1TL3B

Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
422
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 112
structure length 401
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B04
3I0SB 1S1WB 5CYQA 2R8JA 3DLEB 1SH3A 3MR6A 4URGA 1S1UB 4IKAA 5KG3A 2XGPA 4KO0A 1TQLA 1TKTB 3V6DB 2FVRA 3ICLA 3H2LA 2XI3A 1RT5A 4ECZA 3BQ2A 1S1TA 4H4MA 3UQSA 3V6JA 2QV6A 4WFYA 3GIJA 4IFVA 4H4OB 2IM0A 3C6UA 2HNDB 3DRSB 3ITHA 5KFEA 4PWDB 4NYZA 2VG6A 1QE1A 4NCGB 1RT1B 3MEGA 2HAIA 1RT2B 1S48A 3DRRA 3MR2A 1BQNA 3CO9A 4QPXA 3I0RA 4ED8A 1EP4B 4Q45A 1IKYB 2RF2A 1DTTA 5KFHA 3QZ8A 1BQNB 2J6SA 3LALA 3SFUA 3IRXB 5KT6A 1RT2A 3KNAA 2XCAA 5JUMA 1S1VA 1RTJB 4HKQA 1TV6B 3FFIA 5HP1A 2RKIA 1IKXB 3FDSA 2O5DA 1U09A 4RUCA 3QGIA 5KG6A 1C1CA 2W9BB 5KG0A 4R5PB 4IFYB 1RA6A 2FLLA 3OL9A 1RT7A 5CYMB 1C0UB 3NKYA 2FJWA 5EWFA 5KFZA 4Y2AA 5KG5A 4EBEA 2BQ3A 4QWEA 4K4TA 3RAQA 2JEJA 1TL1B 4O44A 2JEIA 4ID5B 1S9GB 1MU2B 5KFWA 2IA6A 3NGDA 1JXLA 4QWCA 2IMWP 3G6VA 3BGRA 3FQKA 1FKPA 5EWGA 1S0OA 1SUQA 3MFHA 3TAMB 1FKPB 3HVTA 1N6QB 3PW2A 4ICLB 3LP0A 4RNOA 3GV7B 2IM2A 2OPQB 3DI6B 2CJQA 2XGQA 5KFPA 3IN5A 3I5CA 3N6LA 1KLMB 4O44B 4KSEB 2IM3A 2D41A 3PW4A 2BANB 1HPZA 1ZTWA 3CJ4A 3DM2A 3T5LA 1FK9A 2AX0A 3QGGA 4WXOA 4XPCA 4WYLA 4ZPDA 4F4YA 3Q8SB 3QO9A 4FBUA 5HLFA 2HNZA 4ZVGA 2I1RA 5DG9A 1T05B 3KJVA 2WK4A 1C1CB 2ZD1A 3QO9B 1RTHB 3DRPA 5L1JA 2RKIB 1TV6A 5HP1B 1FK9B 3OLBA 4ZPBA 1Z4UA 1S9EB 4M95A 4IH6A 1JLEB 5KT7A 3V6KA 2ASDA 2OPPB 2BANA 4HYKA 3BR9A 5KFKA 4WE1A 5F8HA 2AU0A 5DLGA 4IDKA 2CKWA 1HNVA 5KFRA 5KFYA 1MMLA 2OPQA 2R8HA 4J9NA 2IJFA 4RW9A 3CDWA 1EP4A 5DGBA 4ICLA 3I0RB 4ED6A 3HVTB 1N6QA 2C2EA 5DG8A 3KHHA 4IRCA 2AQ4A 1HMVB 4I2PA 3PJWA 2VG6B 4ECVA 3N6NA 3T5JA 1VRUA 2YNGA 5C42B 1C2PA 4RW6A 2HNDA 4RW7B 5L9XA 4H4OA 4ZVHA 1TL1A 4J9MA 4DL6A 1S0NA 3IGVA 3G6XA 3LP1A 3V81B 3CDEA 4RNHA 2YNFA 1CSJA 2WONB 2IM1A 2VA3A 1RTHA 1RT7B 5CYMA 2R2TA 3IGNA 5F8MA 3FRZA 3PVXA 3D5MA 4NLQA 2UVWA 2EC0A 3I0SA 5CYQB 3NAIA 2C2RA 2HNZB 1DLOA 4B3OA 4ZHRB 3KK3B 4DEZA 3HKWA 5KG1A 1JLAB 3OL7A 3KMQA 1RAJA 4ZVFA 4YP3A 3DI6A 2V9WA 4URSA 2BRKA 5KFUA 1REVB 1IKYA 1ZTTA 2HWHA 3M9MB 4K4WA 4IR1A 1C1BA 4NLGA 3T5HA 3CJ2A 3VQSA 4J9PA 1S1XA 3KK1A 3NAHA 3MEGB 1QE1B 4NCGA 2HWIA 2UVUA 2W9CA 4EYHB 1SV5A 4F4XA 2C28A 3DRSA 3DOLB 3C6UB 3LAKA 3DOKA 3MEDB 1UWBA 2V4QA 2V0NA 3KK2A 4ECSA 1S1TB 4H4MB 2DPIA 3DYAB 1VRTA 3M8QB 5HBMA 2B6AB 4PQUB 3M9NB 3MR3A 5KFOA 3N6MA 4K4XA 5C24A 4KB7A 1IKVB 5HBMB 2JEFA 3MTKA 3DMJB 5EWEA 3MEDA 3I5BA 3DOKB 4GC6A 4XPEA 4J9OA 5F9NA 5KG4A 1IKXA 5J2MB 1SV5B 4EO6A 4G1QA 4K4UA 5T14A 1S1XB 3KLFB 3KK1B 4JUZA 5KT3A 1HYSB 4I7FB 1IKWA 2GIQA 1RT6B 4TYBA 3OL6A 2YNIA 2UUTA 1DTTB 3BJYA 4J9LA 3ISND 2VG7A 2VG5A 1TKZA 2YKMB 3IG1B 1JX4A 1XR6A 5L1IA 3HHKA 4WZMA 3CIZA 3DLGA 1RT1A 1EETA 4NRTA 3QZ7A 1LWEA 3T19A 2D3UA 2ILYA 1I6JA 4YR2A 1N56A 1KHWA 2OPRB 4IOBA 5C5JA 4LSLB 1RTIA 4U7CA 3Q8QB 2IAJA 2R2SA 4R8UB 4Y2CA 3G6YA 1IKVA 4KV8B 4KO0B 3MEEB 4PQUA 5I42B 4ED3A 2ASLA 1RTDB 1S1WA 5F8LA 2E9RX 4O4GB 2J6TA 4Y3CA 4H54A 4YMEA 2BQRA 2I5JA 5K14A 1S6QB 1T03A 4QWDA 2IBKA 4RW6B 4X2BA 5C42A 4DG1A 3PR4A 1OS5A 4TQRA 2AGQA 1S97A 1TKXA 5F8GA 2D7SA 4JV2A 4XO0A 4ECYA 1GX6A 5HROA 2ZKUA 3C6TA 3DLKB 3G86A 1RDRA 3RB3A 1REVA 4ZP8A 3LP2B 5KG2A 5J2QA 4IG0B 4RW8B 1D0EA 3CJ3A 2W9AA 5C25B 5J1EB 3H5UA 1S9FA 1JLEA 4MH8A 5FDLA 1JLFA 5KFLA 2XC9A 3NL0A 2WRMA 4KFBB 3DRPB 5KT2A 4RUAA 4NLPA 1FKOA 4EO8A 3MF5A 1ZETA 1JKHB 3MR5A 3KLIA 4KHMA 4LQ9A 1HQEB 3MFIA 4TY8B 4O3QA 4EYIB 5J2NA 4FS1A 4ED2A 4ED0A 2E9TA 3CJ5A 1RT3A 5KT4A 3DM2B 5KFDA 1LW0B 2OPSB 2FJVA 4K4YA 1KLMA 4RW7A 1HQUA 4Q8FA 5I3UA 5DQIA 2R8GA 1JLGA 5J2QB 3H5XA 4OL8A 4F4ZA 3PJXA 3KLHB 4I2PB 4PUOA 2BE2A 3QYYA 4YR0A 3H40A 4JV1A 3DLKA 3TAMA 5J2PB 3BGRB 3FSIA 4ZP9A 3KLGB 1JLGB 3SFGA 4ECXA 1HNVB 1MU2A 4WFZA 3BSCA 4IRDA 1TL3A 2WB4A 2C2DA 4RNNA 2OPPA 4JV0A 5KG7A 3V4IB 2HMIB 3QIPA 3Q8RB 2V4RA 5DG7A 1RT3B 5KFMA 1HNIB 3MEEA 5J2NB 2ZE2A 1XR7A 3GILA 2ZD1B 2AGOA 4K4VA 3H98A 4FS2A 1LWCA 1JKHA 3EPGA 3HVAA 4DL7A 2ZE2B 2GC8A 4O3RA 1LWFB 1JLQB 2W8KA 2W8LA 3RAXA 2ASJA 2BR0A 4MFBB 3SI8A 3DLGB 3CJ0A 2FVQA 4QWAA 2IC3A 4IG3A 4J9SA 1N5YB 4DL4A 1TKZB 4ZMMA 4IG0A 3KLGA 2AGPA 5EDWA 3EPIA 3TVKA 1NNDA 4TXSA 4ZPCA 3KMSA 1QAIA 4TY9A 5KFSA 5DLFA 5F8JA 4KKOB 5J2PA 1TP7A 2DPJA 4MKBA 3Q8PB 4G1QB 4WZQA 1S49A 3OLAA 4PWDA 3M9OB 3QGHA 4TLRA 1T03B 4IFVB 4J9RA 1HARA 3NBPA 2XI2A 4DL3A 3DMJA 2RDIA 4ED7A 1RT5B 2ATLA 1S0MA 2RDJA 4ECUA 5KFGA 3H4BA 5D3GA 4DL5A 3GIMA 4KAIA 3UDLA 1TVRA 3MECB 2FVCA 3KLIB 4R8UA 1S6PA 1NHVA 5L1KA 4IR9A 3NBPB 4K50A 5F8NA 5L1LA 4ED1A 4KFBA 1SH0A 2ILZA 3KLVA 3FFIB 2HNYB 1RTJA 4LSNA 3JYTB 1BQMA 1RT4B 1LWEB 1EETB 2JEGA 4ECRA 1K1QA 3IG1A 2YKMA 4RW8A 1C0TB 4NLRA 4FBTA 5KFNA 5KFCA 1RYSA 2UVVA 1C0TA 1SH2A 3I5AA 1IKWB 4ECQA 1RYRA 3DRRB 5KFBA 4J9KA 3PW7A 3T5KA 3NMAA 3RBEA 3RB4A 3GV5B 2FJXA 1RT4A 1RA7A 1J5OB 4LSNB 3JYTA 4Q0BA 5J2MA 1JLAA 4TYAA 4WXWA 2R8KA 4O3NA 2XWYA 1LWFA 3LANA 1DLOB 5EUHA 4O4GA 4IH7A 1JLCA 5C24B 4ZPAA 1S1UA 1WNEA 1JLCB 1VRTB 2YNFB 3M8QA 3KLEB 3V4IA 2HMIA 2FLPA 4Q8EA 1RTIB 4LSLA 4RW4B 