1TMCA

The three-dimensional structure of a class i major histocompatibility complex molecule missing the alpha3 domain of the heavy chain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68)
publication title The three-dimensional structure of a class I major histocompatibility complex molecule missing the alpha 3 domain of the heavy chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility antigen
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1994-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1tmcA00
3HAEA 4U1KA 4CVZA 3MV8A 4WWKC 4JFOA 3KPPA 3RTQA 3TIDA 4ZUVA 4PJ5A 4N0UA 2VE6A 4NQEA 4O2EA 3U0PA 3GSOA 4MJIA 1RK0A 4PG9A 5HHQA 2WY3A 2BSSA 2DYPA 3G08A 4X6CA 4QRUA 2AV1A 3FT4A 3KPOA 3SKMA 1FZOA 1HHGA 1ZHLA 1NANH 3FONA 3V5HA 5SWSA 1ZHNA 3HG1A 3P9MA 5E6IC 5HHOA 3V5DA 3V5KA 3MRKA 3VFWA 3FQXA 3TFKA 4PRHA 4JFFA 3TBSA 1E27A 1DUZA 3CCHA 4L4TA 4PREA 5IB2A 5L2JA 5FDWA 3BEWA 3GSQA 1ZSDA 1SYVA 1ZHKA 3REWA 1MHCA 3VXPA 3S6CA 2ESVA 4L3CA 1JFMA 1AGEA 3PQYA 3RGVC 1QQDA 3ARGA 4WUUA 3T1FA 4F7MA 5C9JA 3P9LA 1UQSA 3BW9A 3GJFA 3UTSA 4G59A 5FA4A 2CKBH 3L3IA 2H26A 3QQ3A 3H9SA 4PGCA 4ZUWA 1NEZA 4WW2C 3TBYA 1TMCA 1XR9A 2BNQA 1EEYA 4NQDA 3RWGA 4WU7A 2GTWA 2GAZA 1TVHA 4EUPA 5MENA 3MRRA 3L9RA 3RZCA 1HYRC 2X4TA 3JTSA 4HUXA 3P73A 2PO6A 1VADA 4L3EA 4V3EB 3LV3A 1I1FA 4PJ7A 3SDAA 4U1LA 1M6OA 3SDCA 1CD1A 3OV6A 3CH1A 1ZVSA 3PWLA 1C16A 3WS3A 3IXAA 2PYEA 3KXFA 4PJGA 3DX7A 3BHBA 3MRLA 5F9JA 1I1YA 2VABA 3GSXA 3O3EA 3GMMA 3KPLA 3QDJA 4U1IA 1AGFA 1KPVA 3QI9A 2ZSWA 3JTCA 3QULA 2BVQA 5D7LA 1B0GA 1KPUA 3ES6A 4WJ5A 5E9DA 3VXMA 1YDPA 5DEGA 3TBVA 3TZVC 2FYYA 3QUKA 3PWVA 1RJYA 1WBYA 5BS0A 3WUWA 1KBGH 4PRIA 3L3JA 1X7QA 1JHTA 1P1ZA 4PJAA 1KTLA 5EO0A 3GMOA 4MXQA 1LEKA 5C0EA 5C0JA 3H7BA 3P4MA 3O3BA 4V3DB 4JRXA 5IB4A 5E8OA 2BVOA 5BXFA 3TPUE 3MRNA 3RWHA 3ARBA 3VFNA 4K7FA 3OXSA 3MRQA 1MI5A 1S8DA 2ZOKA 1SYSA 1E28A 1U58A 1JUFA 4UQ2A 5IEKA 3MR9A 2BNRA 3TA3A 3LKQA 3SJVA 3D2UA 1N2RA 5SWQA 3E6HA 5EU5A 3HE6A 4HV8A 3CVHA 1M05A 5D7IA 4MVBA 5C0DA 3MRGA 4JQXA 5HYJA 1TVBA 3FRUA 1KJ2H 1I7RA 2HJKA 4Y16A 3SDXA 3VWKA 3VFMA 3BH8A 5H94A 4PJIA 2D31A 3VFOA 1FZKA 2BVPA 4JFPA 5GSRA 1G7PA 4PRAA 3BH9A 3L3GA 1FFOA 4G9DA 3QFJA 3O3AA 5ISZA 5E8PA 3RWJA 5E00A 1AGBA 1BD2A 4GKNA 1S7TA 3OX8A 2X4UA 3MRPA 5HHMA 5HHPA 4QOKA 3MGOA 3ILQC 3WS6A 5IEHA 1QR1A 1Q94A 3QZWA 4F7CA 3RWEA 2GJ6A 4PV9A 4L4VA 1WBZA 1LP9A 3I6KA 3MGTA 1HHIA 3AU1A 3B3IA 1ZT1A 3HPJA 3PWPA 3AREA 1R3HA 4WDIA 1S7VA 1NAMH 3PWUA 4NO2A 1A9EA 3L3HA 4MJ6A 2ZSVA 4PDCE 4Y4FA 3KPQA 1WBXA 3H9HA 3MV9A 4PGBA 3TO4A 5IB1A 2P5WA 4I4WA 3UTTA 1EFXA 2C7UA 4HKJA 1QSEA 4U1NA 1GZPA 1LK2A 1N59A 4JFQA 1AGCA 4X6DA 3RUGA 3GSUA 5L2KA 4PRNA 1N3NA 3TVMA 3RL1A 4IIQC 1KPRA 1T1XA 4LHUA 1OSZA 1HSBA 4NNXA 2A83A 2X4RA 2X4SA 1XZ0A 4K71B 1B3JA 4PRDA 4PV8A 3QQ4A 4N5EA 4WO4A 1QO3A 1JPGA 4U1JA 4NQXA 5HHNA 4NNYA 5C0FA 4HX1A 1QEWA 5INCA 2CLZA 4PGDA 3MRCA 1T22A 1OGTA 3BVNA 3DXAA 3WLBA 2X70A 4G43A 4F7EA 4N8VA 5D2NA 2BSRA 3D39A 2F54A 4PJCA 4HUUA 3W0WA 1KJVA 3GSWA 2J8UA 3QDMA 3RWCA 1OF2A 4LCYA 4QRQA 1ED3A 4APQA 1MHEA 4PR5A 3C8KA 5MEOA 3VCLA 1LQVA 2YPKA 3BP4A 3SPVA 1ZS8A 3MRMA 3GMPA 1S7WA 2P5EA 3ARDA 3FQTA 4NO5A 2X4NA 2CIKA 1N5AA 1T1ZA 1S7XA 1A9BA 3DX8A 1LDPH 1BQHA 2CLRA 1S7QA 2BSTA 3FFCA 3LN4A 4U6YA 3TF7A 4NO3A 2F74A 4PJDA 1LEGA 3X13A 