDOA 2QN6B 1S7HA 3B82A 5GAEU 4CH1A 1H2TZ 3Q22A 1FKPA 5DQGA 2V67A 3VHQA 1CEZA 1C1CB 5DETA 3P45B 2GIFA 4OV1A 3W62A 3Q8RB 4KFBA 4EO6A 1KC8T 2DHAA 4XPEA 1K0TA 1VQYA 4PUOA 2V8DA 2JOQA 3MGJA 4C0BA 4A8WA 3UD4P 1IKXB 1ZTWA 3C19A 2NXUA 1F9FA 2OPSA 2K8GA 1G3OA 2OMOA 4YMEA 5A8WB 5KFDA 2HWHA 3RW6A 4RW8A 4UOCA 4DQRA 5J2NB 3GYNA 3TJ9A 4ZK7M 4UY8T 3MM6B 5K9FA 4DEZA 2PFFB 2WONB 4IFYB 2W25A 3AB4B 1EKSA 2FUG9 2GQ2A 4KGXB 4PXDA 4ZCMA 4LRAA 2FLLA 2NSBA 4QOTA 2ZBPA 3ZO7A 4ATNA 3VAJA 5HQMA 6FDRA 5H1SV 4DL7A 3GB0A 1N5YA 3OFEA 4NCGA 1E6YA 1R89A 5I4MA 1X5PA 2GFFA 2J76E 3ETOA 1TR0A 2GCFA 3FQKA 2WW8A 3M1VB 2KFNA 2V63A 3EM1A 1QVFR 3QSYB 3NCRA 3THPA 3UVJA 1RKIA 3DLEB 2CPJA 2DISA 1TU0B 1OYEA 2WVDA 5EUHA 5F8JA 3MECA 3R5CA 1T05B 1EAYC 1AYEA 2E5IA 2B3TB 2WVCA 5ETOA 5FIIA 4JV5F 1B0TA 4CLUA 1ACMB 2B56A 2NPIA 3KG1A 1U1QA 5D77A 2B5JB 4K4ZA 1BQXA 1TUGB 3PIOQ 3MR6A 3ADAC 3OL8A 1KQGB 1HHSA 4MTPA 3NXZA 5HMXA 2UVWA 5KOWA 1EIYB 1NMEB 5A2QY 1S9EA 1JLGA 1QAXA 3EGWB 4FYWB 3CDAA 1T9UA 2HAIA 1HBOB 1IKWA 1TTHB 3PACA 2ZH4A 4FS1A 4F02A 4X4SA 4IRCA 2CG4A 1I3OB 1EETB 3KWMA 5L9XA 1YZ7A 1NSQA 1N88A 2FZCB 4TU9A 3SI8A 2BZ2A 1TVRA 2ZH2A 1ZYQA 3BZQA 2BANB 1HWKA 5DDOC 5DG7A 2ZZNA 2DNLA 4ITSA 1FI4A 2JVRA 4ZCIA 1TK5A 2IHR1 4F4YA 5CAAA 3LALA 4ECSA 1O5JA 2YNHB 1N33F 4LSNB 5KFIA 4CLFA 2UUBJ 3CMES 1CULA 4Y3CA 1F2HA 2UUCF 1BGXT 2DO4A 1DTQA 1UFWA 2OEJA 4IRKA 4KC5A 3CE8A 3AQOA 3DU6A 4ZKAA 3FSIA 3PYEA 3TYTA 4ZLJA 3S8SA 3DXBA 3E2EA 1X5OA 3N6LA 3KDOA 4P2FA 3CCLS 3AT1B 5T7LB 3ELHA 4MYTA 1M1HA 4URSA 4ZVUB 4USMA 4ECVA 4B17A 2GX8A 2N4DA 5E2QA 3RZAA 4W90B 1FRHA 3M6XA 2BBEA 4F0HA 5C25A 2DGTA 3TEGA 3ISNC 3HX9A 4WP3A 3M8SA 2A6OA 1JJ4A 2ASJA 2KFZA 1CPZA 3C6TB 3JTNA 4K5RA 3BO3A 3OTOJ 2NCKL 1RTHA 1B99A 4I6YA 1TAQA 3QRPA 2BM1A 2WVEA 2VF3A 3OR1B 3LAMA 4WFZA 5AT1B 2Q3PA 2O1PA 2ZFHA 4L76A 4QZVB 2AYBA 3D2WA 3KJFB 2OIHA 2U1AA 1RTDB 4UT4A 1HBOA 1S9GB 1IR1A 2MQ8A 5ETNA 4FF4A 4UOHA 2W4PA 3RB3A 2WZ1A 5A8RB 1R0AB 2BOPA 2R7RA 1JLEB 2HRTA 2LA6A 1DJ0A 3NCQA 5B0EA 1C1BB 4RUCA 4JI4F 4IDKB 5J2MA 3N6MA 1FKOB 2FTRA 4Q0BA 2Y9HA 2BEFA 3I4HX 3CTRA 5M2RA 5K8MA 2LP4A 2C3MA 3FGVA 1HBUA 3QFWA 2EPIA 4P7TA 4NWBA 3R8YA 3CCJS 1L3KA 4ZDNA 3M8YA 4LIWA 2XLJA 1VDHA 3GG1A 5HROB 3HHKA 2LQ8A 2RJZA 3IAM9 3M2VA 3O5TB 4Y0FA 3CMQA 4QWDA 1K8AT 4USKA 3MAQA 4UOFA 1CULB 2FB0A 3U02A 2CPYA 1FWLA 2AJ4A 3E8OA 4F4WA 1I94J 1D9FA 4ZIWA 1VQ8S 3ZZZA 1A0OB 3SFGA 2CQPA 3OFGA 1Q5YA 4RW6B 1VRTB 3CCTA 1T95A 4NLSA 2QA1A 2HFUA 1KP6A 1YJVA 3D1OA 3F41A 3NGTA 4BBYA 5KFPA 1IJEB 2OELA 4NCBA 2OMLA 4YDXA 1UETA 3HO1A 1T9YA 2V4RA 3QGHA 1HNWJ 2JH3A 2QMWA 2LDYA 3KLEA 2BJDA 5LMUJ 1S10A 3DRSB 2HRYA 2AJ0A 2EVZA 2V8VA 3LP2B 4BWMA 4NE9C 4ETXA 2KH9A 4ZA1A 1SV5B 1RA6A 1ZOTA 2KXFA 1Y7PA 2XMTA 1R6VA 1Q8BA 3K5MA 3N6NA 2FY8A 3EZUA 4OX9J 1DTQB 4DR5F 5AE1A 2HHQA 2DD8S 3CJRA 3IBCB 5D4LA 2GNKA 5L39A 2NZCA 1WHXA 4F4XA 1RWVB 4MYUA 4RLEA 1LWEB 1YJ7A 2DCLA 3MMAA 3WHIA 1S72S 4R5PB 2J7WA 1WHYA 4USVA 2BE7D 2DEIA 3H90A 1N0VC 1X4DA 5T7LA 3R6LB 4DS4A 2HHWA 2YKQA 4PXEA 1LXNA 5KFAA 4RR5A 2HFOA 4IH5A 3QYYA 2D41A 2DGUA 5D4OA 5IC4B 5IT9Y 2E5JA 1U09A 3IO1A 2NS1B 4OI3A 1RTIB 4Y2AA 1U2CA 1RT5B 1N5QA 3CJ5A 4FYXB 1X5SA 3IA0A 4DU7A 1F5CA 2MYFA 2W9BA 1T03B 5LSLA 4J90A 4CLLA 1MWZA 1TL3B 5E33A 3K0JA 4AXIA 1RLDA 3FKBA 4RWXA 3VGTA 3H4DA 3CCSS 2R7UA 3C6TA 1F9EB 2GIQA 3MI7X 1WEZA 1BE4A 2HURA 5DRKA 3OTBA 4NYPA 4NZ6A 4JP8A 3DXSX 1URNA 2H48B 4ID5A 3KLHB 4YN3B 2LEBA 3WZ0A 3RRHA 3ENAA 3EPIA 1WC4A 1TUVA 1SC4B 1O6XA 5I3PA 1FERA 4NLDA 1H2UX 5D78A 5HK4A 4OQJA 2Z2LA 2XS2A 2V4QA 1Q81T 1SJ3P 1VQ4S 2F1FA 1JQGA 3B54A 3G4SS 1HBUB 3H59A 5EGYA 1S1TB 1TL4A 3BPDA 1EP4A 5B0GA 3CDEA 4GVLA 2C3YA 1RBAA 1NZAA 1ROFA 2NSCA 3SMZA 1U49A 3EE3A 4P52A 2X7IA 3QGPA 4ZVEA 2XY7A 7AT1B 1VQ6S 4TVAB 3ICLA 2XLIA 3RAXA 4NXMF 1FRIA 4E0DA 3EGVA 2A18A 2UU9J 4XO0A 1MROB 5DQIA 1IQZA 4M5IA 3A4TA 2KB2A 