1TMCA

The three-dimensional structure of a class i major histocompatibility complex molecule missing the alpha3 domain of the heavy chain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of a class I major histocompatibility complex molecule missing the alpha 3 domain of the heavy chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility antigen
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68)
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1994-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1tmcA00
5IB2A 4O2FA 1UXWA 1G7PA 4NO2A 1CG9A 1JPGA 4U1JA 3ROLA 3L3DA 4S0UC 3VRIA 5IB5A 4L29A 1WBZA 5E00A 3FOMA 5H94A 4LCYA 1TVHA 3KPNA 4PRNA 3SDXA 3G08A 4WUUA 3TIEA 4WDIA 4MQ7A 3PWVA 3TBVA 3VWJA 3SJVA 3MRFA 4PRDA 1ZS8A 1XR9A 5C07A 3DTXA 4WJ5A 2BSSA 1T20A 3MR9A 3BH8A 1JGEA 1WBXA 4ZUWA 3VFNA 5GSVA 1RJYA 2ZOKA 3V5DA 3TZVC 5C0DA 1P1ZA 3ARFA 3RWJA 4JFDA 4U1KA 1QR1A 1T7VA 5F1IA 1QSEA 1IM9A 1QQDA 3GSQA 3GSNH 1BZ9A 3O3EA 4X6EA 5HHOA 5ISZA 4U1HA 5C0CA 3KPOA 1T1ZA 5B39A 4K71B 1LP9A 3FTGA 3BEVA 1OGAA 3HG1A 4D0CA 3TPUE 5HHNA 3V5KA 3QDGA 5ACZA 4O2EA 4PRPA 3DBXA 3MRRA 3LKOA 3PABA 2AK4A 2F53A 4HUWA 4QRPA 1KJVA 1KCGC 2VE6A 4G8GA 3IXAA 4X6CA 4NO5A 3L9RA 1KPUA 1N5AA 4K7FA 3P73A 3ARDA 1ZT7A 1JGDA 4HUVA 4HS3A 3KLAA 4PJCA 3H7BA 2ZSWA 3FQWA 3KWWA 3JTTA 4U6XA 4Y4KA 1A9BA 3VXRA 3QFJA 3L3HA 1FZJA 1S9YA 3S6CA 4F7CA 1XR8A 2BVQA 2H6PA 5IEKA 2X4UA 2DYPA 1S7UA 2FYYA 3TBTA 3UTSA 3LKPA 3PWNA 1I7UA 3L3GA 5EO1A 4ZFZA 3TA3A 3VFMA 2CKBH 2X70A 2H26A 5FA4A 3TBYA 2NW3A 1B0GA 3SKOA 4G43A 4HUUA 4PJEA 3PWPA 2GJ6A 2BSRA 5SWSA 3D18A 2WY3A 1HHKA 2GTZA 3L3JA 4PGCA 3RWIA 3KYOA 4PGEA 1BQHA 2UWEA 3MGOA 2AV1A 2NX5A 3MRGA 1HHGA 3BZFA 1M6OA 3TO2A 4F7EA 1JE6A 1LQVA 3BZEA 3U0PA 1S7RA 3MRBA 4QRSA 3QZWA 5D7IA 1KJ2H 4PJDA 1KTLA 5E8NA 5F7DA 3KPMA 1XZ0A 2D31A 3C8KA 3MRDA 1LDPH 3RWHA 3LKQA 4JQVA 3QI9A 5FA3A 5DEGA 4EUPA 1RK0A 3FQUA 4NNYA 4N0CA 3T1FA 5D7JC 3H9HA 4Z78A 4IRJA 1C16A 3BUYA 3QEQA 3L3KA 4JFFA 1DUZA 1SYSA 3KPLA 1JUFA 3MROA 2JCCA 1UXSA 3GMOA 3O9WA 3VFTA 4ONOA 3X11A 4PG9A 2GITA 1MHCA 2HLAA 4F7MA 1PQZA 1HOCA 3O3DA 4MVBA 5HGBA 1AKJA 2HJKA 1ZHNA 2F74A 3BHBA 1MI5A 4N5EA 4NO0A 4U1IA 1QLFA 3W39A 2BCKA 1FZMA 4EN3C 4L4TA 5HGAA 3KPQA 5J1AA 4IRSA 4MX7A 3JTCA 1JPFA 3D39A 3VWKA 1I7RA 1RK1A 5EU5A 4GUPA 4WU7A 5SWZA 4Y2DA 2CLZA 1S7WA 3FQXA 3TBSA 3TF7A 4F7PA 4X6DA 5HGDA 3BH9A 3JTSA 1W72A 4G8IA 5DDHA 1T7YA 3HAEA 1NANH 1AGDA 4Y4FA 3SCMA 3VFPA 1S9XA 2CIIA 1DE4A 3M17A 4LNRA 1A6ZA 5MEPA 4WO4A 4U1LA 3FRUA 2J8UA 3KXFA 1ZT4A 2X4OA 2GUOA 1LEGA 1QVOA 3FQRA 1VADA 3TN0A 1S7SA 4ZUSA 1ED3A 1YPZA 2ZOLA 4PR5A 4PDCE 1AO7A 1NEZA 3JVGA 3E6FA 2VABA 1LEKA 1I1FA 4QOKA 3X14A 1UQSA 3VXUA 1B0RA 1G7QA 2OI9A 4ZAKA 1FG2A 1S7QA 3GSRA 2X4SA 2VLRA 2CLVA 3I6KA 4HWZA 4ZUTA 3RWCA 5IB3A 1ZT1A 5E8PA 1EFXA 3CPLA 3GJFA 3VFRA 1VGKA 1FFNA 4E5XA 4GKNA 4PJAA 3GMRA 3VFSA 4L3EA 1QRNA 4F7TA 4PJIA 3ECBA 5C0EA 4Z76A 5J6HA 3LV3A 1KJMA 2BNRA 1S7TA 5EU6A 4PJ8A 3VXPA 4PJ5A 1CD1A 3DXAA 4NHUE 5E8OA 4E0RA 3VXNA 2X4RA 4PJ7A 3VJ6A 2YPLA 1T1YA 1TVBA 3WS3A 5IVXA 4FFEX 1QO3A 3D25A 4N8VA 3GSUA 3L3IA 3MGTA 3T8XA 3HPJA 1I1AA 3BWAA 4L3CA 1T22A 4JRYA 4PG2A 3UTTA 4PV9A 1L8JA 1TMCA 1HHJA 1FZKA 4ELMA 3X12A 3B6SA 2AKRA 3HLAA 4NT6A 4PP8C 3WS6A 5IROA 5EU3A 1OSZA 3BP7A 3FT2A 4NQXA 3WL9A 5E9DA 4NO3A 3TVMA 1ONQA 1T1WA 3RTQA 4CVZA 2X4QA 3DX6A 4PRAA 5HYJA 3MV9A 1ZHLA 2Q7YA 3BW9A 4GKSA 4MS8A 3TJHA 2FWOA 2VAAA 3AU1A 3DMMA 5HHQA 4D0DA 1OGTA 4U6YA 1FO0H 3MRKA 3WLBA 2OL3H 1A1MA 5IB1A 1T80A 5AD0A 2CLRA 3MRNA 1QEWA 1ZHKA 3OV6A 4G42A 4Z77A 3ARGA 2PYEA 1LK2A 3BVNA 4NQCA 5F9JA 3UPRA 2AXGA 3E2HA 3HE6A 1RJZA 2HN7A 3MRMA 3BO8A 3QUZA 4L8BA 3FOLA 3HCVA 4I4WA 5INDA 3BEWA 3QUXA 5GSRA 3RWFA 5B38A 3LKNA 1E27A 5IM7A 3VFUA 2F54A 3PWLA 4G9FA 2VLLA 3GSVA 3GMNA 1HYRC 1W0WA 2FIKA 1CE6A 2RFXA 4PGBA 4UQ2A 4UQ3A 1T7ZA 1N3NA 5MEOA 3UTQA 3VFVA 3IT8D 3GSWA 4QRQA 4N0UA 3P9LA 3RL1A 1I7TA 1R3HA 5C0AA 3TIDA 3QULA 3P4MA 4MJIA 3KPSA 2VLJA 3DX7A 3I6GA 4WWKC 3SPVA 4PJ9A 1VACA 5C08A 3GMLA 4HX1A 3GSXA 4QRTA 5FKPA 3ROOA 3FFCA 3VFWA 4LCWA 2YEZA 2C7UA 3O8XA 2ESVA 4MJ6A 4IIQC 1A1NA 1DDHA 3MRIA 3MRLA 4NQVA 4V3EB 2FZ3A 2VLKA 3CCHA 4U1MA 3E6HA 2AXFA 5D9SA 4CW1A 3GIVA 3P4OA 3MRPA 3MRCA 1T1XA 1Z5LA 5C9JA 5MEQA 1X7QA 5EO0A 3VXOA 2BVPA 1AGEA 4X6FA 5BJTA 3KYNA 1JHTA 4EI5A 2ZSVA 1GZPA 3CZFA 3ES6A 4QRUA 4ZUVA 3NFNA 1ZAGA 3ILPA 3O3AA 5C0FA 1Q94A 5BXFA 3HUJA 1AGBA 2HJLA 3P9MA 4HV8A 3RUGA 1S7XA 1A1OA 1BD2A 1G6RH 1S9WA 3KPRA 4PRHA 3QFDA 1NAMH 3RWDA 3M1BA 4MXQA 3ARBA 3DX8A 4HKJA 5J6GA 3OX8A 4L8DA 5D2NA 1OF2A 4PREA 3MRHA 2V2XA 4JFPA 1MHEA 1S7VA 1EXUA 3GMPA 3TO4A 1FZOA 1YN6A 3I6LD 3LKSA 5C0GA 2XFXA 3FQNA 5EUOA 1K5NA 4L8SC 3BP4A 1HSBA 2BVOA 4NQDA 3RWGA 3QUKA 3UBXA 2E7LE 2V2WA 2PO6A 3QQ3A 2FO4A 3MA7A 4U1SA 3TFKA 1YDPA 2P5EA 3HE7A 3SDCA 5FDWA 4JFQA 5IB4A 5C0JA 3X13A 3BXNA 3MYJA 3QUYA 3VXSA 5EOTA 3MV7A 1T21A 4NNXA 3KPPA 3LKRA 3C9NA 4L9LC 3VFOA 1IM3A 1T7XA 4JQXA 1SYVA 4MJ5A 3RWEA 1HHHA 4PGDA 5L2KA 3REWA 2XPGA 4N0FA 4HUXA 1FFOA 1XH3A 3AM8A 3ILQC 4PJHA 4L4VA 3GMMA 4MNGA 1EEZA 1A9EA 5HGHA 3FT4A 4APQA 1I4FA 5D5MA 3H9SA 5JHDA 3QQ4A 4PJFA 1ZVSA 3SDAA 1FFPA 1P4LA 3AREA 3FONA 4WW2C 4D0BA 4O2CA 3VH8A 1YN7A 2CIKA 1P7QA 4Y16A 1N59A 2GT9A 1LD9A 3MREA 3O3BA 1ZSDA 1K8DA 4PRBA 5DEFA 5BS0A 2X4PA 3FT3A 2BSTA 3D2UA 1T0NA 3B3IA 5IEHA 1AGCA 2X4NA 3OXSA 3RL2A 3RGVC 4PJXA 1KBGH 1E28A 3FQTA 4LHUA 1KJ3H 1JF1A 4V3DB 4LCCC 3V5HA 4JFEA 2GAZA 1T7WA 3E3QA 4G9DA 4QRRA 4XXCA 4PV8A 3OXRA 3SKMA 4G59A 3W0WA 3VCLA 1KPRA 3QDJA 4FTVA 1EEYA 5HHPA 3RZCA 1QSFA 3PWUA 3PWJA 5ENWA 3MRQA 3SDDA 5HHMA 1W0VA 5MENA 5E6IC 4CVXA 4PRIA 1KPVA 2YPKA 1JFMA 5D7LA 3WUWA 1BIIA 1U58A 3LN4A 3GSOA 3P77A 5BRZA 4NSKA 3QDMA 1S8DA 4PJGA 2GTWA 4PJBA 3CDGA 5F1NA 3CC5A 1N2RA 2AV7A 4ZUUA 1M05A 1DUYA 4NQEA 4U1NA 5EFIA 3BGMA 5D2LA 3CVHA 3O4LA 3PQYA 3VRJA 3D3VA 1HSAA 4WU5A 2MHAA 1T0MA 5INCA 5C0BA 5C0IA 2P5WA 1AGFA 4Y4HA 4JRXA 5EU4A 3TBWA 1I1YA 3P4NA 1ZHBA 2BNQA 1B3JA 5MERA 4L8CA 1INQA 1MWAH 4I48A 2A83A 5SWQA 4IHOA 1HHIA 1GZQA 3ERYA 5L2JA 4MNQA 3MV8A 2X4TA 4JFOA 3LN5A 1WBYA 3MRJA 3CH1A 3VXMA 5C09A 3GMQA