1A6ZA 1AKJA 3T8XA 4NQCA 4EI5A 2Q7YA 1T0MA 3PABA 3TIEA 5EUOA 2NW3A 2AK4A 3O3DA 4Z77A 3O8XA 1PQZA 2FZ3A 4JFEA 4LCWA 2CLVA 4NQVA 1ZAGA 5C0BA 1S9YA 3DMMA 5DEFA 4ELMA 1T0NA 3TO2A 5C09A 2GITA 1S7UA 3O4LA 4MS8A 4E0RA 4G8GA 3BP7A 3ERYA 3FT2A 1MWAH 2X4QA 3VRJA 5EU6A 4MNQA 1RK1A 4O2CA 2GT9A 4N0CA 4HUVA 2X4OA 3MV7A 4PJXA 4ONOA 4Y4KA 1FO0H 3B6SA 3ARFA 5FKPA 1VGKA 2YEZA 3E3QA 4HS3A 3JVGA 3VXRA 3BZEA 1IM3A 3HUJA 1ZT7A 1HHKA 1GZQA 2V2XA 2JCCA 3PWNA 4MNGA 3FQUA 5GSVA 4EN3C 4ZUSA 1JE6A 1K8DA 1T7YA 3X11A 1B0RA 4ZUTA 4NHUE 2H6PA 2NX5A 2VLLA 1JGDA 4PJ8A 3KPMA 1HHJA 3GSVA 3KYOA 2E7LE 1A1NA 1W72A 4L29A 4Y4HA 1KJMA 3VFTA 4PP8C 5DDHA 2F53A 5ACZA 3L3DA 2CIIA 2XFXA 1JPFA 3GIVA 4MX7A 5IM7A 3QUZA 3MRIA 1T7XA 4U6XA 2HN7A 4UQ3A 4D0BA 2VLRA 3GMQA 3KYNA 4ZFZA 2GUOA 4F7TA 3FTGA 3GSRA 3VFVA 3M1BA 3QUYA 5EO1A 3ECBA 5IROA 5B38A 2MHAA 3ILPA 5D2LA 3SDDA 3VXSA 4D0DA 1ZT4A 1K5NA 2ZOLA 4GKSA 4IRJA 3LN5A 4JFDA 5FA3A 5C0GA 1I7UA 1LD9A 2FIKA 3HE7A 4L8DA 4X6EA 4NSKA 3RWDA 3UPRA 1G7QA 3PWJA 3CDGA 3VH8A 1T7ZA 3VJ6A 1QRNA 3VFRA 4HWZA 5JHDA 1JGEA 4HUWA 1ONQA 3RL2A 5IVXA 1CE6A 2V2WA 3SKOA 3MRBA 3VRIA 1QSFA 4D0CA 5J6HA 3LKSA 3C9NA 1T20A 3FQWA 3QEQA 5ENWA 1DE4A 4Z78A 3DBXA 4U1HA 1YN6A 3KWWA 4NO0A 4G8IA 1P7QA 4IHOA 4PJ9A 1BIIA 2VAAA 3MA7A 4L9LC 3KLAA 3DX6A 3HCVA 3BXNA 1VACA 2AKRA 3P4NA 4S0UC 5EOTA 3KPNA 4NT6A 3VFPA 1BZ9A 4L8SC 5C0CA 4IRSA 1FZMA 3W39A 1FFPA 1AGDA 1YN7A 1QVOA 5C0IA 4GUPA 5MEQA 5SWZA 5HGBA 4F7PA 1AO7A 3FQRA 3I6LD 1DDHA 2AV7A 2BCKA 1T7WA 1XR8A 5MEPA 2RFXA 3TBTA 1P4LA 5F1NA 1FZJA 5IB5A 3E2HA 3X12A 1W0WA 3MROA 4PRBA 3VXUA 3FOMA 2VLJA 3ROOA 3BWAA 2AXGA 2FO4A 4Y2DA 2UWEA 3BZFA 1INQA 1FG2A 5J6GA 5D9SA 5IB3A 5INDA 3KPRA 1HSAA 3CZFA 3VFUA 1S7SA 4L8CA 4XXCA 1IM9A 3LKNA 3IT8D 4U1SA 3AM8A 3P4OA 2HJLA 3UTQA 1A1MA 3WL9A 3LKRA 4MJ5A 3NFNA 1W0VA 2GTZA 5BRZA 2X4PA 3UBXA 4FTVA 3TN0A 1L8JA 4X6FA 1YPZA 3DTXA 3GMLA 5D5MA 4QRPA 4I48A 3X14A 3BGMA 1T1YA 5F7DA 3FQNA 5EFIA 1EEZA 5HGAA 5J1AA 4QRSA 4L8BA 1RJZA 4PG2A 3FOLA 4QRTA 1G6RH 4MQ7A 3QFDA 1Z5LA 3VXOA 3CPLA 3RWFA 3I6GA 2HLAA 2XPGA 5AD0A 3BEVA 3KPSA 1QLFA 3LKPA 4PJEA 1T7VA 2AXFA 3M17A 1KCGC 1T21A 3MRFA 3MREA 5EU4A 5B39A 1KJ3H 3BUYA 1EXUA 1I1AA 3GSNH 4LCCC 3P77A 4LNRA 1A1OA 4PJHA 4PJFA 4CVXA 1HHHA 3D25A 3MRHA 4QRRA 3OXRA 5E8NA 1T1WA 1CG9A 4ZAKA 1I7TA 3SCMA 4N0FA 5C0AA 1XH3A 4PRPA 4ZUUA 1DUYA 3D18A 5C08A 4JRYA 3TBWA 1HOCA 3GMRA 3L3KA 5MERA 1FFNA 4WU5A 3HLAA 3QDGA 5C07A 1JF1A 3TJHA 3FT3A 2VLKA 3JTTA 1OGAA 1T80A 3D3VA 3E6FA 5F1IA 3VFSA 4JQVA 5HGHA 1S9XA 4Z76A 4E5XA 4O2FA 3O9WA 3CC5A 5BJTA 4G42A 2YPLA 2OI9A 3MRJA 2OL3H 4CW1A 4PGEA 1I4FA 3VWJA 4FFEX 4G9FA 3RWIA 4U1MA 5HGDA 5EU3A 1UXWA 4PJBA 3VXNA 1S7RA 1UXSA 1ZHBA 3MYJA 3ROLA 3BO8A 2FWOA 3LKOA 3QUXA 3MRDA 1S9WA 3GMNA 5D7JC
chains in the Genus database with same CATH superfamily
3HAEA 4U1KA 4CVZA 3MV8A 4WWKC 4JFOA 3KPPA 3RTQA 3TIDA 4ZUVA 4PJ5A 4N0UA 2VE6A 4NQEA 4O2EA 3U0PA 3GSOA 4MJIA 1RK0A 4PG9A 5HHQA 2WY3A 2BSSA 2DYPA 3G08A 4X6CA 4QRUA 2AV1A 3FT4A 3KPOA 3SKMA 1FZOA 1HHGA 1ZHLA 1NANH 3FONA 3V5HA 5SWSA 1ZHNA 3HG1A 3P9MA 5E6IC 5HHOA 3V5DA 3V5KA 3MRKA 3VFWA 3FQXA 3TFKA 4PRHA 4JFFA 3TBSA 1E27A 1DUZA 3CCHA 3I0TA 4L4TA 4PREA 5IB2A 5L2JA 5FDWA 3BEWA 3GSQA 1ZSDA 1SYVA 1ZHKA 3REWA 1MHCA 3VXPA 3S6CA 2ESVA 4L3CA 1JFMA 1AGEA 3PQYA 3RGVC 1QQDA 3ARGA 4WUUA 