1YG0A 2Q1LA 4RL1A 4DX8H 1VQ9S 2J5AA 4HKQA 5HLFB 5KFGA 2R2RA 2JC1A 1ZM2A 2MZJA 3OQ2A 5LXRA 2KYXA 1DLOB 2DBBA 3A3NB 3FSXA 3DOLB 2IFXA 2LQ5A 2VL1A 2ZOGA 3NOGA 4P75A 2G2YA 4RU9A 4K0KJ 3ONQA 1J5OA 2HWIA 4JI8F 4BCAA 1TP7A 4CZCA 3B6BA 1QDUB 5KFZA 1FXRA 4OX8A 3IRWP 2YNGB 2CNNB 4CO4A 3GIIA 3ZNUA 3QT5A 4BWJA 1NAQA 1URRA 2VBYA 2DNQA 3CCZA 3LF0A 4TY9A 1W26A 4WIIA 5HROA 4F3MA 4NCAA 3QJPA 2PA8D 1BWVA 5DZ7A 1NSPA 1HNXJ 4GVBA 2G0CA 3NBPA 2R8JA 2RS8A 3UR3C 2B0GA 9RUBA 3C6UB 3M9MB 2FPHX 2QFJA 2OO4A 3K5NA 1YK9A 4MIWA 3D67A 2HVDA 1QE1B 2GVDA 1N4LA 5E3QA 2MKIA 2VD3A 3CMAS 1NKBA 2O01C 5GAEI 1D9AA 1HD1A 1HARA 1LKZA 2GMLA 4F2RA 2QLXA 3OD2A 2ZD1B 3DI6B 2YWWA 3U1MA 2OPSB 4N8NA 2QYGA 3FSYA 4HHJA 2W9BB 2D74B 2Y0BB 4U8VA 4U7CA 4NASA 2CPXA 1RAIB 5JJBA 2C3UA 4NXNF 1RWMB 1OMSA 1VFJA 2E7WA 3MTKA 4OHYA 3N5BA 1RHQB 4IFVB 1RACB 5KFTA 4DV0J 3OR2B 2F7VA 5KFMA 2BXJA 3CO0P 5C24A 1P27B 1FKPB 1SH2A 4PQUB 1NK7A 1B0VA 4B9NA 4WBFA 3CJKA 2ALYB 3CSKA 1IBLJ 4IH6A 1Z1ZA 1RT1A 3N0VA 3Q89A 1JNZB 3A8IA 4P72A 4AUKA 4DUZF 1R6YA 1W2IA 2N7YA 1CLFA 1FX4A 3GV5B 1UAWA 4K59A 3SFUA 4OX6A 3OJSA 4DV4J 1NK9A 1WJ9A 2D69A 4WE1B 3TVKA 3BKTA 5HANA 2ZZTA 3BPSP 3FC9A 3RG6A 3QLHB 3M32A 2VOOA 4TN2A 3JYTB 1G1XA 4F7VA 2VA2A 1Q95G 2E7VA 4UQGA 4A8QA 1KWMA 2MQMA 1DHMA 2VU5A 4H4MB 2PE8A 4RW9A 3D0GE 3MEDA 1O51A 2CPIA 2LLZA 1XNQJ 3W3SA 1GK8A 1RJJA 3G87A 4CWBA 1HWIA 1WOPA 2O67A 3D1QA 3TRGA 2J6SA 5HQLA 1RA7A 3J81j 4LFBJ 4RUHA 3IRXB 4M8LA 1FVSA 2JFKA 2V8HA 1S7IA 1F3FA 1JXVA 1OWXA 2C2OB 2M7SA 2ROGA 7FDRA 4NPOA 2UVRA 5THWA 2VJUA 5KT3A 2F65A 1Y5IB 1R8BA 3V81B 1U8SA 2QL5B 2CAJA 4DDFA 3VAKA 1BY9A 3ILJA 1RAEB 2YNIB 3AAWB 3IP0A 4CRJA 1TKZB 4DN9A 3UNYA 3PR5B 3G6XA 2R2SA 4G6VB 5HATA 3A3OB 3PYDA 3IR6B 2BJ7A 5J2PB 1HIYA 3RAQA 2P6SA 3HFKA 3TZYA 1IBKF 1IBLF 2FVSA 3AJ1A 3EVOA 2B4UA 1BC6A 2G0IA 1KVIA 4LF4J 3IGNA 2IMOA 3BGFA 2W2OP 1FJ7A 4P10A 3MURP 3PO5A 3WX8A 2W8LA 8AT1B 2VPWB 4M5KA 4JI4J 3QFHA 4NLQA 1RAHB 2ZNYA 5DQHA 4L72B 5EWEA 4LQ9A 4UOGA 2UXBJ 3BQ1A 4XPCA 3HVAA 1LEOA 3I9V9 3SQGA 2MSSA 4Q8EA 2G13A 3O1LA 1GNKA 2RF2B 3SCKE 1RI7A 4LF8J 1XNRF 1RAAB 5IC6B 2KHCA 2XTJP 5L1IA 3POTA 4B9VA 1FD8A 1ZS6A 4K5SA 1X4HA 4PEOA 4OMFG 4ANEA 2XNQA 2ZD1A 4NRUA 5JUMA 4FYYB 2XBPA 2ZOFA 2ZKTA 3KDNA 1TL7B 1XTZA 2QMXA 5SUHA 3CXCR 4DV2F 1NKCA 2Y8WA 4DF4A 3W65A 3T1YF 1MMLA 2LXIA 2WB1D 3GV7B 2PMHA 2QA4G 2ADBA 4JI0J 5DGBA 2QJ3A 3RU0A 2E7XA 2RMLA 5KT2A 2C42A 3H40A 3NMRA 2DHGA 2CQBA 4FZVA 2DHHA 2PC6A 2X3GA 3QSIA 3NBPB 2WAQD 4NYOA 1AT1B 4L3NA 3BYRA 1MU2B 2K3KA 4CLKA 4PKDB 4TKTA 3OFHA 1YZ6A 4QIFA 2H1YA 3IFEA 2HHUA 3HFVA 5CD4A 1LW2A 4LIRA 4C6AA 4IOBA 3HHNB 5CCMA 5KFBA 1NB2A 4UUXA 2W01A 3QLHA 3EVWA 3M32B 4DSKA 5C42A 3P6YC 4FPIA 1K47A 1NEEA 2J9DA 3GJQB 3GU0A 1UJ6A 2OTJS 3EWGA 1M5VC 3MM7B 3KK3A 4NMLA 4F3OA 3J7YU 4KYZA 3TAPA 1TKXA 2F9JA 1VQPS 3R6GB 4AL5A 2CJBA 3MTJA 1U1RA 3P96A 1X9WA 1B7FA 1S6OA 4AL6A 2VA3A 2ZH1A 2K1RA 2RILA 3CC7S 4KH0B 3DOKA 1Q53A 1MN7A 1NRKA 2AJ2A 1BWEA 1F9HA 3I9ZA 2PMWA 4KH1B 4JI0F 2N7CA 2J0QD 2NZ4A 2F3JA 2FHJD 2JSXA 1TQLA 3V81A 2QLJB 3GJSB 4LF1A 4F26A 1P1LA 4ZN1A 3GV8B 1HWUA 2MDAA 3TW0A 4CT9A 4X64J 1VHIA 1WOOA 3NAHA 4RW9B 2ZKUA 2XGPA 2O3DA 5M2UA 1X8DA 3KJVA 2PDAA 3RUBL 2YBVA 3KXDA 5GAGI 4NLPA 2AD9A 5D4PA 4IH7A 4ALZA 4LF2A 3OLAA 1DARA 1QE1A 1N54B 3NRBA 4J9MA 4WU2A 2MKSA 2G2ZA 2IBOA 4OJ1A 3KNGA 3K17A 3R2CJ 1XNRJ 2FVCA 4B08A 1XWLA 4O3OA 1IKYA 1OQ6A 2YKOA 4ERDA 4KIAA 4P71A 2W2MP 1YJWS 1SIZA 1IUJA 2MEWA 2MSTA 3M8PA 2OFHX 2QRRA 4KKOA 3PDNA 3R5DA 1M1GA 4NLRA 2L41A 1RWUA 1S6UA 5H9FJ 2E1CA 2HVHA 1N36J 4NMXA 1Y3JA 2ZC3A 2PA3A 1PG5B 2AGPA 3DYAB 2H3EB 1YJ9S 4DR6F 3D6TB 1GTHA 4USWA 3VQSA 1S1VA 2N82B 2KI2A 1UPMB 3D3CJ 2APOA 3HSZA 1KBRA 3OL6A 5A8KA 5HP1A 3D9BA 1HYSA 3TZWA 4KHPF 4LF4F 2YNFB 2QV6A 3EPGA 1HI1A 1MLAA 4ZP8A 3A3PB 2AEJA 1X31C 3RTVA 4XAKA 1VC6A 5AXNA 2CQ1A 5C7PA 4M1KA 4TU7A 2U2FA 