1TL3B

Crystal structure of hiv-1 reverse transcriptase in complex with gw450557
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
422
structure length
401
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 112
structure length 401
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl3B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl3B04
3V81A 1SV5A 3IG1B 4O3QA 1EP4B 1T3NA 4J9MA 4YR0A 1HMVB 1LW0B 4ZVEA 4NLOA 4J9SA 3PJWA 4QWEA 3JSMA 1TL1B 1TL3A 2XI2A 4O3OA 4NCGA 3BQ0A 3DRPA 3MR6A 3G6XA 2ALZA 3TAMB 4ICLB 1C2PA 3DLKA 4ED1A 4ZPCA 3FDSA 2UVUA 2YNIA 3JYTB 4TXSA 2D41A 4KKOA 1TKXB 1RTIA 2O5DA 3LAMA 2ILYA 4NZ0A 3V6DA 5DQIA 1XR6A 5KFVA 1W25A 3RB3A 4RNOA 4H4MB 2BQRA 1DTTB 3ISND 3CJ0A 5K14A 1N48A 2FJVA 1JLCA 3BQ1A 3MEEB 4ZP9A 5KFIA 3FQLA 3CJ2A 5KG3A 5DLFA 4WZMA 5C24B 1RT1A 2YKMA 3KLEB 4KHMA 1ZETA 4YR2A 3H40A 3V6JA 4WXOA 3OLBA 4RW4A 2YNGA 2FVQA 1QAJA 2ZD1B 1S1VA 3BSAA 4NLVA 5T14A 4ZVHA 1JLEA 4ZVFA 4R5PB 3IRXB 5D3GB 1ZTTA 4K4UA 4R0EA 1HNVA 3KMSA 2V4RA 5DGAA 1FK9A 4QWAA 3IGVA 4ECXA 2IBKA 2HNYB 1JX4A 4M95A 3CO9A 3UR0A 4RNMA 4O3NA 2WTFA 2DPJA 1RT3B 4Y2AA 4NYZA 4DL6A 1RT4A 5DLGA 1S1WB 3V4IB 3H4DA 1D1UA 5KT3A 1LW2A 1HNIB 5HP1B 5I42A 4LSNB 2OPSA 3KLIA 4ZHRB 2UVWA 4RZRA 3DYAB 3GV7B 3I0SB 3Q8RB 1REVA 4KFBA 1RTHA 2ILZA 5KFPA 4PUOB 4U7CA 2W8KA 4J9RA 4K4VA 4KSEB 2HAIA 3NAHA 5KFNA 3UQSA 3BJYA 2YNHA 2WONB 2AX1A 2FJXA 4ZP8A 3MFIA 2RF2B 3PHEA 3QO9A 3QZ8A 4H4OA 5C42A 3DM2A 4RUAA 4ED0A 2OPPA 5KFOA 2IJFA 2R8KA 4ED2A 1J5OA 2QV6A 2HNZB 4XO0A 5J2NA 4KHRA 4PQUB 1S1XB 3LP2B 1N5YA 3KHRA 1S6QA 1I6JA 2XGQA 4NLGA 1MMLA 3C6TB 3QIPA 3DI6A 4G1QA 1R0AB 3V81B 1SV5B 3MFHA 5C5JA 4YP3A 4K50A 2FVRA 3MEGA 3FFIB 3T1AA 4URSA 2C22A 2C2EA 4ECQA 4PWDA 5I3UA 4ZP7A 2JEFA 3NL0A 3JSMB 3DRRB 1TL3B 4EBEA 1S1UB 3M8PB 4NCGB 5EUHA 4XPCA 3OHBA 4Q44A 3D28A 1TKTA 3KOAA 1C1CB 2IM2A 4Y34A 3MR2A 1RA7A 1MU2A 1GX5A 2C28A 3E01A 4IFVB 4MKAA 1NNDA 4H54A 4Q45A 1S0OA 4ZPAA 1RTIB 3KHGA 3MF5A 4TY8A 3GV8B 4F4YA 1Z4UA 2AWZA 3PW2A 4URQU 1KHVA 1D0EA 2JEJA 2C2RA 4F4XA 1JLCB 2HMIA 2J6UA 4NLSA 3T5LA 1RYSA 1S6PA 3M9MB 4Q43A 4ECYA 5FDLA 1RT1B 2YKMB 4IFYB 3QIDA 3CJ5A 4KBIA 4NLTA 5KFMA 3HKWA 4NRUA 3GIJA 3MEDB 4I7FA 4RW4B 5DG8A 2YNGB 2E9ZA 1S49A 2AU0A 2FLNA 2R8GA 1JLEB 2E9RX 3PW0A 1HNVB 3CDUA 2AQ4A 4F4WA 1FK9B 3KK3B 1CSJA 1HPZA 2GIQA 4ED6A 1EETA 4ID5B 1N56A 1WNEA 2VG5A 2IAJA 3G6VA 4QW9A 1SH3A 5KG6A 3M8QA 5DQHA 4U6PA 2ZKUA 1VRTA 3TQ1A 5J2PB 1U09A 2B5JA 5CYQB 2WB4A 5KFBA 1LW2B 5I42B 4RW8A 3OL6A 3OSNA 2BRKA 4K4WA 2OPSB 3KLFB 1GX6A 1LWCA 1S1TA 3GV5B 1XR5A 3G86A 4KFBB 1RTHB 2UUTA 2R2TA 4WYLA 5KG1A 1C0UA 1RA6A 4JV0A 2W9BA 4ZP6A 1IKYA 5L1JA 1DTQB 5EWEA 4JV1A 3RB6A 3Q8PB 1JLAB 3HVAA 5KFQA 2JLEA 1S9GA 3KJVB 1RT7A 2UUWA 2BE2A 4ECSA 3NMAA 4EBDA 5C42B 3DM2B 3LP0A 2OPPB 3KK1A 5KFEA 1C0TA 5HROA 3C6UA 3UDLA 1J5OB 2I5JA 1OS5A 1HYSA 4MH8A 1C1BA 4TLRA 3RBEA 5J2NB 1N5YB 1TV6A 1IKWA 2DPIA 3ITHA 3LALA 1S6QB 2BRLA 2XCAA 3QIPB 5KFSA 4I2PA 5J1EA 4NLYA 3MEGB 2AGPA 4TYBA 1NHUA 1IKXA 1TKZA 5F8HA 2WRMA 4IH5A 1RT6B 4NLXA 4PWDB 5I3UB 2ASJA 2YNFA 2JEGA 5KFKA 1JLFA 1N6QA 5HBMA 4R8UB 2B6AA 1S9FA 4NLWA 4MFBA 1KLMA 5KFHA 3I0RA 1K1QA 3PR4A 4QW8A 3H5XA 1IKVA 2FVSA 2XGPA 4J9NA 1LWFB 3N6MA 1S9EB 3HVTA 1SH2A 3MR5A 1RAJA 3V6KA 4LQ3A 4I2QA 4IG0A 4RW9A 2ZE2A 3I5BA 4QWCA 2RDJA 3QLHA 4TY8B 1BQMA 4LSLA 1BQNA 2HWIA 1S0NA 2VG7A 3D5MA 2HNDA 3DLEB 3BQ2A 5J2MA 3IS9A 2HMIB 1HARA 1HQUA 3LANA 1S0MA 1S6PB 1SH0A 3BSCA 1JLGA 4DG1A 4MIAA 4DL7A 4Y2CA 3DOKA 5DGBA 4NLPA 4JV2A 3KK2A 1JIHA 3SFUA 3PVXA 3T5HA 4I7FB 4WFYA 2OPQA 4EYHB 1JLQA 4IG3A 1HMVA 4K4SA 1FKPB 3HHKA 4B3OB 2W7OA 4FBTA 5KT5A 4K4ZA 4RU9A 2IM0A 4Q0BA 4IRKA 3FRZA 3KLHA 3DOLA 2BANB 5KT2A 5KFRA 4ECRA 2VG5B 2IAJB 1T05B 2JC0A 4DEZA 3H5SA 5L9XA 2WHOA 1VRTB 3RB0A 4XPEA 5KG5A 2IC3A 1RYRA 5EWFA 4TYAA 4ED8A 4J9LA 2V9WA 4Q8FA 1FKOA 4RW8B 2ATLA 4EBCA 3DRPB 3TVKA 1JKHA 3Q8QB 2AGOA 3CJ4A 3LAKA 1C0UB 3DLKB 3MEEA 3KNAA 4WFZA 3BGRA 2UVRA 2YNIB 4IRDA 1IKYB 4WXWA 4TQRA 1T94A 4KKOB 2XCPA 2D3UA 3KLEA 1S9GB 2FJWA 4O3PA 3V6DB 1KHWA 4F50A 4ECZA 2E9TA 4K4YA 2BE2B 4RNNA 5K14B 1TVRA 1C0TB 1RT2A 5HROB 4QWDA 1JLBA 4IQXA 4J9QA 1HYSB 3DDKA 1C1BB 2V4QA 2UVVA 5C25A 2IM1A 2VG6A 2XWYA 1VRUA 1QAIA 5KG4A 3RAQA 3LP1A 5F8MA 1RTJA 2IMWP 1IKWB 2HNYA 3ITHB 3FSIA 3H98A 1TP7A 3HVWA 3V6HA 1RT5A 4NLQA 4I2PB 3CIZA 5KFTA 5J1EB 2W8LA 5DG7A 1S1VB 3T19A 2ASLA 1S1WA 1IKXB 1TKZB 3CWJA 1QE1A 5KFAA 4ZPDA 3ICLA 4M94A 4NLDA 5KFXA 1HQEA 2YNFB 4EO6A 1JLFB 1N6QB 5HBMB 4FBUA 4LSNA 2R2RA 3PJXA 4K4XA 2B6AB 4O44A 4ZHRA 2IM3A 4ED7A 2FVCA 3I0SA 1DLOA 4MFBB 2YKNA 5F9LA 1LWEA 2GC8A 4PUOA 4TN2A 4FS1A 4HKQA 1RT4B 1IKVB 3PW5A 4WYWA 3OL7A 3QGHA 2W9AA 3RBDA 5HLFA 2WONA 1JXLA 3H2LA 3KHLA 2WK4A 3H4BA 3HVTB 3KLVA 4DL5A 4I2QB 4IG0B 4RW9B 5JXSA 5DQGA 3QLHB 2OH2A 2RF2A 3KLIB 4IH6A 1BQMB 3KLGA 1BQNB 1REVB 2VG7B 4MIBA 5J2MB 3DRSA 2RKIA 2FLPA 1QUVA 4TQSA 2XC9A 3NBPA 2BQ3A 4YR3A 2YNHB 2VA3A 1JLGB 4DG1B 1S1XA 3CDEA 3NGDA 1S10A 4NLRA 5CYMA 3KK2B 5KFZA 3C6TA 2B43A 1R0AA 4KO0A 5L1IA 2VA2A 3OL8A 4J9OA 2OPQB 3QO9B 3DMJA 3MECA 3H5UA 4ECTA 3FFIA 1JLQB 4H4OB 4IG3B 