5F9LA 1R0AB 2GIRA 1J5OA 4Q0BB 4RNFA 2WTFA 3GQCA 2OH2A 2YNHB 3CVKA 3PW5A 4M94A 2FLNA 3E51A 3M8PA 2BRLA 4WYWA 2ALZA 4MIAA 3PZPA 1C1BB 2BE2B 3KLHA 4PUOB 4QW8A 2F8EX 3GIKA 1RT6A 2B5JB 4I7FA 3UPFA 4MK8A 5I3UB 5KT5A 1N5YA 1HQUB 2IC3B 3ISNC 4IG3B 4GC7A 4WE1B 3KLFA 1XR5A 2D3ZA 1LW0A 2OPSA 3IS9B 3LAMA 1GX5A 2WHOA 1S9EA 1BQMB 4NLOA 1JIHA 4R0EA 4ZP6A 2W7OA 1N48A 2WOMA 1JLQA 2AWZA 4IRKA 4B3OB 3RBDA 3OHBA 4I2QB 1LWCB 1TVRB 3MECA 5HLFB 5KFQA 2UVRA 5D3GB 2FVSA 1W25A 3FQLA 3DYAA 2WCXA 3QLHA 5FDLB 3QIPB 3BSAA 3LP1B 1HPZB 3V81A 4QWBA 3JSMA 5J1EA 1VRUB 2YNGB 3T1AA 4MK7A 3RB0A 2W9CB 4O3SA 4ZP7A 3H5YA 1LW2B 3LP2A 2FVPA 4WFXA 4QW9A 1HMVA 3H59A 3OSPA 4Q44A 4NLYA 5HROB 4KKOA 2JLEA 2BQUA 1N4LA 2UUWA 3BQ1A 4O3OA 1JLBA 2R2RA 1TKXB 4U6PA 4RW9B 2VA2A 5KFTA 4J9QA 1S9GA 5DQGA 2JC1A 2YKNB 3JSMB 2I5JB 1DTQA 3DDKA 4URQU 4MFBA 5KFIA 4IQXA 2XCPA 5DGAA 1S10A 4F50A 3QLHB 4ZVEA 4KHRA 5I42A 4KBIA 4O4RA 4ZHRA 3E01B 3KK3A 4KV8A 1T94A 3CWJA 4TY8A 1HQEA 4R5PA 1S4FA 1T05A 4NLDA 2AX1A 2W9BA 3D28A 3HVWA 4G3IA 3E01A 4NLWA 4RNMA 1HNIA 5JXSA 2WONA 4MK9A 4MKAA 4EBDA 3H5SA 2OPRA 1S1VB 1DTQB 4Y34A 2YKNA 1TL3B 5C25A 3IRXA 5DQHA 5KFFA 4EEYA 4K4ZA 2B5JA 2VG5B 2VG7B 2RF2B 3LP0B 1QUVA 1YVFA 1JLBB 3C6TB 2YNIB 3H4DA 1T3NA 3QIDA 3BREA 4DL2A 4MIBA 1D1UA 1LW2A 4Q43A 5KFVA 4NLVA 3OSNA 3ITHB 4IDKB 4ID5A 4NLSA 5KFXA 4NRUA 2JC0A 3KLEA 1K1SA 4KE5A 3KHLA 3CDUA 1RTDA 1TKTA 3V6DA 3UR0A 1C0UA 4RU9A 5F8IA 4ECTA 2B6AA 3BSOA 3DLEA 4YR3A 4IFYA 3KJVB 4NZ0A 4I2QA 3KK2B 2IAJB 1UWBB 1FKOB 3RB6A 3BSNA 3GV8B 3PR5B 2J6UA 2IJNA 2WOMB 3BQ0A 3DOLA 2W7PA 4F4WA 1JLFB 3KHGA 2R2UA 3IS9A 5KFJA 4K4SA 4TN2A 4TQSA 5KFAA 4IH5A 2R8IA 4NLTA 2B43A 2QE5A 3GIIA 1QAJA 4EBCA 2C22A 3GYNA 3PW0A 3V6HA 4YQWA 1NHUA 4ECWA 1SUQB 3PHEA 3TQ1A 1IM4A 4NLXA 3EZUA 4O3PA 3M8PB 1HYSA 3OL8A 3KHRA 2YNHA 4LQ3A 1KHVA 4DG1B 4NLUA 2HNYA 1R0AA 3KOAA 4RW4A 2E9ZA 1S6QA 5K14B 3OHAA 1S6PB 4RZRA
chains in the Genus database with same CATH superfamily
5A8WA 3I0SB 1S1WB 4M5GA 3UE2A 3B54A 4OQJA 3VV2B 2OTLS 3MR6A 1WWHA 1W2BR 3J7AN 2FC9A 3NG8A 4ZLJA 4KO0A 3RBEA 3V6DB 2FVRA 3O8WA 1RKIA 2XI3A 2N7YA 5I3QA 1EX8A 1NPPA 3BQ2A 1BXNA 2APOA 4LFCF 3PXGa 2V6AA 5K8PA 1LOUA 2HNDB 2FTRA 3EXCX 3ITHA 1KVJA 4LF2A 4LUBA 4DUYJ 3JAMY 3GJQB 1ZA2B 1WEZA 3IAM9 1FI4A 4NYZA 2DR5A 4DQSA 2QT7A 3HSJA 5D4PA 5DM6Q 4C3MA 2YVSA 1SC6A 2B4PA 3C14B 1AA1B 3NP5A 2BKNA 2G9OA 4M63A 1BQNA 3CO9A 4DCJB 1M5VC 2CQBA 3CO0P 2HPUA 2LVWA 3Q22A 1TMJA 3SEOA 4YB6A 3MAHA 1N54B 4QU7A 2N3OA 1JXVA 3NOCA 3SFUA 4A46A 1NK5A 3H42A 3KNAA 2R9LA 5GMDA 2YWHA 1RHMB 2O01C 2JHEA 1KS2A 3CJ8A 1VYAA 3FDSA 5GAGU 2CPYA 4KGMA 1FWKA 2ZH3A 2C3UA 1RXOB 3MCMA 1X4CA 1R43A 2QL9B 2XY5A 3ENWA 2QTWA 3JS9A 1PC4A 1DY3A 4DMZA 3NKYA 2CZVC 3JXOA 1RAFB 4G1PA 3CIMA 5KG5A 1GXUA 2P6SA 3R27A 2K3KA 4K4TA 2Q66A 3MM6B 2VOPA 4C0HA 1TL1B 5D0GA 2JEJA 3PM9A 1UEKA 3AXKA 4ID5B 2AD9A 2LU2A 2HK2A 4USJC 1RBLA 1J5EF 4DV5J 4W92B 1U02A 3IM9A 3MURP 3TX0A 1OMSA 2VIHA 1QSYA 2IMWP 5B0GA 3W9JA 3G71S 2IBOA 1BE4A 5EWGA 1VQLS 3MFHA 3TAMB 3PW2A 4YHHJ 4WU3A 2GAGC 5K20B 4DR2J 3RW7A 3K8VA 4DS5A 2H4YB 2GGPA 2A1BA 2D9OA 2JL9A 2ZDPA 3H2VE 4JP8A 2VPZB 2XGQA 1F60B 3CD5A 4O44B 1A6LA 2IM3A 1LXJA 2KXFA 2QMWA 1SIZA 1SJRA 4J90A 2KN4A 2XS5A 1NUEA 2FY1A 2B4OA 1SJFA 2W1BA 4U9RA 3ZNUA 4X62J 1EIYB 2DNOA 4WXOA 3EX7B 2Q6CA 4WYLA 4ZPDA 4F4YA 3QO9A 1G3OA 3UD5A 2B9WA 2I1RA 2WBRA 4C8NA 4UOGA 2WK4A 1FXRA 2ZD1A 3MPUB 5HQ8A 4KRWA 3EZOA 5L1JA 4UZCA 1PKUA 3OUYA 1FK9B 1XJWB 4DF4A 4MYUA 1S9EB 2GCFA 1B4SA 2XG8A 4IH6A 3TA2A 8ATCB 3C46A 4OZNA 1QSLA 2X1FA 1NK9A 3FCWA 1VQ8S 7FDRA 5DLGA 4GKKJ 4WP9A 5KFYA 2OPQA 2DHAA 1IBMJ 2CJBA 4KJIA 1PYSB 3MCNA 1M5SA 2NPIA 1EP4A 3KKFA 3PYEA 5LM7E 2FZKB 1N6QA 3FBFA 4ED6A 2C2EA 1KNZA 3GR1A 2QSFA 3Q2TC 4ES2A 5B0EA 4CI0B 2HQIA 2AQ4A 3C3LA 2VG6B 2RQMA 4I64A 4ECVA 2X1BA 3N6NA 4Q2MA 2YNGA 1C2PA 5L9XA 4RW6A 3FRYA 2HQ3A 2XBPA 3G6XA 1DHMA 2UUCJ 4CRJA 3DC2A 4PG4A 2MGZA 3SQGB 2XTJP 2Z2LA 5BYSA 4TU9A 4L3NA 1FTCA 2R2TA 4B9UA 1U24A 5CYJA 2UVWA 2LDIA 3UO0A 2CNOB 3D5MA 2W2MP 3P8BB 3PFEA 5HJXA 3UN2A 4WKYA 4AE5A 4A8KA 1AT1B 2VFSA 3BBFA 5CH7B 4WF9Q 1RK8A 1SC4B 4MIWA 3LWLA 5ETPA 5CA5A 2E5GA 3M8WA 4ETXA 3OL7A 1YJWS 3PX0A 3HXMA 2DNMA 3JTNA 3ETOA 3TUPA 1HI1A 2IVMA 1FX4A 4C6AA 3O5TB 3OFFA 1PSDA 3CB4A 1L3SA 4X4PA 3DI6A 2VBWA 1HBMA 4G65A 1MLAA 2BRKA 5ETOA 4YP3A 2H48B 3OR2A 4I0WA 4OI6A 5KFUA 4ILLA 3G8QA 2CRLA 2BVZA 1F9EB 1N32J 4LBIA 5J1NA 2DGOA 1FEEA 2MPUA 3SSSA 2VBXA 2PGCA 4DV0J 5IZHA 3MEGB 2FZCB 4NCGA 2HWIA 2VBYA 1HBUB 2OI2A 2YKAA 4EYHB 2L9DA 4GVLA 3TJ9A 3DRSA 1FRIA 1BQXA 3C6UB 2OLWA 4F4XA 4QU6A 2OHDA 3MGJA 3MEDB 3AOCA 1VC5A 1NMEB 2B3TB 2V0NA 4ECSA 2DPIA 2AF6A 3M8QB 5HBMA 2LFVA 3NY0A 5GVQA 4PQUB 2NXUA 1W26A 3MOZA 3HI9A 5D78A 9ATCB 4ES3A 2HHHF 5E33A 1AFIA 3ENVA 1YJTA 3MEDA 1KSPA 4A8QA 4XPEA 1U0SA 4J9OA 2FIUA 2QJ3A 1PG5B 5F9NA 3OV7A 1RWUA 1XMOJ 5J2MB 4B9LA 4CLZA 2DNQA 1VQNS 5GAHU 4G1QA 3LA0A 3P45B 4K4UA 1N5VA 4JUZA 2D3OR 4QOTA 1URNA 1ZS6A 3FUYA 2F9JA 2DNRA 2R7RA 2UXCF 2QA2A 2RT3A 1N33J 3TR5A 3MUVP 2DVIA 3HSGA 1DTTB 2DRDA 1NKCA 4J9LA 2RHQB 2LQ9A 1RGVA 2VG7A 