4A8KA 1FFWB 2IDLA 3H2VE 5KAKA 5D4NA 4AQYF 2DNRA 4CO0A 5F3ZA 3PO4A 4DV1J 1NB7A 1D3WA 1FT8A 1WSVA 1NM2A 2R2UA 2EBEA 2LQ9A 3OW2R 3THVA 4DX5A 1NJWA 3W2VB 1H98A 1RAJA 4CH0S 2C2RA 1KDNA 4D3HA 3JXOA 1KTVA 2HHSA 4C11A 4DL6A 1UZDA 4U96A 2CJXB 1DBDA 4OZ3A 1DQ8A 3BS9A 1FJGJ 3R7NB 5EHHA 4USJC 4GKJJ 3GP9A 5AXMA 1CS4A 1S99A 1HKAA 4OYIA 3Q8VA 5HMWA 2BVZA 2CA9A 2VC1A 3VR1A 3MPDA 1ZM4A 2DRDA 1XEZA 4EGLA 4Y6IA 3VQTA 1H0HB 2MY7A 3OTCA 3F44A 1BQMA 1FWPA 5IZHA 4YY3F 2X51A 4URQU 3KHRA 2CJKA 2ZZMA 1QM9A 2YTCA 2HNYA 3P8BB 4ZVQB 4QQBA 4Z37A 1FFGB 5AJ3J 1L3UA 1DY3A 3D6MB 4U6PA 1UJ5A 4PUOB 5HSPA 3LANA 4DR1J 3PW7A 3DDIA 4DV3F 4ELVA 3VAIA 2G1HA 2R7XA 3NG8A 3D28A 2IA6A 4K2JA 4CYUB 5LXYA 3R5GA 3DKDA 4KR0B 4HVZA 3R1LA 4LR7A 1FD2A 3FNNA 2ATLA 3HD1A 1UW9A 1UZHA 2VC0A 2FY1A 2HZAA 2D3ZA 4MK8A 4N47A 5EWGA 5DDPC 3IN5A 5KFWA 4L73A 3RR7A 2YWGA 4DX6A 4N7TA 1Q16B 2Z56B 2HBZB 4CLZA 2JL9A 1Y11A 2MQQA 4W4MA 1XN9A 3LWLA 2C2MB 3DGPA 4Q8FA 2EFGA 1T0TV 4XDCA 5K14A 4Z2XA 3GILA 1U1OA 1HNXF 1FNMA 2DNKA 3BEGB 4KB7A 5CCLA 2MZSA 5JXSA 3F73A 3IMQJ 4YS2A 3ZZUA 2DO0A 4CI0B 2FVRA 1TK8A 2DNZA 3KHHA 5CABA 1NDKA 3OV7A 3A8JA 5K20B 1SQFA 3RRGA 5IM0A 2YY3A 4TLRA 1Y4ZB 4UZBA 5ADZA 1SB6A 2IIHA 5E7OB 2R8IA 3QIPB 4K0KF 3DHXA 1N48A 1XR5A 4PXBA 4MH8A 3RRKA 2I2YA 3GYGA 2LVWA 2GJIA 3UQSA 2FHJA 3AD7C 2EFPA 3MMJA 4JUZA 5FLXU 4HI2A 3SDEB 1LV5A 3I32A 4JV5J 4KQZA 1VC0A 3BGUA 1PYTA 3OTEA 4YB5A 2OEKA 3PNIA 3HT3A 2MQPA 3M8QB 2GMHA 5EDWA 1V3ZA 3Q8YA 4DXLA 1PIEA 4BC9A 4FF2A 3US5A 4WKYA 1SKSA 2R8KA 1RE1B 1R0AA 4A8MP 2VBWA 5ITHA 4YR2A 3HCXA 4WYLA 4WZMA 2VDHA 3MMBA 4DWIA 5L46A 3RBDA 4N76A 1CJKA 5E41A 4DR3J 2CNLB 1U1PA 2V5HG 1S76D 4Q0BB 1WC1A 1W25A 1RHKB 1WF0A 1GMWA 3ULHA 4QWAA 1PC5A 1ZA2B 4JI8J 5I3QA 2ERRA 1RU2A 5CQGA 1NDLA 2QX0A 4IO1A 5D3GA 4DPOA 1YBAA 1R8HA 3TQ1A 4UTGA 4CYUA 1RAOA 4N77A 2Y0SD 3KLFB 1N5TA 2FD2A 1LWFA 2VV5A 1IKWB 2GHVC 3M8ZA 2OPRA 3SEOA 2IVYA 4OYOA 3BSOA 3H5YA 3MR7A 1R8AA 4CM2A 1SC6A 2CQ4A 3BO2A 4P9SA 1S0NA 3MFHA 5CYQA 2W2NP 4WK1A 1RWWB 4X84A 1U2FA 4ZHRA 1WELA 3GLJA 3ZTSA 1U6FA 2C2KB 3KNAA 3CCQS 4NEZA 4B3TF 4DPXA 4O44B 4O0IA 2XNRA 3UPFA 3QO9A 2CDQA 3M6VA 4O4RA 4H4OB 1SUQB 2AMCB 4HACA 5D15A 2PI4A 4DSJA 2AV5A 5EX0A 1NJYA 2XMVA 2OI2A 4BC7A 3UDCA 5BXIA 4NL5A 1RWXB 1FRKA 2EK6A 2F4FA 1EKRA 1JKHA 4PYAA 3JYTA 3M30A 3CJ8A 5KFEA 1J2VA 4TY8B 6FD1A 4GC6A 1FKAF 4FF1A 1HBNB 3BV8A 4JOUA 1Q1KA 2CWXA 4O23A 1ZM9A 3TUPA 1QVGR 4OX9F 3SCIE 3T6JA 3KK2A 5J2MB 1PBAA 1EJ7L 1HD0A 2MHEA 4KHMA 4B3MF 4JI5J 4NI2A 3PJWA 2J0XA 1PGZA 4ZVTB 2QTWA 1RT2B 2XI2A 1VBYA 4Q7AA 4YEAA 3TOQA 2ASLA 1YKWA 1NDPA 5A8KB 5IXUA 4EYIB 3QMQA 1F1BB 2NREA 1TK0A 1RT6B 5LT5A 3Q8QB 4ZVPB 1VIOA 1FXLA 4O4GA 3OTDA 4V1Ak 2AQ4A 1M90T 1JLBA 2W7OA 5U47A 2B51A 3FEXB 3OR1A 3KUGA 2CFXA 4TNOA 2ZH6A 2DPJA 5LL6d 2JNJA 3OPKA 4F2SA 2AW0A 2DGQA 4R0EA 1UMJA 4ZP6A 5HAOA 3TX0A 2QSWA 1LWFB 2Z57B 3MMBB 2PO4A 4FDFA 4KO0A 2J9EA 5E0OA 3PG9A 2QLWA 2QLBB 1EHWA 3I31A 5KFXA 1OPZA 3VF0B 3W9IA 1FKOA 1SKUB 4DR5J 2B43A 5ETLA 2ZJPQ 3LPEA 4FS2A 3VZIA 1VQSA 2DR7A 4DLEA 3VGSA 1DQ9A 1GXLA 4DPTA 2K06A 3QO9B 4P73A 3J7A1 1YX2A 5KFNA 1XC9A 3JQKA 1D8YA 4N5SA 2R7TA 3CCUS 2BA9A 1G6BA 2FJEB 3TWZA 2LXUA 2UV8G 1T9VA 1U1KA 4F8RA 4L3KA 1SKRA 3QIPA 1R7IA 2FJXA 1REVA 5KG2A 2ZDPA 1XMQF 5DG9A 2DNYA 2ZBQA 2HIYA 4C8NA 1NSAA 3GR0A 4JI7J 2CQCA 3UNGC 1JB0C 3I55S 3BGRA 2I6WA 1K73T 2Q66A 3H42A 4HR2A 2VB6A 2RD5C 5A6WA 3OVAA 2KTQA 1C1CA 2CKWA 2DNNA 1QUVA 3QQCD 1PCAA 1RT2A 1WC3A 2MKHA 1K1SA 4HH0A 2ATCB 4RNNA 2W4CA 1N34F 1HNZF 1H73A 4JYAF 1WKKA 4B3RF 5L1KA 2VPYB 3DM2B 3ZZPA 1TKXB 2QGFB 2DXFA 3GCXP 3H5XA 1QLNA 2VDIA 4YFUA 3FJ2A 3C16A 4I68A 4OI2A 1O8BA 4IG0B 1P9YA 1IKYB 1VR6A 2LEAA 5BYRA 5KFCA 5B0BA 3PZPA 1JLCA 1U24A 2QFIA 4LF5J 1U25A 3CO9A 2AYMA 3CJSA 2MHNA 3MCSA 1UWAA 4H4KA 3S7RA 3LWMA 1F2GA 1LWEA 2B7CB 1FTRA 2MZTA 3I5AA 3MMAB 4FKXA 4MMOA 4C8YA 3C14B 