3T1FA 4F7MA 5C9JA 3P9LA 1UQSA 3BW9A 3GJFA 3UTSA 4G59A 5FA4A 2CKBH 3L3IA 2H26A 3QQ3A 3H9SA 4PGCA 4ZUWA 1NEZA 4WW2C 3TBYA 1TMCA 1XR9A 2BNQA 1EEYA 4NQDA 3RWGA 4WU7A 2GTWA 2GAZA 1TVHA 4EUPA 5MENA 3MRRA 3L9RA 3RZCA 1HYRC 2X4TA 3JTSA 4HUXA 3P73A 2PO6A 1VADA 4L3EA 4V3EB 3LV3A 1I1FA 4PJ7A 3SDAA 4U1LA 1M6OA 3SDCA 1CD1A 3OV6A 3CH1A 1ZVSA 3PWLA 1C16A 3WS3A 3IXAA 2PYEA 3KXFA 4PJGA 3DX7A 3BHBA 3MRLA 5F9JA 1I1YA 2VABA 3GSXA 3O3EA 3GMMA 3KPLA 3QDJA 4U1IA 1AGFA 1KPVA 3QI9A 2ZSWA 3JTCA 3QULA 2BVQA 5D7LA 1B0GA 1KPUA 3ES6A 4WJ5A 5E9DA 3VXMA 1YDPA 5DEGA 3TBVA 3TZVC 2FYYA 3QUKA 3PWVA 1RJYA 1WBYA 5BS0A 3WUWA 1KBGH 4PRIA 3L3JA 1X7QA 1JHTA 1P1ZA 4PJAA 1KTLA 5EO0A 3GMOA 4MXQA 1LEKA 5C0EA 5C0JA 3H7BA 3P4MA 3O3BA 4V3DB 4JRXA 5IB4A 5E8OA 2BVOA 5BXFA 3TPUE 3MRNA 3RWHA 3ARBA 3VFNA 4K7FA 3OXSA 3MRQA 1MI5A 1S8DA 2ZOKA 1SYSA 1E28A 1U58A 1JUFA 4UQ2A 5IEKA 3MR9A 2BNRA 3TA3A 3LKQA 3SJVA 3D2UA 1N2RA 5SWQA 3E6HA 5EU5A 3HE6A 4HV8A 3CVHA 1M05A 5D7IA 4MVBA 5C0DA 3MRGA 4JQXA 5HYJA 1TVBA 3FRUA 1KJ2H 1I7RA 2HJKA 4Y16A 3SDXA 3VWKA 3VFMA 3BH8A 5H94A 4PJIA 2D31A 3VFOA 1FZKA 2BVPA 4JFPA 5GSRA 1G7PA 4PRAA 3BH9A 3L3GA 1FFOA 4G9DA 3QFJA 3O3AA 5ISZA 5E8PA 3RWJA 5E00A 1AGBA 1BD2A 4GKNA 1S7TA 3OX8A 2X4UA 3MRPA 5HHMA 5HHPA 4QOKA 3MGOA 3ILQC 3WS6A 5IEHA 1QR1A 1Q94A 3QZWA 4F7CA 3RWEA 2GJ6A 4PV9A 4L4VA 1WBZA 1LP9A 3I6KA 3MGTA 1HHIA 3AU1A 3B3IA 4BKWA 1ZT1A 3HPJA 3PWPA 3AREA 1R3HA 4WDIA 1S7VA 1NAMH 3PWUA 4NO2A 1A9EA 3L3HA 4MJ6A 2ZSVA 4PDCE 4Y4FA 3KPQA 1WBXA 3H9HA 3MV9A 4PGBA 3TO4A 5IB1A 2P5WA 4I4WA 3UTTA 1EFXA 2C7UA 4HKJA 1QSEA 4U1NA 1GZPA 1LK2A 1N59A 4JFQA 1AGCA 4X6DA 3RUGA 3GSUA 5L2KA 4PRNA 1N3NA 3TVMA 3RL1A 4IIQC 1KPRA 1T1XA 4LHUA 1OSZA 1HSBA 4NNXA 2A83A 2X4RA 2X4SA 1XZ0A 4K71B 1B3JA 2IA1A 4PRDA 4PV8A 3QQ4A 4N5EA 4WO4A 1QO3A 1JPGA 4U1JA 4NQXA 5HHNA 4NNYA 5C0FA 4HX1A 1QEWA 5INCA 2O5NA 2CLZA 4PGDA 3MRCA 1T22A 1OGTA 3BVNA 3DXAA 3WLBA 2X70A 4G43A 4F7EA 4N8VA 5D2NA 2BSRA 3D39A 2F54A 4PJCA 4HUUA 3W0WA 1KJVA 3GSWA 2J8UA 2NYKA 3QDMA 1OF2A 4LCYA 4QRQA 1ED3A 3RWCA 4APQA 1MHEA 4PR5A 3C8KA 5MEOA 3VCLA 1LQVA 2YPKA 3BP4A 3SPVA 1ZS8A 3MRMA 3GMPA 1S7WA 2P5EA 3ARDA 3FQTA 4NO5A 2X4NA 2CIKA 1N5AA 1T1ZA 1S7XA 1A9BA 3DX8A 1LDPH 1BQHA 2CLRA 1S7QA 2BSTA 3FFCA 3LN4A 4U6YA 3TF7A 4NO3A 2F74A 4PJDA 1LEGA 3X13A 1A6ZA 1AKJA 3T8XA 4NQCA 4EI5A 2Q7YA 1T0MA 4JO8A 4G59C 3PABA 3TIEA 5EUOA 2NW3A 2AK4A 3O3DA 4Z77A 3O8XA 1PQZA 2FZ3A 4JFEA 4LCWA 2CLVA 4NQVA 1ZAGA 5C0BA 1S9YA 3DMMA 5DEFA 4ELMA 1T0NA 3TO2A 5C09A 2GITA 1S7UA 3O4LA 4MS8A 4E0RA 4G8GA 3BP7A 3ERYA 3FT2A 1MWAH 2X4QA 3VRJA 5EU6A 4MNQA 1RK1A 4O2CA 2GT9A 4N0CA 4HUVA 2X4OA 3MV7A 4PJXA 4ONOA 4Y4KA 1FO0H 3B6SA 3ARFA 5FKPA 1VGKA 2YEZA 3E3QA 4HS3A 3JVGA 3VXRA 3BZEA 1IM3A 3HUJA 1ZT7A 1HHKA 1GZQA 2V2XA 2JCCA 3PWNA 4MNGA 3FQUA 5GSVA 4EN3C 4ZUSA 1JE6A 1K8DA 1T7YA 3X11A 1B0RA 4ZUTA 4NHUE 2H6PA 2NX5A 2VLLA 1JGDA 4PJ8A 3KPMA 1HHJA 3GSVA 3KYOA 2E7LE 1A1NA 1W72A 4L29A 4Y4HA 1KJMA 3VFTA 4PP8C 5DDHA 2F53A 5ACZA 3L3DA 2CIIA 2XFXA 1JPFA 3GIVA 4MX7A 5IM7A 3QUZA 3MRIA 1T7XA 4U6XA 2HN7A 4UQ3A 4D0BA 2VLRA 3GMQA 3KYNA 4ZFZA 2GUOA 4F7TA 3FTGA 3GSRA 3VFVA 3M1BA 3QUYA 5EO1A 3ECBA 5IROA 5B38A 2MHAA 3ILPA 5D2LA 3SDDA 3VXSA 4D0DA 1ZT4A 1K5NA 2ZOLA 4GKSA 4IRJA 3LN5A 4JFDA 5FA3A 5C0GA 1I7UA 1LD9A 2FIKA 3HE7A 4L8DA 4X6EA 4NSKA 3RWDA 3UPRA 1G7QA 3PWJA 