2VG5A 2E29A 1TKZA 5GAHI 1QVGR 3VAIA 1CJUB 1XR6A 2NXNA 5L1IA 4DPYA 2J9DE 1EB0A 3ZZYA 4NRTA 2QYCA 4B3MF 2ILYA 2EC0A 1RHUB 1I6JA 4AXJA 4X4NA 4IOBA 2OPRB 2C3PA 5T7LB 2HHQA 5C5JA 4ELVA 3WIUA 2BZ2A 4U7CA 2IAJA 2E5LF 5DDRC 2ZDOA 1FEHA 1YQHA 4KV8B 4NI2B 2YX1A 4LFAJ 3WDOA 5HMZA 3MEEB 3SDEA 1UW4A 2KU7A 2MLYA 4DV0F 2DR8A 5I42B 4ES1A 1RTDB 5F8LA 3Q23A 4V19X 5DS7A 2OMOA 5CCMA 2DISA 2J6TA 2I5JA 5K14A 4Q7AA 4E2FB 3F41A 1T03A 3EGNA 4QWDA 1KC8T 2E1CA 3TWZA 4X2BA 2P2CB 3GCWP 1S97A 1SC1B 2E1PA 2G0JA 3WC0A 2D7SA 2GFFA 4ECYA 2BM1A 3NS5A 4FYWB 1RJJA 4X66F 1HR0J 1WC0A 3RW6A 3QNWB 5IT9Y 3H7HB 4J91A 3SXLA 2C2NA 1REVA 3LF0A 1N5TA 4HT7A 4WFBQ 3CJ3A 1SJ3P 2FDNA 4MMOA 3VGTA 1TUWA 1RHRB 1U45A 3CUNA 2MMYA 2ZOGA 5FDLA 5KFLA 1QLNA 3DLHA 3N79A 3NL0A 4USIA 1GQEA 3GSIA 1JK9B 3DRPB 2JZ5A 4IQMA 1GMUA 4NLPA 3OD2A 3OUYB 4JI8J 2NYHA 2GVZB 3PG9A 4H4KC 1JKHB 1ZETA 3KLIA 4KHMA 2OO4A 2XMTA 3W2WB 1I1GA 1QSSA 2MKIA 2E5LJ 3QQCD 5A8RB 4A8SA 3CMQA 3JAMU 2MZJA 3PO5A 3CJ5A 4ZVOB 4ZJQA 2ZH1A 1KQSR 2KT3A 2ZITA 4D3HA 2FJVA 1IR0A 1Y3KA 2V94A 4ZCKA 4MAKA 2ZWOA 4WBFA 1AZSB 1FXLA 1LKZA 2MDAA 5D15A 4Q8FA 4ZVQB 2HQFA 5J2QB 3CT9A 5ETRA 1GXLA 3KLHB 1GTHA 3EGWB 5T41A 4YR0A 1M5OC 2HFUA 2XY6A 3AOBA 4P72A 2YQ3A 4FXWA 3IC1A 1UJ6A 5AXLA 3BGRB 3FSIA 1JJCB 1JNRB 5FD1A 2U2FA 1NM2A 4OLOA 1ZYQA 3FEZA 3G2XA 3M8SA 1MROA 5L9NA 2KZMA 3VAMA 4TKTA 2OPPA 2CWXA 3GU0A 1X7VA 2OEKA 3V4IB 1X4AA 4ZVPB 2W25A 5KG7A 1N0UA 4ENOA 4AQYJ 1RT3B 4F2RA 4OHYA 3L95X 2G4BA 2GJFA 1WC5A 4PG5A 3E8OA 3HFVA 3I6PA 3MD3A 1XR7A 4MYTA 3TAPA 4K4VA 4F4AA 5CCLA 1IQZA 4PZVA 4NX9A 3S8SA 2GVZA 5H9FJ 1LWFB 4DZ6A 3SZ2A 1JLQB 1MW7A 1CJTA 3B4MA 3S6EA 2MQPA 1CS4B 3BS9A 1BMQB 3RAXA 4OZ0A 3HF5A 2VQEF 1RACB 1F9FA 1UFLA 4IG3A 1GXTA 3RBZA 3TUIC 2AGPA 3QFWA 1VQ5S 5D0HA 2F1FA 3ZTQA 1VC6A 3AHPA 2ABYA 3ZZOA 1RHJB 4TY9A 3MMCA 4UOHA 5KFSA 4OI0A 4KKOB 1HNWJ 1TP7A 2MZSA 5EGYA 1JJ4A 2DPJA 1Y10A 1FFGB 1QD1A 1VBKA 4MKBA 3Q8PB 2W4DA 4ZVUB 2UXDJ 1M5KC 4W4MA 3HM9A 4KHPJ 3N0VA 4WJBA 1VLYA 1V5IB 2F4VF 1EARA 1T03B 2FHOB 1D8YA 2PMHA 2RJZA 3M2RA 3NBPA 5BYQA 3CW2C 3GWCA 1VQ4S 2H5JB 4ED7A 5LMUJ 2CPFA 3VAJA 1Q7YT 2OTJS 2GQCA 2RU3A 3CJRA 4NA1A 2DGVA 3Q8VA 1WOSA 2V5HG 5AJ3J 5LJ3Y 1UEVA 1D8ZA 2CQPA 4DR1J 2JH3A 3NBPB 4B02A 2J0XA 4BHQA 5L1LA 1CVJA 1XNQF 2ZZMA 3W3SA 2ILZA 1SH0A 2OD4A 3HULA 5F3TA 1HW8A 1RWXB 3W8GA 2FHKA 5LSOA 5IM0B 1RBOB 2IRXA 4JI3J 3NMRA 1F2GA 1KLNA 1UAWA 2A2CA 2EG2A 3NRBA 4O23A 6AT1B 4RW8A 2BJ7A 4FXDA 3MMCB 4NLRA 2X7IA 4OV1A 5KFCA 1RYSA 3O44A 4CZCA 3BH7B 3I5AA 4RJVA 4JV5F 1IKWB 2DO0A 2MZQA 3ENQA 1MNEA 3DRRB 2DXEA 2W7AA 1Z1ZA 3U02A 2AMCB 2YX7A 3LUYA 3PW7A 2NR0A 2G1DA 4UOFA 1VIOA 3D67A 3KG0A 3QT8A 4Q0BA 3CCMS 4B9TA 4WXWA 1Q5YA 2F65A 2R8KA 4I4BA 4L74A 4O3NA 2XWYA 4LFAF 3MM9B 5JVHQ 1WACA 2RH3A 2AYGA 4O4GA 4UUWA 1Q4RA 4OX8A 2RUGA 3G82A 3MR7A 2B9EA 1H98A 1Q1KA 3SDEB 2EPIA 3CXCR 1NZ8A 2DHGA 2YQ0A 1JLCB 2HZCA 2KM8C 2YNFB 3V4IA 2YWKA 2F5GA 2Y8YA 5IQ6A 4RW4B 2BEFA 2PEHA 4OMFG 5U47A 3B8HA 3M1VA 4AL7A 4Q0BB 5LXRA 2G0IA 2WTFA 3GQCA 2OH2A 3CVKA 4U95A 2EXUA 3PW5A 4JI5J 2M52A 3CJQA 3VWSA 4WYWA 5LT5A 2RD5C 3OVAA 1ZZNA 1SC3B 2GMHA 2ALZA 3L7UA 4WFAQ 3KLHA 3BH6B 4XDDA 3R7BB 3CULA 2ROEA 1J5EJ 2XMUA 4I7FA 3D54A 3UPFA 4KIAA 5I4MA 1HQUB 3ISNC 3AFGA 1VBXA 1IBKF 2UUAJ 2D3ZA 2VKZG 2ADBA 2OPSA 4ZP6A 1GX5A 1HHQA 2WHOA 1BQMB 2W7OA 1JIHA 2VFUA 3HO1A 2WOMA 3GSDA 4HHUA 3OTCA 4IRKA 1WHYA 2HLUA 2HQDA 3QWUA 2ERRA 2Y1JA 4JYAJ 3HFKA 4BCAA 4UZBA 4KT0C 1OQ3A 2H5EA 2ZHBA 3EGVA 4CWBA 2RRAA 3FQLA 1HWIA 2A0FB 2GAHC 5FDLB 3QIPB 4J7CA 4GKJJ 2RIJA 3ZZ0A 3V81A 1QY7A 2MKYA 3UDVA 4DSEA 2PFFB 4PXEA 3JQJA 3MD1A 4GO7X 1UVJA 3HP6A 5K9FA 3T1AA 4MK7A 4O3SA 2W9CB 4XK8C 1HIYA 2MB0B 2ALYB 1UVNA 2FVPA 1RHQB 1KOOA 3PX6A 3H59A 1B3TA 2WSFC 4Q44A 4NLYA 4KKOA 2UU9J 1N4LA 2UUWA 3BQ1A 4O3OA 2NXEA 2NPFA 1JLBA 2AJ4A 1TKXB 2W2NP 2RB7A 3H90A 3W62A 2M0GB 1NK8A 3IXQA 4RW9B 2AZ3A 1RABB 1X5SA 2V69A 4NOHA 1WG5A 1CJVB 1R6YA 1GMVA 4NEZA 3CD7A 4DUYF 4DR3J 1S9GA 1TL7B 3CCLS 2XZTB 2NS1B 3D4JA 4Q5VA 3QPIA 4MFBA 5KFIA 3TZYA 5THWA 3J81U 1XTZA 2CNLB 3GTYX 3Q83A 1NKBA 3EVOA 1R27B 2PO4A 1CJTB 2Z58B 1FJGJ 3W66A 3K5LA 2JVOA 3RJMB 4NLDA 1PAEX 3GFHA 3R6GB 2BOAA 4K5SA 5AE2A 2R7TA 3A8JA 4NLWA 1X5OA 3TJ8A 4RNMA 2VQEJ 5JXSA 4ANCA 4UOCA 4U67Q 5A0YB 2OPRA 2B9YA 2H5IB 1Q8IA 3D6TB 3DFEA 3M2VA 3CJSA 4DV4F 1P1TA 1NAQA 2DXDA 4DV6F 3TA1A 1RU1A 3HT0A 2WSEC 3NS7B 2B5JA 4B3TF 3ZFVA 3LP0B 1QUVA 1WHVA 3POTB 2QIFA 1F2HA 5E7OB 3BO4A 1SPBP 2HQCA 1GMWA 1TK8A 4OZ2A 3QMQA 4MIBA 5B0CA 1AYEA 3SV4A 2HZAA 2AP6A 1TU0B 4DL2A 1HNZJ 2LCWA 2ZH9A 3ITHB 4IDKB 2U1AA 3NCQA 4JI5F 1NSKL 4P75A 3PRBA 5KFXA 2XNRA 2KB2A 2N82B 4NASA 1K1SA 2X3GA 2V8HA 1FDNA 2AW0A 1ICEB 1N34F 1N52B 4YR3A 2KYZA 3A3OB 3RRKA 4NZ0A 4I2QA 2W01A 2IAJB 1Q82T 4USUA 1QM9A 4X4QA 4DV1F 2WOMB 4N41A 2EKNA 2H54B 5T7LA 2EI5A 1JLFB 3HJFA 2V2KA 1HWJA 1QUPA 5KFJA 2WSCC 1CPZA 4DR2F 2ZFHA 1N0VC 1U1PA 2GZOA 4TQSA 1FRXA 3TEHB 4A8YA 4KC5A 1OJ4A 1B7YB 5MLCV 4UT4A 3GIIA 2DH9A 3MMAA 2CUYA 2QSWA 2ZJRQ 3JTOA 2C22A 4EWTA 3EDRB 1NHUA 4PXDA 4ECWA 1FDDA 4O3PA 3T1YF 1FJCA 4MKVA 3OL8A 2AYEA 2XWXA 