4S0MA 5F9NA 1H7XA 4WTYA 2CRLA 4IR9A 5ETRA 4JV2A 2FLOA 1R43A 2IM2A 3D3BJ 2ZITA 3ET6B 2G0JA 4H4OA 1JLFA 2C2NA 3DDKA 4HACB 3OVSA 3GIJA 1HFEL 3M1VA 1EX8A 4J9QA 3PW5A 3LGNA 1RLCL 2CJYB 1SH0A 1WDTA 2CQ0A 2Z58B 1RBLA 1OJ4A 4RO0A 4K4VA 1S0VA 2RT3A 4UW2A 1QD1A 1IXKA 3SV3A 1NK4A 3CULA 2ZHAA 5KOXA 4LREA 1Y5LB 1RTHB 1BUXA 2W1BA 2HBYB 1LWCA 4OYPA 5LJ5Y 2UZAA 2CPZA 5AE2A 2BQUA 1N5VA 1RT6A 1RT4B 3H2UB 3DRPA 2XO7A 5J2NA 1KTQA 1U1NA 3SSSA 5F0WA 2M2BA 1XIQA 1VQOS 1X9MA 4PAAA 1AUSL 2GVZA 1ZM3A 2YKNB 1MN9A 1UKUA 2VFVA 5L38A 2KM8C 2HBRB 3EZ5A 3M8PB 3PCOB 4K4SA 2E9RX 1TMJA 5MLCV 5J2QB 2M52A 2VFRA 1CJKB 2XULA 4DFPA 3PW0A 3W5ZA 1GFWB 5JMNA 3I5CA 3IR7B 2ACMA 2HVIA 1S1TA 1UJ4A 2BV3A 1HHQA 2V6AA 2ZM6F 3W2VA 2EFOA 2HGLA 1K1QA 2BMBA 2HNZA 1N6QA 2BOAA 3BBCA 4KHPJ 1G7CB 1C1BA 2ZH5A 3FUYA 1RT3B 1T02A 1HNVB 2HFVA 3AQPA 2YNHA 4OZ0A 2HMIA 4YB7A 3LP1A 4ECUA 2AT1B 4KRWA 1JNRB 3V4IA 4L74A 3QWUA 4ED3A 1OPIA 2YWHA 4HL9A 3DOKB 2AJ1A 2FHMA 3VAHA 3NNCA 1B7YB 2XSFA 4QW9A 2KT3A 4DQQA 2LXFA 5F8GA 2CIMA 1SL2A 3VAFA 4K8RA 4OHXA 1ZZNA 2COLA 3DN9A 2VG7A 3BGRB 1U26A 1HPZA 3GONA 2HHTA 4CO3A 4JI3J 2V94A 2XMWA 1JLFB 1YWXA 2GAGC 2J8SA 1UWBB 5IWAF 2UUAJ 4Z7YA 3C2PA 4OHWA 4ANDA 3H2LA 4ZN3A 1F0XA 2KJWA 1S1WA 4U67Q 3M30B 5HN0A 1SJQA 3OJUA 2LKZA 4I56A 2C22A 2V9KA 1J27A 2M8DB 2KN4A 3TVYA 1AFIA 1NZ8A 2XCAA 4PR6A 2W24A 2E1MC 4QPXA 3C46A 1FF2A 3TUJC 5BR8F 3BKFA 2D7SA 2NR0A 4FN5A 3W8PA 3NGDA 2XZDB 2NYHA 4P7VA 4A48A 4OYBA 2YH1A 4MT1A 4OZLA 4R5PA 3AFGA 1VJWA 2FJBB 3H5UA 4OX7A 4ZS6A 2EC0A 3EDRB 1RTDA 2HWTA 1XQIA 4P6QA 2UVUA 3IBWA 2CPFA 4Y2MA 4ZVSB 1S0MA 4EU0A 4J9PA 3CCES 3TAQA 1T9XA 2DY9A 3B4DA 3TARA 4ZJLA 2W2QP 5ETTA 1HI0P 3N28A 4HHUA 4HDGA 3ENWA 3UDEA 4CO5A 1GAOA 1GMVA 4O3PA 1OY8A 4C97A 1VQ7S 1YBUA 2KL8A 4A46A 2W9CB 2KM8B 4F25A 3DMJB 5G0RA 2EFNA 3N5FA 2QG9B 1GTEA 4J9RA 2VOPA 1NPRA 1D09B 1NPKA 2YKPA 3K89A 5CYJA 4EBDA 3PY8A 4RW7A 1Q5VA 1VK3A 2D3OR 2ZE2A 1TL7A 2Z2MA 3ET6A 5E3RA 2DTJA 3I5BA 2WW4A 2L3MA 3FCHA 3HK2A 1T11A 3NNHA 1VLYA 3GZ7A 4ETZA 1D9DA 4RNFA 1LNQA 5KT6A 2RQCA 1I51B 2B4OA 1L3TA 3RBXA 2CADA 1MWQA 3FEYB 4MKVA 4W98A 4ES3A 4DR4F 1S6QA 3KLGA 2XB2D 4GO7X 2H65B 2EC2A 2AP6A 2V2ZA 4DR2F 3N79A 1MU2A 4GMKA 1V9OA 4EK2A 1RTJB 2CZVC 5KFQA 3IGVA 1VCTA 4P2MA 4I6WA 2MZQA 3NGUA 2VBXA 4DR1F 4I69A 1HPZB 1HW9A 1U2RA 3OFFA 2Q43A 4DV7F 1V3RA 3TVZA 3K5LA 2M3DA 1KONA 4DL4A 1JLEA 1X4AA 3SSRA 4A8XA 2W2PP 1HQUB 1JXEA 4DFKA 4I64A 3KMQA 4WFAQ 2HGNA 1U1MA 2DGVA 2JX2A 2DHXA 2EK1A 2IVFB 2VONA 4V19X 1RCOB 1C4CA 1U1LA 2B6AA 1QAYA 1MMDA 2C1EB 4MFBA 1QAJA 1V6HA 2R7QA 2B5JA 3PHEA 2E1RA 1V5VA 3A13A 3V6JA 1S97A 1MROA 3J80Y 2RB7A 3HSGA 4JBCA 4XK8C 4DV5J 4DQPA 5HJXA 3TA2A 3V4IB 5ETMA 1S1UA 3GIKA 1P6TA 3QT7A 1YLXA 2JVOA 9ATCB 5KG0A 1WWHA 2ABYA 4DR4J 4OJ3A 5IQQA 4GO5X 1UL3A 2A1BA 1BLUA 2D1CA 2WRMA 4WJBA 4DCPB 4JI3F 3C3LA 3VAGA 2W7AA 4NCGB 1E6YB 3T9NA 3VZHA 1Q8IA 1U48A 5A8RA 1WNEA 2OPQA 1DFDA 3MDFA 2I8EA 4IO9Q 2IVMA 4WP9A 5KFRA 3PIPQ 1GX6A 2RHQB 4X62J 4DV1F 3LP2A 3HI9A 5FJ4A 4LSZB 3KTQA 2C2DA 3HDSA 1TL5A 2AZ1A 3W5YA 3QRRA 3UCUP 2FDNA 2VQFJ 1JLBB 2OHDA 1WF2A 4NA3A 3SCLE 4RNMA 2AX0A 4X4OA 1IJFB 2IJRA 3G6ES 3NWGA 2M4MA 3V6DA 1N32J 2XI3A 3D0IE 4LBPA 4LSLA 1WUUA 5F41A 4ZLLA 5F8LA 5FLXY 3AA9A 3HHEA 4QU6A 2RQKA 2CWKA 1R3NA 2CZ4A 1IBKJ 4J9SA 4JV1A 3BSNA 3DMJA 2RSQA 3KYLA 5G0RB 2BQRA 2GQQA 3W2WA 4NX9A 1TMMA 3D1HA 2X1GA 2UUAF 5ETQA 1PJ6A 3HHDA 1X4GA 2LFVA 4FPRA 5DDQC 4B3MJ 2MQLA 2VFUA 3CPWR 2HVZA 4LRBA 1TKTA 2ROEA 5E3PA 1RKJA 4AL7A 4PWUA 4N8OA 3NGSA 5F8MA 2DR9A 4PQUA 3VALA 5JVGQ 3IS9B 3VAMA 3RAMA 5F8IA 2VFTA 2PT0A 2R7VA 3NGRA 3QT8A 1KFDA 5D0GA 1GXTA 3JAMU 2EG2A 4WXOA 3M2RA 3Q24A 1RWPB 1CJVB 2V2KA 2ZBRA 3SIPB 1NKEA 1H2VZ 1ZTTA 3LAKA 2VG5A 3BSAA 5KFLA 3CVKA 4B3OB 2E5LJ 1R0CB 3FCWA 4HT7A 2PI5A 1TL1B 3GPAA 2R2TA 5DLGA 4GKKF 1YIJS 2NPFA 4ECRA 4KGMA 2B6AB 4LBHA 2FGOA 3T5HA 1S57A 