3CDGA 3VH8A 1T7ZA 3VJ6A 1QRNA 3VFRA 4HWZA 5JHDA 1JGEA 4HUWA 1ONQA 3RL2A 5IVXA 1CE6A 2V2WA 3SKOA 3MRBA 3VRIA 1QSFA 4D0CA 5J6HA 3LKSA 3C9NA 1T20A 3FQWA 3QEQA 5ENWA 1DE4A 4Z78A 3DBXA 4U1HA 1YN6A 3KWWA 4NO0A 4G8IA 1P7QA 4IHOA 4PJ9A 1BIIA 2VAAA 3MA7A 4L9LC 3KLAA 3DX6A 3HCVA 3BXNA 1VACA 2AKRA 3P4NA 4S0UC 5EOTA 3KPNA 4NT6A 3VFPA 1BZ9A 4L8SC 5C0CA 4IRSA 1FZMA 3W39A 1FFPA 1AGDA 1YN7A 1QVOA 5C0IA 4GUPA 5MEQA 5SWZA 5HGBA 4F7PA 1AO7A 3FQRA 3I6LD 1DDHA 2AV7A 2BCKA 1T7WA 1XR8A 5MEPA 2RFXA 3TBTA 1P4LA 5F1NA 1FZJA 5IB5A 3E2HA 3X12A 1W0WA 3MROA 4PRBA 3VXUA 3FOMA 2VLJA 3ROOA 3BWAA 2AXGA 2FO4A 4Y2DA 2UWEA 3BZFA 1INQA 1FG2A 5J6GA 5D9SA 5IB3A 5INDA 3KPRA 1HSAA 3CZFA 3VFUA 1S7SA 4L8CA 4XXCA 1IM9A 3LKNA 3IT8D 4U1SA 3AM8A 3P4OA 2HJLA 3UTQA 1A1MA 3WL9A 3LKRA 4MJ5A 3NFNA 1W0VA 2GTZA 5BRZA 2X4PA 3UBXA 4FTVA 3TN0A 1L8JA 4X6FA 1YPZA 3DTXA 3GMLA 5D5MA 4QRPA 4I48A 3X14A 3BGMA 1T1YA 5F7DA 3FQNA 5EFIA 1EEZA 5HGAA 5J1AA 4QRSA 4L8BA 1RJZA 4PG2A 3FOLA 4QRTA 1G6RH 4MQ7A 3QFDA 1Z5LA 3VXOA 3CPLA 3RWFA 3I6GA 2HLAA 2XPGA 5AD0A 3BEVA 3KPSA 1QLFA 3LKPA 4PJEA 1T7VA 2AXFA 3M17A 1KCGC 1T21A 3MRFA 3MREA 5EU4A 5B39A 1KJ3H 3BUYA 1EXUA 1I1AA 3GSNH 4LCCC 3P77A 4LNRA 1A1OA 4PJHA 4PJFA 4CVXA 1HHHA 3D25A 3MRHA 4QRRA 3OXRA 5E8NA 1T1WA 1CG9A 4ZAKA 1I7TA 3SCMA 4N0FA 5C0AA 1XH3A 4PRPA 4ZUUA 1DUYA 3D18A 5C08A 4JRYA 3TBWA 1HOCA 3GMRA 3L3KA 5MERA 1FFNA 4WU5A 3HLAA 3QDGA 5C07A 1JF1A 3TJHA 3FT3A 2VLKA 3JTTA 1OGAA 1T80A 3D3VA 3E6FA 5F1IA 3VFSA 4JQVA 5HGHA 1S9XA 4Z76A 4E5XA 4O2FA 3O9WA 3CC5A 5BJTA 4G42A 2YPLA 2OI9A 3MRJA 2OL3H 4CW1A 4PGEA 1I4FA 3VWJA 4FFEX 4G9FA 3RWIA 4U1MA 5HGDA 5EU3A 1UXWA 4PJBA 3VXNA 1S7RA 1UXSA 1ZHBA 3MYJA 3ROLA 3BO8A 2FWOA 3LKOA 3QUXA 3MRDA 1S9WA 3GMNA 5D7JC
chains in the Genus database with same CATH topology
3HAEA 4U1KA 4CVZA 3MV8A 4WWKC 4JFOA 3KPPA 3RTQA 3TIDA 4ZUVA 4PJ5A 4N0UA 2VE6A 4NQEA 4O2EA 3U0PA 3GSOA 4MJIA 1RK0A 4PG9A 5HHQA 2WY3A 2BSSA 2DYPA 3G08A 4X6CA 4QRUA 2AV1A 3FT4A 3KPOA 3SKMA 1FZOA 1HHGA 1ZHLA 1NANH 3FONA 3V5HA 5SWSA 1ZHNA 3HG1A 3P9MA 5E6IC 5HHOA 3V5DA 3V5KA 3MRKA 3VFWA 3FQXA 3TFKA 4PRHA 4JFFA 3TBSA 1E27A 1DUZA 3CCHA 4L4TA 4PREA 5IB2A 5L2JA 5FDWA 3BEWA 3GSQA 1ZSDA 1SYVA 1ZHKA 3REWA 1MHCA 3VXPA 3S6CA 2ESVA 4L3CA 1JFMA 1AGEA 3PQYA 3RGVC 1QQDA 3ARGA 4WUUA 3T1FA 4F7MA 5C9JA 3P9LA 1UQSA 3BW9A 3GJFA 3UTSA 4G59A 5FA4A 2CKBH 3L3IA 2H26A 3QQ3A 3H9SA 4PGCA 4ZUWA 1NEZA 4WW2C 3TBYA 1TMCA 1XR9A 2BNQA 1EEYA 4NQDA 3RWGA 4WU7A 2GTWA 2GAZA 1TVHA 4EUPA 5MENA 3MRRA 3L9RA 3RZCA 1HYRC 2X4TA 3JTSA 4HUXA 3P73A 2PO6A 1VADA 4L3EA 4V3EB 3LV3A 1I1FA 4PJ7A 3SDAA 4U1LA 1M6OA 3SDCA 1CD1A 3OV6A 3CH1A 1ZVSA 3PWLA 1C16A 3WS3A 3IXAA 2PYEA 3KXFA 4PJGA 3DX7A 3BHBA 3MRLA 5F9JA 1I1YA 2VABA 3GSXA 3O3EA 3GMMA 3KPLA 3QDJA 4U1IA 1AGFA 1KPVA 3QI9A 2ZSWA 3JTCA 3QULA 2BVQA 5D7LA 1B0GA 1KPUA 3ES6A 4WJ5A 5E9DA 3VXMA 1YDPA 5DEGA 3TBVA 3TZVC 2FYYA 3QUKA 3PWVA 1RJYA 1WBYA 5BS0A 3WUWA 1KBGH 4PRIA 3L3JA 1X7QA 1JHTA 1P1ZA 4PJAA 1KTLA 5EO0A 3GMOA 4MXQA 1LEKA 5C0EA 5C0JA 3H7BA 3P4MA 3O3BA 4V3DB 4JRXA 5IB4A 5E8OA 2BVOA 5BXFA 3TPUE 3MRNA 3RWHA 3ARBA 3VFNA 4K7FA 3OXSA 3MRQA 1MI5A 1S8DA 2ZOKA 1SYSA 1E28A 1U58A 1JUFA 4UQ2A 5IEKA 3MR9A 2BNRA 3TA3A 3LKQA 3SJVA 3D2UA 1N2RA 5SWQA 3E6HA 5EU5A 3HE6A 4HV8A 3CVHA 1M05A 5D7IA 4MVBA 5C0DA 3MRGA 4JQXA 5HYJA 1TVBA 3FRUA 1KJ2H 