chains in the Genus database with same CATH superfamily
5IB2A 4O2FA 1UXWA 1G7PA 4NO2A 1CG9A 1JPGA 4U1JA 3ROLA 3L3DA 2O5NA 4S0UC 3VRIA 5IB5A 4L29A 1WBZA 5E00A 3FOMA 5H94A 4LCYA 1TVHA 3KPNA 4PRNA 3SDXA 3G08A 4WUUA 3TIEA 4WDIA 4MQ7A 3PWVA 3TBVA 3VWJA 3SJVA 3MRFA 4PRDA 1ZS8A 1XR9A 5C07A 3DTXA 4WJ5A 2BSSA 1T20A 3MR9A 3BH8A 1JGEA 1WBXA 4ZUWA 3VFNA 5GSVA 1RJYA 2ZOKA 3I0TA 3TZVC 5C0DA 1P1ZA 3ARFA 3RWJA 3V5DA 4JFDA 4U1KA 1QR1A 1T7VA 5F1IA 1QSEA 1IM9A 1QQDA 3GSQA 3GSNH 1BZ9A 3O3EA 4X6EA 5HHOA 5ISZA 4U1HA 5C0CA 3KPOA 1T1ZA 5B39A 4K71B 1LP9A 3FTGA 3BEVA 1OGAA 3HG1A 4D0CA 3TPUE 5HHNA 3V5KA 3QDGA 5ACZA 4O2EA 4PRPA 3DBXA 3MRRA 3LKOA 3PABA 2AK4A 2F53A 4HUWA 4QRPA 1KJVA 1KCGC 2VE6A 4G8GA 3IXAA 4X6CA 4NO5A 3L9RA 1KPUA 1N5AA 4K7FA 3P73A 3ARDA 1ZT7A 1JGDA 4HUVA 4HS3A 3KLAA 4PJCA 3H7BA 2ZSWA 3FQWA 3KWWA 3JTTA 4U6XA 2IA1A 4Y4KA 1A9BA 3VXRA 3QFJA 3L3HA 1FZJA 1S9YA 3S6CA 4F7CA 1XR8A 2BVQA 2H6PA 5IEKA 2X4UA 2DYPA 1S7UA 2FYYA 3TBTA 3UTSA 3LKPA 3PWNA 1I7UA 3L3GA 5EO1A 4ZFZA 3TA3A 3VFMA 2CKBH 2X70A 2H26A 5FA4A 3TBYA 2NW3A 1B0GA 3SKOA 4G43A 4HUUA 4PJEA 3PWPA 2GJ6A 2BSRA 5SWSA 3D18A 2WY3A 1HHKA 2GTZA 3L3JA 4PGCA 3RWIA 3KYOA 4PGEA 1BQHA 2UWEA 3MGOA 2AV1A 2NX5A 3MRGA 1HHGA 3BZFA 1M6OA 3TO2A 4F7EA 1JE6A 1LQVA 3BZEA 3U0PA 1S7RA 3MRBA 4QRSA 3QZWA 5D7IA 1KJ2H 4PJDA 1KTLA 5E8NA 5F7DA 3KPMA 1XZ0A 2D31A 3C8KA 3MRDA 1LDPH 3RWHA 3LKQA 4JQVA 3QI9A 5FA3A 5DEGA 4EUPA 1RK0A 3FQUA 4NNYA 4N0CA 3T1FA 5D7JC 3H9HA 4Z78A 4IRJA 1C16A 3BUYA 3QEQA 3L3KA 4JFFA 1DUZA 1SYSA 3KPLA 1JUFA 3MROA 2JCCA 1UXSA 3GMOA 3O9WA 3VFTA 4ONOA 3X11A 4PG9A 2GITA 1MHCA 2HLAA 4F7MA 1PQZA 1HOCA 3O3DA 4MVBA 5HGBA 1AKJA 4BKWA 2HJKA 1ZHNA 2F74A 3BHBA 1MI5A 4N5EA 4NO0A 4U1IA 1QLFA 3W39A 2BCKA 1FZMA 4EN3C 4L4TA 5HGAA 3KPQA 5J1AA 4IRSA 4MX7A 3JTCA 1JPFA 3D39A 3VWKA 1I7RA 2NYKA 1RK1A 5EU5A 4GUPA 4WU7A 5SWZA 4Y2DA 2CLZA 1S7WA 3FQXA 3TBSA 3TF7A 4F7PA 4X6DA 5HGDA 3BH9A 3JTSA 1W72A 4G8IA 5DDHA 1T7YA 3HAEA 1NANH 1AGDA 4Y4FA 3SCMA 3VFPA 1S9XA 2CIIA 1DE4A 3M17A 4LNRA 1A6ZA 5MEPA 4WO4A 4U1LA 3FRUA 2J8UA 3KXFA 1ZT4A 2X4OA 2GUOA 1LEGA 1QVOA 3FQRA 1VADA 3TN0A 1S7SA 4ZUSA 1ED3A 1YPZA 2ZOLA 4PR5A 4PDCE 1AO7A 1NEZA 3JVGA 3E6FA 2VABA 1LEKA 1I1FA 4QOKA 3X14A 1UQSA 3VXUA 1B0RA 1G7QA 2OI9A 4ZAKA 1FG2A 1S7QA 3GSRA 2X4SA 2VLRA 2CLVA 3I6KA 4HWZA 4ZUTA 3RWCA 5IB3A 1ZT1A 5E8PA 1EFXA 3CPLA 3GJFA 3VFRA 1VGKA 1FFNA 4E5XA 4GKNA 4PJAA 3GMRA 3VFSA 4L3EA 1QRNA 4F7TA 4PJIA 3ECBA 5C0EA 4Z76A 5J6HA 3LV3A 1KJMA 2BNRA 1S7TA 5EU6A 4PJ8A 3VXPA 4PJ5A 1CD1A 3DXAA 4NHUE 5E8OA 4E0RA 3VXNA 2X4RA 4PJ7A 3VJ6A 2YPLA 1T1YA 1TVBA 3WS3A 5IVXA 4FFEX 1QO3A 3D25A 4N8VA 3GSUA 3L3IA 3MGTA 3T8XA 3HPJA 1I1AA 3BWAA 4L3CA 1T22A 4JRYA 4PG2A 3UTTA 4PV9A 1L8JA 1TMCA 1HHJA 1FZKA 4ELMA 3X12A 3B6SA 2AKRA 3HLAA 4NT6A 4PP8C 3WS6A 5IROA 5EU3A 1OSZA 3BP7A 3FT2A 4NQXA 3WL9A 5E9DA 4NO3A 3TVMA 1ONQA 1T1WA 3RTQA 4CVZA 2X4QA 3DX6A 4PRAA 5HYJA 3MV9A 1ZHLA 2Q7YA 3BW9A 4GKSA 4MS8A 3TJHA 2FWOA 2VAAA 3AU1A 3DMMA 5HHQA 4D0DA 1OGTA 4U6YA 1FO0H 3MRKA 3WLBA 2OL3H 1A1MA 5IB1A 1T80A 5AD0A 2CLRA 3MRNA 1QEWA 1ZHKA 3OV6A 4G42A 4Z77A 3ARGA 2PYEA 1LK2A 3BVNA 4NQCA 5F9JA 3UPRA 2AXGA 3E2HA 3HE6A 1RJZA 2HN7A 3MRMA 3BO8A 3QUZA 4L8BA 3FOLA 3HCVA 4I4WA 5INDA 3BEWA 3QUXA 5GSRA 3RWFA 5B38A 3LKNA 1E27A 5IM7A 3VFUA 2F54A 3PWLA 4G9FA 2VLLA 3GSVA 3GMNA 1HYRC 1W0WA 2FIKA 1CE6A 2RFXA 4PGBA 4UQ2A 4UQ3A 1T7ZA 1N3NA 5MEOA 3UTQA 3VFVA 3IT8D 3GSWA 4QRQA 4N0UA 3P9LA 3RL1A 1I7TA 1R3HA 5C0AA 3TIDA 3QULA 3P4MA 4MJIA 3KPSA 2VLJA 3DX7A 3I6GA 4WWKC 3SPVA 4PJ9A 1VACA 5C08A 3GMLA 4HX1A 3GSXA 4QRTA 5FKPA 3ROOA 3FFCA 3VFWA 4LCWA 2YEZA 2C7UA 3O8XA 2ESVA 4MJ6A 4IIQC 1A1NA 1DDHA 3MRIA 3MRLA 4NQVA 4V3EB 2FZ3A 2VLKA 3CCHA 4U1MA 3E6HA 2AXFA 5D9SA 4CW1A 3GIVA 3P4OA 3MRPA 3MRCA 1T1XA 1Z5LA 5C9JA 5MEQA 1X7QA 5EO0A 3VXOA 2BVPA 1AGEA 4X6FA 5BJTA 3KYNA 1JHTA 4EI5A 2ZSVA 1GZPA 3CZFA 3ES6A 4QRUA 4ZUVA 3NFNA 1ZAGA 3ILPA 3O3AA 5C0FA 1Q94A 5BXFA 3HUJA 4G59C 1AGBA 2HJLA 3P9MA 4HV8A 3RUGA 1S7XA 1A1OA 1BD2A 1G6RH 1S9WA 3KPRA 4PRHA 4JO8A 3QFDA 1NAMH 3RWDA 3M1BA 4MXQA 3ARBA 3DX8A 4HKJA 5J6GA 3OX8A 4L8DA 5D2NA 1OF2A 4PREA 3MRHA 2V2XA 4JFPA 1MHEA 1S7VA 1EXUA 3GMPA 3TO4A 1FZOA 1YN6A 3I6LD 3LKSA 5C0GA 2XFXA 3FQNA 5EUOA 1K5NA 4L8SC 3BP4A 1HSBA 2BVOA 4NQDA 3RWGA 3QUKA 3UBXA 2E7LE 2V2WA 2PO6A 3QQ3A 2FO4A 3MA7A 4U1SA 3TFKA 1YDPA 2P5EA 3HE7A 3SDCA 5FDWA 4JFQA 5IB4A 5C0JA 3X13A 3BXNA 3MYJA 3QUYA 3VXSA 5EOTA 3MV7A 1T21A 4NNXA 3KPPA 3LKRA 3C9NA 4L9LC 3VFOA 1IM3A 1T7XA 4JQXA 1SYVA 4MJ5A 3RWEA 1HHHA 4PGDA 5L2KA 3REWA 2XPGA 