2Y1LB 1ICEB 2RUSA 2ZWOA 3GFXA 3UCGA 3K8VA 1NHUA 2Y1RI 4KFBB 3T19A 4UZCA 5HLFA 1X60A 4IR1A 1SJ1A 2DGOA 5L1LA 3MM9B 3WBZA 4PG7A 1A7GE 4Y2KA 1Q8LA 4JI7F 1U6BA 3R97A 4ICLB 2QIFA 3CEDA 4QR2A 2D3UA 2HG4A 1BMQB 2O5DA 3UDLA 1NLKL 2MZRA 3PFEA 4ZPAA 1YDLA 4C0OC 3QZ7A 2P9GA 2H51B 2R4FA 1Q79A 3GFHA 4QIEA 1S4EA 1PJ5A 3FZ2A 4C8MA 4CNZA 1B3TA 4UQTA 3PJ9A 4DV7J 3M2UB 1Z4UA 3QNWB 4KE5A 4K4XA 4ILLA 3CWJA 3I0SA 1KS2A 2MQNA 2RIJA 3Q8UA 3B8HA 4GVBB 3TO8A 3M05A 3J7YI 5DM7Q 3JSMA 1RYRA 1U7LA 2CNOB 3BREA 3I0RA 2R3VA 1WKLA 1WC0A 5DS7A 4U95A 3R7BB 2RS2A 2HNDB 4KV8B 5L1JA 2B9EA 1F60B 3TANA 4PRFA 2PN6A 2CJAA 5ETSA 4ES1A 2XMUA 3ENQA 3JAMY 4LFAJ 4Y2IA 4EMDA 3KG4A 1HLWA 4ZIVA 2AJQA 3W1YC 3DYAA 3QWPA 4KT0C 4M5JA 2BRKA 2YQ3A 3DCAA 3GE9A 3M8WA 2EWHA 3FBBA 1HMVA 4KHRA 5K5MA 4AXJA 3EGNA 4ZLNA 1CVJA 2JDJA 4A47A 5IQ6A 4IRDA 2YX1A 4PG8A 1VC5A 2BE9B 4MAKA 4B3RJ 4ZVFA 2WOMA 1NJIT 3LGMA 2ZH9A 1H3DA 3J7ZT 1KNZA 1PBUA 3QGIA 2O66A 5G4DA 1KOOA 1RCXB 2JFDA 3Q2TC 4WWSA 2P9EA 3KHLA 1AZSB 2FYXA 1RWNB 3FBEA 3L7OA 1AA1B 3CF5Q 3OSPA 2KHDA 4LF5F 1JLCB 4HTJA 1RUSA 1UEKA 1CJVA 1U47A 1FRXA 4LF9J 2L9DA 2MKCA 2XYGB 3B78A 4ILMA 2DNGA 3BN4A 2ZH8A 2XY5A 3C14A 3MEGA 3UWTA 3Q83A 3X3UA 1E6VB 5LSRA 4DL3A 2YNGA 2Z2ZA 4NOHA 1JLQB 4XIUA 4USTA 4MKBA 4Q44A 1U45A 3W2WB 3MAAB 4WKRA 2FLNA 4IDKA 4ZP9A 5DM6Q 2A3JA 3DRPB 1HW8A 2RDJA 3FVYA 2ALZA 2NQPA 3HULA 2D3O1 3KOAA 3S6EA 1IKVB 1SVDA 1XR7A 1NH8A 2CQGA 2ILYA 2NUHA 3L7UA 4J37A 4NLXA 1UWBA 2VKRA 4IQXA 4WF9Q 2K1RB 5LJ3Y 1BQMB 3ZC4A 1TV6B 2HZCA 3HVTA 5KG1A 4B3OA 1UVKA 1JLAA 4FXWA 2XY6A 4E2FB 1RT5A 3SZ2A 1NK8A 1DRZA 2DH7A 3C66A 4PPDA 1M5SA 1F5BA 2IPOB 3NKYA 2X1FA 4ECWA 3VGUA 3GMGA 5E3AA 3HHLC 3J80U 4P2SA 2JEGA 4ER8A 1J5EJ 2E5LF 1GT8A 1KR4A 1N0UA 1PAUB 2QO3A 3G82A 3POTB 5A76A 5IWAJ 1RT3A 3VTIA 1RADB 4BHQA 4LF6F 3OXFA 3TUZC 2CJ9A 2ZDOA 3HXMA 2DR5A 3DOMA 2QZ8A 3BO4A 4LRCA 5CA5A 2VQEF 1Q4RA 1RXOB 2I0XA 3NS7B 4AYBD 4WCEQ 4QWCA 5F0UA 1TKZA 2GC8A 4X65F 4B3SF 1YTYA 4KGZB 2KVIA 3I96A 4DUTA 4DBQA 1TFWA 1X7VA 2OGUA 4ED4A 4G65A 1Q86T 1RBOB 3SYZA 4I7FB 2D9PA 1L3VA 3EXYA 2J7KA 5BYQA 2EEYA 2LA4A 3HHLD 3C15A 4I67A 1IN0A 1FWKA 4WPAA 4K4UA 1CJTA 2OAUA 1N32F 5H9FK 2JLFA 2AYEA 3T5LA 1U0HB 3BYPA 4YHHJ 3RR8A 1LWCB 4E8UA 5BYSA 4LBIA 2AWZA 3MR2A 5K8NA 4G1QA 1RISA 3J81Y 1QSLA 1F3VA 3I56S 2GS8A 1FVQA 2HHVA 2DEJA 2J0WA 1JMTA 3BF4A 4B3TJ 1UCNA 2QL7B 5EWFA 2B9WA 1E6VA 3OVBA 5KFHA 5GADU 1S1XA 2FC9A 2GGPA 4NZ7A 2MGZA 3CJ2A 2IYIA 4C8KA 2DIVA 4F67A 3L3CA 2G2OA 2R9LA 4NRTA 2CZ9A 3C8YA 3V2UC 4JI1F 4I1TA 4PG5A 3K59A 3M8QA 3KK2B 1S0OA 4OI0A 2DITA 1JJHA 2HFSA 2R42A 1Y10A 2F5GA 2EG1A 2ZEJA 3LW5C 5D0EA 3HKWA 5C2CA 3R7SB 3TA0A 3PYFA 1FDDA 1HBNA 4NXNJ 4MJKA 4WFNQ 1WTBA 2AEMA 2X1BA 4WTOB 2IBKA 4M5GA 4NLTA 2XHWA 3PW4A 1X9SA 2GZOA 2DNOA 3BB5A 4QYRA 3UN3A 4DSFA 3BDPA 3D7SB 1LW0B 4FNIA 3BKUA 3BM7A 1JIHA 3TR5A 2IM3A 1BQNB 1CJUA 4URGA 2HVEA 4F4ZA 4RU2A 3M7VA 1D8ZA 2BE2A 3RBZA 1L3SA 1PAEX 4DHVA 1NHVA 2HK2A 1DURA 2QSFA 4ID8A 3IG1A 5M2PA 2Z4PA 4RW7B 1JJ2R 4RUBA 3T41A 1G4CA 2GHPA 4HHHA 4JB8B 1KQSR 2YKAA 2L9NA 1TV6A 2F4VF 2AJFE 4H4MA 4JV0A 1REGX 2IA0A 4J5OA 2F8EX 3GQCA 4I2PA 2GA7A 1FDAA 2HQCA 3GTYX 4DQSA 5K8OA 4YOEA 3TA1A 1CJTB 4X64F 2XQCA 4K50A 3QBCA 5CHCB 1T94A 3BQ0A 1TUWA 3GSIA 5FD1A 3EX7B 4DR2J 1RWOB 3OL9A 2E1PA 2JEIA 2BKPA 4Q5VA 2B8QA 3NEKA 1F6TA 3OHBA 2MJNA 2YXLA 3FZBA 3PEJA 3M6UA 1FX2A 4UUWA 1VQ5S 4DQIA 1HQEA 1B4SA 2CQHA 3B4MA 1P9QC 1MMNA 1WSRA 3FMWA 2C3PA 3DRXA 3N01A 3HD2A 1S1XB 2GGPB 3W63A 2I1RA 4XDDA 1S9GA 4IG0A 1CQNA 1V5IB 3MUTP 3RB0A 3OTOF 2QC3A 3TP2A 4F3QA 2XS7A 2FVPA 2PIIA 4XTTA 2RRAA 2NXJA 4M5NA 2XGQA 2A2DA 3X1LB 2UXDJ 3K8WA 2NUUG 2YX7A 4NXMJ 2WVFA 3P49B 4GKJF 2W9CA 4FVMA 3D4JA 3DU5A 1U0HA 1VYAA 3OXGA 4DPUA 3CCRS 2FLPA 4U7UD 3K5OA 1M5KC 2VBZA 2C2EA 3GYXB 1MWYA 1RYSA 2RQMA 4ZPCA 4KPCA 4O4GB 2DJWA 3GIRA 1UVIA 1GEHA 3HJVA 4LSLB 1FRLA 1T3OA 