1I7RA 2HJKA 4Y16A 3SDXA 3VWKA 3VFMA 3BH8A 5H94A 4PJIA 2D31A 3VFOA 1FZKA 2BVPA 4JFPA 5GSRA 1G7PA 4PRAA 3BH9A 3L3GA 1FFOA 4G9DA 3QFJA 3O3AA 5ISZA 5E8PA 3RWJA 5E00A 1AGBA 1BD2A 4GKNA 1S7TA 3OX8A 2X4UA 3MRPA 5HHMA 5HHPA 4QOKA 3MGOA 3ILQC 3WS6A 5IEHA 1QR1A 1Q94A 3QZWA 4F7CA 3RWEA 2GJ6A 4PV9A 4L4VA 1WBZA 1LP9A 3I6KA 3MGTA 1HHIA 3AU1A 3B3IA 1ZT1A 3HPJA 3PWPA 3AREA 1R3HA 4WDIA 1S7VA 1NAMH 3PWUA 4NO2A 1A9EA 3L3HA 4MJ6A 2ZSVA 4PDCE 4Y4FA 3KPQA 1WBXA 3H9HA 3MV9A 4PGBA 3TO4A 5IB1A 2P5WA 4I4WA 3UTTA 1EFXA 2C7UA 4HKJA 1QSEA 4U1NA 1GZPA 1LK2A 1N59A 4JFQA 1AGCA 4X6DA 3RUGA 3GSUA 5L2KA 4PRNA 1N3NA 3TVMA 3RL1A 4IIQC 1KPRA 1T1XA 4LHUA 1OSZA 1HSBA 4NNXA 2A83A 2X4RA 2X4SA 1XZ0A 4K71B 1B3JA 4PRDA 4PV8A 3QQ4A 4N5EA 4WO4A 1QO3A 1JPGA 4U1JA 4NQXA 5HHNA 4NNYA 5C0FA 4HX1A 1QEWA 5INCA 2CLZA 4PGDA 3MRCA 1T22A 1OGTA 3BVNA 3DXAA 3WLBA 2X70A 4G43A 4F7EA 4N8VA 5D2NA 2BSRA 3D39A 2F54A 4PJCA 4HUUA 3W0WA 1KJVA 3GSWA 2J8UA 3QDMA 3RWCA 1OF2A 4LCYA 4QRQA 1ED3A 4APQA 1MHEA 4PR5A 3C8KA 5MEOA 3VCLA 1LQVA 2YPKA 3BP4A 3SPVA 1ZS8A 3MRMA 3GMPA 1S7WA 2P5EA 3ARDA 3FQTA 4NO5A 2X4NA 2CIKA 1N5AA 1T1ZA 1S7XA 1A9BA 3DX8A 1LDPH 1BQHA 2CLRA 1S7QA 2BSTA 3FFCA 3LN4A 4U6YA 3TF7A 4NO3A 2F74A 4PJDA 1LEGA 3X13A 1A6ZA 1AKJA 3T8XA 4NQCA 4EI5A 2Q7YA 1T0MA 3PABA 3TIEA 5EUOA 2NW3A 2AK4A 3O3DA 4Z77A 3O8XA 1PQZA 2FZ3A 4JFEA 4LCWA 2CLVA 4NQVA 1ZAGA 5C0BA 1S9YA 3DMMA 5DEFA 4ELMA 1T0NA 3TO2A 5C09A 2GITA 1S7UA 3O4LA 4MS8A 4E0RA 4G8GA 3BP7A 3ERYA 3FT2A 1MWAH 2X4QA 3VRJA 5EU6A 4MNQA 1RK1A 4O2CA 2GT9A 4N0CA 4HUVA 2X4OA 3MV7A 4PJXA 4ONOA 4Y4KA 1FO0H 3B6SA 3ARFA 5FKPA 1VGKA 2YEZA 3E3QA 4HS3A 3JVGA 3VXRA 3BZEA 1IM3A 3HUJA 1ZT7A 1HHKA 1GZQA 2V2XA 2JCCA 3PWNA 4MNGA 3FQUA 5GSVA 4EN3C 4ZUSA 1JE6A 1K8DA 1T7YA 3X11A 1B0RA 4ZUTA 4NHUE 2H6PA 2NX5A 2VLLA 1JGDA 4PJ8A 3KPMA 1HHJA 3GSVA 3KYOA 2E7LE 1A1NA 1W72A 4L29A 4Y4HA 1KJMA 3VFTA 4PP8C 5DDHA 2F53A 5ACZA 3L3DA 2CIIA 2XFXA 1JPFA 3GIVA 4MX7A 5IM7A 3QUZA 3MRIA 1T7XA 4U6XA 2HN7A 4UQ3A 4D0BA 2VLRA 3GMQA 3KYNA 4ZFZA 2GUOA 4F7TA 3FTGA 3GSRA 3VFVA 3M1BA 3QUYA 5EO1A 3ECBA 5IROA 5B38A 2MHAA 3ILPA 5D2LA 3SDDA 3VXSA 4D0DA 1ZT4A 1K5NA 2ZOLA 4GKSA 4IRJA 3LN5A 4JFDA 5FA3A 5C0GA 1I7UA 1LD9A 2FIKA 3HE7A 4L8DA 4X6EA 4NSKA 3RWDA 3UPRA 1G7QA 3PWJA 3CDGA 3VH8A 1T7ZA 3VJ6A 1QRNA 3VFRA 4HWZA 5JHDA 1JGEA 4HUWA 1ONQA 3RL2A 5IVXA 1CE6A 2V2WA 3SKOA 3MRBA 3VRIA 1QSFA 4D0CA 5J6HA 3LKSA 3C9NA 1T20A 3FQWA 3QEQA 5ENWA 1DE4A 4Z78A 3DBXA 4U1HA 1YN6A 3KWWA 4NO0A 4G8IA 1P7QA 4IHOA 4PJ9A 1BIIA 2VAAA 3MA7A 4L9LC 3KLAA 3DX6A 3HCVA 3BXNA 1VACA 2AKRA 3P4NA 4S0UC 5EOTA 3KPNA 4NT6A 3VFPA 1BZ9A 4L8SC 5C0CA 4IRSA 1FZMA 3W39A 1FFPA 1AGDA 1YN7A 1QVOA 5C0IA 4GUPA 5MEQA 5SWZA 5HGBA 4F7PA 1AO7A 3FQRA 3I6LD 1DDHA 2AV7A 2BCKA 1T7WA 1XR8A 5MEPA 2RFXA 3TBTA 1P4LA 5F1NA 1FZJA 5IB5A 3E2HA 3X12A 1W0WA 3MROA 4PRBA 3VXUA 3FOMA 2VLJA 3ROOA 3BWAA 2AXGA 2FO4A 4Y2DA 2UWEA 3BZFA 1INQA 1FG2A 5J6GA 5D9SA 5IB3A 5INDA 3KPRA 1HSAA 3CZFA 3VFUA 1S7SA 4L8CA 4XXCA 1IM9A 3LKNA 3IT8D 4U1SA 3AM8A 3P4OA 2HJLA 3UTQA 1A1MA 3WL9A 3LKRA 4MJ5A 3NFNA 1W0VA 2GTZA 5BRZA 2X4PA 3UBXA 4FTVA 3TN0A 1L8JA 4X6FA 1YPZA 3DTXA 3GMLA 5D5MA 4QRPA 4I48A 3X14A 3BGMA 1T1YA 5F7DA 3FQNA 5EFIA 1EEZA 5HGAA 5J1AA 4QRSA 4L8BA 1RJZA 4PG2A 3FOLA 4QRTA 1G6RH 4MQ7A 3QFDA 1Z5LA 3VXOA 3CPLA 3RWFA 3I6GA 2HLAA 2XPGA 5AD0A 3BEVA 