4N0FA 4HUXA 1FFOA 1XH3A 3AM8A 3ILQC 4PJHA 4L4VA 3GMMA 4MNGA 1EEZA 1A9EA 5HGHA 3FT4A 4APQA 1I4FA 5D5MA 3H9SA 5JHDA 3QQ4A 4PJFA 1ZVSA 3SDAA 1FFPA 1P4LA 3AREA 3FONA 4WW2C 4D0BA 4O2CA 3VH8A 1YN7A 2CIKA 1P7QA 4Y16A 1N59A 2GT9A 1LD9A 3MREA 3O3BA 1ZSDA 1K8DA 4PRBA 5DEFA 5BS0A 2X4PA 3FT3A 2BSTA 3D2UA 1T0NA 3B3IA 5IEHA 1AGCA 2X4NA 3OXSA 3RL2A 3RGVC 4PJXA 1KBGH 1E28A 3FQTA 4LHUA 1KJ3H 1JF1A 4V3DB 4LCCC 3V5HA 4JFEA 2GAZA 1T7WA 3E3QA 4G9DA 4QRRA 4XXCA 4PV8A 3OXRA 3SKMA 4G59A 3W0WA 3VCLA 1KPRA 3QDJA 4FTVA 1EEYA 5HHPA 3RZCA 1QSFA 3PWUA 3PWJA 5ENWA 3MRQA 3SDDA 5HHMA 1W0VA 5MENA 5E6IC 4CVXA 4PRIA 1KPVA 2YPKA 1JFMA 5D7LA 3WUWA 1BIIA 1U58A 3LN4A 3GSOA 3P77A 5BRZA 4NSKA 3QDMA 1S8DA 4PJGA 2GTWA 4PJBA 3CDGA 5F1NA 3CC5A 1N2RA 2AV7A 4ZUUA 1M05A 1DUYA 4NQEA 4U1NA 5EFIA 3BGMA 5D2LA 3CVHA 3O4LA 3PQYA 3VRJA 3D3VA 1HSAA 4WU5A 2MHAA 1T0MA 5INCA 5C0BA 5C0IA 2P5WA 1AGFA 4Y4HA 4JRXA 5EU4A 3TBWA 1I1YA 3P4NA 1ZHBA 2BNQA 1B3JA 5MERA 4L8CA 1INQA 1MWAH 4I48A 2A83A 5SWQA 4IHOA 1HHIA 1GZQA 3ERYA 5L2JA 4MNQA 3MV8A 2X4TA 4JFOA 3LN5A 1WBYA 3MRJA 3CH1A 3VXMA 5C09A 3GMQA
chains in the Genus database with same CATH topology
5IB2A 4O2FA 1UXWA 1G7PA 4NO2A 1CG9A 1JPGA 4U1JA 3ROLA 3L3DA 4S0UC 3VRIA 5IB5A 4L29A 1WBZA 5E00A 3FOMA 5H94A 4LCYA 1TVHA 3KPNA 4PRNA 3SDXA 3G08A 4WUUA 3TIEA 4WDIA 4MQ7A 3PWVA 3TBVA 3VWJA 3SJVA 3MRFA 4PRDA 1ZS8A 1XR9A 5C07A 3DTXA 4WJ5A 2BSSA 1T20A 3MR9A 3BH8A 1JGEA 1WBXA 4ZUWA 3VFNA 5GSVA 1RJYA 2ZOKA 3V5DA 3TZVC 5C0DA 1P1ZA 3ARFA 3RWJA 4JFDA 4U1KA 1QR1A 1T7VA 5F1IA 1QSEA 1IM9A 1QQDA 3GSQA 3GSNH 1BZ9A 3O3EA 4X6EA 5HHOA 5ISZA 4U1HA 5C0CA 3KPOA 1T1ZA 5B39A 4K71B 1LP9A 3FTGA 3BEVA 1OGAA 3HG1A 4D0CA 3TPUE 5HHNA 3V5KA 3QDGA 5ACZA 4O2EA 4PRPA 3DBXA 3MRRA 3LKOA 3PABA 2AK4A 2F53A 4HUWA 4QRPA 1KJVA 1KCGC 2VE6A 4G8GA 3IXAA 4X6CA 4NO5A 3L9RA 1KPUA 1N5AA 4K7FA 3P73A 3ARDA 1ZT7A 1JGDA 4HUVA 4HS3A 3KLAA 4PJCA 3H7BA 2ZSWA 3FQWA 3KWWA 3JTTA 4U6XA 4Y4KA 1A9BA 3VXRA 3QFJA 3L3HA 1FZJA 1S9YA 3S6CA 4F7CA 1XR8A 2BVQA 2H6PA 5IEKA 2X4UA 2DYPA 1S7UA 2FYYA 3TBTA 3UTSA 3LKPA 3PWNA 1I7UA 3L3GA 5EO1A 4ZFZA 3TA3A 3VFMA 2CKBH 2X70A 2H26A 5FA4A 3TBYA 2NW3A 1B0GA 3SKOA 4G43A 4HUUA 4PJEA 3PWPA 2GJ6A 2BSRA 5SWSA 3D18A 2WY3A 1HHKA 2GTZA 3L3JA 4PGCA 3RWIA 3KYOA 4PGEA 1BQHA 2UWEA 3MGOA 2AV1A 2NX5A 3MRGA 1HHGA 3BZFA 1M6OA 3TO2A 4F7EA 1JE6A 1LQVA 3BZEA 3U0PA 1S7RA 3MRBA 4QRSA 3QZWA 5D7IA 1KJ2H 4PJDA 1KTLA 5E8NA 5F7DA 3KPMA 1XZ0A 2D31A 3C8KA 3MRDA 1LDPH 3RWHA 3LKQA 4JQVA 3QI9A 5FA3A 5DEGA 4EUPA 1RK0A 3FQUA 4NNYA 4N0CA 3T1FA 5D7JC 3H9HA 4Z78A 4IRJA 1C16A 3BUYA 3QEQA 3L3KA 4JFFA 1DUZA 1SYSA 3KPLA 1JUFA 3MROA 2JCCA 1UXSA 3GMOA 3O9WA 3VFTA 4ONOA 3X11A 4PG9A 2GITA 1MHCA 2HLAA 4F7MA 1PQZA 1HOCA 3O3DA 4MVBA 5HGBA 1AKJA 2HJKA 1ZHNA 2F74A 3BHBA 1MI5A 4N5EA 4NO0A 4U1IA 1QLFA 3W39A 2BCKA 1FZMA 4EN3C 4L4TA 5HGAA 3KPQA 5J1AA 4IRSA 4MX7A 3JTCA 1JPFA 3D39A 3VWKA 1I7RA 1RK1A 5EU5A 4GUPA 4WU7A 5SWZA 4Y2DA 2CLZA 1S7WA 3FQXA 3TBSA 3TF7A 4F7PA 4X6DA 5HGDA 3BH9A 3JTSA 1W72A 4G8IA 5DDHA 1T7YA 3HAEA 1NANH 1AGDA 4Y4FA 3SCMA 3VFPA 1S9XA 2CIIA 1DE4A 3M17A 4LNRA 1A6ZA 5MEPA 4WO4A 4U1LA 3FRUA 2J8UA 3KXFA 1ZT4A 2X4OA 2GUOA 1LEGA 1QVOA 3FQRA 1VADA 3TN0A 1S7SA 4ZUSA 1ED3A 1YPZA 2ZOLA 4PR5A 4PDCE 1AO7A 1NEZA 3JVGA 3E6FA 2VABA 1LEKA 1I1FA 4QOKA 3X14A 1UQSA 3VXUA 1B0RA 1G7QA 2OI9A 4ZAKA 1FG2A 1S7QA 3GSRA 2X4SA 2VLRA 2CLVA 3I6KA 4HWZA 4ZUTA 3RWCA 5IB3A 1ZT1A 5E8PA 1EFXA 3CPLA 3GJFA 3VFRA 1VGKA 1FFNA 4E5XA 4GKNA 4PJAA 3GMRA 3VFSA 4L3EA 1QRNA 4F7TA 4PJIA 3ECBA 5C0EA 4Z76A 5J6HA 3LV3A 1KJMA 2BNRA 1S7TA 5EU6A 4PJ8A 3VXPA 4PJ5A 1CD1A 3DXAA 4NHUE 5E8OA 4E0RA 3VXNA 2X4RA 4PJ7A 3VJ6A 2YPLA 1T1YA 1TVBA 3WS3A 5IVXA 4FFEX 1QO3A 3D25A 4N8VA 3GSUA 3L3IA 3MGTA 3T8XA 3HPJA 1I1AA 3BWAA 4L3CA 1T22A 4JRYA 4PG2A 3UTTA 4PV9A 1L8JA 1TMCA 1HHJA 1FZKA 4ELMA 3X12A 3B6SA 2AKRA 3HLAA 4NT6A 4PP8C 3WS6A 5IROA 5EU3A 1OSZA 3BP7A 3FT2A 4NQXA 3WL9A 5E9DA 4NO3A 3TVMA 1ONQA 1T1WA 3RTQA 4CVZA 2X4QA 3DX6A 4PRAA 5HYJA 3MV9A 1ZHLA 2Q7YA 3BW9A 4GKSA 4MS8A 3TJHA 2FWOA 2VAAA 3AU1A 3DMMA 5HHQA 4D0DA 1OGTA 4U6YA 1FO0H 3MRKA 3WLBA 2OL3H 1A1MA 5IB1A 1T80A 5AD0A 2CLRA 3MRNA 1QEWA 1ZHKA 3OV6A 4G42A 4Z77A 3ARGA 2PYEA 1LK2A 3BVNA 4NQCA 5F9JA 3UPRA 2AXGA 3E2HA 3HE6A 1RJZA 2HN7A 3MRMA 3BO8A 3QUZA 4L8BA 3FOLA 3HCVA 4I4WA 5INDA 3BEWA 3QUXA 5GSRA 3RWFA 5B38A 3LKNA 1E27A 5IM7A 3VFUA 2F54A 3PWLA 4G9FA 2VLLA 3GSVA 3GMNA 1HYRC 1W0WA 2FIKA 1CE6A 2RFXA 4PGBA 4UQ2A 4UQ3A 1T7ZA 1N3NA 5MEOA 3UTQA 3VFVA 3IT8D 3GSWA 4QRQA 4N0UA 3P9LA 3RL1A 1I7TA 1R3HA 5C0AA 3TIDA 3QULA 3P4MA 4MJIA 3KPSA 2VLJA 3DX7A 3I6GA 4WWKC 3SPVA 4PJ9A 1VACA 5C08A 3GMLA 4HX1A 3GSXA 4QRTA 5FKPA 3ROOA 3FFCA 3VFWA 4LCWA 2YEZA 2C7UA 3O8XA 2ESVA 4MJ6A 4IIQC 1A1NA 1DDHA 3MRIA 3MRLA 4NQVA 4V3EB 2FZ3A 2VLKA 3CCHA 4U1MA 3E6HA 2AXFA 5D9SA 4CW1A 3GIVA 3P4OA 3MRPA 3MRCA 1T1XA 1Z5LA 5C9JA 5MEQA 1X7QA 5EO0A 3VXOA 2BVPA 1AGEA 4X6FA 5BJTA 3KYNA 1JHTA 4EI5A 2ZSVA 1GZPA 3CZFA 3ES6A 4QRUA 4ZUVA 3NFNA 1ZAGA 3ILPA 3O3AA 5C0FA 1Q94A 5BXFA 3HUJA 1AGBA 2HJLA 3P9MA 4HV8A 3RUGA 1S7XA 1A1OA 1BD2A 1G6RH 1S9WA 3KPRA 4PRHA 3QFDA 1NAMH 3RWDA 3M1BA 4MXQA 3ARBA 3DX8A 4HKJA 5J6GA 3OX8A 4L8DA 5D2NA 1OF2A 4PREA 3MRHA 2V2XA 4JFPA 1MHEA 1S7VA 1EXUA 3GMPA 3TO4A 1FZOA 1YN6A 3I6LD 3LKSA 5C0GA 2XFXA 3FQNA 5EUOA 1K5NA 4L8SC 3BP4A 1HSBA 2BVOA 4NQDA 3RWGA 