3O6QA 4TYAA 5KFSA 2N3LA 3DLJA 4TLQA 1S1VB 2N3OA 4ED0A 5K8PA 2HS0A 3K2YA 4EBCA 2YPYA 1AXQA 3Q23A 5A6PA 4LR8A 4U7UK 3KHGA 4LFCJ 1UVLA 4BLGA 1RT7B 3MZIA 4X4PA 1UP1A 2ACYA 1LFPA 1JLGB 3DNCA 3LA0A 1RGVA 1PSDA 3M2VB 4DG1B 1VRUB 3AXKA 2NLWA 5CZXA 3C16B 3MPWA 2BACA 5IT0A 3BDEA 7FD1A 4DUYJ 1UVMA 2HK3A 4F36A 3U1NA 4JI5F 1VK8A 3QT6A 3CJKB 1ULRA 2V9WA 2OP5A 2QLFB 3DRRB 2MZ1A 2CQIA 1ZPWX 2QA4S 4KGKA 2E9ZA 1WF1A 1SKWA 1ZZFA 1HWLA 1WG4A 3E3XA 3NGKA 2MY8A 4IFVA 1D1UA 2KXNB 2HLUA 1S9FA 1VS3A 2YX4A 4BS2A 3RYLA 1X0FA 4IFYA 3S1TA 5HQ8A 2RDIA 1U4BA 4LUBA 4OZJA 1CC7A 3V6DB 5RUBA 4ECTA 4CO2A 3T1YJ 2IM1A 1REVB 4QWBA 4NLYA 2JRSA 3JTOA 2HFZA 3CT9A 4H54A 4FYVB 2LQJA 4P74A 4RBTA 4ZVOB 4AE5A 8RUCA 2FJAB 4USIA 1UFLA 2ASDA 3AOBA 4A8OA 4CLYA 3OSNA 3CD6S 3DLKB 3S01A 1YITS 3MOJB 4EWTA 5F8NA 4OHVA 2HHPA 3MHYA 3IS9A 4QIVA 1EP4B 1FK9A 2FVQA 3BH7B 4CH7A 2KRBA 1ELOA 5I42B 5C25B 3MUVP 1IKXA 2HQDA 2L48A 2DRBA 2JZ5A 2AZ3A 4C3MA 4DUYF 1WOSA 3MCNA 2H9ZA 1FRMA 3JSMB 1OS5A 3JS9A 1BXNA 3PEHA 4LVOP 5B0CA 4N41A 3HZGA 4IYQA 4CIOA 1HHTP 2BJ9A 3NCPA 3UE2A 1FEEA 2UP1A 4DPYA 3UFCX 3GJTB 1PYSB 4DI6A 5DDRC 3PV8A 3EXCX 4PYDA 1HR0F 1K0VA 3EZOA 3FEZA 4ECXA 1VRUA 4MKAA 4C7QA 2CQ3A 2OPPA 4K7QA 2YQ0A 4WXWA 1YRTA 4CQ1A 4Q45A 4M5DA 2LQBA 3MM6A 4OIXA 3G8TA 2QMUB 2JLGA 2HEKA 1DAXA 3TZXA 1YQHA 5KG4A 3W8GA 1LWXA 3T1HJ 5CYQB 2P8IA 4USUA 3KLVA 4I2QA 3CIMA 1FDBA 1ZBTA 3IAS9 2OFGX 4PCQA 4RBUA 4YQWA 3KG0A 3W9JA 4B9SA 3HJFA 3QGGA 2XMJA 4KSEB 4Z7CA 3HF5A 4ZCKA 4OYZA 2OTLS 3K57A 1UFKA 2MXYA 2W8KA 2VPXB 3FQLA 3MM8A 5D3GB 2ZWPA 2IRYA 2ASYA 1S79A 2GO9A 4PZVA 3HPOA 2RF2A 4NLUA 4C2MA 4CCHA 2CPDA 4OI6A 5T14A 3G6VA 2WHOA 1IBCB 2V0NA 3K5PA 3NP5A 3MD3A 4HTIA 2LYVA 2OEMA 1OSDA 1VHFA 1RTJA 1Q7LB 1O0PA 1DTTA 3HSDA 2B4PA 4ED6A 5I42A 1JKHB 1K9MT 1KLMB 4LR9A 4YR3A 1S5ZA 2XYPB 3OXLA 4H4KC 5ETVA 2MKKA 4OZ1A 3T5KA 4V19J 4X4VA 2DGWA 2J6UA 1N5YB 3BGLA 1XMOJ 4LF8F 3BBFA 2MB0B 4DV6J 2W9AA 2XZTB 1N56A 4ELTA 3TI0A 4RKUC 4KPYA 3D6HB 2YKMB 4DFJA 5H9EK 2KKHA 4QYZK 2LCWA 4KJIA 2DXDA 4FBTA 4M94A 3ZZYA 1SC1B 2QL9B 2RRBA 5GMEA 5HVGA 3M8RA 3ZTQA 3JSBA 3KK1B 1RDRA 4ZPBA 5B08A 4QU7A 1HBMB 3CNQP 2VICA 4RNOA 2J6TA 3U1LA 3DLGA 1Q7YT 3PTWA 2UU9F 2RE1A 3AXMA 3FCVA 2R7WA 4U9RA 4IQMA 4EFAC 2POKA 5DZ6A 1OO0B 4I4BA 3FBFA 3J7Z5 2Y3YA 4B9TA 4ED7A 2CNKB 2GVDB 1YRUA 1SQEA 1FE4A 3TAMB 5I3UA 2K2PA 2ZNZA 1S59A 4OI4A 3G71S 3MXHP 3MF5A 3GWCA 4E98A 1H72C 1W2BR 4DCJB 3PKMA 2V34A 2XO6A 2HRUA 3KMSA 4F4AA 1SJ4P 2KU7A 1KLNA 3T6BA 3PHTA 5KFOA 1H74A 1SQGA 1UTAA 3Q0AA 1AFJA 2A10A 4D3GA 4DV3J 3T1HF 5LOQA 4O3SA 2EKNA 1RHJB 3V5RA 3AJ2A 1RT1B 3ZNJ1 2YQ1A 4B9UA 1YJUA 4MFBB 2Y1IA 2L9WA 1KVJA 1S12A 1FXDA 2Z0GA 5J2PA 4OFZA 3RW7A 2OUGA 3PX4A 2IMWP 1KD1T 1WEXA 1WC5A 3MM5A 3C15B 2DPIA 3CJQA 4HI1A 2BJ8A 3WX4A 3CB4A 2LMIA 2R8HA 2VQEJ 1MSWD 3PRVA 3HMJG 2AYGA 4G1QB 1SJRA 1RU1A 4DV4F 5HBMA 2E66A 5A0YB 2OLWA 4DCOB 2XWXA 4OYMA 3IM9A 2OPRB 2C3OA 5HMYA 2MLZA 1SL0A 2X3DA 3NMAA 2PEHA 3I87A 3L4BC 4OYXA 4X4NA 2CVEA 2OPQB 2GMJA 1CS4B 4OLOA 3WQPA 4DJBA 4CDIA 3N4WA 3MEDB 4O3QA 4F04B 2AGOA 4LQ3A 5CYMA 3Q8SB 4M5MA 1IBMF 2WK4A 1JJCB 1JLQA 3ITHB 3MMCA 2H5JB 4X66J 2HHHF 1SUQA 3ISZA 5C24B 5C2GA 2AEFA 2AIRB 3T9ZA 3QPIA 1J5OB 1F5AA 1X5TA 5KFFA 1SC3B 4F50A 2VKZG 3L09A 5HL7Q 4WYWA 4ZITA 2BANA 3DDNA 4DUZJ 3DM2A 3CCVS 1JWWA 1Y9OA 3G86A 3BSCA 4MIBA 2B8PA 2HGMA 3RB6A 1NHKL 3UCZP 2GW8A 3W9HA 1ZAXA 2YKMA 2IRXA 2B9XA 4QIGA 4J9NA 3DLKA 4DV0F 4DR6J 1FJGF 1RT4A 1L5UA 3H7HB 3VV2B 1R8CA 2R7OA 3NL0A 1GQEA 5DGAA 1VQLS 1NDCA 2ZJRQ 3AOAA 1HNVA 3PJXA 3SV4A 1B64A 1DZ5A 4LJMA 4RWWA 3CJ0A 3TZZA 2RVJA 4FVCA 4DR3F 1X4FA 4C11B 1Y5NB 5K14B 2CG8A 3TQEA 4DZDA 1FRJA 4IKAA 3AODA 5IM0B 3H4BA 2E29A 5DLFA 1RTIA 2ZH3A 4ZPDA 2V8GA 2UXCF 1YHQS 2D9OA 3GFYA 3W64A 3CGIA 3A12A 1M1KT 5EX3A 3TAMA 5I3UB 5KT4A 1CG2A 3CIZA 2VPZB 4ANCA 3TJ8A 1MW7A 2FZGB 2PFDA 2BUNA 5B0DA 1U8WA 