3KPSA 1QLFA 3LKPA 4PJEA 1T7VA 2AXFA 3M17A 1KCGC 1T21A 3MRFA 3MREA 5EU4A 5B39A 1KJ3H 3BUYA 1EXUA 1I1AA 3GSNH 4LCCC 3P77A 4LNRA 1A1OA 4PJHA 4PJFA 4CVXA 1HHHA 3D25A 3MRHA 4QRRA 3OXRA 5E8NA 1T1WA 1CG9A 4ZAKA 1I7TA 3SCMA 4N0FA 5C0AA 1XH3A 4PRPA 4ZUUA 1DUYA 3D18A 5C08A 4JRYA 3TBWA 1HOCA 3GMRA 3L3KA 5MERA 1FFNA 4WU5A 3HLAA 3QDGA 5C07A 1JF1A 3TJHA 3FT3A 2VLKA 3JTTA 1OGAA 1T80A 3D3VA 3E6FA 5F1IA 3VFSA 4JQVA 5HGHA 1S9XA 4Z76A 4E5XA 4O2FA 3O9WA 3CC5A 5BJTA 4G42A 2YPLA 2OI9A 3MRJA 2OL3H 4CW1A 4PGEA 1I4FA 3VWJA 4FFEX 4G9FA 3RWIA 4U1MA 5HGDA 5EU3A 1UXWA 4PJBA 3VXNA 1S7RA 1UXSA 1ZHBA 3MYJA 3ROLA 3BO8A 2FWOA 3LKOA 3QUXA 3MRDA 1S9WA 3GMNA 5D7JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAE A;  4U1K A;  4CVZ A;  3MV8 A;  4WWK C;  4JFO A;  3KPP A;  3RTQ A;  3TID A;  4ZUV A;  4PJ5 A;  4N0U A;  2VE6 A;  4NQE A;  4O2E A;  3U0P A;  3GSO A;  4MJI A;  1RK0 A;  4PG9 A;  5HHQ A;  2WY3 A;  2BSS A;  2DYP A;  3G08 A;  4X6C A;  4QRU A;  2AV1 A;  3FT4 A;  3KPO A;  3SKM A;  1FZO A;  1HHG A;  1ZHL A;  1NAN H;  3FON A;  3V5H A;  5SWS A;  1ZHN A;  3HG1 A;  3P9M A;  5E6I C;  5HHO A;  3V5D A;  3V5K A;  3MRK A;  3VFW A;  3FQX A;  3TFK A;  4PRH A;  4JFF A;  3TBS A;  1E27 A;  1DUZ A;  3CCH A;  4L4T A;  4PRE A;  5IB2 A;  5L2J A;  5FDW A;  3BEW A;  3GSQ A;  1ZSD A;  1SYV A;  1ZHK A;  3REW A;  1MHC A;  3VXP A;  3S6C A;  2ESV A;  4L3C A;  1JFM A;  1AGE A;  3PQY A;  3RGV C;  1QQD A;  3ARG A;  4WUU A;  3T1F A;  4F7M A;  5C9J A;  3P9L A;  1UQS A;  3BW9 A;  3GJF A;  3UTS A;  4G59 A;  5FA4 A;  2CKB H;  3L3I A;  2H26 A;  3QQ3 A;  3H9S A;  4PGC A;  4ZUW A;  1NEZ A;  4WW2 C;  3TBY A;  1TMC A;  1XR9 A;  2BNQ A;  1EEY A;  4NQD A;  3RWG A;  4WU7 A;  2GTW A;  2GAZ A;  1TVH A;  4EUP A;  5MEN A;  3MRR A;  3L9R A;  3RZC A;  1HYR C;  2X4T A;  3JTS A;  4HUX A;  3P73 A;  2PO6 A;  1VAD A;  4L3E A;  4V3E B;  3LV3 A;  1I1F A;  4PJ7 A;  3SDA A;  4U1L A;  1M6O A;  3SDC A;  1CD1 A;  3OV6 A;  3CH1 A;  1ZVS A;  3PWL A;  1C16 A;  3WS3 A;  3IXA A;  2PYE A;  3KXF A;  4PJG A;  3DX7 A;  3BHB A;  3MRL A;  5F9J A;  1I1Y A;  2VAB A;  3GSX A;  3O3E A;  3GMM A;  3KPL A;  3QDJ A;  4U1I A;  1AGF A;  1KPV A;  3QI9 A;  2ZSW A;  3JTC A;  3QUL A;  2BVQ A;  5D7L A;  1B0G A;  1KPU A;  3ES6 A;  4WJ5 A;  5E9D A;  3VXM A;  1YDP A;  5DEG A;  3TBV A;  3TZV C;  2FYY A;  3QUK A;  3PWV A;  1RJY A;  1WBY A;  5BS0 A;  3WUW A;  1KBG H;  4PRI A;  3L3J A;  1X7Q A;  1JHT A;  1P1Z A;  4PJA A;  1KTL A;  5EO0 A;  3GMO A;  4MXQ A;  1LEK A;  5C0E A;  5C0J A;  3H7B A;  3P4M A;  3O3B A;  4V3D B;  4JRX A;  5IB4 A;  5E8O A;  2BVO A;  5BXF A;  3TPU E;  3MRN A;  3RWH A;  3ARB A;  3VFN A;  4K7F A;  3OXS A;  3MRQ A;  1MI5 A;  1S8D A;  2ZOK A;  1SYS A;  1E28 A;  1U58 A;  1JUF A;  4UQ2 A;  5IEK A;  3MR9 A;  2BNR A;  3TA3 A;  3LKQ A;  3SJV A;  3D2U A;  1N2R A;  5SWQ A;  3E6H A;  5EU5 A;  3HE6 A;  4HV8 A;  3CVH A;  1M05 A;  5D7I A;  4MVB A;  5C0D A;  3MRG A;  4JQX A;  5HYJ A;  1TVB A;  3FRU A;  1KJ2 H;  1I7R A;  2HJK A;  4Y16 A;  3SDX A;  3VWK A;  3VFM A;  3BH8 A;  5H94 A;  4PJI A;  2D31 A;  3VFO A;  1FZK A;  2BVP A;  4JFP A;  5GSR A;  1G7P A;  4PRA A;  3BH9 A;  3L3G A;  1FFO A;  4G9D A;  3QFJ A;  3O3A A;  5ISZ A;  5E8P A;  3RWJ A;  5E00 A;  1AGB A;  1BD2 A;  4GKN A;  1S7T A;  3OX8 A;  2X4U