3QUKA 3UBXA 2E7LE 2V2WA 2PO6A 3QQ3A 2FO4A 3MA7A 4U1SA 3TFKA 1YDPA 2P5EA 3HE7A 3SDCA 5FDWA 4JFQA 5IB4A 5C0JA 3X13A 3BXNA 3MYJA 3QUYA 3VXSA 5EOTA 3MV7A 1T21A 4NNXA 3KPPA 3LKRA 3C9NA 4L9LC 3VFOA 1IM3A 1T7XA 4JQXA 1SYVA 4MJ5A 3RWEA 1HHHA 4PGDA 5L2KA 3REWA 2XPGA 4N0FA 4HUXA 1FFOA 1XH3A 3AM8A 3ILQC 4PJHA 4L4VA 3GMMA 4MNGA 1EEZA 1A9EA 5HGHA 3FT4A 4APQA 1I4FA 5D5MA 3H9SA 5JHDA 3QQ4A 4PJFA 1ZVSA 3SDAA 1FFPA 1P4LA 3AREA 3FONA 4WW2C 4D0BA 4O2CA 3VH8A 1YN7A 2CIKA 1P7QA 4Y16A 1N59A 2GT9A 1LD9A 3MREA 3O3BA 1ZSDA 1K8DA 4PRBA 5DEFA 5BS0A 2X4PA 3FT3A 2BSTA 3D2UA 1T0NA 3B3IA 5IEHA 1AGCA 2X4NA 3OXSA 3RL2A 3RGVC 4PJXA 1KBGH 1E28A 3FQTA 4LHUA 1KJ3H 1JF1A 4V3DB 4LCCC 3V5HA 4JFEA 2GAZA 1T7WA 3E3QA 4G9DA 4QRRA 4XXCA 4PV8A 3OXRA 3SKMA 4G59A 3W0WA 3VCLA 1KPRA 3QDJA 4FTVA 1EEYA 5HHPA 3RZCA 1QSFA 3PWUA 3PWJA 5ENWA 3MRQA 3SDDA 5HHMA 1W0VA 5MENA 5E6IC 4CVXA 4PRIA 1KPVA 2YPKA 1JFMA 5D7LA 3WUWA 1BIIA 1U58A 3LN4A 3GSOA 3P77A 5BRZA 4NSKA 3QDMA 1S8DA 4PJGA 2GTWA 4PJBA 3CDGA 5F1NA 3CC5A 1N2RA 2AV7A 4ZUUA 1M05A 1DUYA 4NQEA 4U1NA 5EFIA 3BGMA 5D2LA 3CVHA 3O4LA 3PQYA 3VRJA 3D3VA 1HSAA 4WU5A 2MHAA 1T0MA 5INCA 5C0BA 5C0IA 2P5WA 1AGFA 4Y4HA 4JRXA 5EU4A 3TBWA 1I1YA 3P4NA 1ZHBA 2BNQA 1B3JA 5MERA 4L8CA 1INQA 1MWAH 4I48A 2A83A 5SWQA 4IHOA 1HHIA 1GZQA 3ERYA 5L2JA 4MNQA 3MV8A 2X4TA 4JFOA 3LN5A 1WBYA 3MRJA 3CH1A 3VXMA 5C09A 3GMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IB2 A;  4O2F A;  1UXW A;  1G7P A;  4NO2 A;  1CG9 A;  1JPG A;  4U1J A;  3ROL A;  3L3D A;  4S0U C;  3VRI A;  5IB5 A;  4L29 A;  1WBZ A;  5E00 A;  3FOM A;  5H94 A;  4LCY A;  1TVH A;  3KPN A;  4PRN A;  3SDX A;  3G08 A;  4WUU A;  3TIE A;  4WDI A;  4MQ7 A;  3PWV A;  3TBV A;  3VWJ A;  3SJV A;  3MRF A;  4PRD A;  1ZS8 A;  1XR9 A;  5C07 A;  3DTX A;  4WJ5 A;  2BSS A;  1T20 A;  3MR9 A;  3BH8 A;  1JGE A;  1WBX A;  4ZUW A;  3VFN A;  5GSV A;  1RJY A;  2ZOK A;  3V5D A;  3TZV C;  5C0D A;  1P1Z A;  3ARF A;  3RWJ A;  4JFD A;  4U1K A;  1QR1 A;  1T7V A;  5F1I A;  1QSE A;  1IM9 A;  1QQD A;  3GSQ A;  3GSN H;  1BZ9 A;  3O3E A;  4X6E A;  5HHO A;  5ISZ A;  4U1H A;  5C0C A;  3KPO A;  1T1Z A;  5B39 A;  4K71 B;  1LP9 A;  3FTG A;  3BEV A;  1OGA A;  3HG1 A;  4D0C A;  3TPU E;  5HHN A;  3V5K A;  3QDG A;  5ACZ A;  4O2E A;  4PRP A;  3DBX A;  3MRR A;  3LKO A;  3PAB A;  2AK4 A;  2F53 A;  4HUW A;  4QRP A;  1KJV A;  1KCG C;  2VE6 A;  4G8G A;  3IXA A;  4X6C A;  4NO5 A;  3L9R A;  1KPU A;  1N5A A;  4K7F A;  3P73 A;  3ARD A;  1ZT7 A;  1JGD A;  4HUV A;  4HS3 A;  3KLA A;  4PJC A;  3H7B A;  2ZSW A;  3FQW A;  3KWW A;  3JTT A;  4U6X A;  4Y4K A;  1A9B A;  3VXR A;  3QFJ A;  3L3H A;  1FZJ A;  1S9Y A;  3S6C A;  4F7C A;  1XR8 A;  2BVQ A;  2H6P A;  5IEK A;  2X4U A;  2DYP A;  1S7U A;  2FYY A;  3TBT A;  3UTS A;  3LKP A;  3PWN A;  1I7U A;  3L3G A;  5EO1 A;  4ZFZ A;  3TA3 A;  3VFM A;  2CKB H;  2X70 A;  2H26 A;  5FA4 A;  3TBY A;  2NW3 A;  1B0G A;  3SKO A;  4G43 A;  4HUU A;  4PJE A;  3PWP A;  2GJ6 A;  2BSR A;  5SWS A;  3D18 A;  2WY3 A;  1HHK A;  2GTZ A;  3L3J A;  4PGC A;  3RWI A;  3KYO A;  4PGE A;  1BQH A;  2UWE A;  3MGO A;  2AV1 A;  2NX5 A;  3MRG A;  1HHG A;  3BZF A;  1M6O A;  3TO2 A;  4F7E A;  1JE6 A;  1LQV A;  3BZE A;  3U0P A;  1S7R A;  3MRB A;  4QRS A;  3QZW A;  5D7I A;  1KJ2 H;  4PJD A;  1KTL A;  5E8N A;  5F7D A;  3KPM A;  1XZ0 A;  2D31 A;  3C8K A;  3MRD A;  1LDP H;  3RWH A;  3LKQ A;  4JQV A;  3QI9 A;  5FA3 A;  5DEG A;  4EUP A;  1RK0 A;  3FQU A;  4NNY A;  4N0C A;  3T1F A;  5D7J C;  3H9H A;  4Z78 A;  4IRJ A;  1C16 A;  3BUY A;  3QEQ A;  3L3K A;  4JFF A;  1DUZ A;  1SYS A;  3KPL A;  1JUF A;  3MRO A;  2JCC A;  1UXS A;  3GMO A;  3O9W A;  3VFT A;  4ONO A;  3X11 A;  4PG9 A;  2GIT A;  1MHC A;  2HLA A;  4F7M A;  1PQZ A;  1HOC A;  3O3D A;  4MVB A;  5HGB A;  1AKJ A;  2HJK A;  1ZHN A;  2F74 A;  3BHB A;  1MI5 A;  4N5E A;  4NO0 A;  4U1I A;  1QLF A;  3W39 A;  2BCK A;  1FZM A;  4EN3 C;  4L4T A;  5HGA A;  3KPQ A;  5J1A A;  4IRS A;  4MX7 A;  3JTC A;  1JPF A;  3D39 A;  3VWK A;  1I7R A;  1RK1 A;  5EU5 A;  4GUP A;  4WU7 A;  5SWZ A;  4Y2D A;  2CLZ A;  1S7W A;  3FQX A;  3TBS A;  3TF7 A;  4F7P A;  4X6D A;  5HGD A;  3BH9 A;  3JTS A;  1W72 A;  4G8I A;  5DDH A;  1T7Y A;  3HAE A;  1NAN H;  1AGD A;  4Y4F A;  3SCM A;  3VFP A;  1S9X A;  2CII A;  1DE4 A;  3M17 A;  4LNR A;  1A6Z A;  5MEP A;  4WO4 A;  4U1L A;  3FRU A;  2J8U A;  3KXF A;  1ZT4 A;  2X4O A;  2GUO A;  1LEG A;  1QVO A;  3FQR A;  1VAD A;  3TN0 A;  1S7S A;  4ZUS A;  1ED3 A;  1YPZ A;  2ZOL A;  4PR5 A;  4PDC E;  1AO7 A;  1NEZ A;  3JVG A;  3E6F A;  2VAB A;  1LEK A;  1I1F A;  4QOK A;  3X14 A;  1UQS A;  3VXU A;  1B0R A;  1G7Q A;  2OI9 A;  4ZAK A;  1FG2 A;  1S7Q A;  3GSR A;  2X4S A;  2VLR A;  2CLV A;  3I6K A;  4HWZ A;  4ZUT A;  3RWC A;  5IB3 A;  1ZT1 A;  5E8P A;  1EFX A;  3CPL A;  3GJF A;  3VFR A;  1VGK A;  1FFN A;  4E5X A;  4GKN A;  4PJA A;  3GMR A;  3VFS A;  4L3E A;  1QRN A;  4F7T A;  4PJI A;  3ECB A;  5C0E A;  4Z76 A;  5J6H A;  3LV3 A;  1KJM A;  2BNR A;  1S7T A;  5EU6 A;  4PJ8 A;  3VXP A;  4PJ5 A;  1CD1 A;  3DXA A;  4NHU E;  5E8O A;  4E0R A;  3VXN A;  2X4R A;  4PJ7 A;  3VJ6 A;  2YPL A;  1T1Y A;  1TVB A;  3WS3 A;  5IVX A;  4FFE X;  1QO3 A;  3D25 A;  4N8V A;  3GSU A;  3L3I A;  3MGT A;  3T8X A;  3HPJ A;  1I1A A;  3BWA A;  