2C28A 1G2EA 3R5JB 3OUYA 2HHXA 2YNFA 3EICA 3LP0A 3PFOA 3FMBA 2YWKA 3DLGB 3CDUA 3SCJE 1KHWA 2IYGA 3OR2A 1JK9B 1FO1A 1IWAA 1VMBA 2PEBA 4F0KA 4HLBA 2XEXA 2IJNA 5KT7A 2E9TA 1DLOA 2OKQA 1T8EA 2Z8QA 4DR7F 3A8EA 4WFXA 1QSSA 3NNAA 3KJVB 3PXGa 2M88A 3H8YA 3CW2C 3VVTA 3MD1A 4EI2A 4M95A 3KLEB 3PVXA 1ZETA 3IWNC 5HVFA 4NA1A 2E5HA 3G2XA 3V4MA 2ZUGA 5KG5A 3DGVA 3UI3A 2KYZA 4ZPTR 2MLXA 1ZPVA 4QCLA 1IM6A 3AHPA 2AX1A 3KUEA 3QJJA 1RZMA 4J7CA 4ZLPA 1VIXA 4HT5A 4PG4A 2YH0A 2DB1A 1LXJA 4ED2A 2J9CA 1XMOF 2JEJA 1RWKB 2RQ4A 3M2UA 2IJFA 1MNEA 4X4QA 1LK5A 4DV2J 4DV6F 1NK6A 4Q2MA 1DTTB 3H98A 1XERA 1GXUA 5B09A 3QJLA 1RHUB 3KJQB 1GH8A 3AA8A 3I0RB 1KOHA 3DRYA 2I5JB 2BW7A 2LEPA 3DFEA 3EMTA 3A1YG 3CD7A 2G9OA 5GAGU 4FF3A 3JQJA 1M5PC 4KGVB 4A4JA 1PC4A 4O3NA 2BDPA 5HMZA 2F63A 2IRUA 5BR8J 4YDDB 1LK7A 1XR6A 1Y0HA 1RHRB 4CLSA 3AY0A 2LU2A 8ATCB 3KLHA 4RW4B 5F8HA 5FDLB 1T9WA 1RHMB 1SH3A 3AOCA 3IR5B 2ZBIA 4WFBQ 1UA1A 1YJNS 3H25A 1RAGB 2E1AA 2JC0A 2WSFC 1QUPA 1OIAA 2P9CA 3P3DA 1SIWB 2RUGA 2Z30B 2PGCA 3PRDA 1TAUA 4R0JA 1YRXA 3HVTB 3MPYA 4RW8B 1RTZA 1EETA 1TL1A 5CD4H 2MJUA 4ID5B 1VGYA 1LFWA 3GCWP 4PWWA 2MMYA 2OD6A 3WIUA 5HI7A 4A8FA 2UXCJ 2UUTA 4OHZA 2RU9A 3NY0A 2GHWA 3ZFVA 3KK3B 4OJHA 4EBEA 4QR1A 1UEVA 3KLFA 3MWBA 2XLKA 2IAJA 1WG5A 2J7UA 4LF9F 2DH9A 4KTQA 3OUYB 1SJFA 3GSDA 3ITHA 4OV6A 1Z2LA 1S6PB 2WBMA 2XHCA 6AT1B 5GADI 4FNHA 2MQOA 4Y65A 5SZTA 4EEYA 3LOUA 2BKNA 2N4CA 3MM7A 1KFSA 3PW2A 2W7PA 1H6KX 4WP8A 2VIHA 3PRBA 4TQRA 1R8PA 4OZ2A 3WIVA 1YSJA 2NXNA 5D6GA 4K4YA 5HJYA 3EUNA 5CXTA 2J0SD 2AHOB 4ZP7A 1TELA 3E01A 2M5YA 4RBVA 4KAIA 4ECZA 2UVVA 1EQMA 2QE5A 2DKOB 1PYOB 2WONA 4O44A 5IT4A 4ED8A 3ILIA 3EYZA 2VJVA 2AF6A 1FNXH 2ZJQQ 5KFKA 3IM8A 5A0YA 1WHWA 4X65J 4B3SJ 4ZMMA 1WC6A 4M63A 4I7FA 2MTLA 1TVRB 4QIWD 3IWXA 3FFIB 2WSCC 1FNOA 2WVBA 1RSCA 3SXLA 2RHSB 3FRZA 4GRSA 4CLPA 2RU3A 1NK0A 2RKIA 3FRYA 3R27A 4RUAA 2GQCA 4AQYJ 4K4WA 3R1HA 3OL7A 1QAIA 1IKVA 2ZHBA 4FYDA 5GMDA 5J1NA 1KQKA 4TXSA 3HT0A 5EN1A 4DV5F 1T7PA 3CUNA 5J1EA 5IS2A 1KLMA 1UVJA 2BX6A 3HHLB 2XMKA 4CT8A 3TUIC 4AT1B 2XSJA 3UN5A 2HLTA 4OZNA 4C8OA 1KN6A 3MECB 3CJ3A 3G8QA 4F4KA 2ZE2B 5L9NA 2K3IA 1UA0A 3DLHA 4PWDA 3M9NB 1FJCA 1Z2ZA 4ELUA 3MFIA 1OY6A 4YUDA 1U02A 1ZH5A 3HKZD 3SBMA 3MM8B 3O44A 2IAJB 2H5IB 3CD0A 5KG3A 4AFFA 4CO1A 4X4RA 1JX4A 1HBMA 2XG8A 4FKYA 1VISA 2DNHA 3ZTPA 2VQFF 1T9TA 1QJHA 3FDSA 1JLAB 1R0BG 2DGXA 2H4WB 5KFVA 1I94F 1H7WA 4KBIA 4JYAJ 2E5GA 4OL8A 3RJMB 3LQVA 2I38A 4K4TA 4X62F 3IBFB 2QA2A 3PYGA 2WCXA 3RGIA 2FJDB 4NLVA 2F40A 5F3TA 4DR7J 3E51A 4L75A 1C0TB 4OYWA 2E44A 1HQUA 1CC8A 2EXUA 2ZOMA 2FIUA 2ZC4A 1RQ0A 2PMZD 3QZ8A 2MKYA 3CC2S 5E5NA 3PR4A 2DVIA 3ZZ0A 3ZZTA 4X4TA 4C8ZA 3CDWA 3GFZA 3TX8A 2HKEA 2Q6BA 2VUGA 1AUDA 4RX6A 2EFVA 3DLLQ 4DSEA 2ADCA 4EZ6A 3J81U 3HVRA 4DN0A 4WE1A 3G6YA 3KKFA 2AKWB 2MKJA 5J2QA 5HO4A 3Q8PB 1S6QB 3KLGB 3KK1A 2L08A 5J1EB 2VZ9A 4WFYA 1S48A 2K7JA 3I82A 1S6PA 1EARA 4EUVA 2CDRB 2BKOA 4YP3A 3KUHA 3DI6A 4DLGA 1WKJA 4ZPVR 4JI6J 3M4XA 2FJWA 4JI2F 5B0AA 2KT2A 5IOLA 4EYHB 2YNIA 1HA1A 1A9NB 3MEEB 1NNDA 2HMIB 1FDNA 1C4AA 2OH2A 4QW8A 1N33J 1RABB 2BM0A 2HPUA 1LW0A 2XWYA 2ZBCA 3Q86A 5DG8A 1M5HA 3E01B 4DL0C 3T3FA 1NJZA 5KFYA 4W92B 2Y8YA 2LDIA 2CYYA 4FP9A 5B0FA 3PKYA 1YGYA 1HNIA 3P5TL 3WC2A 3MPUB 2VG5B 2EW9A 1FE0A 4J91A 2OSQA 4QJVA 4LFAF 3ZXWA 2YVSA 4B9MA 3D54A 5D0RA 2VODA 3QAEA 3KLIA 4WU3A 3CJTA 4LFBF 4DPWA 2KT5A 3I0SB 2UV8A 1WI6A 1LQ9A 3EJMA 4LRDA 2UXBF 2V2QA 3JSRA 4DU8A 1S1WB 4M5HA 3MEGB 2RRNA 4DX7A 4HDHA 3M6WA 3GIMA 3SDEA 1WD6A 2EBGA 4NA2A 1KEKA 3LH2S 4RPFA 1KVKA 3HVWA 2EI5A 2MLYA 3DHWC 1B0PA 5C5JA 5AJ3F 5HBMB 4ENOA 4G1PA 5DO2A 4Q43A 1WEYA 1D0EA 4RZRA 2YPZA 4B9LA 5LMNF 1C0UB 1SPBP 2KO1A 2NYIA 4CP5A 1VBZA 4BDPA 2FC8A 4DS5A 3DRSA 1EQ0A 1BD6A 1Y00A 4QR0A 2WOMB 1YJRA 1FESA 3F56A 4O0NA 4ZVHA 2DR6A 3DOLA 3IG1B 3LP1B 3R9LA 4C3LA 3RBEA 1PO6A 4PXCA 1NSKL 