A;  3MRP A;  5HHM A;  5HHP A;  4QOK A;  3MGO A;  3ILQ C;  3WS6 A;  5IEH A;  1QR1 A;  1Q94 A;  3QZW A;  4F7C A;  3RWE A;  2GJ6 A;  4PV9 A;  4L4V A;  1WBZ A;  1LP9 A;  3I6K A;  3MGT A;  1HHI A;  3AU1 A;  3B3I A;  1ZT1 A;  3HPJ A;  3PWP A;  3ARE A;  1R3H A;  4WDI A;  1S7V A;  1NAM H;  3PWU A;  4NO2 A;  1A9E A;  3L3H A;  4MJ6 A;  2ZSV A;  4PDC E;  4Y4F A;  3KPQ A;  1WBX A;  3H9H A;  3MV9 A;  4PGB A;  3TO4 A;  5IB1 A;  2P5W A;  4I4W A;  3UTT A;  1EFX A;  2C7U A;  4HKJ A;  1QSE A;  4U1N A;  1GZP A;  1LK2 A;  1N59 A;  4JFQ A;  1AGC A;  4X6D A;  3RUG A;  3GSU A;  5L2K A;  4PRN A;  1N3N A;  3TVM A;  3RL1 A;  4IIQ C;  1KPR A;  1T1X A;  4LHU A;  1OSZ A;  1HSB A;  4NNX A;  2A83 A;  2X4R A;  2X4S A;  1XZ0 A;  4K71 B;  1B3J A;  4PRD A;  4PV8 A;  3QQ4 A;  4N5E A;  4WO4 A;  1QO3 A;  1JPG A;  4U1J A;  4NQX A;  5HHN A;  4NNY A;  5C0F A;  4HX1 A;  1QEW A;  5INC A;  2CLZ A;  4PGD A;  3MRC A;  1T22 A;  1OGT A;  3BVN A;  3DXA A;  3WLB A;  2X70 A;  4G43 A;  4F7E A;  4N8V A;  5D2N A;  2BSR A;  3D39 A;  2F54 A;  4PJC A;  4HUU A;  3W0W A;  1KJV A;  3GSW A;  2J8U A;  3QDM A;  3RWC A;  1OF2 A;  4LCY A;  4QRQ A;  1ED3 A;  4APQ A;  1MHE A;  4PR5 A;  3C8K A;  5MEO A;  3VCL A;  1LQV A;  2YPK A;  3BP4 A;  3SPV A;  1ZS8 A;  3MRM A;  3GMP A;  1S7W A;  2P5E A;  3ARD A;  3FQT A;  4NO5 A;  2X4N A;  2CIK A;  1N5A A;  1T1Z A;  1S7X A;  1A9B A;  3DX8 A;  1LDP H;  1BQH A;  2CLR A;  1S7Q A;  2BST A;  3FFC A;  3LN4 A;  4U6Y A;  3TF7 A;  4NO3 A;  2F74 A;  4PJD A;  1LEG A;  3X13 A;  1A6Z A;  1AKJ A;  3T8X A;  4NQC A;  4EI5 A;  2Q7Y A;  1T0M A;  3PAB A;  3TIE A;  5EUO A;  2NW3 A;  2AK4 A;  3O3D A;  4Z77 A;  3O8X A;  1PQZ A;  2FZ3 A;  4JFE A;  4LCW A;  2CLV A;  4NQV A;  1ZAG A;  5C0B A;  1S9Y A;  3DMM A;  5DEF A;  4ELM A;  1T0N A;  3TO2 A;  5C09 A;  2GIT A;  1S7U A;  3O4L A;  4MS8 A;  4E0R A;  4G8G A;  3BP7 A;  3ERY A;  3FT2 A;  1MWA H;  2X4Q A;  3VRJ A;  5EU6 A;  4MNQ A;  1RK1 A;  4O2C A;  2GT9 A;  4N0C A;  4HUV A;  2X4O A;  3MV7 A;  4PJX A;  4ONO A;  4Y4K A;  1FO0 H;  3B6S A;  3ARF A;  5FKP A;  1VGK A;  2YEZ A;  3E3Q A;  4HS3 A;  3JVG A;  3VXR A;  3BZE A;  1IM3 A;  3HUJ A;  1ZT7 A;  1HHK A;  1GZQ A;  2V2X A;  2JCC A;  3PWN A;  4MNG A;  3FQU A;  5GSV A;  4EN3 C;  4ZUS A;  1JE6 A;  1K8D A;  1T7Y A;  3X11 A;  1B0R A;  4ZUT A;  4NHU E;  2H6P A;  2NX5 A;  2VLL A;  1JGD A;  4PJ8 A;  3KPM A;  1HHJ A;  3GSV A;  3KYO A;  2E7L E;  1A1N A;  1W72 A;  4L29 A;  4Y4H A;  1KJM A;  3VFT A;  4PP8 C;  5DDH A;  2F53 A;  5ACZ A;  3L3D A;  2CII A;  2XFX A;  1JPF A;  3GIV A;  4MX7 A;  5IM7 A;  3QUZ A;  3MRI A;  1T7X A;  4U6X A;  2HN7 A;  4UQ3 A;  4D0B A;  2VLR A;  3GMQ A;  3KYN A;  4ZFZ A;  2GUO A;  4F7T A;  3FTG A;  3GSR A;  3VFV A;  3M1B A;  3QUY A;  5EO1 A;  3ECB A;  5IRO A;  5B38 A;  2MHA A;  3ILP A;  5D2L A;  3SDD A;  3VXS A;  4D0D A;  1ZT4 A;  1K5N A;  2ZOL A;  4GKS A;  4IRJ A;  3LN5 A;  4JFD A;  5FA3 A;  5C0G A;  1I7U A;  1LD9 A;  2FIK A;  3HE7 A;  4L8D A;  4X6E A;  4NSK A;  3RWD A;  3UPR A;  1G7Q A;  3PWJ A;  3CDG A;  3VH8 A;  1T7Z A;  3VJ6 A;  1QRN A;  3VFR A;  4HWZ A;  5JHD A;  1JGE A;  4HUW A;  1ONQ A;  3RL2 A;  5IVX A;  1CE6 A;  2V2W A;  3SKO A;  3MRB A;  3VRI A;  1QSF A;  4D0C A;  5J6H A;  3LKS A;  3C9N A;  1T20 A;  3FQW A;  3QEQ A;  