1PBUA 1OPZA 4A8OA 4CLKA 3KHRA 1OY9A 1SJ4P 1ZA1B 4DG1B 1YIJS 4S0MA 1APSA 2L3MA 4OZLA 3NNAA 3FMWA 4UQGA 1S6PB 2RRBA 4RZRA 3BPSP 3QRRA 1X31C 4QIFA 1SH3A 4URGA 1S1UB 4HH0A 1PYOB 3DN9A 4IKAA 1K8AT 1VDHA 2XGPA 4NI2A 2V67A 1FRMA 2DY9A 3H2LA 3ICLA 3OXFA 4C48A 3V6JA 2V8DA 3DOMB 4FYXB 5C2CA 5IV4A 3DLBA 3QJLA 2VICA 2CA9A 3ET6B 3O2IA 4WFYA 4FF4A 1TAUA 1RZMA 3DRSB 1O5JA 3SCKE 1M5PC 3GMGA 1U0HA 2VG6A 2CFXA 5HAOA 5IT4A 1DURA 3QT5A 4U8YA 1S48A 4DLEA 3KDNA 3MR2A 4N76A 2QA4G 1GK8A 5GAEI 1TR0A 1FRKA 4QPXA 3MPWA 1X5PA 3I0RA 4DV7F 4ED8A 5E3AA 3QZ8A 1J27A 1FERA 2JLFA 2M7SA 2WB1D 3G4SS 1SL2A 2HHXA 2OJ3A 3TUJC 3UDEA 5ITHA 1XIQA 2VU5A 1RT2A 4GRSA 4M5DB 3R7SB 2XCAA 3I56S 1JNZB 3R2DJ 1S7HA 1S1VA 2GS8A 3EMTA 4YS2A 2HBQB 3H20A 1RTJB 4HKQA 1WTFA 3FFIA 2FJBB 2RKIA 1IKXB 2VASA 3R5DA 4C8ZA 2O5DA 4RUCA 3ZZPA 3SSQA 3D2WA 1C1CA 4R5PB 3UCGA 1SKUB 4MJKA 3M8ZA 3NCRA 4WIQA 4JI7F 2VPWB 1YJVA 3R9LA 3EGZA 3MM5A 2K1RA 3OL9A 3G87A 3GFYA 2FJWA 5KFZA 3QSIA 5JVGQ 2CPXA 2PDAA 1U49A 4QWEA 3RB4A 1L3UA 1YLXA 3PYDA 2HSEB 3B4DA 3CC7S 3EM1A 1MU2B 5KFWA 2ZOFA 2IA6A 1FJGF 4JI1J 1KFDA 1JXLA 3OR1B 2YX4A 3G6VA 2KJVA 3FQKA 4GO5X 1YZ7A 1IVZA 1HHTP 1Q95G 1RP5A 2GJ2A 1S0OA 2HYIB 4NCAA 1FKPB 4K0KF 1N6QB 1VS3A 4ICLB 1SXLA 2LQ5A 2PFDA 4RNOA 1X4GA 4C8KA 1WF2A 1SI9A 3DI6B 2CJQA 4LF9J 3IN5A 4C2MA 3I5CA 3N6LA 1KLMB 4C3KA 5JJBA 1HPZA 1ZTWA 2R3VA 3M6VA 3DRYA 2HVIA 5HI7A 3T5LA 3DM2A 2DHXA 1NPRA 1FK9A 2PI4A 5D0EA 1S0VA 3UR3C 2EKYA 1YRUA 4ZS6A 1K0VA 3PDNA 1H7XA 4PXBA 4RR5A 3ZZUA 4ZVGA 2HNZA 3KJVA 1N36J 3SSRA 3WX4A 2P9CA 2JNJA 3DRPA 1NDLA 4NZ7A 3SQGA 2ASDA 4ZJLA 2F8MA 5KT7A 2BANA 3BR9A 4Z7YA 3BO2A 3TQEA 5F8HA 4DR4F 2Q79A 5H9EK 2CKWA 4FYVB 2NSBA 2XSJA 3M6UA 2GGPB 5KFRA 1Z2ZA 2IJFA 4K5RA 2MEWA 2J5AA 4A48A 4ICLA 3I0RB 4DZDA 3HVTB 4C11A 2YTCA 2FJDB 1NK0A 1HD0A 3TO8A 4PR6A 4IRCA 1HMVB 3PJWA 3VHQA 1VI7A 4DR5F 4NXMF 1RSCA 1T9VA 3VR1A 4LF9F 1F5BA 2HNDA 1D3WA 4ZVHA 4ELUA 5ETLA 3SQOP 2BXJA 2N7CA 3DGVA 1VQMS 4CO4A 2WONB 2BOPA 1FO1A 2UXDF 2F63A 3PVXA 4UTGA 4M8LA 1A7GE 3GFZA 2E7WA 1FWPA 1VFJA 2LU1A 3Q86A 3I0SA 4JBCA 4OYMA 4NMXA 3F0NA 1GTEA 4ZHRB 3KK3B 3IWNC 3J7A1 4B3RF 2ZUAA 1JLAB 1HNZF 4F0HA 1IBLJ 1KONA 1ULRA 3KMQA 1B70B 4ZVFA 1VQKS 5ETKA 2XNQA 2HFOA 2QZ8A 5AXKA 3KUHA 4X4SA 3ZTRA 1EKSA 4P10A 1NDPA 4Y65A 1R89A 4FPRA 2VODA 3M32B 1REVB 1WEYA 2B7BB 2OIHA 2WAQD 4ANEA 2O66A 3T5HA 1L3VA 3HD2A 3CJ2A 2KHCA 3MM7A 4J9PA 4WKRA 3VGUA 1T8EA 1FDAA 3ZC4A 1CBKA 1HL6A 1T95A 3NAHA 2KO1A 1Q8LA 3D66A 3OR1A 5EX3A 5K5MA 3OTOJ 4HDHA 3LWMA 2W9CA 4DR5J 4NXMJ 1SV5A 1UVMA 2C28A 4NXNF 1PCAA 2J0SD 1NU4A 2H9ZA 4CM0A 1P27B 2FD2A 3H2UB 4CLYA 1Y00A 1UWBA 1WJ9A 5KOXA 1TFWA 1S1TB 4H4MB 2BACA 2C3YA 4J5OA 3DYAB 4N8NA 4BLGA 4QIEA 3HK2A 2K1RB 5E0OA 1QTNB 2V34A 3K89A 2JEFA 1YKWA 3FBCA 1HLWA 5A8WB 5AE3A 5DETA 2R7UA 1GT8A 4DI6A 4GC6A 2WVEA 4NPOA 1X9SA 3BGFA 4TU8A 4EO6A 4DSLA 2ZJPQ 1WD6A 5LMUF 4QZVB 9RUBA 4LF8J 3PX4A 1S1XB 3KLFB 4J9VA 3WIVA 2H65B 1HYSB 3A1YG 2RS2A 3DLJA 4HTJA 3T6BA 4I7FB 1IKWA 3MM7B 1RT6B 2WBMA 4K2XA 4ZCIA 2ZH2A 2WVBA 4KHPF 1DFDA 5D4LA 2G2YA 1R6VA 5CABA 2VUGA 4NWBA 1S6UA 3OR2B 1S72S 1T11A 3C14A 1XERA 3IG1B 1SQEA 4WCEQ 3UNGC 1JX4A 3HHKA 3CIZA 1EETA 3QZ7A 4OYOA 1XBWA 1N56A 1KHWA 2B7CB 1OQ6A 1LV5A 2IYIA 4QPTA 1YJNS 4R8UB 5FLXU 2XS2A 2I0XA 3AA8A 4Y6IA 1FNXH 1LK7A 4KTQA 1BD6A 1HWLA 4HHHA 4PQUA 3I32A 2ZVIA 4PWUA 2JFDA 3TX8A 4O4GB 2I8EA 1T9YA 2FQQB 3DXBA 4EUVA 1TK5A 2F4VJ 2Z0GA 1OSCA 4C8YA 4RW6B 2XMWA 5IXUA 1U26A 3BKTA 1QAYA 4ZN1A 1AROP 4PG7A 2LEBA 1UVKA 1GX6A 1V6HA 1UCNA 2MXYA 3PYGA 3RB3A 3TZWA 3LP2B 3BKFA 4A8FA 1KQFB 4F0MA 1Y5NB 5HVFA 4M5JA 5C25B 2KL8A 2ASYA 1KKHA 2E44A 4QQBA 2YKOA 4L3KA 3W1YC 4YY3F 2XLIA 1JLEA 4DR7F 5AJ3F 1O51A 1WHXA 3C15A 2IIHA 5IT0A 2BJ9A 1XQIA 2C2KB 1Y9OA 3KJFB 1FKOA 5E5NA 4LMZA 2YPZA 1WORA 3MR5A 4DV3J 1WUUA 1L3TA 1HQEB 2EFQA 3X1LB 5CAAA 2ACYA 4EYIB 5J2NA 4KGXB 4ED2A 4ED0A 2ZWPA 2ZH4A 2DNLA 1OSDA 2XULA 3DM2B 2CQ4A 1JQGA 4OJGA 2KRBA 2OPSB 1OY6A 4RUHA 4ERDA 2ZH5A 4B3SF 3EVWA 4RW7A 4IO1A 4B9NA 4V19J 3QJJA 1VOMA 2R8GA 2CJAA 3PTWA 2PD1A 4ZPTR 5A76A 4F4ZA 3Q8YA 4I2PB 3OTDA 2BE2A 4E98A 5GAGI 2QYGA 3BBBA 3DLKA 4ZVTB 2KVIA 5J2PB 2NYIA 4FYYB 1U4BA 1UJ5A 4DV2F 3DU5A 4AUKA 1Q5VA 2XMMA 4E0DA 4DR7J 3GG0A 3KLGB 1O6XA 2BDPA 3TRGA 1MU2A 3D6HB 4USWA 3HPOA 4IRDA 1EZZB 1S7IA 3BSCA 3EUNA 3EYZA 3BO3A 4RNNA 4OHXA 3DDNA 2K8GA 3FBBA 1DJ0A 1WF1A 2KRRA 1S4EA 2MQLA 3VF0B 3Q8RB 3GP9A 2V4RA 4PWWA 3R7NB 1HNIB 3UI3A 5J2NB 2ZE2A 1SJ1A 2GX8A 2KVQE 2MLZA 3DKDA 1JKHA 2ROPA 1QVFR 3Q8UA 2GC8A 2VZ9A 4NA2A 3MM9A 5DO2A 2WVDA 3I4PA 4ILMA 2W8KA 2W8LA 1PBAA 3HMJG 1VQYA 4KYZA 3UCUP 4MFBB 3THVA 2QLWA 3HHLA 3QT6A 2DITA 4J9SA 2ZBIA 4I6AA 1TKZB 3K5PA 4ZJOA 3EPIA 1HHSA 2B4UA 1TZ0A 4TXSA 1NJIT 4AXIA 1IR1A 1QAIA 2QC3A 4OYWA 5F8JA 3NNHA 1P1LA 3OXLA 3W9IA 1NJWA 4G1QB 2DRBA 1WG1A 3QWPA 4BDPA 3J7ZT 1P9YA 4MKYA 3IR5B 4HI2A 3MMBA 4YDXA 4IFVB 1HARA 3H0PA 3GPAA 4NL5A 2ATLA 4DR6J 2OELA 2MKSA 1WELA 4ECUA 4FPIA 4JI7J 3P6YC 3I55S 3IMQJ 3CCQS 1LEOA 4LRFA 3UNYA 4DL5A 1QAXA 3G82B 5A2QU 1U25A 4XDCA 4CO2A 4JI6F 2OGUA 1NHVA 1Y11A 4R8UA 3GE9A 