2W7PA 4WFXA 3M9NB 2W9CA 5EWGA 2OPRA 3DLGA 3GQCA 4Q0BB 3DRRA 4QWBA 3KLHB 3H59A 4URGA 1S1UA 3M8PA 3DOLB 1YVFA 4GC6A 3T5KA 5KFGA 3RAXA 3FQKA 3IN5A 3ISNC 4G1QB 2HWHA 5F8GA 3DI6B 5L1KA 2J6TA 4IDKA 5KFDA 3N6LA 1C1CA 1UWBA 5KT4A 2C2DA 3KMQA 3PW7A 4O3RA 2IC3B 4IFVA 4KE5A 4ZVGA 5KFWA 1FKOB 3GIIA 5KFLA 3CJ3A 4JUZA 3GILA 5KG0A 1JKHB 4O4GA 4F4ZA 4RW7A 2R2UA 1TKTB 3BGRB 1NHVA 3M9OB 4RUCA 1MU2B 2WOMA 3QZ7A 3E01B 1TQLA 4IFYA 4KV8A 2RDIA 4RNFA 4IR9A 3OL9A 2AX0A 4YMEA 3MEDA 4IKAA 5F9NA 3EPGA 2R8IA 4NLUA 1TVRB 4Y3CA 1RT2B 1JLBB 3MR3A 4WE1A 2IA6A 1SUQA 3QGIA 5C25B 1RTDA 2VG6B 3KK3A 1VRUB 4RW6A 5J2QA 1T03A 3LP1B 1N4LA 1K1SA 1RTJB 5FDLB 3E51A 3I5CA 4ID5A 3EZUA 4MKBA 3BREA 4GC7A 2I1RA 1RT5B 2D3ZA 1RDRA 3IG1A 1EP4A 4K4TA 4EYIB 1QE1B 2GIRA 4MK8A 3KHHA 1LW0A 5J2PA 1HQEB 3CVKA 5KFUA 5CYQA 4NRTA 5F8IA 1IM4A 3VQSA 3PR5B 5L1LA 4J9KA 1TL1A 2AGQA 3KLFA 1HPZB 4O44B 2XI3A 1EETB 4WZQA 1S48A 3BSNA 4DL4A 1DLOB 2YKNB 3TAMA 4ICLA 2CKWA 4MK9A 1LWEB 2R2SA 2QE5A 3IGNA 4IH7A 4TY9A 3NKYA 3M8QB 2JEIA 5F8JA 4ZMMA 3GIKA 5HLFB 3PW4A 1DTQA 3JYTA 3CDWA 2B5JB 4HYKA 1TKXA 1JLAA 5KFCA 4EEYA 4IRCA 3KJVA 5KG2A 3OLAA 4IOBA 2JC1A 1LWCB 1S1TB 5F8NA 4H4MA 3KLGB 1DTTA 2F8EX 3H5YA 2EC0A 4X2BA 3DRSB 5KFYA 2RKIB 2R8JA 3NBPB 2W9BB 3NAIA 3SFGA 4LQ9A 2J6SA 5C24A 5CYMB 4KB7A 1RT7B 4KO0B 4ECWA 2ASDA 3DMJB 2ZD1A 3MECB 4J9PA 3LP0B 3KK1B 4R5PA 3IRXA 5D3GA 4KAIA 3C6UB 1ZTWA 1RT6A 5KT7A 2W9CB 3BSOA 2I5JB 2OPRB 3DLGB 4FS2A 3I5AA 3PZPA 2R8HA 4Q8EA 3QYYA 4R8UA 1TV6B 2BR0A 4G3IA 5EDWA 4DL2A 4EO8A 5DG9A 1RT3A 4IDKB 2D7SA 4IR1A 1UWBB 2CJQA 3OSPA 1LWFA 3EPIA 3V4IA 1S9EA 2IJNA 1HNIA 5HP1A 3BR9A 4O3SA 1S4FA 3RB4A 4ZPBA 4ECUA 5KT6A 3DYAA 1S97A 1KLMB 3GYNA 5JUMA 3UPFA 3DLEA 3I0RB 4O4GB 4RW7B 3QGGA 5KFJA 4RNHA 4ECVA 4ED3A 4OL8A 3N6NA 5KG7A 4O4RA 2WOMB 4DL3A 1XR7A 2WCXA 2FVPA 4KV8B 4QPXA 2ZE2B 5F8LA 3OHAA 4LSLB 4MK7A 2HNDB 3Q8SB 3GIMA 3IS9B 1FKPA 3MTKA 4B3OA 2FLLA 4WE1B 1SUQB 2V0NA 1HQUB 2HNZA 1RTDB 1T03B 4RW6B 5J2QB 3SI8A 4PQUA 3LP2A 4YQWA 2BANA 2BQUA 3DOKB 5KFFA 1T05A 3T5JA 3G6YA
chains in the Genus database with same CATH superfamily
3UI3A 2GVDB 4F2SA 2OFHX 1TL1B 2VPWB 3D3BJ 2ALZA 4ILRA 2HHHJ 2D41A 3I32A 3I82A 1NJYA 1RU1A 4TLQA 3ISND 3BQ1A 3EVWA 5KFIA 3FQLA 3OUYB 4RBTA 3HHDA 1SVDA 2B0GA 4J91A 2ZVIA 3KMSA 1HBOA 5FIIA 4EU0A 2GMJA 4ZN3A 2WTFA 4RO0A 4LFCJ 1ITPA 3GYXB 2JFKA 2Y1LB 2E5LF 3NGRA 2FJXA 4M5HA 1UJ5A 2RF2B 3PHEA 2KJWA 4OYAA 4IO9Q 1FRLA 2CQIA 2OJ3A 1EZZB 1YJRA 3DI6A 1SC4B 2OLWA 4X4NA 4PWDA 3NL0A 1UVKA 2QMWA 2VKRA 2HQIA 2V94A 3GJSB 1B64A 3UO0A 1RWVB 3UNYA 1JLCB 3ENQA 2YVSA 1G1XA 2YKMB 4IFYB 2V8DA 3GIJA 3MEDB 3LGHA 2LU1A 1KN6A 3TYTA 5AE3A 3M32A 3G6VA 4EI2A 1JXVA 3GJTB 4UT4A 2WB4A 5KFBA 3MPUB 4RW8A 3QWPA 3MZIA 1H3DA 4M8LA 3SDEA 4USMA 5L8RC 2EFPA 4ZKAA 3Q8PB 2CQCA 2JLEA 3J80Y 4ZA1A 1CQMA 2NYHA 3FRYA 3HHLD 1S6QB 3QIPB 4HR2A 4DUZF 3BEGB 3ZZRA 1S9FA 1WJ9A 3R97A 1UAWA 4J9NA 3HVTA 1NDCA 4AD6A 1TAUA 2F8MA 5GMEA 1BQMA 4LSLA 3K7RA 2HNDA 4LBIA 2KM8B 2HMIB 3LANA 1RWNB 3LW5C 4OHWA 1GXLA 1RCOB 2BANB 1GMWD 5KT2A 2L41A 3OV7A 3CCRS 2RE1A 3CCSS 3JQMA 1IBMJ 2CDRB 4C97A 4J9LA 4ED8A 3EMTA 4WTYA 2HIYA 3CEDA 4IRDA 2CAJA 2JLGA 3L09A 1U2RA 2B8QA 3TA2A 2IM1A 3AAWB 1RGVA 3K5PA 2V68A 3H98A 1R8CA 3V6HA 4HTIA 2HZCA 4L3NA 4I2PB 5B0FA 3EGWB 3GWCA 1X4AA 1QE1A 3HF5A 4CH1A 2VFSA 3BGLA 4DDFA 3WC0A 1WEZA 2IVYA 1JXLA 2WONA 4NYPA 3M8WA 4RW9B 1FD8A 2FLPA 1H2UX 4YHHF 1FWKA 4LF7J 5B09A 3FFIA 1YJ9S 3EXYA 5K8NA 1HWJA 3M8YA 4JI4F 3GPAA 2KXNB 5KFGA 3DC2A 3DI6B 4D3HA 2NXCA 2HW3A 4QU6A 4ZVGA 1F9HA 1J2VA 4G1IA 5CXTA 2WW4A 1HNWF 4QIFA 1FRHA 4LRFA 1XIQA 2RUGA 1RHUB 1S72S 3QGIA 3N6NA 1RTDA 2F4VF 3MM7B 3LWLA 3IG1A 2ZHOA 3ZTOA 3MPDA 5LSOA 3PX0A 2XI3A 2ABYA 2HS3A 4FYXB 1KR4A 3T1YJ 4CLKA 4IRCA 2JC1A 2VBZA 4OZ0A 6FDRA 4AQYF 2YWGA 1XMQF 4RL1A 5CYMB 1VQSA 2CQBA 1V3ZA 2OO4A 4J9PA 4C3LA 2O1PA 3M2RB 4CI0B 2DNNA 3H8YA 3UCGA 3RAMA 2MY8A 2NUUG 5HP1A 2XYGB 5KT6A 1XEZA 2M52A 2DXFA 2I38A 4FZVA 4LSLB 2HNDB 1FKPA 4WE1B 2LVWA 2ACYA 2N7YA 1EKRA 1NJWA 3N0VA 2LQ9A 3I4HX 1U26A 2G0JA 5A8KB 3JYTB 1RTIA 2GQ2A 2V8PA 3GR0A 4NA2A 1B7YB 5DLFA 1YITS 1U1RA 1RT1A 2KYZA 3KJQB 4V19J 3OVSA 2ZD1B 2MQOA 1HNVA 1KTQA 4KHPF 1UZHA 1RT3B 2NR0A 4J7CA 1F9EB 1LFPA 4F0KA 1EIYB 1HNIB 3OTDA 2ZH2A 5G0RA 2PN6A 4KSEB 2WONB 3QZ8A 2LQBA 3NMRA 4NLGA 4MKYA 3H20A 2OHDA 4OX8A 3RYLA 3FFIB 1CQNA 2GW8A 4X4OA 2DYAA 4ZP7A 5D77A 4NCGB 5D4LA 5GMKa 4ZJOA 3OT9A 1Z4UA 1KHVA 3D6TB 3LA0A 2EKYA 2IVFB 4X4TA 1Q95G 2Y0SD 2DEJA 3MMAA 2WW8A 4Y28C 5ETLA 4PRFA 1A0OB 4GKKJ 2DTJA 3O1LA 4CLSA 2YKOA 2ZH1A 1OY9A 1I94J 3HVAA 5D4PA 2JFDA 1VQ4S 1NSAA 2HHPA 3HI9A 2FGOA 3K8WA 4DZDA 2MSSA 4OX6A 2V2KA 5FD1A 2NXNA 2VC0A 1Y0HA 2KDOA 3HJVA 1WF1A 1FJ7A 2HYIB 1BMQB 1F3VA 2R4FA 1BQNA 3LH2S 4E0DA 1IBKF 2CPXA 1S0MA 5IC6B 2HLUA 3TUJC 2HHUA 5DGBA 4JV2A 1GAOA 1Y3KA 4IG3A 2KHDA 1FKPB 1APSA 4RR5A 3PX6A 4I4BA 5DZ7A 2V2VA 5C2GA 4ZCMA 4LRCA 2RQMA 2RB7A 1UVJA 3LQVA 3JQJA 2IFXA 2UVRA 1RWMB 4TQRA 1CULA 3EDQB 4Q2LA 2W7AA 3U1MA 4YB5A 1AT1B 1C1BB 4LFBF 4USKA 5KG4A 2CNLB 2VDHA 2CYYA 3DFEA 1N0VC 4FBUA 3PJXA 4OI2A 3CULA 1UPPA 4OYOA 5HLFA 2DGUA 