3AD8C 4LVNP 1OYDA 3MAHA 1MG7A 2XC9A 2NXEA 4OZ5A 1ITPA 4PWDB 1TL3A 3LTOA 3UR0A 4IOCQ 2BQ3A 3A8KA 5IT9U 3NAIA 3RB4A 2RNEA 2CQDA 5ETPA 2IM0A 1WORA 4KKOB 4DFMA 1ZAWA 2RAQA 3BBBA 4HEA9 4U8YA 3WDOA 5GMKa 3AD9C 1IBMJ 1QSYA 4ZJOA 5MAOA 3UW1A 3DLBA 2XYHB 3JB9k 4DG1A 1X0PA 2EFQA 4RJVA 2DY1A 2FQQB 3DOMB 3KFWX 2KXHA 3MAAA 4AD6A 1GMWD 4EZ9A 2F9DA 3JTPA 3OHAA 3MR3A 4CNYA 1KKHA 5HP1B 1TKTB 4WIQA 1IM4A 3O2IA 3SSQA 2XM3A 1N36F 1VOMA 3HP6A 1VQKS 3U7JA 1C0TA 4DF8A 1S1UB 2HQIA 3L9ZA 2KJVA 1QTMA 4LF6J 5LMNJ 5BJRA 3FFIA 2ZHOA 1ZA1B 1W7WA 5IV4A 1VBKA 5D8HB 4I2QB 4C3KA 2Y1JA 1FHTA 4ZJQA 4C8LA 4QWEA 1T03A 4DOZA 4UY85 3V6HA 2HYIB 3VVUA 4TYBA 3MCOA 4HYKA 1TKDA 2RDDA 1FEHA 1RAFB 1A6LA 4PABA 3H5SA 3PX0A 1WI8A 2P5VA 1X4EA 4ZOSA 4X66F 1YJTA 2HHHJ 3AJDA 1NBEB 4CTAA 1Q82T 2VG6A 1U6ZA 2ILZA 1HMVB 3I6PA 5HVHA 2VFSA 1H38A 3LO3A 4WK3A 3SQOP 5C42B 1QY7A 3LGHA 4F0MA 2XS5A 3CCWA 4DZ6A 3MUMP 1T3NA 3IXQA 1IR0A 1OSCA 2HFNA 2UUWA 3WC0A 1J5EF 1TZ0A 2B4VA 2H4YB 1IR2A 4YR0A 2V68A 3KLIB 4K2XA 1B70B 5CH7B 1VQNS 4NLOA 2JJ4D 4RW4A 2CJQA 1BHNA 1EB0A 4ZCLA 1AW0A 1JXLA 1M0SA 2VH7A 2JWNA 4R8UB 2SXLA 4ICLA 4OLPA 2KFYA 3G8SA 4OJGA 2MPUA 1IWGA 4J9KA 3MOZA 1XMQJ 4C9DA 3TEHB 1FTCA 1HYSB 3W66A 1UVNA 2KZZA 1FJEB 1WACA 4LSNA 5JVHQ 1XMBA 5KFJA 3G82B 4KO0B 1NCLA 2HS3A 1HWJA 2H5EA 2A6MA 2DCUB 1N5SA 4G1IA 4MK7A 2HIQA 3GG0A 3ZTRA 3ZZOA 3UD3P 5H9EJ 4IOAQ 5AXLA 2HNYB 3VCDA 2VASA 2X1AA 3D68A 2KG0A 2UUCJ 2CVIA 2OD4A 3OLBA 2XZWA 4IG3A 2KRRA 3CD5A 1C0UA 3TNVA 3EDQB 4OYAA 1WHVA 2B7BB 3PX6A 3U27A 3UDVA 3IC1A 4X4UA 4JI2J 4C98A 2OPPB 4YY3J 1HQ2A 3R5AA 1NO8A 4I0WA 3NWRA 1PILA 1OQ3A 1WDDA 1CBKA 1NXIA 2BE2B 3Q2SC 4YB6A 4R25A 3BR9A 1I6JA 1SBRA 1XJWB 2F8HA 2GO8A 2H54B 2LU1A 3AH6A 3BH6B 3N9UC 4J9UE 4NI2B 5D0HA 2M8HA 3JQMA 3C6UA 5KG6A 2ZVIA 4C4WA 2J8AA 2ZUAA 1NPPA 4MKYA 3CDBA 3W7BA 1NUEA 2P2CB 1GX5A 3MR5A 1GMUA 3R3TA 3BR8A 4HH1A 3LP0B 1VRQC 1WG1A 3F0NA
chains in the Genus database with same CATH topology
4DMZA 1HQEB 3QIDA 2YWEA 3HLUA 1HI8A 1NK5A 2DIUA 3JSYA 4CTAB 3LUYA 1S49A 3MEEA 3V6KA 2CQ2A 3MM5B 4QPTA 4FXVA 2DHSA 1S4FA 5IFMA 1VRTA 2DR8A 4L6V3 5KFUA 2PD1A 5T41A 2LECA 1M5OC 4Y34A 4YHHF 4QYZJ 4EO8A 3THTA 5A8WA 2DK2A 2WBRA 3IRXA 5LMUF 4A8SA 2ZVSA 5KT5A 1HNWF 2UUBF 4NLGA 4RW6A 2XMMA 2FHOB 1N8RT 4DSIA 2HNZB 1N6QB 2RH3A 1XNQF 4Q2LA 3IWLA 5J1PA 2GV1A 1NJXA 2DRAA 1AROP 5GVQA 2XSJB 2BJEA 2V4JB 3LPYA 1V3SA 4RNHA 2IC3B 3DLEA 5L8RC 4I2PB 2AGQA 2P6TA 5CYMB 2BW2A 4ZVGA 1NH7A 1DQAA 3MM9A 4NZ0A 1VI7A 1XBWA 2VG6B 2W4DA 3H20A 3CJ4A 3D0HE 3BJYA 3PM9A 2QYCA 2K7KA 2FJVA 4USHA 3K58A 1YI2S 1N52B 4IUFA 1TFYA 5AXKA 5F9LA 4G3IA 1UEUA 2WB4A 4IG3B 1I1GA 4Y2CA 3MEKA 5GAHU 1VQMS 4Y00A 2M9KA 1IQTA 2YWFA 3NS6A 4ILRA 4WZQA 2UXDF 4LF7F 3M2RB 4ECQA 2CPEA 3GR1A 4NYZA 3D5MA 3HHLA 1RP5A 1KQFB 1RK8A 2B9YA 1R31A 2F8MA 3BN7A 3DRRA 3SQGB 2GJ2A 2M0GB 3R5BA 4ECYA 1NU4A 4NLWA 5E3CA 3M9OB 2KZMA 2HQ3A 1FK9B 2MGZB 2DNPA 4A8YA 1YVFA 3ENVA 4LMZA 1APSA 4FBUA 3T1AA 3VWSA 4ZHRB 2BYCA 1KHVA 1RT7A 2VG7B 2WSEC 4I6AA 2YKNA 4PG6A 2G1DA 3G96A 3L7PA 1LOUA 2QT7A 1S77D 4PPZA 1X4BA 2FGCA 4Y28C 1ZAVA 2G4BA 1SI9A 3O3LA 5AE3A 2ROPA 4DSLA 1R27B 4ES2A 2WTFA 2RKIB 4KV8A 3HM9A 3L95X 1BQNA 3NLCA 3T5JA 2DGSA 4DL5A 2AU0A 2J9DE 3O8WA 1KRPA 2JEFA 3CCMS 1X4CA 4QBUA 3K7RA 2BR0A 4J9LA 2V4JA 4R8UA 3ISND 2DT9A 3OBIA 4GC7A 1S9EB 1T05A 2HNDA 4TY8A 2Q6CA 4LFCF 1KSPA 1FCAA 1P1TA 2M70A 2JLEA 1Y3KA 4JI6F 3BQ2A 1VBXA 1SL1A 4TU8A 2QEXS 4FXDA 1C2PA 2FHKA 1Q78A 3MMCB 4DL2A 1CQMA 2EKYA 1LW2B 5B7WA 4B02A 3EGZA 2I9SA 3ZZRA 2I5JA 2HS4A 4J9OA 4N56A 2GIRA 4ED5A 4X2BA 5DJBA 1HNIB 1XK8A 3G9CA 1WTFA 2PSZA 5CZVA 5LSOA 2R7SA 2Q79A 3NS5A 3MPVA 2OSRA 2JHEA 3AB2B 4M5DB 4LT6A 4MIAA 1SXLA 1CSJA 4MK9A 2A2CA 3HZEA 2HW3A 5KTQA 4OI1A 4YB1P 5GAHI 1HL6A 2KG1A 4O3RA 2BRLA 4ED1A 4ZPWR 2OJ3A 2CPHA 3QAUA 4PQAA 2BABA 4C0HA 2IC3A 3I4PA 5FDLA 3CC4S 1FA0A 1P8GA