4L3C A;  1T22 A;  4JRY A;  4PG2 A;  3UTT A;  4PV9 A;  1L8J A;  1TMC A;  1HHJ A;  1FZK A;  4ELM A;  3X12 A;  3B6S A;  2AKR A;  3HLA A;  4NT6 A;  4PP8 C;  3WS6 A;  5IRO A;  5EU3 A;  1OSZ A;  3BP7 A;  3FT2 A;  4NQX A;  3WL9 A;  5E9D A;  4NO3 A;  3TVM A;  1ONQ A;  1T1W A;  3RTQ A;  4CVZ A;  2X4Q A;  3DX6 A;  4PRA A;  5HYJ A;  3MV9 A;  1ZHL A;  2Q7Y A;  3BW9 A;  4GKS A;  4MS8 A;  3TJH A;  2FWO A;  2VAA A;  3AU1 A;  3DMM A;  5HHQ A;  4D0D A;  1OGT A;  4U6Y A;  1FO0 H;  3MRK A;  3WLB A;  2OL3 H;  1A1M A;  5IB1 A;  1T80 A;  5AD0 A;  2CLR A;  3MRN A;  1QEW A;  1ZHK A;  3OV6 A;  4G42 A;  4Z77 A;  3ARG A;  2PYE A;  1LK2 A;  3BVN A;  4NQC A;  5F9J A;  3UPR A;  2AXG A;  3E2H A;  3HE6 A;  1RJZ A;  2HN7 A;  3MRM A;  3BO8 A;  3QUZ A;  4L8B A;  3FOL A;  3HCV A;  4I4W A;  5IND A;  3BEW A;  3QUX A;  5GSR A;  3RWF A;  5B38 A;  3LKN A;  1E27 A;  5IM7 A;  3VFU A;  2F54 A;  3PWL A;  4G9F A;  2VLL A;  3GSV A;  3GMN A;  1HYR C;  1W0W A;  2FIK A;  1CE6 A;  2RFX A;  4PGB A;  4UQ2 A;  4UQ3 A;  1T7Z A;  1N3N A;  5MEO A;  3UTQ A;  3VFV A;  3IT8 D;  3GSW A;  4QRQ A;  4N0U A;  3P9L A;  3RL1 A;  1I7T A;  1R3H A;  5C0A A;  3TID A;  3QUL A;  3P4M A;  4MJI A;  3KPS A;  2VLJ A;  3DX7 A;  3I6G A;  4WWK C;  3SPV A;  4PJ9 A;  1VAC A;  5C08 A;  3GML A;  4HX1 A;  3GSX A;  4QRT A;  5FKP A;  3ROO A;  3FFC A;  3VFW A;  4LCW A;  2YEZ A;  2C7U A;  3O8X A;  2ESV A;  4MJ6 A;  4IIQ C;  1A1N A;  1DDH A;  3MRI A;  3MRL A;  4NQV A;  4V3E B;  2FZ3 A;  2VLK A;  3CCH A;  4U1M A;  3E6H A;  2AXF A;  5D9S A;  4CW1 A;  3GIV A;  3P4O A;  3MRP A;  3MRC A;  1T1X A;  1Z5L A;  5C9J A;  5MEQ A;  1X7Q A;  5EO0 A;  3VXO A;  2BVP A;  1AGE A;  4X6F A;  5BJT A;  3KYN A;  1JHT A;  4EI5 A;  2ZSV A;  1GZP A;  3CZF A;  3ES6 A;  4QRU A;  4ZUV A;  3NFN A;  1ZAG A;  3ILP A;  3O3A A;  5C0F A;  1Q94 A;  5BXF A;  3HUJ A;  1AGB A;  2HJL A;  3P9M A;  4HV8 A;  3RUG A;  1S7X A;  1A1O A;  1BD2 A;  1G6R H;  1S9W A;  3KPR A;  4PRH A;  3QFD A;  1NAM H;  3RWD A;  3M1B A;  4MXQ A;  3ARB A;  3DX8 A;  4HKJ A;  5J6G A;  3OX8 A;  4L8D A;  5D2N A;  1OF2 A;  4PRE A;  3MRH A;  2V2X A;  4JFP A;  1MHE A;  1S7V A;  1EXU A;  3GMP A;  3TO4 A;  1FZO A;  1YN6 A;  3I6L D;  3LKS A;  5C0G A;  2XFX A;  3FQN A;  5EUO A;  1K5N A;  4L8S C;  3BP4 A;  1HSB A;  2BVO A;  4NQD A;  3RWG A;  3QUK A;  3UBX A;  2E7L E;  2V2W A;  2PO6 A;  3QQ3 A;  2FO4 A;  3MA7 A;  4U1S A;  3TFK A;  1YDP A;  2P5E A;  3HE7 A;  3SDC A;  5FDW A;  4JFQ A;  5IB4 A;  5C0J A;  3X13 A;  3BXN A;  3MYJ A;  3QUY A;  3VXS A;  5EOT A;  3MV7 A;  1T21 A;  4NNX A;  3KPP A;  3LKR A;  3C9N A;  4L9L C;  3VFO A;  1IM3 A;  1T7X A;  4JQX A;  1SYV A;  4MJ5 A;  3RWE A;  1HHH A;  4PGD A;  5L2K A;  3REW A;  2XPG A;  4N0F A;  4HUX A;  1FFO A;  1XH3 A;  3AM8 A;  3ILQ C;  4PJH A;  4L4V A;  3GMM A;  4MNG A;  1EEZ A;  1A9E A;  5HGH A;  3FT4 A;  4APQ A;  1I4F A;  5D5M A;  3H9S A;  5JHD A;  3QQ4 A;  4PJF A;  1ZVS A;  3SDA A;  1FFP A;  1P4L A;  3ARE A;  3FON A;  4WW2 C;  4D0B A;  4O2C A;  3VH8 A;  1YN7 A;  2CIK A;  1P7Q A;  4Y16 A;  1N59 A;  2GT9 A;  1LD9 A;  3MRE A;  3O3B A;  1ZSD A;  1K8D A;  4PRB A;  5DEF A;  5BS0 A;  2X4P A;  3FT3 A;  2BST A;  3D2U A;  1T0N A;  3B3I A;  5IEH A;  1AGC A;  2X4N A;  3OXS A;  3RL2 A;  3RGV C;  4PJX A;  1KBG H;  1E28 A;  3FQT A;  4LHU A;  1KJ3 H;  1JF1 A;  4V3D B;  4LCC C;  3V5H A;  4JFE A;  2GAZ A;  1T7W A;  3E3Q A;  4G9D A;  4QRR A;  4XXC A;  4PV8 A;  3OXR A;  3SKM A;  4G59 A;  3W0W A;  3VCL A;  1KPR A;  3QDJ A;  4FTV A;  1EEY A;  5HHP A;  3RZC A;  1QSF A;  3PWU A;  3PWJ A;  5ENW A;  3MRQ A;  3SDD A;  5HHM A;  1W0V A;  5MEN A;  5E6I C;  4CVX A;  4PRI A;  1KPV A;  2YPK A;  1JFM A;  5D7L A;  3WUW A;  1BII A;  1U58 A;  3LN4 A;  3GSO A;  3P77 A;  5BRZ A;  4NSK A;  3QDM A;  1S8D A;  4PJG A;  2GTW A;  4PJB A;  3CDG A;  5F1N A;  3CC5 A;  1N2R A;  2AV7 A;  4ZUU A;  1M05 A;  1DUY A;  4NQE A;  4U1N A;  5EFI A;  3BGM A;  5D2L A;  3CVH A;  3O4L A;  3PQY A;  3VRJ A;  3D3V A;  1HSA A;  4WU5 A;  2MHA A;  1T0M A;  5INC A;  5C0B A;  5C0I A;  2P5W A;  1AGF A;  4Y4H A;  4JRX A;  5EU4 A;  3TBW A;  1I1Y A;  3P4N A;  1ZHB A;  2BNQ A;  1B3J A;  5MER A;  4L8C A;  1INQ A;  1MWA H;  4I48 A;  2A83 A;  5SWQ A;  4IHO A;  1HHI A;  1GZQ A;  3ERY A;  5L2J A;  4MNQ A;  3MV8 A;  2X4T A;  4JFO A;  3LN5 A;  1WBY A;  3MRJ A;  3CH1 A;  3VXM A;  5C09 A;  3GMQ A; 
#chains in the Genus database with same CATH topology
 5IB2 A;  4O2F A;  1UXW A;  1G7P A;  4NO2 A;  1CG9 A;  1JPG A;  4U1J A;  3ROL A;  3L3D A;  2O5N A;  4S0U C;  3VRI A;  5IB5 A;  4L29 A;  1WBZ A;  5E00 A;  3FOM A;  5H94 A;  4LCY A;  1TVH A;  3KPN A;  4PRN A;  3SDX A;  3G08 A;  4WUU A;  3TIE A;  4WDI A;  4MQ7 A;  3PWV A;  3TBV A;  3VWJ A;  3SJV A;  3MRF A;  4PRD A;  1ZS8 A;  1XR9 A;  5C07 A;  3DTX A;  4WJ5 A;  2BSS A;  1T20 A;  3MR9 A;  3BH8 A;  1JGE A;  1WBX A;  4ZUW A;  3VFN A;  5GSV A;  1RJY A;  2ZOK A;  3I0T A;  3TZV C;  5C0D A;  1P1Z A;  3ARF A;  3RWJ A;  3V5D A;  4JFD A;  4U1K A;  1QR1 A;  1T7V A;  5F1I A;  1QSE A;  1IM9 A;  1QQD A;  3GSQ A;  3GSN H;  1BZ9 A;  3O3E A;  4X6E A;  5HHO A;  5ISZ A;  4U1H A;  5C0C A;  3KPO A;  1T1Z A;  5B39 A;  4K71 B;  1LP9 A;  3FTG A;  3BEV A;  1OGA A;  3HG1 A;  4D0C A;  3TPU E;  5HHN A;  3V5K