4DL5A 5M2UA 1TAQA 1AFJA 2VG7B 4K5RA 1QUVA 2QL9B 2JWNA 5MLCV 1C4AA 2H9ZA 3OTOF 2OPQB 2MKJA 4F26A 3M9NB 2BKOA 1PYOB 4U96A 4C8MA 2HFOA 1ZS6A 5L1KA 5KFDA 2C2DA 4OX9J 2HBRB 4KE5A 2ZJPQ 2KM8C 3TAPA 3FMBA 3IA0A 1YJWS 3OTCA 1F2HA 3MMJA 5ETVA 4RUCA 1GXTA 4U7UD 3A8IA 4QOTA 4BWJA 2ZNZA 3X1LB 2AX0A 2IA6A 2MZRA 1WC5A 1K1SA 3LP1B 4WP8A 2CG4A 1O0PA 2WSFC 3BREA 5HMXA 3U1LA 1U48A 4N47A 4C6AA 5F8IA 3M6UA 1D9AA 1N32F 1UEVA 2V69A 2QFJA 4F3QA 5DDPC 1MMNA 3CDWA 4F2RA 4FYWB 5LMUF 1TKXA 2DJWA 3ISZA 4E8UA 2EC0A 2JNJA 2HS4A 1OPZA 4BS2A 5BXIA 5CYJA 4LF8F 5DZ6A 1RAIB 3RR8A 3DLJA 3MECB 5A2QU 1PAEX 2BABA 1T02A 4Q8EA 3PTWA 4OQJA 1JNZB 2KO1A 5F41A 1LV5A 5EX0A 1S4FA 2VZ9A 1UPMB 2XB2D 1TR0A 3DLEA 4RW7B 3TWZA 1KSPA 1S7IA 4O4RA 2R7WA 1VC6A 1QLNA 2HNZA 3KDNA 3MURP 5K5MA 1LW0B 4P71A 3I87A 3NS5A 3JSMA 4O3OA 4NCBA 1C2PA 2PI4A 3BZQA 1U2FA 1WOOA 1O6XA 1W25A 1DTTB 2FJVA 3FVYA 1XK8A 2BKPA 3QRQA 4DCOB 4RW4A 4ZVFA 4DQPA 3EGZA 1IVZA 1N5QA 4ZCIA 7FDRA 3SIPB 4JI8F 4HL9A 2F5GA 2HWTA 5DLGA 3H4DA 2E1RA 3PFOA 2Y8YA 1RTHA 2Z8QA 3PRDA 4CLPA 2ZC3A 3HSJA 1IM6A 3FEXB 4F0HA 3GFZA 2GQQA 3DM2A 3LPYA 2HVEA 1PBUA 1RI7A 5HVHA 1N5YA 4JI6J 3VGSA 3THTA 2IYIA 3ZZUA 5I4MA 3ZXWA 4XPCA 2JL9A 2IPOB 5HJYA 5C7PA 4Q45A 3KHGA 1TUVA 4F4YA 4ZIWA 3M8RA 2C2RA 1R7IA 3MM5A 2HIQA 4LR9A 1S6PA 4ILMA 5DG8A 4WWSA 4OI4A 3W2WB 4F4WA 3JSBA 4B3SF 5DQHA 2QJ3A 4HHUA 2R2TA 5KG1A 2X1BA 2PEBA 4DL0C 1W26A 3NOCA 2M70A 4DHVA 2R7VA 2ZZTA 2OPPB 3W62A 3D1HA 1PILA 3CD6S 1YGYA 2VFUA 3MEGB 3KDOA 3AA8A 1WEXA 3SSRA 3IWNC 5I3UB 2YNFA 2XWXA 2K7KA 2CPYA 4RBVA 4QW8A 4P2SA 3DLEB 2WB1D 3SCJE 2C3YA 4MIAA 1HFEL 1E6YA 1JLQA 1P1LA 4DR5F 3DN9A 2H1YA 4IRKA 2O01C 3PYEA 2KH9A 5K8MA 2HBQB 4C8YA 2NXUA 4DR3J 2QMXA 1U8WA 2DT9A 3Q8QB 2AGOA 1FKAF 1IKYB 4WXWA 1NMEB 4DV3J 1KHWA 3IAM9 4QWDA 4FYVB 1QAIA 2DO4A 2OD6A 4NLQA 1VCTA 4OZLA 1F2GA 4B17A 1S1WA 4XK8C 4QYZJ 2HAFA 4QIVA 4K59A 1DLOA 4ZVTB 2GC8A 1OJ4A 2EG2A 4HKQA 5D0EA 3H4BA 2JX2A 4I2QB 4IG0B 1U45A 3P5BP 3QLHB 2DGOA 1RJJA 2XMVA 4EWTA 2B4PA 1RAGB 4TQSA 4YS2A 4LF4J 3CJKA 3JTOA 5E33A 2EEYA 4F04B 4QWBA 3M8PA 1RBAA 3FQKA 3ISNC 2DGTA 3N6LA 1UWBA 4MYUA 3KMQA 4IFVA 2FHKA 5KFLA 3A8KA 3W60A 2P9CA 2FC9A 4CCHA 3CJRA 4KV8A 2BV3A 3DOMA 4ERDA 2D3ZA 4KQZA 4MK8A 2PA3A 2J9CA 5KFUA 3QWUA 4RWWA 4DL4A 3OFFA 3TAMA 1HBNA 5HMZA 4C11A 1I1GA 2VFTA 1UA0A 1WDTA 2QRRA 1NJIT 5AXLA 2Y0BB 4ZJQA 4LQ9A 2IHR1 4FYYB 1TELA 3BSOA 1ZTWA 3DLGB 3P8BB 3PZPA 2B3TB 2YXLA 5DG9A 5DM6Q 1RAEB 5A6PA 3QT5A 3T1HJ 4DV7F 4JYAF 4ZPBA 3QGGA 4RNHA 2F1FA 5CH7B 2OMLA 1YBUA 1WD6A 3JTNA 3J7YU 4U9RA 3W5YA 2CQ4A 3Q8SB 4QPTA 4OFZA 3GIRA 3W9JA 2V0NA 2H51B 2XMMA 1X9WA 2QL7B 4LFAF 2XMTA 5H9FJ 2F7VA 1EP4B 1HNXF 4Q2MA 1E6YB 1N36F 1YHQS 3FBFA 5IM0A 1B3TA 5HI7A 2AJQA 3UDCA 3FDSA 1XNRF 4ELVA 4ZVUB 1SC3B 4ZP9A 2C3MA 3T41A 3BN7A 3VAKA 4DR2J 3EVOA 3NXZA 4WK3A 3NNCA 1JX4A 3CC7S 1UEKA 1JJHA 3RUBL 1S1WB 3KJNB 5I42A 2K3IA 2RJZA 4OZ1A 4RZRA 2J7KA 4ZIVA 4OHZA 4OYXA 2XSFA 2CQGA 5ETPA 1YTYA 2CPEA 2CUYA 4RBUA 2QV6A 5E2QA 4XO0A 3MMCB 2VDIA 4ZLLA 3QJJA 3CJKB 4WJBA 2L9DA 3LUYA 2UUBJ 5HK4A 4QBUA 4AYBD 2GAGC 3M8PB 5CA5A 1R0CB 2OUGA 3FEYB 3OHBA 3POTA 1TKTA 4PZVA 4ELTA 4Y34A 1UW4A 3KG0A 4IFVB 1NNDA 1R8PA 4TY8A 1S6OA 1RTZA 2E5LJ 5FDLA 4NLTA 4JI0J 1S49A 2X1FA 2Q6BA 3PW0A 5GAHU 3OQ2A 3UD5A 3P6YC 4V19X 2HLTA 1TZ0A 2ZWPA 4ETZA 2RMLA 2B5JA 1FT8A 3OL6A 2BRKA 3ZZ0A 1HBNB 1CJVA 3MM6B 1VLYA 1QJHA 1S9GA 4LIRA 3DKDA 1C0TA 2A3JA 2I5JA 5J2NB 4PR6A 4QCLA 1MROB 1KFSA 2GA7A 2XCAA 2DNPA 3RBZA 2ASYA 1P8GA 2DXDA 4OZJA 2UXCF 3QGPA 4PCQA 3HFKA 3N28A 1RAJA 3KG4A 2AF6A 3D5MA 2RRBA 2LP4A 1M5PC 2KFZA 3JB9k 2B4VA 3UCUP 3SFUA 3PVXA 3TUPA 2PFFB 1CC7A 2DGXA 1QM9A 2YX4A 2DGSA 4P2MA 2F3JA 3Q8VA 1GK8A 1VRTB 2ZJQQ 1IBCB 5AE2A 4DUZJ 5IM0B 3AY0A 4I6WA 1UEUA 3QJLA 1FVQA 2ZH4A 5KOWA 1HW9A 2HPUA 2QA1A 2W01A 1UW9A 5ETRA 4OHVA 4JI3F 2E1PA 1TVRA 4EFAC 1NSPA 3DDKA 2ZH9A 3TR5A 2HNYA 2AZ3A 1T0TV 4WP3A 3G4SS 4RPFA 2V67A 4CDIA 1XERA 5KFAA 1FDNA 4TU8A 3HKZD 5A0YA 4ZHRA 3W5ZA 4USIA 3DRXA 1X9MA 3O6QA 3B82A 3OL7A 4J37A 1WUUA 2HFVA 5J2MB 3T9ZA 1DY3A 4ZLPA 3N9UC 1O51A 3B6BA 2LXIA 4KO0A 2DIUA 4J9OA 3ENVA 1RHQB 3OBIA 4P6QA 3D1QA 1B0PA 3G9CA 1FESA 4IQMA 4X62F 4A8MP 2B51A 5KG0A 1TKTB 2F63A 5F9NA 3RRKA 3MM9A 4A8OA 2NXJA 2DHGA 1D09B 4HH0A 3OVAA 5FDLB 1WKLA 4YHHJ 3CCES 3G2XA 2DNMA 1QVGR 2Y9HA 1EQMA 5F8JA 2R2SA 3CCVS 2H5EA 4BDPA 2CPIA 2B5JB 4HYKA 4N8OA 2NZ4A 4FVCA 2L9NA 4H4MA 2IY5B 1HNZJ 2P6SA 2M7SA 3PYFA 2KU7A 8ATCB 1HNWJ 3HHLA 3H2VE 1DBDA 3E2EA 3THPA 4R5PA 3IRXA 2I5JB 2X3DA 3C15B 4DLGA 1BWVA 3HJFA 3PACA 4UOHA 2ZH6A 2IJNA 2OKQA 1S97A 3AQPA 1WOSA 2E7XA 1XR7A 3IP0A 3IM8A 4F4AA 1CS4A 1FTCA 4DJBA 2RS8A 5KFFA 2H48B 1GMWA 2J0SD 2OFGX 2VQFF 5JMNA 2H5JB 1U02A 4UW2A 2GNKA 3PJ9A 5AJ3F 1XMOF 4U67Q 2ZZNA 1BGXT 4G1PA 2YNIA 3BYRA 2RS2A 5GAEU 3VHQA 2EFVA 5AXKA 2XHWA 1N48A 4K7QA 3QAEA 1N0UA 5KG3A 2DNLA 4KHMA 2JVRA 2Z30B 1FJGF 2YNGA 1EARA 3H42A 5BYRA 4ZVHA 1HBUA 5B08A 4K4UA 4QWAA 2HNYB 3B8HA 4RNMA 2DPJA 4O0IA 4QU7A 2KVQE 4DR6F 2UUAF 5THWA 1LW2A 1NK6A 2E1MC 2EFOA 4H4KC 5A0YB 4ZHRB 2UVWA 3DYAB 3Q8RB 4CO3A 3CCJS 4DV5F 1Q16B 3M2VA 1NRKA 5KFOA 