3W63A 1VR6A 2YKQA 3GFXA 1MWZA 2MTLA 4PKDB 1VK8A 3VAFA 5F8NA 3KLVA 4ALZA 1RTJA 1RT4B 1ZBTA 2HRUA 3SIPB 2J8SA 4EI2A 2RILA 5I3PA 4Y2MA 2NXCA 3IG1A 5B0DA 4OIXA 5A8KB 1KFSA 4FDFA 3S1TA 4FBTA 3MXHP 2XY7A 2UUCF 2PSZA 1C0TA 1HBMB 1RYRA 1SKRA 1K44A 4DFKA 2AZ1A 4J9KA 4CQ1A 3GV5B 3LPYA 4F3QA 2FB0A 1RA7A 4DDFA 1EQ0A 5J2MA 4N5SA 4P2SA 5M2RA 5AXMA 3V5RA 4ETZA 5HVGA 4JI0F 2LKZA 2E66A 3LANA 1DLOB 1R31A 2KFZA 1DQAA 3HKZD 4IH7A 3K58A 4PPDA 1B0TA 4LBHA 1JLCA 5C24B 2CPJA 2FHJA 2ZH6A 4DFJA 4ZN3A 3L7OA 4DV6J 1WNEA 2WW4A 1GAOA 3M8QA 3AT1B 2KJWA 2FJEB 2RDDA 2V63A 2HRYA 2HGLA 4JB8B 4Q8EA 4CLWA 3B82A 5F9LA 3Q89A 3D0GE 2MLXA 4RNFA 2PA8D 4USVA 2COLA 3ZZTA 1T9UA 4U7UK 2BABA 3SYZA 2UZAA 3E51A 3M8PA 1OYEA 2BJDA 1FE0A 1H7WA 3MAAA 4CLUA 1YITS 1A9NB 4MIAA 1RWOB 2DKOB 3PZPA 1U1QA 3PIPQ 2M4MA 2ROGA 5DDPC 1IM6A 1RI7A 1WOOA 3CCSS 2B5JB 1FESA 3CMAS 4HACA 5I3UB 4MK8A 2IC3B 1XR5A 1BGXT 3AODA 1Q16B 2LDYA 3P5TL 1A0OB 4NLOA 1RLCL 3G6ES 3MAQA 2R7QA 3HD1A 3R5CA 4OYZA 3OFEA 1N48A 2UUBJ 2GO9A 2MZ1A 2MKKA 4AT1B 1RADB 4NMLA 3AAWB 2MQOA 3K2YA 4I2QB 5ETMA 4C97A 1TVRB 3MECA 2DGQA 2IY5B 5KFQA 3PNIA 2R7WA 2UVRA 3PCOB 3QT7A 3IA0A 2YQ1A 4AYBD 2WCXA 4USHA 2M8HA 1VBYA 4PYAA 4WPAA 4QIWD 4HH1A 1VRUB 1UA0A 1CJVA 2OD6A 4ZP7A 2XZDB 1LNQA 1XN9A 2ZHOA 1CQNA 1HMVA 3EWGA 3N9UC 4ZPWR 2WVFA 4CO0A 3DU6A 5HROB 2BQUA 2P9EA 3K59A 1IBMF 4C0BA 1S76D 2A6MA 1IBCB 3R1LA 3N4WA 5L46A 1M1GA 2Y1RI 2LA6A 3R5BA 2DD8S 4K2JA 1KP6A 2LQJA 2HS3A 1R0BG 4J9QA 2V8PA 2JC1A 4IQXA 4HDGA 4LR8A 4DXLA 3CCRS 2VJVA 3FEYB 1HNWF 3MHYA 1S10A 3QLHB 4JV5J 2DNYA 5HANA 2IVYA 2C3OA 3E01B 2KG0A 4KV8A 1TL5A 4PXCA 4TY8A 3TJAA 3TAQA 1S4FA 1T05A 4R25A 2AX1A 4DL0C 2R7SA 1LK5A 3J80Y 3HVWA 2DGSA 3WBZA 4G3IA 1B0VA 4EMDA 2W2QP 4M5MA 1PYTA 3H25A 1F5CA 2DGWA 3HZEA 2O67A 2VJUA 3WX8A 3W5ZA 4WFNQ 1DTQB 4Y34A 1PGZA 4OYXA 1MROB 3B78A 1F0XA 5DQHA 1T9XA 3BN4A 1CJKA 3J7YI 1BC6A 4RL1A 1Z2LA 5LL6d 1X9WA 2AJFE 2LXFA 1UKUA 2V8VA 4FXVA 4ZVSB 2VQFJ 1YVFA 4GVBB 3U7JA 1T3NA 2YNIB 2R7XA 3QIDA 3BREA 2XS7A 2LP4A 3TEGA 4LF8F 1BWEA 1HBNA 2VC1A 5DDQC 1D1UA 3OJUA 5CD4A 1LW2A 2G2OA 3AJDA 4NLVA 2OMLA 3ZNJ1 3J7YU 4UY85 4B9VA 4M1KA 1ZH5A 4LFBJ 4NYOA 2YH0A 3HSDA 1NDKA 3KLEA 2VPYB 4KE5A 3KHLA 4DQQA 2Y8WA 3KUGA 2KHDA 1TKTA 1S79A 2CNNB 4XIUA 5F8IA 4ECTA 5A8RA 2SXLA 4QIGA 4ZIVA 4U8VA 2CVEA 4A8XA 3KK2B 2IRYA 3ZXWA 1CC7A 3QATA 3GV8B 5B7WA 5H9EJ 2IJNA 2J6UA 1SCJB 2QEXS 2F40A 1FCAA 4HHJA 4PYDA 3C15B 4ILRA 2W7PA 3D1HA 2JFKA 3KHGA 4F4WA 3JB9k 1X8DA 3PYFA 1XK8A 2QA4S 3JSRA 4TU7A 2GVDB 3P49B 4EFAC 2R8IA 2Z2YB 2I38A 3H5XA 3R5GA 4JOUA 2ZEJA 5HO4A 1QAJA 1U1KA 3V4MA 4EBCA 3GCXP 3AJ1A 3GYNA 4AD6A 2VL1A 2HQGA 2A18A 4C0OC 1SUQB 2FYXA 4YQWA 1IM4A 1YX2A 3K7RA 4OZJA 3M8PB 1DQ9A 3QGPA 4F67A 4EU0A 2GVDA 3FKBA 4L76A 1AXQA 4YUDA 2YNHA 2J7WA 1KHVA 1XMBA 3JQMA 2NSCA 2QRRA 1R0AA 4ECZA 2D3O1 2VFTA 5K14B 2WZ1A 4DOZA 1JB0C 1UZHA 2K06A 3MEKA 5CYQA 2R8JA 2G13A 5LXYA 1YI2S 2E5IA 5IWAJ 1D9FA 4N56A 1TQLA 3ILLA 1TKTB 1ZM3A 2QFIA 1SBRA 3Q2SC 4QJVA 2XMAA 5AT1B 2QX0A 1S1TA 4H4MA 4DBQA 5L38A 4JI4J 3N5BA 4LF6J 1NLKL 2Q43A 3GJSB 4KGVB 4IFVA 4H4OB 3C6UA 3EVMA 3GB0A 2HIYA 3LTOA 4KH1B 1U2RA 3D0HE 4M5LA 5KFEA 3OW2R 2CAJA 5KAKA 1QE1A 3MEGA 4RWXA 3NNCA 2HAIA 3D9BA 1RT2B 3C66A 3CNQP 5GADU 4M5NA 3RGIA 3DRRA 1SQFA 4KGKA 3I87A 4F0KA 2C3MA 4X4TA 1EQMA 2CQIA 1EP4B 4Q45A 1IKYB 2RF2A 2XSFA 3MMAB 2NXJA 4P52A 1E6YB 1Q7LB 2ZUGA 3LALA 2HHUA 3IRXB 2OUGA 3I4HX 3HHLB 5KT6A 3VALA 5JUMA 3FC9A 1M90T 4OX9F 2HZVA 1IQTA 2H4WB 3WQPA 1TV6B 5HP1A 4DR1F 2A10A 3ET6A 4LRAA 3MPYA 5KG6A 3AY0A 5KG0A 4LVOP 4CYUB 4OI4A 3IBCB 5CYMB 1C0UB 2B4VA 4F3MA 2AV5A 1KOHA 4Y2AA 4DQIA 4EBEA 2KZZA 2J7KA 2AJ2A 4O44A 2DRAA 1U7LA 4KY3A 4PG8A 5K8MA 4EZ9A 4X64F 3NGDA 1JWWA 4YEAA 2B56A 4QWCA 2Z2ZA 2RNEA 1NJZA 3FZ2A 1U6BA 1PJ5A 1FT8A 2CQHA 1FKPA 3VVUA 2QO3A 1CC8A 1SVDA 3QBCA 2LLZA 1SUQA 2LMIA 3HVTA 4C11B 4M5KA 3LP0A 3POTA 3M2UB 3PKYA 3LQVA 2IM2A 5ETSA 4C9DA 2XSJB 3TZXA 3DXSX 5KFPA 1RWPB 4KSEB 2BJEA 2D41A 2JDJA 2W24A 2DK2A 2CQGA 3CJ4A 3T6JA 4FVCA 1CS4A 2YBVA 2AX0A 3CCJS 2LXUA 4XPCA 1B99A 1P9QC 1WI6A 2DTJA 3Q8SB 2KFYA 2VPXB 3AB4B 3FSXA 2J0QD 4FBUA 5HLFA 1VQSA 3OJSA 3LGNA 5DG9A 1T05B 2N3LA 1C1CB 3QO9B 1RTHB 1UFKA 2R7OA 3TVZA 1NEEA 4J37A 3UN3A 3OLBA 1Z4UA 2HS0A 2O1PA 3V6KA 1ITPA 2YWEA 4HYKA 5KFKA 4DSFA 2LYVA 1UVLA 2V50A 4RX6A 2HHSA 1MMNA 4JI2F 1HNVA 3R8YA 1RE1B 1TL4A 2BX6A 2EK1A 5F0UA 3ELHA 2R8HA 1CEZA 4RW9A 2CYYA 3CDWA 3L09A 5IWAF 1NSAA 3JSYA 3X3UA 3F44A 4OYIA 3W2VA 1LFWA 2EFVA 3U27A 3BV8A 4N47A 4LIRA 2EBEA 3CJKB 4BC9A 4OX6A 3KHHA 4U7UD 1UVIA 1YBUA 2X3DA 1KBRA 3BGLA 2RUSA 4I2PA 2EWHA 2YXLA 1CJKB 1VRUA 4DV3F 3T5JA 4RW7B 2X1GA 4H4OA 1TL1A 4N8OA 4UF4A 4DL6A 1S0NA 3M2VB 3LP1A 4RNHA 3CDEA 4CH1A 2EVZA 1IWAA 3GZ7A 1HI0P 4ZCMA 2QL5B 1CSJA 2VA3A 4RLEA 1RTHA 5CYMA 2UV8A 4DF8A 3IGNA 3FRZA 2NLWA 2C1EB 1U2FA 2DIUA 3GONA 3W2WA 1VCTA 3CCTA 2HNZB 1BWVA 1DLOA 2C2RA 4B3OA 2R42A 3ILJA 4DEZA 4ED5A 1LFPA 1HI8A 3FCVA 3DNCA 3HKWA 1Q79A 4ZITA 4K7QA 7AT1B 3VGVA 1D9AA 4Y28C 1RAJA 1L3KA 4P9SA 5SZTA 1PILA 1NHKL 2FUG9 2GHVC 4Z2XA 4JI2J 4RPFA 2P5VA 2V9WA 1HNXJ 