A;  3QDG A;  5ACZ A;  4O2E A;  4PRP A;  3DBX A;  3MRR A;  3LKO A;  3PAB A;  2AK4 A;  2F53 A;  4HUW A;  4QRP A;  1KJV A;  1KCG C;  2VE6 A;  4G8G A;  3IXA A;  4X6C A;  4NO5 A;  3L9R A;  1KPU A;  1N5A A;  4K7F A;  3P73 A;  3ARD A;  1ZT7 A;  1JGD A;  4HUV A;  4HS3 A;  3KLA A;  4PJC A;  3H7B A;  2ZSW A;  3FQW A;  3KWW A;  3JTT A;  4U6X A;  2IA1 A;  4Y4K A;  1A9B A;  3VXR A;  3QFJ A;  3L3H A;  1FZJ A;  1S9Y A;  3S6C A;  4F7C A;  1XR8 A;  2BVQ A;  2H6P A;  5IEK A;  2X4U A;  2DYP A;  1S7U A;  2FYY A;  3TBT A;  3UTS A;  3LKP A;  3PWN A;  1I7U A;  3L3G A;  5EO1 A;  4ZFZ A;  3TA3 A;  3VFM A;  2CKB H;  2X70 A;  2H26 A;  5FA4 A;  3TBY A;  2NW3 A;  1B0G A;  3SKO A;  4G43 A;  4HUU A;  4PJE A;  3PWP A;  2GJ6 A;  2BSR A;  5SWS A;  3D18 A;  2WY3 A;  1HHK A;  2GTZ A;  3L3J A;  4PGC A;  3RWI A;  3KYO A;  4PGE A;  1BQH A;  2UWE A;  3MGO A;  2AV1 A;  2NX5 A;  3MRG A;  1HHG A;  3BZF A;  1M6O A;  3TO2 A;  4F7E A;  1JE6 A;  1LQV A;  3BZE A;  3U0P A;  1S7R A;  3MRB A;  4QRS A;  3QZW A;  5D7I A;  1KJ2 H;  4PJD A;  1KTL A;  5E8N A;  5F7D A;  3KPM A;  1XZ0 A;  2D31 A;  3C8K A;  3MRD A;  1LDP H;  3RWH A;  3LKQ A;  4JQV A;  3QI9 A;  5FA3 A;  5DEG A;  4EUP A;  1RK0 A;  3FQU A;  4NNY A;  4N0C A;  3T1F A;  5D7J C;  3H9H A;  4Z78 A;  4IRJ A;  1C16 A;  3BUY A;  3QEQ A;  3L3K A;  4JFF A;  1DUZ A;  1SYS A;  3KPL A;  1JUF A;  3MRO A;  2JCC A;  1UXS A;  3GMO A;  3O9W A;  3VFT A;  4ONO A;  3X11 A;  4PG9 A;  2GIT A;  1MHC A;  2HLA A;  4F7M A;  1PQZ A;  1HOC A;  3O3D A;  4MVB A;  5HGB A;  1AKJ A;  4BKW A;  2HJK A;  1ZHN A;  2F74 A;  3BHB A;  1MI5 A;  4N5E A;  4NO0 A;  4U1I A;  1QLF A;  3W39 A;  2BCK A;  1FZM A;  4EN3 C;  4L4T A;  5HGA A;  3KPQ A;  5J1A A;  4IRS A;  4MX7 A;  3JTC A;  1JPF A;  3D39 A;  3VWK A;  1I7R A;  2NYK A;  1RK1 A;  5EU5 A;  4GUP A;  4WU7 A;  5SWZ A;  4Y2D A;  2CLZ A;  1S7W A;  3FQX A;  3TBS A;  3TF7 A;  4F7P A;  4X6D A;  5HGD A;  3BH9 A;  3JTS A;  1W72 A;  4G8I A;  5DDH A;  1T7Y A;  3HAE A;  1NAN H;  1AGD A;  4Y4F A;  3SCM A;  3VFP A;  1S9X A;  2CII A;  1DE4 A;  3M17 A;  4LNR A;  1A6Z A;  5MEP A;  4WO4 A;  4U1L A;  3FRU A;  2J8U A;  3KXF A;  1ZT4 A;  2X4O A;  2GUO A;  1LEG A;  1QVO A;  3FQR A;  1VAD A;  3TN0 A;  1S7S A;  4ZUS A;  1ED3 A;  1YPZ A;  2ZOL A;  4PR5 A;  4PDC E;  1AO7 A;  1NEZ A;  3JVG A;  3E6F A;  2VAB A;  1LEK A;  1I1F A;  4QOK A;  3X14 A;  1UQS A;  3VXU A;  1B0R A;  1G7Q A;  2OI9 A;  4ZAK A;  1FG2 A;  1S7Q A;  3GSR A;  2X4S A;  2VLR A;  2CLV A;  3I6K A;  4HWZ A;  4ZUT A;  3RWC A;  5IB3 A;  1ZT1 A;  5E8P A;  1EFX A;  3CPL A;  3GJF A;  3VFR A;  1VGK A;  1FFN A;  4E5X A;  4GKN A;  4PJA A;  3GMR A;  3VFS A;  4L3E A;  1QRN A;  4F7T A;  4PJI A;  3ECB A;  5C0E A;  4Z76 A;  5J6H A;  3LV3 A;  1KJM A;  2BNR A;  1S7T A;  5EU6 A;  4PJ8 A;  3VXP A;  4PJ5 A;  1CD1 A;  3DXA A;  4NHU E;  5E8O A;  4E0R A;  3VXN A;  2X4R A;  4PJ7 A;  3VJ6 A;  2YPL A;  1T1Y A;  1TVB A;  3WS3 A;  5IVX A;  4FFE X;  1QO3 A;  3D25 A;  4N8V A;  3GSU A;  3L3I A;  3MGT A;  3T8X A;  3HPJ A;  1I1A A;  3BWA A;  4L3C A;  1T22 A;  4JRY A;  4PG2 A;  3UTT A;  4PV9 A;  1L8J A;  1TMC A;  1HHJ A;  1FZK A;  4ELM A;  3X12 A;  3B6S A;  2AKR A;  3HLA A;  4NT6 A;  4PP8 C;  3WS6 A;  5IRO A;  5EU3 A;  1OSZ A;  3BP7 A;  3FT2 A;  4NQX A;  3WL9 A;  5E9D A;  4NO3 A;  3TVM A;  1ONQ A;  1T1W A;  3RTQ A;  4CVZ A;  2X4Q A;  3DX6 A;  4PRA A;  5HYJ A;  3MV9 A;  1ZHL A;  2Q7Y A;  3BW9 A;  4GKS A;  4MS8 A;  3TJH A;  2FWO A;  2VAA A;  3AU1 A;  3DMM A;  5HHQ A;  4D0D A;  1OGT A;  4U6Y A;  1FO0 H;  3MRK A;  3WLB A;  2OL3 H;  1A1M A;  5IB1 A;  1T80 A;  5AD0 A;  2CLR A;  3MRN A;  1QEW A;  1ZHK A;  3OV6 A;  4G42 A;  4Z77 A;  3ARG A;  2PYE A;  1LK2 A;  3BVN A;  4NQC A;  5F9J A;  3UPR A;  2AXG A;  3E2H A;  3HE6 A;  1RJZ A;  2HN7 A;  3MRM A;  3BO8 A;  3QUZ A;  4L8B A;  3FOL A;  3HCV A;  4I4W A;  5IND A;  3BEW A;  3QUX A;  5GSR A;  3RWF A;  5B38 A;  3LKN A;  1E27 A;  5IM7 A;  3VFU A;  2F54 A;  3PWL A;  4G9F A;  2VLL A;  3GSV A;  3GMN A;  1HYR C;  1W0W A;  2FIK A;  1CE6 A;  2RFX A;  4PGB A;  4UQ2 A;  4UQ3 A;  1T7Z A;  1N3N A;  5MEO A;  3UTQ A;  3VFV A;  3IT8 D;  3GSW A;  4QRQ A;  4N0U A;  3P9L A;  3RL1 A;  1I7T A;  1R3H A;  5C0A A;  3TID A;  3QUL A;  3P4M A;  4MJI A;  3KPS A;  2VLJ A;  3DX7 A;  3I6G A;  4WWK C;  3SPV A;  4PJ9 A;  1VAC A;  5C08 A;  3GML A;  4HX1 A;  3GSX A;  4QRT A;  5FKP A;  3ROO A;  3FFC A;  3VFW A;  4LCW A;  2YEZ A;  2C7U A;  3O8X A;  2ESV A;  4MJ6 A;  4IIQ C;  1A1N A;  1DDH A;  3MRI A;  3MRL A;  4NQV A;  4V3E B;  2FZ3 A;  2VLK A;  3CCH A;  4U1M A;  3E6H A;  2AXF A;  5D9S A;  4CW1 A;  3GIV A;  3P4O A;  3MRP A;  3MRC A;  1T1X A;  1Z5L A;  5C9J A;  5MEQ A;  1X7Q A;  5EO0 A;  3VXO A;  2BVP A;  1AGE A;  4X6F A;  5BJT A;  3KYN A;  1JHT A;  4EI5 A;  2ZSV A;  1GZP A;  3CZF A;  3ES6 A;  4QRU A;  4ZUV A;  3NFN A;  1ZAG A;  3ILP A;  3O3A A;  5C0F A;  1Q94 A;  5BXF A;  3HUJ A;  4G59 C;  1AGB A;  2HJL A;  3P9M A;  4HV8 A;  3RUG A;  1S7X A;  1A1O A;  1BD2 A;  1G6R H;  1S9W A;  3KPR A;  4PRH A;  4JO8 A;  3QFD A;  1NAM H;  3RWD A;  3M1B A;  4MXQ A;  3ARB A;  3DX8 A;  4HKJ A;  5J6G A;  3OX8 A;  4L8D A;  5D2N A;  1OF2 A;  4PRE A;  3MRH A;  2V2X A;  4JFP A;  1MHE A;  1S7V A;  1EXU A;  3GMP A;  3TO4 A;  