3CJSA 2KKHA 4PQUB 3C19A 1NCLA 1U1PA 2XGQA 3D6FB 3NG8A 5HO4A 2C22A 3Q89A 1VQLS 2BOPA 2ZDPA 2MSTA 3KOAA 1K73T 3MR2A 4MKAA 5ETOA 3GV8B 1D0EA 4F4XA 2BM0A 3BKTA 1SC6A 4F25A 1QTNB 2FUG9 3QRRA 4I68A 3GE9A 2R8GA 5LM7E 2D74B 4BC9A 1H7WA 4N76A 1EETA 1N56A 2IAJA 5B0AA 2D69A 2R7UA 4NXNF 1W2IA 2CJYB 2BE9B 4L76A 4DBQA 5CHCB 4AUKA 4YUDA 4W90B 2CJKA 2DNRA 4P73A 5C42B 4RWXA 5KFEA 2PT0A 1IKWA 3QFHA 3HHLB 2COLA 5A6WA 1U25A 2K7JA 3H5XA 2XGPA 2RRNA 4DSFA 3TVZA 3WBZA 2NUHA 4NWBA 2A2CA 4XAKA 3GSIA 4B9TA 4DL7A 3D7SB 2IVMA 3GFYA 2HK3A 3R6LB 3T5HA 3DHXA 3RRHA 2IRUA 3W8GA 4K4ZA 3DGPB 1Y5NB 1REGX 4ECRA 2CQHA 4DV0J 1FHTA 5L9XA 1NPPA 4CLFA 2QN6B 1LK5A 2ATLA 3MD1A 2C3OA 3J81U 2YNIB 5GVQA 3M6WA 1H38A 4CWBA 5HN0A 4ES3A 5LXYA 4RNNA 4C2MA 3CTRA 1IBKJ 3A3NB 3HVWA 3HVRA 5J1EB 1HBUB 3GJQB 1X0PA 3AD9C 5ETQA 4EO6A 4LSNA 1CJTB 2M2BA 2YKNA 2LQ8A 5CD4H 3C3LA 4DR1F 3F56A 4Q7AA 1U4BA 2I2YA 3DRSA 1RK8A 3P3DA 2V6AA 1S1XA 1R8HA 3K58A 3BGFA 3DDIA 2W9CA 1KRPA 3IFEA 4OV1A 4LFBJ 5KT4A 3TJ9A 2IC3B 5KFWA 1YWXA 3GILA 2VUGA 3M9OB 2WOMA 1HHTP 1TKDA 3VAIA 1VK3A 5LMNJ 4C98A 1UVNA 5J2QA 1OPIA 1WG1A 3NWRA 1IBLF 2H54B 2QX0A 4MKBA 2E7WA 2LEBA 3BDPA 1RT5B 1U1MA 3NS6A 2RNEA 3OTOJ 3EWGA 4UY85 1EETB 4DPOA 1LWEB 2LLZA 1YLXA 3VF0B 2FDNA 4F36A 3AOCA 2ADBA 1MN9A 2XMAA 2PFDA 2OEKA 4KAIA 4ED7A 4F0MA 3AB4B 5DDOC 4LF9F 2MGZB 1QY7A 4C0BA 3MMBB 2CJQA 3TP2A 2AJ0A 2QYGA 1V9OA 1RB0A 3NY0A 3D3CJ 4GO5X 4DFMA 1N32J 4KGZB 2DR7A 3BBBA 4NASA 2ZDOA 3EZ5A 3D0IE 4N5SA 5LMUJ 3DU5A 4X65J 2FLOA 3A4TA 3GIMA 4JV5J 4CTAA 5LJ3Y 2BQUA 3ENAA 4LF8J 1RLCL 4LF2A 3G6XA 2QZ8A 4LF1A 4HTJA 2G13A 2W4CA 3TO8A 2DHSA 3J81j 2C2OB 3WQPA 5KFVA 2VQEF 2BQRA 3AH6A 2V50A 2KG0A 4ZLNA 4ZCLA 4B9MA 2HFUA 2WBMA 4A47A 2ZZMA 4PG4A 4IOAQ 4NLVA 1JLEA 2V4RA 3LOUA 4Y00A 3H25A 1H2TZ 2B9YA 4Y2AA 4NYZA 4DFJA 1XC9A 3V4IB 3P45B 3FC9A 3OVBA 5HAOA 4LSNB 2OGUA 3PKYA 3R6GB 3BH7B 2YNHA 1Q81T 2POKA 3TX0A 4AXJA 1L3TA 1NAQA 2LECA 4DV1J 1S1XB 2L9WA 1QVFR 3T1AA 3QMQA 3WZ0A 2AT1B 1KKHA 2IM2A 3I6PA 1RA7A 3TANA 4H54A 5FLXY 3MF5A 2Z58B 4URQU 3QNWB 2J6UA 4QR2A 1RBOB 1SIWB 3M9MB 1TK0A 2E5GA 2E9RX 2JLFA 4L3KA 2HHTA 2P6TA 3ET6A 3D54A 4OYZA 4CO1A 1KNZA 1U09A 3GFHA 3SV3A 2XZDB 1XR5A 2RRAA 3KNGA 4WYLA 1U1KA 4RKUC 4F3OA 4C8OA 3C14A 2BACA 3I31A 2CQ1A 1HYSA 4MH8A 4QYRA 2VFRA 1JJ4A 4NLYA 4PG8A 2V8VA 1FXLA 4ATNA 1U1OA 3U1NA 3D68A 4B3SJ 5KTQA 3MR5A 2IDLA 3W63A 2EKNA 1F0XA 4ETXA 2ZE2A 5ETNA 1LWXA 2PIIA 4FF1A 1AYEA 1HQUA 1VBKA 3DOKA 2HVIA 4ZK7M 1HMVA 4CTAB 3BR8A 1J5EF 2H4YB 1O5JA 2BXJA 4OYMA 1M0SA 3SYZA 4K2XA 3BF4A 1T9XA 2RU3A 1WSRA 3TVKA 1JKHA 3MPYA 3LAKA 3MEEA 1YJUA 2AEMA 3BO3A 5DJBA 5HQ8A 1RT2A 4IQXA 1DQ9A 2UVVA 3RAQA 4HHHA 1WF0A 2RD5C 3ZTQA 2CXEA 4GVLA 1BHNA 2CADA 1IKXB 1JXEA 2I6WA 4B3MF 2MDAA 4DR5J 4MFBB 3BGUA 3GG1A 4TN2A 3UN5A 4I64A 3PW5A 2WK4A 2B7BB 1Q1KA 1B4SA 2E7VA 3CO0P 2XC9A 2YNHB 1IJFB 2WSCC 4NI2A 2MKIA 3RZAA 1IR0A 2N4DA 4NEYA 4Q0BB 1QAXA 3KLHB 2JZ5A 3FJ2A 3T6JA 3FMWA 1C1CA 4ZS6A 3SSSA 3BDEA 3GIIA 3PY8A 2N7CA 2CWKA 3EXCX 3VVTA 1G6BA 2CNNB 4DV2J 1K9MT 3T3FA 2KN4A 2OEMA 4O0NA 1VQ6S 2RDIA 3OL9A 3IRWP 2AEJA 5LOQA 2AYGA 4FKXA 3VAJA 4CYUA 1UTAA 4DSJA 1M1KT 3J7YI 2I1RA 3QBCA 2DKOB 2RQKA 4AXIA 4EYIB 3A8EA 4FYDA 3CCZA 2MKHA 5CYQA 3PR5B 4J9KA 2MY7A 4O44B 1V3RA 3NKYA 4CIOA 4WIQA 1PSDA 4KPCA 4A48A 3KJVA 2OELA 5F3TA 2YQ3A 5LJ5Y 2RKIB 3RW7A 4C0OC 2SXLA 2DRAA 3NP5A 1IWGA 2R8HA 4R8UA 1Y11A 1YQHA 1OMSA 1FX4A 4M63A 3D6MB 2WAQD 5BYSA 3MAHA 1PGZA 1YJNS 2PDAA 4HLBA 2WCXA 4K2JA 2ZE2B 5F8LA 1EJ7L 1RKJA 3CF5Q 3SQGA 2Y1JA 4B3OA 1HQUB 2UU9F 3TW0A 1PJ5A 1BLUA 1N5SA 3DOKB 2LEPA 1OSDA 1WF2A 2UXBF 1HMVB 2ZOMA 2B8PA 4ICLB 2BJ9A 4TXSA 4KKOA 1KOHA 1FWLA 2UV8A 5JJBA 4DV7J 1AZSA 3MEEB 1IR2A 4WU2A 5C24B 1ZETA 3VALA 2KXFA 3G82A 1Q4RA 1FJEB 2XYPB 2VV5A 2IBKA 3MR7A 4M95A 4O3NA 2HKEA 4RJVA 4RUHA 1KC8T 4M5MA 1HNXJ 2IRXA 1N36J 1YJTA 2LXFA 5GAHI 1X5SA 4DQRA 4KGVB 4EGLA 3BJYA 2JRSA 4BLGA 1XNRJ 2PA8D 2GHVC 2VF3A 1XQIA 1FXRA 4ZVOB 4ZVQB 1RHMB 4ED2A 1Y5IB 4BBYA 4O23A 4NI2B 4G6VB 1RWXB 3V81B 4LF5J 3MFHA 4MIWA 3MM8B 2R9LA 2GJ2A 2KB2A 1RAAB 3OW2R 1C1CB 3M2UB 1VYAA 2VJVA 1ZPWX 1KVJA 1X5PA 3VAFA 4M5NA 3L7OA 2W4PA 3Q83A 2ZBIA 1TK8A 4Q43A 2DHXA 4U8VA 1L3UA 4I7FA 3VAGA 3TX8A 3UD4P 3JXOA 1FK9B 2GGPA 8RUCA 2GIQA 1F9FA 1WORA 1WNEA 1HLWA 3TJAA 2X1GA 2AZ1A 4FXDA 2E1AA 3TZXA 3IAS9 2CG8A 5CYQB 2HZAA 3H0PA 1TL7A 1C0UA 3RTVA 3CSKA 3R9LA 5EWEA 3EVMA 1ELOA 3KJVB 3EDRB 2VC1A 5SUHA 2BE2A 3NMAA 2DR6A 4EBDA 4CQ1A 5I3PA 1J5OB 2BJDA 2F8HA 1L3KA 2O3DA 5F8HA 1TKZA 1UL3A 4QR0A 1U24A 1JLFA 1N6QA 4FKYA 4UQTA 4R8UB 2B6AA 1KLNA 4MMOA 3R5BA 2LXUA 3GCWP 3OJUA 1QUPA 5IFMA 3D4JA 2RT3A 4GO7X 4DUYF 5A8WB 4A8SA 2MHEA 4WFYA 3RR7A 4CRJA 3SQGB 4B3OB 3R5GA 3AJ2A 2YKAA 3DOLA 4KIAA 4DF4A 2JC0A 1E6VA 4LBPA 3H5SA 5D4NA 1RYRA 4TYAA 4Q8FA 4A8QA 1ZM9A 3ZFVA 2Z2YB 4UTGA 4M5DA 4KKOB 2FJWA 4O3PA 2QLXA 2ZM6F 4K4YA 1WC0A 2LMIA 1AZSB 4JI2F 1JLBA 3PHTA 5C25A 2VG6A 1RTJA 3ITHB 3G82B 3CIZA 3CWJA 5KFXA 4NLDA 1B7FA 3K5OA 1TL4A 3VAMA 4EK2A 2MHNA 2C42A 1U0HB 1Y00A 2DPIA 3TQEA 4WYWA 1AB8A 3H2LA 4OYIA 3TA1A 2DO0A 4DG1B 4AL5A 3KK2B 5KFZA 1YBTA 4OYWA 2LA6A 