2GV1A 3HSZA 3NCPA 1IKYA 3M9MB 1UPMB 1CQMA 3M6XA 4IR1A 2DGTA 3VQSA 4C4WA 2HVZA 4NXNJ 1KN6A 1RAOA 1REGX 5A6WA 3CCWA 2C2MB 1S1XA 2H3EB 2HVDA 2KT5A 2P6TA 3HFZB 2CQ0A 1QDUB 3PHTA 5D0RA 1OO0B 3Q0AA 2J0WA 3RR7A 3AJ2A 5T14A 2R7VA 2PA3A 3A4TA 2V4QA 2IRUA 3V2UC 1XNRJ 1VRTA 4C3LA 2EFPA 3MR3A 4DPTA 1AUDA 4K4XA 5C24A 2O3DA 1EHWA 4KB7A 5HBMB 1UETA 1VLOA 4OYPA 2CXEA 3MTKA 1R7IA 1G4CA 3VCDA 2X1AA 3DOKB 1NCLA 3MPVA 4OHZA 5KG4A 1U8SA 1IKXA 1VMBA 2OFHX 3DRXA 4HR2A 2B0GA 1UP1A 3O1LA 3KK1B 4P2FA 3VAHA 3R1HA 1HBNB 1TFYA 4JI3F 1XEZA 2GIQA 3G96A 3TVYA 3U1LA 3AD7C 4GVBA 5B08A 3VZIA 3J7Z5 2NZCA 2AT1B 1UL3A 1ZAVA 2E5JA 3BJYA 3MOJB 3E2EA 3ISND 1N32F 1M1HA 2MJNA 5A8KA 3P4UB 3J80U 4WZMA 1RTZA 2BUNA 2CDQA 1RT1A 2DIVA 1K9MT 2JVRA 1RWNB 3T19A 4YR2A 4CH7A 4OI2A 1T7PA 3CC2S 2DR6A 4Y2CA 2HBZB 4DN0A 3G6YA 3T1HJ 1IKVA 4P2XA 2D74B 2BJ1A 4UQTA 4BWMA 1UTAA 2CPDA 1Y4ZB 2N4DA 2OP5A 4DPUA 1RU2A 1WOPA 2YPYA 4YMEA 4H54A 2GNKA 2BQRA 5DDOC 1IBKJ 3UD3P 4CLPA 1IXKA 3KNGA 5ETTA 4OYAA 4DV2J 2MJUA 1OS5A 4C8LA 1VJQA 4TQRA 5E3QA 5F8GA 1ZZFA 1R8AA 5ETQA 4XO0A 3M8YA 3MM8A 3CJKA 3WZ0A 2YY3A 2ZKUA 4JV2A 2E7XA 3C6TA 3DLKB 1FJEB 1S59A 1RDRA 4LR7A 4ZP8A 4QIVA 3J81Y 4RKUC 5AE1A 1TKDA 2UU9F 5J1EB 1RLDA 3H5UA 1KR4A 4CT9A 2EG1A 4GKKF 4LF1A 4DFMA 4CM2A 1JLFA 1H2UX 1K47A 3RAMA 2XC9A 2WRMA 2XHWA 4WP3A 4KFBB 1F5AA 4QR2A 4LR9A 5KT2A 3PIOQ 4BS2A 1HWUA 4CLSA 3IBFB 3ZO7A 4LQ9A 2B9XA 1F3VA 4TY8B 5KOWA 2Q1LA 4JI1F 2HRTA 1Y5IB 2ZC3A 4FS1A 4DQPA 4KR0B 4LFBF 1K0TA 5KT4A 5EX0A 5KFDA 1YRTA 3C2PA 1PC5A 4FN5A 4K4YA 2RS8A 3VAKA 1VQPS 1DZ5A 1UEUA 1KLMA 5HMYA 4ANDA 1MG7A 2VKRA 4G1IA 2PC6A 2V2VA 2DNGA 2M5YA 3T1HF 2Z8QA 1O8BA 4IOCQ 3QYYA 4RU2A 1ZPWX 3H40A 1N8RT 1BLUA 2PEBA 1YJ7A 4Y0FA 2BBEA 5HK4A 4F3OA 2EBGA 4JI0J 2XYGB 1RAEB 4PEOA 2VD3A 1JLGB 3SFGA 5C2GA 1HNVB 2GA7A 2HFVA 3PJ9A 1Q0NA 4YB1P 1TL3A 2WB4A 4CTAB 5LJ5Y 4JV0A 1UA1A 2HMIB 3H8YA 3QIPA 2B51A 2RAQA 4PCQA 2I6WA 4WTOB 2EFOA 3MUMP 3WHIA 5DG7A 1JMTA 3FBEA 5KFMA 2FHJD 2CZ4A 3K5MA 3MEEA 3U1NA 1KDNA 2Z30B 3CF5Q 1X5TA 3H98A 2DEJA 4WWSA 4X4RA 1LWCA 4FS2A 4OYBA 1XMQJ 3EPGA 3HVAA 4DL7A 4O3RA 2AHOB 2RVJA 2MY7A 2DCLA 3BKUA 3IBWA 2NREA 2HGNA 2MSSA 3CD6S 1TTHB 2BR0A 2YWFA 2AKWB 1E6VA 2J7UA 2DNHA 3OTOF 2FVQA 4LF4F 1RHKB 2IC3A 2HHTA 3NGRA 1N5YB 4NEYA 4P2MA 4XAKA 4ZMMA 2ZM6J 4IG0A 3KFWX 3KLGA 3NLCA 2FC8A 3OXGA 4FNIA 5EDWA 3TVKA 4FF1A 1FRJA 3D1OA 2Z2MA 5IOLA 3OBIA 1M0SA 1WHWA 1F6TA 3PACA 3KMSA 1JJ2R 5DLFA 1BHNA 3TOQA 4DWIA 2WW8A 1W2IA 5J2PA 4FKYA 2DJWA 2BW7A 2QN6B 1R8BA 2E1MC 2V2ZA 4CNYA 4WZQA 4UW2A 3OLAA 1N5QA 2F4FA 5IM0A 3ADAC 3QGHA 4TLRA 4J9RA 1VISA 2DHHA 2C42A 1U6FA 4DL3A 3DMJA 1S0MA 4LF7F 2RDJA 5KTQA 5CZXA 3H4BA 3DCAA 4O0NA 3TUZC 4DX8H 4ZLPA 3SCJE 3WC2A 2FVCA 1N88A 5BJRA 1YGYA 4IR9A 3IWLA 2MQ8A 3BB5A 5GMEA 4KFBA 4LJMA 3FFIB 2HNYB 2HGMA 4LSNA 1BQMA 2AJ0A 2PI5A 2L48A 1LWEB 2HAFA 4WP8A 4DHVA 4ECRA 1K1QA 2W2PP 3FEXB 2YKMA 1XMQF 3KJNB 2IMOA 2GW8A 3T3FA 5KFNA 2V4JA 4LF5F 3QAUA 1X0PA 5D77A 4W98A 2A2DA 3NWGA 2CQDA 2HK3A 1IWGA 3MM8B 2NUHA 2QLJB 2Y9HA 5KFBA 1Q78A 4YOEA 2RQKA 1YJRA 1VQ6S 2CQ3A 2KKHA 2CG8A 2FJXA 1FD8A 1P8GA 3UVJA 4LSNB 1R0CB 3M1VB 4TYAA 4X62F 3K0JA 3S01A 3HDSA 1XWLA 4C8MA 2RE1A 3I96A 2Q6BA 1YJ9S 2B8PA 8RUCA 3THPA 4CT8A 2HFZA 3QRQA 3MDFA 3L9ZA 2JOQA 2BM0A 1KVKA 5HL7Q 4UY8T 1NZAA 4ZPVR 4FVMA 2V2QA 5IT9U 2FLPA 2HMIA 1YBTA 2FPHX 4AFFA 2VQFF 2B8QA 4LSLA 2CNKB 1R0AB 2YWGA 4RBUA 2GIRA 2K7KA 3SMZA 1FA0A 3UVJB 1HBUA 4P73A 1FVQA 3HHLC 1CJUA 3TARA 2QFJA 4Q2LA 2BRLA 2KXHA 2ZVSA 3HCXA 4DCPB 3VGSA 2BE2B 2GO8A 1WF0A 2VF3A 3GYXB 5ETVA 4QW8A 2HFSA 3BBCA 4ZCLA 1RT6A 2YH1A 3C8YA 3ONQA 5KT5A 1N5YA 2CJKA 4QCLA 3CEDA 3TANA 3T9ZA 3FNNA 3O6QA 1LW0A 3IS9B 2MQMA 3LAMA 1RWWB 2VDIA 2IA0A 3NXZA 4R0EA 4ZA1A 4DV1J 4ZVRB 4A8MP 2ADCA 1JLQA 4LF5J 4FNHA 2MY8A 4KQZA 5J1PA 4B3SJ 3RBDA 3AQPA 4ED4A 3OHBA 1LWCB 2W2OP 1R8CA 5HLFB 2ZZNA 3N01A 1EKRA 5D3GB 5HQLA 4DSKA 4HI1A 3DYAA 4KGZB 3QLHA 2KDOA 1HWKA 4DPOA 4EZ6A 3BDEA 4N7TA 4K8RA 2RQCA 3P5BP 3KG4A 4ELTA 1U1LA 1KD1T 3MMBB 4AQYF 3F56A 3BYRA 1RCXB 3RB0A 3NEKA 3LP2A 4PRFA 3ILOA 3OSPA 4I6WA 4OZ5A 4OHWA 1H72C 4Z37A 2JLEA 1OPIA 5HJYA 1XNQJ 2R2RA 2Y0BB 4U6PA 4FF2A 2KG1A 1G6BA 2VA2A 2LXIA 4A4JA 1P6TA 3TYTA 3L4BC 3FCHA 4E8UA 2CWKA 3NOGA 5FLXY 2YKNB 2Z57B 2AYBA 4URQU 2HS4A 5DGAA 1ZAWA 4F50A 3ETMA 5ETNA 4KHRA 1MN9A 3HJVA 2J9EA 4YB5A 3PRVA 1RISA 1PJ6A 2J8AA 3M4XA 4I56A 4O4RA 2HKEA 3CWJA 4DQRA 4R5PA 2W9BA 1IR2A 2Q3PA 4L75A 3D28A 1VK3A 3K17A 3RU0A 2BKOA 1HNIA 2L9NA 4OX9J 3EE3A 4MKAA 3H5SA 3KUEA 3TP2A 4F4KA 3JSBA 4GKJF 1YWXA 1DQ8A 2CPZA 1R8HA 2YKNA 4EGLA 4TLQA 2DH8A 3IRXA 4CH0S 5KFFA 1FX2A 4EEYA 3RTVA 4HACB 3R2CJ 3OFHA 2VG5B 2VG7B 4G6VB 2DHSA 4OLPA 2RF2B 3D7SB 3VAGA 3UWTA 1FJ7A 4DLGA 3H4DA 1FFWB 1KTQA 2FGCA 3FGVA 3TI0A 2HLTA 4YN3B 3VVTA 2VC0A 3QSYB 5EHHA 1VQ7S 2RMLA 4Q43A 3OSNA 3RYLA 4ID5A 2GMJA 3R3TA 3W64A 1ZPVA 4LF4J 2JC0A 1NO8A 2XMJA 2BW2A 3CDUA 1RTDA 4I69A 2X51A 1WC1A 4AL6A 1HQ2A 4I67A 1C0UA 2LQ8A 5IS2A 4RU9A 1DBDA 4CLLA 1NB7A 1B7FA 3PO4A 4M5IA 4IFYA 2ZZTA 3KJVB 1UWBB 4USKA 3RB6A 2K2PA 2I2YA 5DJBA 3BQ0A 3DOLA 6FD1A 2D1CA 