1FZO A;  1YN6 A;  3I6L D;  3LKS A;  5C0G A;  2XFX A;  3FQN A;  5EUO A;  1K5N A;  4L8S C;  3BP4 A;  1HSB A;  2BVO A;  4NQD A;  3RWG A;  3QUK A;  3UBX A;  2E7L E;  2V2W A;  2PO6 A;  3QQ3 A;  2FO4 A;  3MA7 A;  4U1S A;  3TFK A;  1YDP A;  2P5E A;  3HE7 A;  3SDC A;  5FDW A;  4JFQ A;  5IB4 A;  5C0J A;  3X13 A;  3BXN A;  3MYJ A;  3QUY A;  3VXS A;  5EOT A;  3MV7 A;  1T21 A;  4NNX A;  3KPP A;  3LKR A;  3C9N A;  4L9L C;  3VFO A;  1IM3 A;  1T7X A;  4JQX A;  1SYV A;  4MJ5 A;  3RWE A;  1HHH A;  4PGD A;  5L2K A;  3REW A;  2XPG A;  4N0F A;  4HUX A;  1FFO A;  1XH3 A;  3AM8 A;  3ILQ C;  4PJH A;  4L4V A;  3GMM A;  4MNG A;  1EEZ A;  1A9E A;  5HGH A;  3FT4 A;  4APQ A;  1I4F A;  5D5M A;  3H9S A;  5JHD A;  3QQ4 A;  4PJF A;  1ZVS A;  3SDA A;  1FFP A;  1P4L A;  3ARE A;  3FON A;  4WW2 C;  4D0B A;  4O2C A;  3VH8 A;  1YN7 A;  2CIK A;  1P7Q A;  4Y16 A;  1N59 A;  2GT9 A;  1LD9 A;  3MRE A;  3O3B A;  1ZSD A;  1K8D A;  4PRB A;  5DEF A;  5BS0 A;  2X4P A;  3FT3 A;  2BST A;  3D2U A;  1T0N A;  3B3I A;  5IEH A;  1AGC A;  2X4N A;  3OXS A;  3RL2 A;  3RGV C;  4PJX A;  1KBG H;  1E28 A;  3FQT A;  4LHU A;  1KJ3 H;  1JF1 A;  4V3D B;  4LCC C;  3V5H A;  4JFE A;  2GAZ A;  1T7W A;  3E3Q A;  4G9D A;  4QRR A;  4XXC A;  4PV8 A;  3OXR A;  3SKM A;  4G59 A;  3W0W A;  3VCL A;  1KPR A;  3QDJ A;  4FTV A;  1EEY A;  5HHP A;  3RZC A;  1QSF A;  3PWU A;  3PWJ A;  5ENW A;  3MRQ A;  3SDD A;  5HHM A;  1W0V A;  5MEN A;  5E6I C;  4CVX A;  4PRI A;  1KPV A;  2YPK A;  1JFM A;  5D7L A;  3WUW A;  1BII A;  1U58 A;  3LN4 A;  3GSO A;  3P77 A;  5BRZ A;  4NSK A;  3QDM A;  1S8D A;  4PJG A;  2GTW A;  4PJB A;  3CDG A;  5F1N A;  3CC5 A;  1N2R A;  2AV7 A;  4ZUU A;  1M05 A;  1DUY A;  4NQE A;  4U1N A;  5EFI A;  3BGM A;  5D2L A;  3CVH A;  3O4L A;  3PQY A;  3VRJ A;  3D3V A;  1HSA A;  4WU5 A;  2MHA A;  1T0M A;  5INC A;  5C0B A;  5C0I A;  2P5W A;  1AGF A;  4Y4H A;  4JRX A;  5EU4 A;  3TBW A;  1I1Y A;  3P4N A;  1ZHB A;  2BNQ A;  1B3J A;  5MER A;  4L8C A;  1INQ A;  1MWA H;  4I48 A;  2A83 A;  5SWQ A;  4IHO A;  1HHI A;  1GZQ A;  3ERY A;  5L2J A;  4MNQ A;  3MV8 A;  2X4T A;  4JFO A;  3LN5 A;  1WBY A;  3MRJ A;  3CH1 A;  3VXM A;  5C09 A;  3GMQ A; 
#chains in the Genus database with same CATH homology
 5IB2 A;  4O2F A;  1UXW A;  1G7P A;  4NO2 A;  1CG9 A;  1JPG A;  4U1J A;  3ROL A;  3L3D A;  4S0U C;  3VRI A;  5IB5 A;  4L29 A;  1WBZ A;  5E00 A;  3FOM A;  5H94 A;  4LCY A;  1TVH A;  3KPN A;  4PRN A;  3SDX A;  3G08 A;  4WUU A;  3TIE A;  4WDI A;  4MQ7 A;  3PWV A;  3TBV A;  3VWJ A;  3SJV A;  3MRF A;  4PRD A;  1ZS8 A;  1XR9 A;  5C07 A;  3DTX A;  4WJ5 A;  2BSS A;  1T20 A;  3MR9 A;  3BH8 A;  1JGE A;  1WBX A;  4ZUW A;  3VFN A;  5GSV A;  1RJY A;  2ZOK A;  3V5D A;  3TZV C;  5C0D A;  1P1Z A;  3ARF A;  3RWJ A;  4JFD A;  4U1K A;  1QR1 A;  1T7V A;  5F1I A;  1QSE A;  1IM9 A;  1QQD A;  3GSQ A;  3GSN H;  1BZ9 A;  3O3E A;  4X6E A;  5HHO A;  5ISZ A;  4U1H A;  5C0C A;  3KPO A;  1T1Z A;  5B39 A;  4K71 B;  1LP9 A;  3FTG A;  3BEV A;  1OGA A;  3HG1 A;  4D0C A;  3TPU E;  5HHN A;  3V5K A;  3QDG A;  5ACZ A;  4O2E A;  4PRP A;  3DBX A;  3MRR A;  3LKO A;  3PAB A;  2AK4 A;  2F53 A;  4HUW A;  4QRP A;  1KJV A;  1KCG C;  2VE6 A;  4G8G A;  3IXA A;  4X6C A;  4NO5 A;  3L9R A;  1KPU A;  1N5A A;  4K7F A;  3P73 A;  3ARD A;  1ZT7 A;  1JGD A;  4HUV A;  4HS3 A;  3KLA A;  4PJC A;  3H7B A;  2ZSW A;  3FQW A;  3KWW A;  3JTT A;  4U6X A;  4Y4K A;  1A9B A;  3VXR A;  3QFJ A;  3L3H A;  1FZJ A;  1S9Y A;  3S6C A;  4F7C A;  1XR8 A;  2BVQ A;  2H6P A;  5IEK A;  2X4U A;  2DYP A;  1S7U A;  2FYY A;  3TBT A;  3UTS A;  3LKP A;  3PWN A;  1I7U A;  3L3G A;  5EO1 A;  4ZFZ A;  3TA3 A;  3VFM A;  2CKB H;  2X70 A;  2H26 A;  5FA4 A;  3TBY A;  2NW3 A;  1B0G A;  3SKO A;  4G43 A;  4HUU A;  4PJE A;  3PWP A;  2GJ6 A;  2BSR A;  5SWS A;  3D18 A;  2WY3 A;  1HHK A;  2GTZ A;  3L3J A;  4PGC A;  3RWI A;  3KYO A;  4PGE A;  1BQH A;  2UWE A;  3MGO A;  2AV1 A;  2NX5 A;  3MRG A;  1HHG A;  3BZF A;  1M6O A;  3TO2 A;  4F7E A;  1JE6 A;  1LQV A;  3BZE A;  3U0P A;  1S7R A;  3MRB A;  4QRS A;  3QZW A;  5D7I A;  1KJ2 H;  4PJD A;  1KTL A;  5E8N A;  5F7D A;  3KPM A;  1XZ0 A;  2D31 A;  3C8K A;  3MRD A;  1LDP H;  3RWH A;  3LKQ A;  4JQV A;  3QI9 A;  5FA3 A;  5DEG A;  4EUP A;  1RK0 A;  3FQU A;  4NNY A;  4N0C A;  3T1F A;  5D7J C;  3H9H A;  4Z78 A;  4IRJ A;  1C16 A;  3BUY A;  3QEQ A;  3L3K A;  4JFF A;  1DUZ A;  1SYS A;  3KPL A;  1JUF A;  3MRO A;  2JCC A;  1UXS A;  3GMO A;  3O9W A;  3VFT A;  4ONO A;  3X11 A;  4PG9 A;  2GIT A;  1MHC A;  2HLA A;  4F7M A;  1PQZ A;  1HOC A;  3O3D A;  4MVB A;  5HGB A;  1AKJ A;  2HJK A;  1ZHN A;  2F74 A;  3BHB A;  1MI5 A;  4N5E A;  4NO0 A;  4U1I A;  1QLF A;  3W39 A;  2BCK A;  1FZM A;  4EN3 C;  4L4T A;  5HGA A;  3KPQ A;  5J1A A;  4IRS A;  4MX7 A;  3JTC A;  1JPF A;  3D39 A;  3VWK A;  1I7R A;  1RK1 A;  5EU5 A;  4GUP A;  4WU7 A;  5SWZ A;  4Y2D A;  2CLZ A;  1S7W A;  3FQX A;  3TBS A;  3TF7 A;  4F7P A;  4X6D A;  5HGD A;  3BH9 A;  3JTS A;  1W72 A;  4G8I A;  5DDH A;  1T7Y A;  3HAE A;  1NAN H;  1AGD A;  4Y4F A;  3SCM A;  3VFP A;  1S9X A;  2CII A;  1DE4 A;  3M17 A;  4LNR A;  1A6Z A;  5MEP A;  4WO4 A;  4U1L A;  3FRU A;  2J8U A;  3KXF A;  1ZT4 A;  2X4O A;  2GUO A;  1LEG A;  1QVO A;  3FQR A;  1VAD A;  