1CJKA 7AT1B 1HBMA 1GFWB 1B0VA 3C16A 4P9SA 1IBMF 3TA0A 3EJMA 2NPIA 4LMZA 1K8AT 5EHHA 4F8RA 5A76A 4ES2A 3BGRB 1BWEA 2HQGA 3VV2B 1LXNA 1CBKA 4P75A 4CO4A 1W2BR 3UD3P 5H9EJ 1SUQA 1MMDA 1FFWB 4K4VA 3F41A 5LXRA 2CJBA 1HQEB 2EC2A 1IM4A 3DXBA 3PCOB 4CM2A 3IC1A 3C8YA 4UF4A 9RUBA 3M6XA 3MEKA 4Z2XA 3OLAA 4YDDB 4YEAA 2X1AA 4X62J 1FA0A 4ZVSB 3IXQA 1DURA 1Q7LB 5GAEI 3K8VA 5B0GA 3DMJB 4ZOSA 2OPRB 3OPKA 4HH1A 4DL2A 2OEJA 1ZH5A 4IDKB 4EZ6A 4ED5A 2HBYB 2GVZA 5K8PA 5RUBA 3UPFA 3HSGA 5KG7A 1ZA2B 1WKJA 2G0IA 1RWPB 4RW6B 1T05A 2FY1A 2QSWA 4J9MA 8AT1B 1FDAA 1R43A 3KKFA 2KT3A 2EK1A 3A8JA 3BQ0A 1N8RT 3MR6A 2J0XA 3GR1A 2CJAA 3LAMA 4RNOA 4ED4A 4M5DB 3VAHA 3SXLA 4R25A 4F02A 1VQ9S 2GMHA 3BSAA 1KDNA 1ZTTA 2RU9A 4WP9A 2E66A 2EPIA 3EUNA 4DL6A 3HHNB 4OLOA 2VQFJ 1ZM4A 2OPSA 3M7VA 4Z7YA 2DXEA 5AJ3J 1D3WA 3PRBA 3TEHB 3HPOA 2MQNA 1KQFB 2GAHC 2XS7A 1DFDA 1FX2A 3W9HA 3HMJG 4X84A 3VZHA 5D0RA 2MEWA 3LP2B 5C5JA 1HL6A 1CJKB 4K50A 4YFUA 1FJGJ 4I67A 3R7SB 1UJ4A 3C16B 2FC8A 1TMMA 4Z7CA 2BJEA 1XNQF 4C8LA 3BPDA 2V2QA 1MU2A 1FRMA 2PMZD 1S0OA 4DR6J 3NCRA 5M2PA 4PPDA 2LA4A 2CQDA 4JBCA 1G3OA 1NB7A 4E98A 3DLBA 4PAAA 1F5BA 1AUDA 1R8BA 3CJ5A 4KBIA 3HZGA 2AU0A 2FLNA 2KZZA 1HBOB 1FVSA 1KVIA 1ZA1B 2VG5A 4NA3A 1NZ8A 2Q43A 1D8YA 4WKRA 1S59A 3OSNA 1MLAA 3GV5B 4U7UK 1NEEA 2UUTA 2W9BA 2C2ZB 4OZ5A 2ZNYA 3BGOP 3QAUA 1MWQA 3O5TB 2P5VA 4JB8B 3L4BC 3UDLA 2CQ2A 3JAMY 1MNEA 3RBEA 3CD7A 4WTOB 2BRLA 1VQMS 2ZOGA 2GJIA 4TYBA 4MYTA 3PIOQ 4PWDB 5HSPA 3RGIA 2QEXS 2YX1A 4TU9A 3MDFA 3OXLA 3V6KA 3T9NA 2XY5A 2VJUA 1S4EA 4UUWA 1XBWA 2MQLA 5IT9U 5EN1A 1TL5A 1V3SA 3S01A 2H4WB 5IZHA 3ZTPA 4FXVA 2FHOB 3M32B 1T05B 4GVBA 3CCTA 3KWMA 1FKOA 4RW8B 4X66F 4OX7A 4W4MA 3SDEB 5GAGU 1T95A 1G2EA 1I94F 4WFZA 2RDDA 4JI7J 4D3GA 1T94A 1GTEA 4USJC 4WCEQ 3SV4A 1NJXA 1U2CA 2MMYA 1DHMA 2HFZA 4J9VA 1NJZA 2MYFA 2ZH7A 3I0SA 2EVZA 2RAQA 4FS1A 1TFWA 3HVTB 1VI7A 2JOQA 3Q0AA 1BQMB 3KLGA 1QD1A 4DX8H 2BBEA 3NS7B 4S0MA 5KOXA 2AJFE 2K3KA 4LJMA 2BX6A 2WVEA 4FF2A 2QLFB 4WFXA 2BYCA 4URGA 2HWHA 1Q82T 1FTRA 1Q8KA 2EG1A 5B0EA 5K9FA 1VHFA 4TKTA 4USHA 1WOPA 1X9SA 4O4GA 4DCJB 1MU2B 3EGVA 2XS2A 1TQLA 2VICA 3FSYA 1VQPS 2IYGA 4DSIA 1SIZA 4ES1A 3MR3A 1R8AA 3HCXA 1XMBA 3KK3A 1T03A 1PC5A 4ID5A 4CM0A 2NCKL 2GHWA 1QE1B 3M8ZA 3KHHA 3CVKA 2AGQA 1KVKA 1HQ2A 3KLFA 2IBOA 1TU0B 1TTHB 2HHVA 1IN0A 2AKWB 2R8JA 2W9BB 5K20B 4BHQA 1R6VA 1GQEA 2AJ1A 2HQCA 3DLLQ 5D3GA 1A9NB 1I51B 2M3DA 4TNOA 4FDFA 2KG1A 1RWKB 3NCQA 1IBLJ 1YI2S 3TZWA 1LWFA 1S9EA 1UFKA 1X4HA 4DXLA 4J5OA 4HDGA 5T7LA 5KFJA 1NH8A 2QLWA 5LT5A 4NA1A 1AFIA 2FZCB 3PX4A 2FVPA 2F9JA 1RHJB 1P9QC 1NO8A 3GG0A 1Q0NA 2FLLA 2FD2A 3D1OA 1RTDB 3Q23A 3SI8A 1Z2ZA 2QYCA 4YQWA 3ENWA 2JHEA 1SV5A 3IG1B 4O3QA 2CRLA 1DJ0A 1TL3A 2XI2A 2XM3A 3L3CA 3AXKA 1HI0P 3ZZYA 4ANCA 4GVBB 2XULA 5DQIA 2ZC4A 3F0NA 1DQ8A 2QG9B 2QLJB 3AOBA 4F4KA 3OTBA 1M1GA 4KGMA 3AODA 1S76D 1FI4A 2B9XA 4LRDA 4ECXA 1A7GE 3W2VA 4DN9A 3BO4A 1SPBP 1FERA 1L3SA 5HP1B 2YPYA 2CVEA 3I0SB 3T6BA 4KFBA 4UZBA 5KFPA 2F40A 1R6YA 1O8BA 3JSRA 4U7CA 1SXLA 1VQOS 1URRA 3HFVA 2QC3A 2EFGA 2BW7A 1WC3A 2R8KA 3C46A 3VZIA 4OI1A 3KHRA 1FE4A 2UZAA 3CT9A 3DGVA 4C4WA 2ROGA 1X8DA 2XBPA 1NDPA 2H65B 1KOOA 2QGFB 1G4CA 3G8TA 2KFYA 1RTIB 3FNNA 3IBWA 4J9UE 4P10A 4B9NA 4OZ2A 2AHOB 1RXOB 2MZTA 4DX5A 4DN0A 1ZZFA 1RT1B 3HKWA 4NRUA 2E5IA 4OJ1A 1HNVB 2DISA 3KK3B 3FBEA 3MHYA 4ID5B 1H2VZ 3ZZOA 2ZHAA 1LK7A 3D67A 4CZCA 1KWMA 3KLFB 1LWCA 3LGNA 5G0RB 2KVIA 3I96A 1VQ7S 2HQ3A 4CLTA 2W2PP 3PO5A 5KFQA 1K44A 2UUCF 1KQSR 4ECSA 3LP0A 5HROA 4TLRA 1N34F 5L9NA 1SI9A 1X5OA 1PBAA 1AUSL 2QO3A 3AJ1A 2WRMA 1LXJA 2ASJA 4ZVRB 1JMTA 5HBMA 4WU3A 2Y1IA 1IKVA 1LWFB 2YPZA 1S9EB 5IT4A 2NQPA 1H72C 1YK9A 2J8SA 1HWLA 2WZ1A 2MLXA 5T7LB 2DHHA 3IS9A 4I0WA 1HARA 1SH0A 2CNKB 2J5AA 3BSCA 1JLGA 4M5IA 1JIHA 3MMAB 3MI7X 2Z57B 5IV4A 3GSDA 5KT5A 4RU9A 4NOHA 3GYGA 3BBFA 3FRZA 5F0WA 2GIFA 5A8RA 2Q3PA 1SJ4P 1FXDA 5EX3A 2XTJP 1U0SA 2ZUGA 3CJ8A 2XCPA 2OTLS 4F50A 2R7TA 2W24A 1OSCA 4A8FA 4DLEA 2HVZA 1YZ6A 4K8RA 1FNOA 1VRUA 3PDNA 4TU7A 3FUYA 3NEKA 2ZOFA 2ZFHA 2OSQA 3UVJA 1M5SA 2EK6A 2GS8A 3O44A 1J5EJ 4F3MA 3RBDA 1GTHA 3J80U 3RU0A 4PPZA 1H0HB 1NU4A 1BQNB 4X4UA 1OWXA 1T8EA 3NBPA 3CCLS 2BQ3A 4YR3A 2VA3A 3NGDA 2K1RA 4NLRA 4B3RF 5E5NA 1YJ7A 1SL0A 1VGYA 2CZ4A 4IG3B 5EWGA 4FXWA 3L95X 1BXNA 2QA2A 5DS7A 1Z1ZA 4DR3F 2LCWA 1EB0A 3OR2A 4B3MJ 2C2NA 2QLBB 1NBEB 4DR4J 1SL1A 4B3TJ 4FPRA 1CULB 2J9EA 2OIHA 4YMEA 2ZVSA 3R7NB 2ZKTA 1YRTA 5B0CA 3I5CA 3EZUA 4DWIA 4K5SA 2GVDA 4NEZA 2ZHBA 1TL1A 4X64F 1S48A 3BSNA 4MK9A 4TY9A 2ALYB 5IQQA 5HLFB 3TUZC 1JLAA 3P96A 5KG2A 1LWCB 2YX7A 2J9DE 3FCVA 3OUYA 4PWWA 2I8EA 4KH0B 3G8QA 4ECWA 3LP0B 3L9ZA 3VR1A 1OY8A 1RBLA 3R3TA 1NK8A 4DS5A 1VC5A 2VODA 3N01A 1U1QA 5AT1B 5AXNA 1U49A 3AFGA 1UMJA 3IS9B 1WTFA 3RW6A 4LF6J 3G6YA 1WHWA 4Y65A 2BDPA 2YY3A 5ETKA 2GX8A 5A8RB 2OAUA 5E3AA 5CABA 3I56S 1TKXB 1XR6A 2LDYA 3CJ0A 4CO5A 3QSIA 1JLCA 4HT7A 3RRGA 3IO1A 1TK5A 2YKMA 1RWUA 2W2OP 2WVFA 4R0EA 5M2RA 2UU9J 2GZOA 4HHJA 1WWHA 2DITA 3T1HF 1D1UA 5KT3A 2UXBJ 3QSYB 4BCAA 3QT7A 2BZ2A 4F67A 2HSEB 3QATA 4OZNA 3UQSA 4LVOP 1U1NA 4UY8T 3QO9A 4ANDA 