3BPDA 4LRCA 1X0FA 2KFNA 4MTPA 4F25A 3FMBA 5L8RC 4B3RJ 3A8KA 4TN2A 1T02A 2NUUG 2HVHA 1CLFA 5KFAA 4X66J 4QYZK 3GIRA 2J9CA 1IN0A 2P9GA 1KQKA 2ZH8A 3PW0A 1MN7A 2OKQA 2XLKA 3GJTB 3LGMA 3PHEA 3MAAB 1V3ZA 4Z7CA 2N4CA 1HYSA 1LXNA 1S12A 1YTYA 2BJ8A 1N33F 2IHR1 5E3PA 2UXCJ 2AEJA 3VTIA 2BV3A 4NLUA 4NE9C 4NZ6A 3D1QA 4RW4A 1S6QA 4P74A 1Q8KA 2NCKL 1TAQA 2Y0SD 1U1RA 4C7QA 4L72B 4USTA 1H73A 3DLEB 1RAIB 1NRKA 5K8NA 2RRNA 3CSKA 5KG3A 4WIIA 3PKMA 3ENAA 2MKCA 1RT5A 3IP0A 3UQSA 3HVRA 2V68A 1WDTA 2HHWA 5HVHA 2QV6A 3GIJA 3LW5C 2IM0A 1VBZA 3BZQA 2M9KA 4PWDB 5DZ6A 2VB6A 4RWWA 3RUBL 4A47A 4NCGB 4DPWA 1RT1B 2DGXA 1KRPA 3BF4A 4YHHF 1BY9A 3OFGA 2ATCB 2XYHB 4NYPA 3HHNB 2GHWA 2IJRA 2CVIA 2J6SA 1DTTA 4HTIA 5KFHA 1BQNB 3JQKA 1VIXA 2QA1A 4UUXA 2XO7A 4HEA9 1AB8A 2MZTA 3CDBA 3L3CA 7FD1A 4ZOSA 2F9DA 2D69A 2VBZA 1SL0A 1D09B 1U09A 1FKAF 4DR4J 3QGIA 4LRDA 2R4FA 4YDDB 2W9BB 1IUJA 4IFYB 2M2BA 1RA6A 4ER8A 3ISZA 1RT7A 3EDQB 3O3LA 1NSPA 3KWMA 3B6BA 1RWMB 3D3CJ 1H6KX 1UFWA 2DT9A 3FSYA 5EWFA 2MGZB 4X64J 4PPZA 3I82A 2BQ3A 3BR8A 2RQ4A 3RAQA 2UV8G 2E7VA 3SV3A 3DGPB 3Q24A 2JEIA 1S9GB 1CULB 1R8PA 1TL7A 1YDLA 2LEPA 3OQ2A 5E3CA 2ZBQA 4OHVA 1KTVA 5HMWA 4F2SA 3D68A 3BGRA 1MMDA 4P7TA 2HBYB 3P3DA 3CCES 1B0PA 3BYPA 1GMWD 4BC7A 1V9OA 4RO0A 4BWJA 3UD4P 2UUBF 4U96A 3TA0A 3W2VB 2XMVA 2DCUB 1ZM2A 3BN7A 4OJ3A 3UN5A 8AT1B 2V9KA 3J81j 3GV7B 2OPQB 1DRZA 2KTQA 1UJ4A 4P7VA 4DN9A 2IBKA 3ULHA 3G8TA 2DEIA 2MKHA 2ZBCA 3PW4A 2AEMA 2BANB 4KPYA 1GEHA 2OSQA 5CHCB 2JRSA 1NSQA 1S77D 3SCIE 4WK3A 1U6ZA 3QGGA 1RAGB 2Y1IA 4DV7J 3SCLE 1OWXA 4YY3J 4OZ3A 2C2ZB 3NGKA 4LT6A 2MHEA 4KH0B 4RUBA 5IV3A 2RKIB 4FP9A 1TV6A 5HP1B 3BDPA 4ZPBA 4M95A 1YHQS 4PG6A 1JLEB 1Q81T 1AW0A 2OPPB 3R5AA 3A3NB 3C16A 3K5NA 4WE1A 4DX5A 2AU0A 4F7VA 4IDKA 1J2VA 3RG6A 1MMLA 4J9NA 3CC4S 4NA3A 2IFXA 2POKA 1HFEL 4B08A 5DGBA 2VOOA 5DG8A 2CDRB 1EAYC 3BGOP 2F7VA 2EFGA 2XO6A 2L41A 1GH8A 4R0JA 2OAUA 1H3DA 2D9PA 3FJ2A 2DBBA 5C42B 1ELOA 4J9MA 1B64A 2AJQA 3CTRA 3C16B 1HBOA 3IGVA 4OI3A 3V81B 3CMES 1SJQA 1IJFB 2ZC4A 3DOMA 3MI7X 2K3IA 3I9V9 3MWBA 2YNFA 4LIWA 5E2QA 3UFCX 5LSRA 1JJHA 2IM1A 3AH6A 1RT7B 1X60A 5F8MA 1YBAA 4QYRA 5E41A 4NLQA 5DM7Q 4DR6F 5CYQB 1V3RA 1HW9A 2XYPB 3NAIA 4RBVA 1VRQC 4TNOA 1H74A 3CD0A 5IFMA 4A8WA 3M6WA 4RBTA 5CXTA 5KG1A 4IUFA 4QYZJ 3IRWP 5DZ7A 1NJYA 5HMXA 2M70A 2GHPA 1QTMA 2CIMA 2CQCA 2MHNA 1ZM4A 1E6YA 2F8HA 1SL1A 4URSA 4X65J 1TELA 4CO5A 2E1AA 1ZTTA 2HWHA 4NLGA 1T9TA 3R5JB 4K4WA 1C1BA 2V4JB 3P96A 1U1MA 2QL7B 2ZOMA 2MQQA 5BR8J 3PFOA 1KVIA 5IQQA 5D8HB 3OTBA 3UDCA 5B0FA 3KK1A 1QE1B 3KYLA 1X9MA 2UVUA 2P8IA 3DOLB 1UPPA 2UXBJ 2Y1LB 4O0IA 3LAKA 1RUSA 4HVZA 3DOKA 1QJHA 3KJQB 4H4KA 2VHGA 1O0PA 3HLUA 3KK2A 1F9HA 1WC3A 1PIEA 3IWXA 3F73A 3ILIA 3T9NA 2B6AB 1NH8A 3M9NB 5KFOA 3N6MA 4ITSA 1NK6A 2OSRA 2QG9B 4XTTA 4B9MA 1IKVB 3HHDA 2HHPA 1YK9A 4L6V3 3A13A 4YB7A 3DMJB 1NK7A 1C4AA 5EWEA 3FZBA 3I5BA 3CPWR 4DSIA 4QWBA 2VV5A 2L08A 2KXNB 3OVSA 1U1NA 1SV5B 1TK0A 1WC4A 2BKPA 1UMJA 2J76E 3HHLD 3A3PB 3K5OA 1YZ6A 3R6LB 4K59A 1RWVB 2ZNYA 2M88A 3EJMA 3IR7B 3MCOA 5KT3A 2XM3A 2NZ4A 3EZ5A 1G2EA 4W90B 4DU7A 4TYBA 1Y5LB 2YNIA 3OL6A 2UUTA 3BM7A 2BJ3A 2CPEA 5BR8F 1WI8A 2YKMB 2CPIA 4ID8A 3US5A 4OFZA 3DLGA 2FLLA 1FD2A 1LWEA 1S5ZA 1X4DA 2D3UA 2Z4PA 2VONA 1S6OA 2LEAA 1PJ7A 5SUHA 4LSLB 4KPCA 1RTIA 3Q8QB 4Y2KA 4YFUA 1VJWA 2R2SA 1AUSL 3GLJA 1GFWB 1KQGB 4LVNP 2XHCA 1WKLA 1Y3JA 1T9WA 4KO0B 2H51B 5LSLA 5HN0A 2VDHA 4ED3A 2ASLA 1AFJA 1S1WA 3VZHA 2E9RX 2PMWA 2RSQA 3AXMA 2EW9A 4Y3CA 5D4NA 3NGUA 1WKJA 3MCSA 1WC6A 4LF7J 1S6QB 3GYGA 2PN6A 5FJ4A 3GR0A 5C42A 3NWRA 2HHHJ 3AA9A 4DG1A 3CE8A 3M05A 2FJAB 3PR4A 1F3FA 1NPKA 1OIAA 1TKXA 2CQ2A 5CD4H 2AGQA 4IO9Q 4LRBA 5HROA 3L7PA 1M1KT 2MQNA 1D9DA 1FTRA 2JJ4D 3G86A 4MT1A 1CG2A 1TUGB 5KG2A 3M32A 5HQMA 4D3GA 5J2QA 4IG0B 1V3SA 4RW8B 1D0EA 2ZNZA 3AD9C 2W9AA 2JLGA 1X4FA 2JWNA 2RHSB 4PAAA 4JI8F 4M5HA 1S9FA 2ZHAA 4MH8A 2CPHA 4CDIA 2Y3YA 2IDLA 2KT2A 2DR7A 5M2PA 4RUAA 2ACMA 2MSTA 2ZKTA 3AOAA 4EO8A 3MF5A 3OPKA 4ZKAA 5K8OA 5GAEU 2QMXA 3MFIA 4DV5F 4O3QA 1SKWA 5H9FK 3RBXA 1X4EA 2ZBPA 1T3OA 2LA4A 5F0WA 3U1MA 4C8OA 1RT3A 2E9TA 4CLTA 3UCZP 3QRPA 2DNPA 1I3OB 1LW0B 3W5YA 2CADA 4DU8A 4JYAF 1HQUA 5A2QY 5I3UA 1RBAA 4PABA 2E5HA 1FE4A 1JLGA 5BYRA 5DQIA 1DAXA 1WTBA 4OL8A 3T41A 3PJXA 4PUOA 1SIWB 1YG0A 2GIFA 5IC6B 4LREA 4QBUA 4JV1A 1VQOS 5D4OA 3TAMA 4OV6A 1S57A 3M30B 1WSVA 3T1YJ 2CZ9A 4FZVA 4X4VA 4B17A 4CLFA 1FNMA 4IOAQ 4USMA 1I94F 4ZP9A 4ECXA 5A6PA 3OTEA 5F3ZA 5IC4B 4WFZA 5RUBA 1XC9A 2C2DA 3TZZA 3CDAA 3MM6A 4F04B 2LQBA 4Y00A 3CJTA 2FLOA 3IFEA 5G0RA 1HKAA 4WU2A 4DCOB 5C7PA 2QLXA 2AIRB 3A8EA 3EXYA 3MZIA 3CCVS 3ZZZA 4B3MJ 3GILA 2ZD1B 2C2OB 2AGOA 1EJ7L 1GNKA 2ZE2B 1NBEB 2G2ZA 2DY1A 1H2TZ 1ZM9A 2GQQA 5B0BA 1Y7PA 5G0RB 4LSZB 2HURA 3N5FA 2ASJA 1WSRA 3DLGB 3CJ0A 5LMNF 3SI8A 4C98A 5G4DA 4QWAA 3G8SA 4P6QA 1N5SA 1Q8BA 2BE9B 2V8GA 3GG1A 2KYXA 2UUAF 4V1Ak 1ACMB 1NNDA 1XMOF 2HFNA 2WVCA 3A8IA 4ZPCA 1XNRF 1HD1A 3QAEA 2ZM6F 1NB2A 1Q53A 1RB0A 2AJ1A 1U8WA 1YSJA 5MAOA 5D6GA 1S49A 2GQ2A 4PWDA 1RCOB 3M9OB 1FRHA 1NDCA 1TUVA 1AZSA 3PEJA 2XI2A 1FNOA 2RDIA 