3TN0 A;  1S7S A;  4ZUS A;  1ED3 A;  1YPZ A;  2ZOL A;  4PR5 A;  4PDC E;  1AO7 A;  1NEZ A;  3JVG A;  3E6F A;  2VAB A;  1LEK A;  1I1F A;  4QOK A;  3X14 A;  1UQS A;  3VXU A;  1B0R A;  1G7Q A;  2OI9 A;  4ZAK A;  1FG2 A;  1S7Q A;  3GSR A;  2X4S A;  2VLR A;  2CLV A;  3I6K A;  4HWZ A;  4ZUT A;  3RWC A;  5IB3 A;  1ZT1 A;  5E8P A;  1EFX A;  3CPL A;  3GJF A;  3VFR A;  1VGK A;  1FFN A;  4E5X A;  4GKN A;  4PJA A;  3GMR A;  3VFS A;  4L3E A;  1QRN A;  4F7T A;  4PJI A;  3ECB A;  5C0E A;  4Z76 A;  5J6H A;  3LV3 A;  1KJM A;  2BNR A;  1S7T A;  5EU6 A;  4PJ8 A;  3VXP A;  4PJ5 A;  1CD1 A;  3DXA A;  4NHU E;  5E8O A;  4E0R A;  3VXN A;  2X4R A;  4PJ7 A;  3VJ6 A;  2YPL A;  1T1Y A;  1TVB A;  3WS3 A;  5IVX A;  4FFE X;  1QO3 A;  3D25 A;  4N8V A;  3GSU A;  3L3I A;  3MGT A;  3T8X A;  3HPJ A;  1I1A A;  3BWA A;  4L3C A;  1T22 A;  4JRY A;  4PG2 A;  3UTT A;  4PV9 A;  1L8J A;  1TMC A;  1HHJ A;  1FZK A;  4ELM A;  3X12 A;  3B6S A;  2AKR A;  3HLA A;  4NT6 A;  4PP8 C;  3WS6 A;  5IRO A;  5EU3 A;  1OSZ A;  3BP7 A;  3FT2 A;  4NQX A;  3WL9 A;  5E9D A;  4NO3 A;  3TVM A;  1ONQ A;  1T1W A;  3RTQ A;  4CVZ A;  2X4Q A;  3DX6 A;  4PRA A;  5HYJ A;  3MV9 A;  1ZHL A;  2Q7Y A;  3BW9 A;  4GKS A;  4MS8 A;  3TJH A;  2FWO A;  2VAA A;  3AU1 A;  3DMM A;  5HHQ A;  4D0D A;  1OGT A;  4U6Y A;  1FO0 H;  3MRK A;  3WLB A;  2OL3 H;  1A1M A;  5IB1 A;  1T80 A;  5AD0 A;  2CLR A;  3MRN A;  1QEW A;  1ZHK A;  3OV6 A;  4G42 A;  4Z77 A;  3ARG A;  2PYE A;  1LK2 A;  3BVN A;  4NQC A;  5F9J A;  3UPR A;  2AXG A;  3E2H A;  3HE6 A;  1RJZ A;  2HN7 A;  3MRM A;  3BO8 A;  3QUZ A;  4L8B A;  3FOL A;  3HCV A;  4I4W A;  5IND A;  3BEW A;  3QUX A;  5GSR A;  3RWF A;  5B38 A;  3LKN A;  1E27 A;  5IM7 A;  3VFU A;  2F54 A;  3PWL A;  4G9F A;  2VLL A;  3GSV A;  3GMN A;  1HYR C;  1W0W A;  2FIK A;  1CE6 A;  2RFX A;  4PGB A;  4UQ2 A;  4UQ3 A;  1T7Z A;  1N3N A;  5MEO A;  3UTQ A;  3VFV A;  3IT8 D;  3GSW A;  4QRQ A;  4N0U A;  3P9L A;  3RL1 A;  1I7T A;  1R3H A;  5C0A A;  3TID A;  3QUL A;  3P4M A;  4MJI A;  3KPS A;  2VLJ A;  3DX7 A;  3I6G A;  4WWK C;  3SPV A;  4PJ9 A;  1VAC A;  5C08 A;  3GML A;  4HX1 A;  3GSX A;  4QRT A;  5FKP A;  3ROO A;  3FFC A;  3VFW A;  4LCW A;  2YEZ A;  2C7U A;  3O8X A;  2ESV A;  4MJ6 A;  4IIQ C;  1A1N A;  1DDH A;  3MRI A;  3MRL A;  4NQV A;  4V3E B;  2FZ3 A;  2VLK A;  3CCH A;  4U1M A;  3E6H A;  2AXF A;  5D9S A;  4CW1 A;  3GIV A;  3P4O A;  3MRP A;  3MRC A;  1T1X A;  1Z5L A;  5C9J A;  5MEQ A;  1X7Q A;  5EO0 A;  3VXO A;  2BVP A;  1AGE A;  4X6F A;  5BJT A;  3KYN A;  1JHT A;  4EI5 A;  2ZSV A;  1GZP A;  3CZF A;  3ES6 A;  4QRU A;  4ZUV A;  3NFN A;  1ZAG A;  3ILP A;  3O3A A;  5C0F A;  1Q94 A;  5BXF A;  3HUJ A;  1AGB A;  2HJL A;  3P9M A;  4HV8 A;  3RUG A;  1S7X A;  1A1O A;  1BD2 A;  1G6R H;  1S9W A;  3KPR A;  4PRH A;  3QFD A;  1NAM H;  3RWD A;  3M1B A;  4MXQ A;  3ARB A;  3DX8 A;  4HKJ A;  5J6G A;  3OX8 A;  4L8D A;  5D2N A;  1OF2 A;  4PRE A;  3MRH A;  2V2X A;  4JFP A;  1MHE A;  1S7V A;  1EXU A;  3GMP A;  3TO4 A;  1FZO A;  1YN6 A;  3I6L D;  3LKS A;  5C0G A;  2XFX A;  3FQN A;  5EUO A;  1K5N A;  4L8S C;  3BP4 A;  1HSB A;  2BVO A;  4NQD A;  3RWG A;  3QUK A;  3UBX A;  2E7L E;  2V2W A;  2PO6 A;  3QQ3 A;  2FO4 A;  3MA7 A;  4U1S A;  3TFK A;  1YDP A;  2P5E A;  3HE7 A;  3SDC A;  5FDW A;  4JFQ A;  5IB4 A;  5C0J A;  3X13 A;  3BXN A;  3MYJ A;  3QUY A;  3VXS A;  5EOT A;  3MV7 A;  1T21 A;  4NNX A;  3KPP A;  3LKR A;  3C9N A;  4L9L C;  3VFO A;  1IM3 A;  1T7X A;  4JQX A;  1SYV A;  4MJ5 A;  3RWE A;  1HHH A;  4PGD A;  5L2K A;  3REW A;  2XPG A;  4N0F A;  4HUX A;  1FFO A;  1XH3 A;  3AM8 A;  3ILQ C;  4PJH A;  4L4V A;  3GMM A;  4MNG A;  1EEZ A;  1A9E A;  5HGH A;  3FT4 A;  4APQ A;  1I4F A;  5D5M A;  3H9S A;  5JHD A;  3QQ4 A;  4PJF A;  1ZVS A;  3SDA A;  1FFP A;  1P4L A;  3ARE A;  3FON A;  4WW2 C;  4D0B A;  4O2C A;  3VH8 A;  1YN7 A;  2CIK A;  1P7Q A;  4Y16 A;  1N59 A;  2GT9 A;  1LD9 A;  3MRE A;  3O3B A;  1ZSD A;  1K8D A;  4PRB A;  5DEF A;  5BS0 A;  2X4P A;  3FT3 A;  2BST A;  3D2U A;  1T0N A;  3B3I A;  5IEH A;  1AGC A;  2X4N A;  3OXS A;  3RL2 A;  3RGV C;  4PJX A;  1KBG H;  1E28 A;  3FQT A;  4LHU A;  1KJ3 H;  1JF1 A;  4V3D B;  4LCC C;  3V5H A;  4JFE A;  2GAZ A;  1T7W A;  3E3Q A;  4G9D A;  4QRR A;  4XXC A;  4PV8 A;  3OXR A;  3SKM A;  4G59 A;  3W0W A;  3VCL A;  1KPR A;  3QDJ A;  4FTV A;  1EEY A;  5HHP A;  3RZC A;  1QSF A;  3PWU A;  3PWJ A;  5ENW A;  3MRQ A;  3SDD A;  5HHM A;  1W0V A;  5MEN A;  5E6I C;  4CVX A;  4PRI A;  1KPV A;  2YPK A;  1JFM A;  5D7L A;  3WUW A;  1BII A;  1U58 A;  3LN4 A;  3GSO A;  3P77 A;  5BRZ A;  4NSK A;  3QDM A;  1S8D A;  4PJG A;  2GTW A;  4PJB A;  3CDG A;  5F1N A;  3CC5 A;  1N2R A;  2AV7 A;  4ZUU A;  1M05 A;  1DUY A;  4NQE A;  4U1N A;  5EFI A;  3BGM A;  5D2L A;  3CVH A;  3O4L A;  3PQY A;  3VRJ A;  3D3V A;  1HSA A;  4WU5 A;  2MHA A;  1T0M A;  5INC A;  5C0B A;  5C0I A;  2P5W A;  1AGF A;  4Y4H A;  4JRX A;  5EU4 A;  3TBW A;  1I1Y A;  3P4N A;  1ZHB A;  2BNQ A;  1B3J A;  5MER A;  4L8C A;  1INQ A;  1MWA H;  4I48 A;  2A83 A;  5SWQ A;  4IHO A;  1HHI A;  1GZQ A;  3ERY A;  5L2J A;  4MNQ A;  3MV8 A;  2X4T A;  4JFO A;  3LN5 A;  1WBY A;  3MRJ A;  3CH1 A;  3VXM A;  5C09 A;  3GMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...