4YY3F 2GCFA 2HNZB 1MN7A 2XLJA 1WI8A 3FEZA 2K1RB 5CZXA 1S6QA 3AT1B 3ZZTA 3HO1A 3QIPA 4L6V3 4WPAA 2C2EA 3IWLA 3JSMB 5D78A 2PO4A 4UUXA 4Q44A 3W1YC 4DV4F 4ZPAA 2O66A 2HMIA 3S8SA 1RYSA 3PV8A 3F73A 1T11A 1WEYA 1UFLA 1WG4A 4RW4B 3TNVA 2HQDA 3PXGa 1W7WA 3KXDA 5BR8F 4PKDB 4QW9A 1SH3A 1VC0A 3ZNJ1 3M30A 2MKYA 3OXGA 2KRBA 4NL5A 4DPUA 1RTHB 3NNHA 4JV0A 4DF8A 3EZOA 3RB6A 1JLAB 3P49B 5B0DA 2JSXA 1FNXH 2C1EB 3DM2B 3C6UA 3WX8A 4N41A 1OS5A 2A1BA 4DSLA 1N5YB 1BUXA 4PYAA 5KFSA 1YBAA 4I2PA 2UUBF 1NHUA 3F44A 3O2IA 2V5HG 5KFHA 3HLUA 3PR4A 4RW9A 2KHCA 1S0NA 1RABB 3MM5B 3CGIA 4XTTA 2G1HA 1S6PB 3NGKA 4JI0F 1FD2A 3KUHA 3CNQP 2J0WA 2IM0A 4ILLA 3QPIA 1LOUA 5F0UA 3RB0A 5KG5A 3LO3A 3N4WA 3SQOP 2LQ5A 4YDXA 2D3UA 4ECZA 2KXHA 1LFWA 2V4QA 9ATCB 4DUYJ 1IQTA 3MM7A 4L75A 1ICEB 3MUVP 3LGMA 4LBHA 2YNFB 1RKIA 5A2QY 2VB6A 2IM3A 1Y7PA 1FRIA 4EMDA 1RHRB 3PIPQ 1PG5B 4C8KA 4G65A 3UW1A 2B4OA 1U1LA 1R0BG 5CYMA 1R0AA 3Q22A 3QO9B 4ECTA 1JLQB 2ZM6J 3M2RA 1MW7A 4JI2J 4WFNQ 3DRYA 1RHKB 3NGTA 3MUMP 1WHVA 3PYGA 3IBFB 2Q66A 3R1HA 2BEFA 2X51A 4M5GA 1RISA 2R2UA 3PEHA 3ILLA 2LU2A 2A18A 3A13A 2W2MP 4ZPTR 4HI1A 4WE1A 2ADCA 4NZ6A 2NSCA 2CZ9A 5AXMA 1Y10A 4MT1A 2WBRA 5J2PA 3TZYA 2YTCA 1HA1A 5D15A 1DLOB 2GJFA 4IH7A 4P74A 5A8KA 1QSLA 4ZMMA 1VK8A 1CVJA 3JYTA 3M30B 2E1CA 1Y4ZB 3ADAC 2MLZA 3E8OA 2ZD1A 3C6UB 2DCUB 4FS2A 2G4BA 4KGXB 1U47A 3G96A 1RT3A 1UWBB 3PO4A 3R2CJ 2VFVA 1HNIA 2MZJA 2DNGA 2Z2MA 4OL8A 2R7RA 5T41A 1GH8A 2DGVA 4KV8B 3HXMA 1HHQA 1NK4A 5B7WA 3VWSA 1VRQC 3VGUA 2OD4A 1RDRA 3DOMB 1B70B 4LREA 3CDBA 1CJUA 3GLJA 4NCGA 3TAMB 3DLKA 2ROPA 1H6KX 4CNZA 4B08A 2CPJA 1CPZA 4C11B 1U6FA 4GMKA 1HNZF 2AP6A 1Q5VA 3SCLE 1ZYQA 4WZMA 2XNRA 4LT6A 3IWXA 3OLBA 3HK2A 1FNMA 1FE0A 1PYTA 4CH0S 2PI5A 2XS5A 5G4DA 3HULA 2FHJD 3UR0A 1RCXB 2F9DA 1CLFA 3BO2A 3KLIA 4HVZA 4RUBA 2XSJA 3GB0A 4OMFG 3TEGA 2W8KA 2HAIA 2PSZA 2XO6A 2PD1A 2FZGB 3KFWX 1URNA 3UN3A 4NXMF 4OI3A 4CLYA 3WHIA 1R0AB 2DY9A 1TMJA 2FVRA 4URSA 4QJVA 3BV8A 4PXDA 4NE9C 2HHQA 2CJ9A 4AT1B 5DRKA 2HHWA 1RUSA 1HKAA 2B9WA 3OFHA 3A3OB 3CCMS 4ZPWR 4Y0FA 3FGVA 4WK1A 2M8HA 3T5LA 2N82B 4Z37A 2OTJS 5FJ4A 4DPXA 4WF9Q 5GADU 1TUGB 5D0GA 3WC2A 2BJ7A 3US5A 3BPSP 2ZH5A 1K47A 5J2PB 5I42B 1DAXA 3CC4S 4WFAQ 1XNQJ 4A4JA 2CJXB 2K8GA 2A2DA 2XLKA 2EW9A 5GAGI 4X4SA 1C1BA 2XZWA 2QFIA 3LALA 3HDSA 1FF2A 2HURA 2AGPA 3DU6A 2XEXA 1SJFA 3TUIC 2XZTB 4M5LA 1HWKA 2C2KB 3I4PA 1PJ7A 2CWXA 3POTB 3MAQA 3CJTA 2LYVA 3N6MA 1M5HA 3I5BA 4TY8B 2R7OA 4C8ZA 2VG7A 2KTQA 4X4QA 3A1YG 1SJQA 1VHIA 2HVDA 2OPQA 5H1SV 3HHKA 3QFWA 2W7OA 5HL7Q 1Y3JA 1RSCA 4Y6IA 4JI4J 2DNKA 5EWFA 2QIFA 2EI5A 5J1PA 3MWBA 1CJUB 4EBCA 1WDDA 1X4FA 2KJVA 3DLKB 1CJVB 1ULRA 2OP5A 2ATCB 2XMWA 1S9GB 1IWAA 2IA0A 1RAOA 1C0TB 1N5TA 3LP1A 1SCJB 3FSIA 1V5IB 5DG7A 2ASLA 2F4VJ 5E0OA 3D9BA 3BH6B 2FVCA 2G2YA 5F9LA 7FD1A 3BB5A 3QGHA 3KHLA 1XN9A 3KLIB 2XSJB 2EBGA 4X66J 3H2UB 3OJSA 2NSBA 4DOZA 2B43A 1X4GA 3OL8A 4AQYJ 3H5UA 3MECA 1XMQJ 4QR1A 4DV0F 2CPZA 1S1UA 2J0QD 3RAXA 3IN5A 4KH1B 2RQ4A 2KRRA 1H7XA 4RW7A 3M6VA 2ZH3A 1NHVA 3C66A 1TVRB 1WSVA 4B02A 2AW0A 1YZ7A 2E29A 1CC8A 2Y1RI 1LW0A 4NRTA 2AEFA 2VONA 2QE5A 1H74A 2F8EX 1DTTA 3HM9A 4XDDA 5KFYA 2FY8A 3TJ8A 2QT7A 3W3SA 4KO0B 3FZBA 2MKSA 1M5VC 5L39A 3I5AA 1ZM3A 4KHPJ 4QYZK 5CQGA 2C2MB 4USVA 3EPIA 2CVIA 4FF3A 5HATA 5LSRA 3ZO7A 2NYIA 1AROP 3S6EA 3GYNA 5B0BA 4ED3A 3K0JA 4CO2A 5LMNF 3PG9A 4MTPA 4PABA 3K59A 3MM9B 3ONQA 2UXDF 4FN5A 3H90A 2V63A 2HGLA 2N3OA 4DMZA 4I6YA 1B99A 3L7UA 2XG8A 4YR0A 2P9GA 2WVBA 2VHGA 3TAQA 2J76E 2QMUB 2V9KA 4ZPCA 2MXYA 2HGMA 1FO1A 4DPYA 2O5DA 1X60A 4H4MB 4OIXA 3OTEA 4B9UA 3FBCA 4YR2A 4JI5F 5T14A 3MXHP 3BM7A 4R5PB 3IRXB 3W2WA 4XDCA 2MZ1A 2VU5A 1N33F 4L73A 1RU2A 5IS2A 4IOCQ 4U8YA 4ZJLA 5AE1A 4C9DA 4CLZA 1REVA 4HACA 3M1VA 4J9RA 1AA1B 2AJ2A 3NGSA 2VIHA 4X65F 3I9V9 4I6AA 4JV5F 1CS4B 4ED0A 2OPPA 1GMUA 2DCLA 3MOJB 4PXCA 1MMLA 5D0HA 3MEGA 1RZMA 4J90A 5I3UA 4EBEA 1S1UB 2FYXA 2D9OA 4NX9A 3K89A 3JTPA 1UFWA 1PO6A 2BMBA 3K5MA 2ACMA 2MKCA 3W8PA 2A6OA 4DSKA 1S5ZA 2HGNA 2YWEA 3QIDA 5KFMA 3HD1A 4OHXA 2YNGB 3CJQA 3D0GE 3R5JB 5H9FK 1VQ8S 3GONA 4A46A 2ZBPA 5KG6A 3AJDA 3R5AA 1LW2B 4K4WA 4GRSA 2D3O1 1S1TA 2J8AA 3G86A 1RA6A 2G2ZA 1IXKA 1IKYA 2LFVA 3D2WA 2Z0GA 3M2VB 2HS0A 3KK1A 2YWWA 4DV1F 2AYBA 3SSQA 1DZ5A 1QSYA 3AA9A 2A10A 5MAOA 4DV6F 2CPDA 2DGQA 5HVGA 2W2NP 1S6UA 4DU7A 2FVSA 1HR0F 4NCAA 3N5BA 4OJ3A 4LQ3A 4I2QA 4IG0A 4QWCA 2MJUA 3QLHA 2MKKA 3ZZZA 2BJ8A 3CCUS 2DRBA 4QQBA 4EYHB 4K4SA 2UUCJ 2L48A 4WBFA 1YDLA 1N34J 2IAJB 2IRYA 2V9WA 1X4EA 4X4PA 2MJNA 1WC1A 2Z56B 4EUVA 5E3RA 2E9TA 3G6ES 2DGWA 4NMXA 1EKSA 1PCAA 2XWYA 5F8MA 1IKWB 1TP7A 4DFPA 2KYXA 2AIRB 3B78A 1S57A 1HD0A 4LSZB 2DR8A 2XYHB 1HD1A 2KI2A 3CCQS 4TVAB 2M0GB 4MJKA 5DQGA 1YKWA 4FP9A 2OH2A 4H4KA 1REVB 4IYQA 4HACB 3M1VB 1FDBA 2N4CA 3HX9A 3U27A 3R27A 1KBRA 3DHWC 4JI1F 3DLGA 3GQCA 3DRRA 2D3OR 1YVFA 4GC6A 2R42A 2R3VA 2FQQB 1B0TA 2FHMA 3MGJA 3CMQA 5ITHA 2YH1A 4JUZA 3X3UA 1P1TA 1T9WA 3EPGA 3HZEA 4Y3CA 3D66A 3PNIA 5IWAF 3FSXA 1EP4A 4B3RJ 2XMUA 5L1LA 3DLHA 4WZQA 2YKNB 4R0JA 2CQ0A 1UJ6A 1LKZA 1WG5A 1FFGB 4X4VA 4IOBA 5F8NA 1S1TB 4UQGA 3DRSB 