2HBRB 1RT5B 4QR0A 2IVFB 5DRKA 3OT9A 5KFGA 1NH7A 5D3GA 4DJBA 3D6FB 3W65A 3HT3A 3GIMA 1VC0A 2IDEA 4DR3F 4KAIA 3UDLA 1TVRA 3MECB 2HG4A 3KLIB 3BGUA 1S6PA 4N77A 5L1KA 4GMKA 1IBLF 4K50A 4F36A 3M2RB 3A12A 1I51B 4CO1A 4ZLNA 4ED1A 3MTJA 5CQGA 4CIOA 2GMLA 5L39A 3JYTB 3AQOA 3MMJA 1OYDA 1EETB 1JXEA 2BMBA 2JEGA 3RR8A 3DHXA 1WKKA 1H0HB 4X84A 1T0TV 2DYAA 3DDIA 1Y0HA 1C0TB 2BYCA 1G1XA 2UVVA 1G7CB 3LH2S 2MZRA 4TVAB 1SH2A 4ECQA 1Q86T 2M8DB 2MKJA 2HIQA 4I68A 2RU9A 3KTQA 2OEMA 2K7JA 1X4BA 1M5HA 2BA9A 2CJ9A 3T5KA 3NMAA 4AL5A 3MUTP 1U0HB 1RT4A 3ZZRA 1J5OB 3JYTA 2FY8A 1JLAA 1OY8A 1VHFA 4DS4A 2KH9A 1NJXA 1LWFA 3HHEA 4HLBA 5EUHA 1U48A 2J9DA 2KM8B 4ZPAA 1FDBA 5AXNA 1SB6A 1ZAXA 2NQPA 4F8RA 2QLBB 1S1UA 2PT0A 2QMUB 1VHIA 2HWTA 2F3JA 1VRTB 3HZGA 1YRXA 5JMNA 1HR0F 1NXIA 3KLEB 4OZ1A 3RRHA 2DGUA 5B09A 3RZAA 3M7VA 1RTIB 3PV8A 1FWLA 2VFVA 2CQ1A 5CZVA 3JTPA 1UW9A 4OJHA 4LFCJ 1J5OA 1RQ0A 1NKEA 3C19A 1N36F 2DO4A 2YNHB 4WTYA 2FHMA 4M94A 1N34J 2FLNA 3GJRB 3M30A 3KXDA 2QLFB 1SKSA 1HNXF 4HT5A 1C1BB 3VQTA 2ZJQQ 4PUOB 3GIKA 2F8EX 3W5XA 1MWYA 1RAHB 2PE8A 4DX7A 5EN1A 1MWQA 4CCHA 4IG3B 3M8RA 3ZTSA 4WE1B 3KLFA 2M3DA 1X4HA 5GADI 4GC7A 1U47A 1KEKA 1ROFA 1E6VB 2KI2A 3E3XA 2JX2A 1S9EA 1VGYA 4Y2IA 3W60A 5LOQA 3CCUS 5A0YA 4K0KJ 4IYQA 4I6YA 3HX9A 4OJ1A 2AWZA 1K73T 3CGIA 3PRDA 2JSXA 4J9UE 4B3OB 1U1OA 1LWXA 4LBPA 3PEHA 1FF2A 2XMKA 1F1BB 1V5VA 2FVSA 3IAS9 1W25A 2XLJA 1C4CA 3BSAA 1PAUB 2ZBRA 3LP1B 1HPZB 3LPEA 1HBOB 3JSMA 1WDDA 2DH7A 2E1RA 5J1EA 5HATA 5GMKa 4ZK7M 2YNGB 1R3NA 3FK4A 4EK2A 1IJEB 3H5YA 1TMMA 1LW2B 2DR9A 1BUXA 1URRA 4HL9A 4WFXA 3W9HA 4QW9A 3I31A 4DUZJ 1LQ9A 3LO3A 2A6OA 1FFSB 4F02A 4DL4A 2W4PA 3TNVA 2HHVA 2CG4A 3BEGB 3NGTA 2IPOB 4QR1A 1PO6A 3UW1A 1DARA 5HSPA 5KFTA 2QGFB 4OI1A 3KDOA 2CJXB 4CP5A 3DGPA 5DQGA 2AYMA 2EEYA 4L73A 3JSMB 2I5JB 1DTQA 2FGOA 2L9WA 3DDKA 3IR6B 4CO3A 2XCPA 1I94J 2UP1A 3NS6A 3DLLQ 4ZVEA 1FVSA 3QJPA 5I42A 2EK6A 4KBIA 3MM5B 2DXFA 4ZHRA 3KK3A 1T94A 1UZDA 2HW3A 2DNZA 1HQEA 2CJYB 4CYUA 4PQAA 1S99A 3E01A 2YWWA 3D0IE 4DV4J 2VH7A 1H38A 2WONA 2YKPA 4MK9A 4EBDA 3I9ZA 3MPDA 4DSJA 2PIIA 1S1VB 4P71A 4B9SA 3SBMA 1TL3B 5C25A 4CTAA 4BBYA 2XQCA 3RRGA 2H1YA 2EFNA 4K4ZA 1RKJA 3CCZA 1YJUA 3LOUA 1JLBB 3C6TB 4DUZF 1H2VZ 3AD8C 4CNZA 2HEKA 1WG4A 3FVYA 3D3BJ 1FRLA 3ZTPA 4FKXA 2OEJA 5KFVA 4ZDNA 6FDRA 3ZTOA 4X65F 3W61A 4DPXA 4NLSA 5ADZA 2PMZD 4NRUA 2XEXA 3W8PA 3PY8A 1RAAB 2Z56B 3W7BA 4F26A 2DNNA 3V6DA 1UWAA 3UR0A 3G9CA 1W7WA 4ATNA 2B6AA 3BSOA 4DFPA 3DLEA 1SQGA 3N28A 3R97A 1VQ9S 4JI4F 3AB2B 4LF6F 2UXBF 3IO1A 1HA1A 1FKOB 1RWKB 3K57A 3BSNA 5LMNJ 3PR5B 1L5UA 2DB1A 2XB2D 2FZGB 3IM8A 3KG1A 3THTA 1I5OB 1ZOTA 1NK4A 2R2UA 3IS9A 1KWMA 2AEFA 2GJIA 2XZWA 3K8WA 2LECA 4K4SA 4M5DA 5FIIA 5M2UA 4IH5A 4WK1A 4DUTA 4NLTA 2G1HA 2B43A 2QE5A 3S7RA 3M2UA 4I1TA 5BXIA 2HVEA 2IYGA 5B0AA 1WEXA 3TW0A 4X4OA 3V6HA 3TQ1A 1MSWD 4ZLLA 2I9SA 4DX6A 3D6MB 4NLXA 3EZUA 4B3TJ 4JI6J 3NGSA 2ZH7A 2MYFA 4NCBA 1FHTA 5F41A 4OX7A 1U2CA 5H1SV 4LQ3A 2EC2A 3DHWC 3EICA 3LGHA 4ZIWA 4FYDA 2A3JA 2OFGX 4X4UA 2HNYA 1CULA 5E3RA 2DNKA 2W4CA 4FF3A 3KOAA 2E9ZA 2VFRA 3OVBA 1FXDA 3OHAA 3QFHA 2G0CA 2BE7D
chains in the Genus database with same CATH topology
5A8WA 3I0SB 1S1WB 3UE2A 2OTLS 4OQJA 3MR6A 1WWHA 1W2BR 2FC9A 3NG8A 4KO0A 3RBEA 3V6DB 2FVRA 3O8WA 1RKIA 2XI3A 2N7YA 5I3QA 3BQ2A 4LFCF 2APOA 3PXGa 5K8PA 1LOUA 2HNDB 2FTRA 3EXCX 3ITHA 1KVJA 4LUBA 3JAMY 4NYZA 1WEZA 3IAM9 2DR5A 4DQSA 2QT7A 5D4PA 5DM6Q 4C3MA 2YVSA 1SC6A 2B4PA 3NP5A 1M5VC 2G9OA 4M63A 1BQNA 3CO9A 2CQBA 2HPUA 2LVWA 3Q22A 3SEOA 4QU7A 4YB6A 3MAHA 1N54B 2N3OA 3SFUA 4A46A 1NK5A 3KNAA 2R9LA 2YWHA 2O01C 2JHEA 1KS2A 3FDSA 5GAGU 2CPYA 4KGMA 2ZH3A 2C3UA 2XY5A 1X4CA 1R43A 3ENWA 1PC4A 4DMZA 3NKYA 2CZVC 4G1PA 3CIMA 5KG5A 1GXUA 2P6SA 3R27A 2K3KA 4K4TA 2Q66A 3MM6B 2VOPA 4C0HA 1TL1B 2JEJA 3PM9A 2AD9A 4ID5B 2LU2A 4USJC 1J5EF 4W92B 1QSYA 3MURP 2IMWP 5B0GA 3G71S 2IBOA 5EWGA 1VQLS 3MFHA 3TAMB 3PW2A 4WU3A 3RW7A 3K8VA 4DS5A 2GGPA 2A1BA 2D9OA 2JL9A 2ZDPA 3H2VE 2XGQA 2VPZB 1F60B 3CD5A 4O44B 1A6LA 2KXFA 1LXJA 2IM3A 2QMWA 1SIZA 1SJRA 2XS5A 2KN4A 2FY1A 2B4OA 1SJFA 4U9RA 2DNOA 4WXOA 3EX7B 2Q6CA 4WYLA 4ZPDA 4F4YA 3QO9A 1G3OA 2B9WA 2I1RA 2WBRA 4C8NA 2WK4A 1FXRA 2ZD1A 5HQ8A 4KRWA 5L1JA 3OUYA 1FK9B 4DF4A 4MYUA 1S9EB 2GCFA 2XG8A 4IH6A 3TA2A 3C46A 4OZNA 1QSLA 1NK9A 1VQ8S 7FDRA 5DLGA 5KFYA 2OPQA 2DHAA 2CJBA 4KJIA 1M5SA 2NPIA 1EP4A 3KKFA 4ED6A 1N6QA 2C2EA 1KNZA 3GR1A 2QSFA 4ES2A 5B0EA 4CI0B 2HQIA 2AQ4A 3C3LA 2VG6B 2RQMA 4I64A 4ECVA 2X1BA 3N6NA 4Q2MA 2YNGA 1C2PA 5L9XA 4RW6A 3FRYA 2HQ3A 2XBPA 3G6XA 1DHMA 3DC2A 4PG4A 2MGZA 3SQGB 2Z2LA 5BYSA 4TU9A 4L3NA 1FTCA 2R2TA 4B9UA 1U24A 2UVWA 2LDIA 4DR7F 3D5MA 4WKYA 3PFEA 4A8KA 4AE5A 2VFSA 5CH7B 4WF9Q 1RK8A 4MIWA 3LWLA 5CA5A 2E5GA 3OL7A 4ETXA 1YJWS 3PX0A 3HXMA 2DNMA 3JTNA 3ETOA 1HI1A 2IVMA 3O5TB 3OFFA 1PSDA 3CB4A 1L3SA 4X4PA 3DI6A 2VBWA 1HBMA 4YP3A 2BRKA 3OR2A 4I0WA 4OI6A 5KFUA 4ILLA 3G8QA 2CRLA 2BVZA 5J1NA 2DGOA 1FEEA 2MPUA 3SSSA 2VBXA 2PGCA 5IZHA 3MEGB 4NCGA 2HWIA 2VBYA 1HBUB 2YKAA 4EYHB 2L9DA 4F4XA 3DRSA 1FRIA 1BQXA 3C6UB 2OLWA 4QU6A