2DD8S 3C2PA 2DHAA 3SFGA 2PMHA 4USWA 2BE7D 3KK1B 1NKEA 1RT6A 2W9CB 1Q5YA 3QYYA 4FPIA 4M5KA 2X3GA 5LL6d 3THVA 4JI8J 4DV2F 2MPUA 4X64J 2APOA 4M1KA 2WOMB 2DVIA 2BVZA 2V34A 3UWTA 4LR7A 3FK4A 1NSKL 4NPOA 5GMDA 4Y2IA 4N8NA 3MMCA 5J2QB 3LWMA 1X4CA 2KFNA 1D9FA 2DNOA 5ETSA 1QSSA 3J7ZT 2XMJA 3PJWA 4QWEA 2WSEC 3EYZA 2ZH8A 2CFXA 4ZDNA 3FCWA 1WC6A 4PG6A 5D4OA 2V2ZA 2VBXA 3V4MA 2ILYA 2M5YA 1X31C 2CQPA 3ULHA 1GT8A 2EWHA 2AV5A 2GHPA 4WXOA 3HHEA 5EGYA 3ETMA 2HHXA 5IOLA 4FVMA 1RAFB 1RACB 3GV7B 4QIEA 1BY9A 4C7QA 3B4MA 2NS1B 3MM6A 4B9LA 1SJ3P 1NSQA 3MFIA 2F4FA 3FKBA 3AB2B 2QL5B 5J2NA 3UFCX 1MROA 5J1NA 4JP8A 2DNYA 1R3NA 4ECQA 2JEFA 1K0TA 3DRRB 3CW2C 4KY3A 4CNYA 4USTA 1FRJA 2AJ4A 3E01A 4ZITA 3PW2A 4QIGA 2JEJA 3CDAA 1FCAA 1U8SA 1KFDA 5JVHQ 4KYZA 3J81Y 1FRKA 1JLEB 4DQQA 3CDUA 4YY3J 1HPZA 4KR0B 3CMAS 1BC6A 2OSRA 2ZKUA 1VRTA 1AXQA 3ELHA 2MB0B 1NK5A 1GX6A 3KUGA 1LQ9A 2VPXB 3GZ7A 1ZAVA 4ZP6A 3UCZP 2VH7A 3HHLC 3U02A 4DV4J 2W1BA 3IR6B 4C8NA 3EM1A 3W7BA 1PYSB 4KT0C 2CA9A 1KONA 3DNCA 4LF5F 1TV6A 1OQ6A 4L74A 1RT6B 5KFKA 2AMCB 1UVIA 3BN4A 5BR8J 3MAAA 3JS9A 3IMQJ 3M8SA 5J2MA 2CZVC 3AOAA 4N7TA 2JDJA 4K0KF 2J7WA 4FBTA 3R1LA 3G8SA 3QJPA 3ET6B 3HSDA 2AD9A 3HT0A 1L5UA 1Q8BA 5I3QA 1NK0A 2PMWA 2PGCA 3C14B 3KLEA 1JQGA 1PAUB 4CLWA 4J9QA 1HYSB 3IBCB 1YX2A 4DR7F 3J7AN 2IMWP 1VIXA 4C0HA 1VQ5S 2I9SA 2R2RA 3BKFA 2EXUA 2RSQA 4ZN1A 2M8DB 2DEIA 3KYLA 1KP6A 3CMES 4UOGA 4DI6A 2W9AA 4DSEA 5BJRA 1UVMA 4Q5VA 1RLDA 2L08A 2EFNA 3UE2A 3P4UB 3C6TA 2CPFA 3C15A 2DH8A 2J6TA 2ERRA 4DS4A 5HQLA 5K8OA 3AXMA 3PW7A 1IQZA 1SKWA 1VQKS 1V6HA 4GKJF 3FZ2A 1JKHB 4JYAJ 1KD1T 3MOZA 1YRXA 2VOPA 3E01B 4IR9A 3PM9A 4PG5A 1MWYA 3BS9A 2R8IA 1QDUB 2QA4S 1RT2B 3OFGA 2B4UA 3S7RA 5SZTA 4WIIA 2VKZG 1RWOB 4LFAJ 2UV8G 1NKCA 3W5XA 5ADZA 3N5FA 1HPZB 3TOQA 3UNGC 2CKWA 3GIKA 1G7CB 3OXFA 4OYBA 3NNAA 1N88A 5U47A 4CLLA 1TFYA 2J6SA 2DNZA 2ASDA 1GNKA 1VIOA 1VJQA 3NRBA 2GMLA 1KQGB 1TV6B 5EDWA 2W2QP 4EO8A 1SL2A 2HHHF 1SKSA 1BD6A 1WELA 1SBRA 2NZCA 3BR9A 1U6ZA 2C3UA 3DYAA 4RLEA 2BA9A 5IV3A 5D8HB 3MAAB 4DL3A 1Q86T 4QPXA 2K06A 1SKUB 1PJ6A 3K5LA 4CYUB 2HVHA 4PYDA 4PQUA 2HFNA 3ETOA 5IT0A 2OMOA 1CEZA 3O3LA 2MLYA 1RAHB 4IUFA 4LFCF 1H73A 4ZPVR 4ZVEA 1EX8A 4J9SA 1JJ2R 1FWPA 4ED1A 2UVUA 3NGUA 4NZ0A 2DBBA 1GEHA 3RB3A 1NLKL 1SB6A 4MAKA 3CJ2A 4AE5A 3KLEB 3H40A 3V6JA 1ZAWA 1N54B 1JNRB 2NREA 4ZLJA 3HT3A 1JK9B 1RE1B 5DGAA 2YBVA 3OFEA 4I1TA 2RHQB 5GADI 3PEJA 1FDDA 1F1BB 1F5CA 3MCOA 1R31A 1WACA 5KFNA 2AX1A 4A8XA 3Q2SC 3UDEA 2V8HA 3EE3A 4ZP8A 5BYQA 3NLCA 1AW0A 1QTMA 5C42A 3MTJA 1NB2A 2IJFA 5L38A 2QTWA 3D6HB 1MWZA 1I6JA 4G1QA 3C6TB 1HWUA 1Z2LA 3RBXA 1Q53A 2BOAA 1NHKL 3H7HB 5DDRC 1H98A 2UXCJ 1EQ0A 1LNQA 2BKNA 2C28A 3K57A 4UOFA 4PXBA 4W98A 2VL1A 3GTYX 1I3OB 3CD5A 1K0VA 2XY6A 4NLSA 1BE4A 1NM2A 1EHWA 2CPHA 5CAAA 1HI1A 2QSFA 2K2PA 1CSJA 3DGPA 4NXMJ 1ZOTA 3K17A 3TI0A 3CCWA 4OI0A 2NLWA 4L72B 4KTQA 3FCHA 2VASA 4QZVB 1HW8A 1NZAA 1VFJA 3CE8A 2UUWA 1X5TA 4AL7A 4YB7A 3OD2A 4JI3J 2I0XA 1X4DA 3KG1A 1S79A 4KPYA 1VQNS 3K5NA 3MCSA 3RJMB 5J1EA 3W65A 3SCIE 4NLXA 2R7QA 2JEGA 2MQQA 4A8YA 1CJTA 1KLMA 3ILOA 1K1QA 2VBYA 3O8WA 1S77D 1JWWA 3VGVA 4KRWA 5KAKA 1NPKA 2HWIA 1M90T 3MPWA 4I7FB 3GCXP 3EGNA 2GGPB 2NPFA 2PE8A 1NDLA 5KFRA 4DEZA 5FLXU 1DRZA 5DO2A 2IC3A 2W4DA 1VOMA 4ID8A 3EICA 1TL7B 5CD4A 2HFSA 1C0UB 3KNAA 1VMBA 4LF7F 2LQJA 4UZCA 1RWWB 5E3PA 2W25A 4E2FB 2BE2B 3I9ZA 2M4MA 1OIAA 3QRPA 1Q79A 4OZ3A 4PG7A 1RT5A 2FHJA 3WDOA 4HT5A 1TKZB 1U6BA 1JLFB 1N6QB 4K4XA 2B6AB 1X4BA 3I55S 1LWEA 3KUEA 5CCMA 3HD2A 2GQCA 3G87A 1OY6A 1VBYA 4MIBA 2U1AA 2M88A 2IIHA 1SQEA 2J7UA 1NK7A 2V4JA 5L1IA 1CG2A 3R2DJ 2Q1LA 2BM1A 2MGZA 2LDIA 3DOLB 3T5KA 5F8GA 4G1QB 1E6VB 3MMBA 2ZBQA 3T1YF 4B9VA 4PWUA 3QT6A 3R7BB 4LVNP 2O67A 4JI7F 1XWLA 4EZ9A 3NOGA 1SQGA 3S1TA 1VBXA 1NXIA 3R5CA 3CC2S 4RNFA 4HDHA 1HHSA 1JLBB 5C25B 2VG6B 1N4LA 1RTJB 3E51A 3PFEA 2VOOA 4OJHA 1T9VA 2HRUA 4LR8A 1XMOJ 2JEIA 2L3MA 1NKBA 4DPTA 1N5VA 4DX7A 5KFCA 4C48A 1J27A 1D9DA 3TZZA 5C2CA 1M1HA 1S0VA 1R27B 1HBMB 5KT7A 4OHYA 1VR6A 2YWKA 4ZVPB 2NXEA 3VCDA 2Y8WA 2E5JA 2D7SA 3GP9A 1WI6A 3V4IA 3B4DA 2UUAJ 1KLMB 5JUMA 2HZVA 3W64A 2B9EA 5CCLA 4DV5J 4A8KA 3TVYA 3DCAA 3MTKA 4WFBQ 2HEKA 3SZ2A 1SUQB 1WC4A 4MKVA 2XO7A 1DARA 3T5JA 1V5VA 3JSYA 4NLOA 4DQSA 2HRYA 4QIWD 2ZJRQ 4LIWA 2ZBRA 5K14A 4NMLA 4RU2A 2CIMA 3UR3C 4CH7A 1QAJA 1M5OC 3GU0A 3Q86A 2FPHX 1X0FA 1KTVA 1Y5LB 3IGVA 2UXDJ 3ZNUA 2HBZB 1ZAXA 2FJDB 1RT4A 4WKYA 1NK9A 2CDQA 2BW2A 2GVZB 1F3FA 2FJAB 1KS2A 4NXNJ 4LRBA 2FGCA 2ILZA 1WTBA 3NAHA 3G71S 2KZMA 3D0HE 3BBCA 4GKKF 1L3VA 3N79A 4KHRA 4I56A 2V4JB 2YQ1A 2WVDA 4UOCA 2FJBB 4JI5J 2V8GA 3EX7B 3FBBA 3D28A 2YKQA 3IR7B 1N33J 4FNHA 2KT2A 3ILIA 3BKUA 1A6LA 1UWAA 3NCPA 4F7VA 3SEOA 2AWZA 2RHSB 1R89A 4ECYA 4ER8A 2MZSA 4OV6A 4YOEA 2IMOA 2CQ3A 3JQKA 1T9UA 4ALZA 3Q8UA 1T9YA 3MD3A 1HIYA 1RQ0A 2IDEA 2N3LA 2OPSB 4PEOA 1RADB 1FEHA 1P6TA 3UN2A 2U2FA 3J7Z5 1OYDA 1T9TA 2RH3A 5ETTA 3KTQA 1F6TA 4ZCKA 1YSJA 3KJFB 4C3KA 3L7PA 1VLOA 1IKXA 1S12A 1UP1A 4NLWA 4MFBA 3I0RA 4DUTA 3W9IA 3A3PB 4OJGA 1SH2A 1UZDA 2RILA 1SKRA 2ZBCA 2XNQA 3AQOA 4DR1J 3BQ2A 4P7VA 1FFSB 2Z2LA 2DK2A 2OI2A 4NLPA 5IQ6A 2E44A 4Q0BA 3KLHA 1YIJS 3MCMA 2VG5B 1VISA 4XPEA 2BUNA 2Q6CA 4DV6J 1UKUA 4X4RA 4KC5A 4CP5A 1JB0C 5HJXA 1HR0J 2P2CB 5K14B 1JJCB 4RX6A 1EAYC 4OX9F 5KFTA 2W8LA 2JVOA 4C3MA 2HHSA 1OQ3A 2A0FB 3ICLA 4ZPDA 4O44A 2FTRA 2YQ0A 4PUOA 1RT4B 1FRXA 3KLVA 5JXSA 1Q78A 4IH6A 1MSWD 2DB1A 2RKIA 4B9SA 1VJWA 4LUBA 2FB0A 6FD1A 2X7IA 3WX4A 4DFKA 2A6MA 2KT5A 4Y2KA 3ZTSA 4DZ6A 4N77A 4FF4A 2FIUA 3H59A 5JVGQ 2YH0A 4LF9J 2G9OA 2YWFA 3WIUA 2YWHA 2R7SA 2FZKB 3SBMA 1NUEA 1U7LA 4O3RA 2R7XA 1FKOB 4DQIA 3CJ3A 2G2OA 2AYEA 3AHPA 3W61A 1LEOA 1Q7YT 4IKAA 2Z4PA 4ITSA 4NLUA 4P52A 2D1CA 4CLUA 2XY7A 2B56A 3PKMA 4K4TA 3WIVA 2GIRA 5E3CA 3VQSA 3M4XA 4JI1J 1S99A 3W66A 4ICLA 5CZVA 3AD7C 4AL6A 3OR1A 3PW4A 2DY1A 1DTQA 4EEYA 2PC6A 3KLGB 4YN3B 4V1Ak 2VQEJ 2ZEJA 4AFFA 3B54A 4OYPA 3NAIA 5DM7Q 1I5OB 2XMKA 5C24A 4KB7A 1KEKA 4KJIA 2YKPA 4O3SA 4PQAA 1T3OA 3TARA 1DQAA 4G3IA 2BR0A 4YB6A 4PXEA 3UDVA 4IR1A 2F65A 1OO0B 3OSPA 1SJRA 3SCKE 5IWAJ 2ZUAA 3CUNA 4DR4F 2D9PA 4ECUA 2CNOB 3IR5B 3LF0A 4B3TF 3I0RB 4O4GB 1UETA 4ECVA 1ZM2A 2BJ1A 1MG7A 1ZBTA 2DNQA 2DNHA 2RUSA 4DPWA 2MTLA 1NDKA 4W92B 4LRAA 4MK7A 1UA1A 1NH7A 1T03B 2QA4G 2HG4A 2DR9A 3Q24A 3V81A 1T3NA 2LEAA 2E5HA 3MM8A 2HQFA 3U7JA 4M5JA 3DRPA 1N52B 3M2UA 2J9DA 4OLPA 3V6DA 3LTOA 1OYEA 1FEEA 1P9YA 4JI6F 5H9EK 2G1DA 2DR5A 2FVQA 4OI6A 1S1VA 5D3GB 1P27B 1YRUA 1FK9A 3LPEA 1YJVA 1M5KC 4XIUA 4P7TA 3CO9A 2ROEA 5DETA 6AT1B 2FJEB 2EFQA 1Q8LA 3QT8A 4PUOB 3CXCR 4ELUA 3IM9A 2DRDA 5DDQC 1SQFA 4H4OA 4RUAA 1J5OA 4LF6F 5L46A 2Z2ZA 5IT9Y 1ZPVA 1GXUA 1VS3A 1SV5B 1TUWA 4YP3A 3SMZA 1SC1B 1TL3B 3E3XA 1QAYA 2Q79A 3R8YA 5EUHA 1PIEA 1ACMB 2BJ3A 4N56A 4NYOA 1D8ZA 1GX5A 3A12A 3TRGA 2MQ8A 4YB1P 3VQTA 5A8WA 2KL8A 2HK2A 2RVJA 2GO8A 2G0CA 2E9ZA 3Q2TC 2P9EA 2AQ4A 3HFZB 2RQCA 4ED6A 4ENOA 2MZQA 3W2VB 4P2XA 1BQXA 3M8QA 4U6PA 1SJ1A 3CD0A 4CT9A 3TQ1A 4A8WA 2B7CB 2GFFA 2XLIA 2HRTA 4KFBB 2XQCA 3OR1B 4P72A 5L1JA 1DTQB 4JV1A 4U95A 1RT7A 3GMGA 5D6GA 1S7HA 1ZZNA 3ITHA 3R5DA 1F60B 4IO1A 2P8IA 4IH5A 3QQCD 4USUA 2H3EB 3CPWR 1U0HA 2LKZA 1VBZA 4DV3F 3ILJA 4I69A 3HP6A 2RDJA 5IC4B 1PC4A 2EBEA 1GMVA 1ROFA 4DG1A 4Y2CA 3KK2A 1C4CA 4BWMA 2WVCA 1IR1A 1VQYA 5ETMA 3PYDA 5HQMA 4NZ7A 2M9KA 2WHOA 1T7PA 1Q8IA 3MUTP 1VDHA 4FNIA 3DRPB 2GO9A 4LF4F 3CJ4A 4KGKA 4DU8A 3BGRA 1IJEB 1NPRA 2ZITA 1HWIA 3CIMA 2IJRA 2AYMA 2DIVA 3V6DB 2RIJA 3P5TL 3RG6A 4JOUA 4CT8A 3ZC4A 2ZWOA 5HROB 3K2YA 4HEA9 2XHCA 2DH9A 3Q8YA 2GV1A 4DX6A 4P2FA 1RP5A 3DXSX 1S1VB 3T19A 1F5AA 3HSZA 4M94A 1HQEA 1Y9OA 4K0KJ 1IUJA 5HBMB 5IXUA 5E41A 4Y2MA 1IKVB 2C3PA 2RF2A 1X7VA 3JAMU 1HI8A 2DH7A 3MCNA 1KQKA 1JLGB 3CDEA 1S10A 2VBWA 3CB4A 2VA2A 3DMJA 4H4OB 2W7PA 4ANEA 2OPRA 1FJCA 4DR7J 1UVLA 3AD8C 5HMYA 4IDKA 1UCNA 3ZZPA 3VTIA 4F4ZA 3QZ7A 4IFYA 3MEDA 5E3QA 4BC7A 1VRUB 4RW6A 3PRVA 5HANA 4GC7A 3V2UC 3NWGA 3GJRB 3V5RA 3UVJB 5E7OB 3VGTA 5F3ZA 3IGNA 3M8QB 1WHXA 3M05A 2VPZB 3H5YA 4X2BA 1XJWB 4GKJJ 3MPVA 3NBPB 2JJ4D 2UP1A 2VPYB 3VVUA 2JH3A 1RT7B 1PKUA 3ZTRA 2MQMA 3J7A1 3GFXA 2MQPA 2Y3YA 3OR2B 1WHYA 3RB4A 5HVFA 3BYPA 2VD3A 5HMWA 4HI2A 4DR2F 3DDNA 5LSLA 2H5IB 3OHAA 1WKKA 2PEHA 1XTZA 4CO0A 4DCPB 1YG0A 3LP2A 2BANA
chains in the Genus database with same CATH topology
3UI3A 1SV5A 3IG1B 4O3QA 2DNOA 2OFGX 2VQFF 1QSSA 2J0SD 2CRLA 1DJ0A 4F2SA 3J7ZT 2OFHX 2XMJA 3PJWA 4QWEA 2WSEC 1TL1B 1TL3A 2GNKA 2XI2A 4UW2A 5AJ3F 3EYZA 3L3CA 2ZH8A 1XMOF 2CFXA 2VPWB 3ZZYA 2ALZA 4U67Q 1HI0P 4ZDNA 2ZZNA 1BGXT 4G1PA 4ILRA 4PG6A 5D4OA 2YNIA 2XULA 2RS2A 2D41A 5GAEU 3I32A 2VBXA 3V4MA 2ILYA 5DQIA 2ZC4A 2EFVA 3I82A 5AXKA 1NJYA 4TLQA 3ISND 1DQ8A 2M5YA 2XHWA 1N48A 3BQ1A 3QAEA 3FQLA 5KFIA 2CQPA 1N0UA 5KG3A 3ULHA 1GT8A 2EWHA 2AV5A 4F4KA 2GHPA 3OTBA 2DNLA 4KGMA 4KHMA 2JVRA 3OUYB 4WXOA 1FJGF 3HHEA 4RBTA 2YNGA 3HHDA 1S76D 2B9XA 5BYRA 4ZVHA 1HBUA 2B0GA 5B08A 4K4UA 5EGYA 3KMSA 1HBOA 5FIIA 4QWAA 4EU0A 4ECXA 2HNYB 2GMJA 1A7GE 3B8HA 3W2VA 4DN9A 4RNMA 2WTFA 3BO4A 2DPJA 4O0IA 1FERA 1L3SA 4QU7A 2HHXA 4FVMA 4DR6F 2UUAF 5THWA 1LW2A 5HP1B 2E1MC 2EFOA 1NK6A 4H4KC 5A0YB 2CVEA 4ZHRB 2JFKA 3GYXB 2UVWA 3GV7B 3DYAB 4QIEA 3I0SB 1BY9A 3T6BA 3Q8RB 4KFBA 4C7QA 3B4MA 5KFPA 2F40A 2E5LF 1R6YA 2NS1B 1O8BA 3JSRA 3MM6A 4U7CA 4CO3A 3CCJS 4DV5F 4B9LA 1Q16B 2FJXA 1SXLA 1URRA 1VQOS 1SJ3P 1UJ5A 3MFIA 2RF2B 3PHEA 3M2VA 2EFGA 2KJWA 4IO9Q 1NRKA 5KFOA 3AB2B 1FRLA 2R8KA 3C46A 3VZIA 2KKHA 5J2NA 2CQIA 4OI1A 3UFCX 2OJ3A 1MROA 4PQUB 3KHRA 1U1PA 2XGQA 1YJRA 5J1NA 3DI6A 1FE4A 2OLWA 2UZAA 3CT9A 3NG8A 5HO4A 2DNYA 2C22A 4X4NA 1R3NA 4PWDA 4ECQA 2JEFA 3NL0A 1K0TA 3DRRB 1UVKA 1VQLS 2QMWA 2BOPA 4C4WA 2ZDPA 2ROGA 2MSTA 4CNYA 1X8DA 2VKRA 2HQIA 1K73T 2XBPA 3KOAA 2V94A 3MR2A 1FRJA 2AJ4A 1KOOA 3E01A 4MKAA 1B64A 3G8TA 2KFYA 1RTIB 3FNNA 3IBWA 3PW2A 3GV8B 4QIGA 4B9NA 1D0EA 2JEJA 4F4XA 1JLCB 2BM0A 2MZTA 3CDAA 1FCAA 3ENQA 1U8SA 1SC6A 2YVSA 1KFDA 4F25A 5JVHQ 1G1XA 4DN0A 1ZZFA 3J81Y 1RT1B 2YKMB 4IFYB 1FRKA 2V8DA 3GIJA 3HKWA 4NRUA 2FUG9 3MEDB 4I68A 3GE9A 2E5IA 2R8GA 1JLEB 4OJ1A 4DQQA 1HNVB 3CDUA 2LU1A 1KN6A 2D74B 4BC9A 3TYTA 2DISA 5AE3A 3KK3B 1H7WA 4N76A 1HPZA 4KR0B 3MHYA 3CMAS 1EETA 4ID5B 1N56A 1BC6A 3M32A