5ENW A;  1DE4 A;  4Z78 A;  3DBX A;  4U1H A;  1YN6 A;  3KWW A;  4NO0 A;  4G8I A;  1P7Q A;  4IHO A;  4PJ9 A;  1BII A;  2VAA A;  3MA7 A;  4L9L C;  3KLA A;  3DX6 A;  3HCV A;  3BXN A;  1VAC A;  2AKR A;  3P4N A;  4S0U C;  5EOT A;  3KPN A;  4NT6 A;  3VFP A;  1BZ9 A;  4L8S C;  5C0C A;  4IRS A;  1FZM A;  3W39 A;  1FFP A;  1AGD A;  1YN7 A;  1QVO A;  5C0I A;  4GUP A;  5MEQ A;  5SWZ A;  5HGB A;  4F7P A;  1AO7 A;  3FQR A;  3I6L D;  1DDH A;  2AV7 A;  2BCK A;  1T7W A;  1XR8 A;  5MEP A;  2RFX A;  3TBT A;  1P4L A;  5F1N A;  1FZJ A;  5IB5 A;  3E2H A;  3X12 A;  1W0W A;  3MRO A;  4PRB A;  3VXU A;  3FOM A;  2VLJ A;  3ROO A;  3BWA A;  2AXG A;  2FO4 A;  4Y2D A;  2UWE A;  3BZF A;  1INQ A;  1FG2 A;  5J6G A;  5D9S A;  5IB3 A;  5IND A;  3KPR A;  1HSA A;  3CZF A;  3VFU A;  1S7S A;  4L8C A;  4XXC A;  1IM9 A;  3LKN A;  3IT8 D;  4U1S A;  3AM8 A;  3P4O A;  2HJL A;  3UTQ A;  1A1M A;  3WL9 A;  3LKR A;  4MJ5 A;  3NFN A;  1W0V A;  2GTZ A;  5BRZ A;  2X4P A;  3UBX A;  4FTV A;  3TN0 A;  1L8J A;  4X6F A;  1YPZ A;  3DTX A;  3GML A;  5D5M A;  4QRP A;  4I48 A;  3X14 A;  3BGM A;  1T1Y A;  5F7D A;  3FQN A;  5EFI A;  1EEZ A;  5HGA A;  5J1A A;  4QRS A;  4L8B A;  1RJZ A;  4PG2 A;  3FOL A;  4QRT A;  1G6R H;  4MQ7 A;  3QFD A;  1Z5L A;  3VXO A;  3CPL A;  3RWF A;  3I6G A;  2HLA A;  2XPG A;  5AD0 A;  3BEV A;  3KPS A;  1QLF A;  3LKP A;  4PJE A;  1T7V A;  2AXF A;  3M17 A;  1KCG C;  1T21 A;  3MRF A;  3MRE A;  5EU4 A;  5B39 A;  1KJ3 H;  3BUY A;  1EXU A;  1I1A A;  3GSN H;  4LCC C;  3P77 A;  4LNR A;  1A1O A;  4PJH A;  4PJF A;  4CVX A;  1HHH A;  3D25 A;  3MRH A;  4QRR A;  3OXR A;  5E8N A;  1T1W A;  1CG9 A;  4ZAK A;  1I7T A;  3SCM A;  4N0F A;  5C0A A;  1XH3 A;  4PRP A;  4ZUU A;  1DUY A;  3D18 A;  5C08 A;  4JRY A;  3TBW A;  1HOC A;  3GMR A;  3L3K A;  5MER A;  1FFN A;  4WU5 A;  3HLA A;  3QDG A;  5C07 A;  1JF1 A;  3TJH A;  3FT3 A;  2VLK A;  3JTT A;  1OGA A;  1T80 A;  3D3V A;  3E6F A;  5F1I A;  3VFS A;  4JQV A;  5HGH A;  1S9X A;  4Z76 A;  4E5X A;  4O2F A;  3O9W A;  3CC5 A;  5BJT A;  4G42 A;  2YPL A;  2OI9 A;  3MRJ A;  2OL3 H;  4CW1 A;  4PGE A;  1I4F A;  3VWJ A;  4FFE X;  4G9F A;  3RWI A;  4U1M A;  5HGD A;  5EU3 A;  1UXW A;  4PJB A;  3VXN A;  1S7R A;  1UXS A;  1ZHB A;  3MYJ A;  3ROL A;  3BO8 A;  2FWO A;  3LKO A;  3QUX A;  3MRD A;  1S9W A;  3GMN A;  5D7J C; 
#chains in the Genus database with same CATH topology
 3HAE A;  4U1K A;  4CVZ A;  3MV8 A;  4WWK C;  4JFO A;  3KPP A;  3RTQ A;  3TID A;  4ZUV A;  4PJ5 A;  4N0U A;  2VE6 A;  4NQE A;  4O2E A;  3U0P A;  3GSO A;  4MJI A;  1RK0 A;  4PG9 A;  5HHQ A;  2WY3 A;  2BSS A;  2DYP A;  3G08 A;  4X6C A;  4QRU A;  2AV1 A;  3FT4 A;  3KPO A;  3SKM A;  1FZO A;  1HHG A;  1ZHL A;  1NAN H;  3FON A;  3V5H A;  5SWS A;  1ZHN A;  3HG1 A;  3P9M A;  5E6I C;  5HHO A;  3V5D A;  3V5K A;  3MRK A;  3VFW A;  3FQX A;  3TFK A;  4PRH A;  4JFF A;  3TBS A;  1E27 A;  1DUZ A;  3CCH A;  3I0T A;  4L4T A;  4PRE A;  5IB2 A;  5L2J A;  5FDW A;  3BEW A;  3GSQ A;  1ZSD A;  1SYV A;  1ZHK A;  3REW A;  1MHC A;  3VXP A;  3S6C A;  2ESV A;  4L3C A;  1JFM A;  1AGE A;  3PQY A;  3RGV C;  1QQD A;  3ARG A;  4WUU A;  3T1F A;  4F7M A;  5C9J A;  3P9L A;  1UQS A;  3BW9 A;  3GJF A;  3UTS A;  4G59 A;  5FA4 A;  2CKB H;  3L3I A;  2H26 A;  3QQ3 A;  3H9S A;  4PGC A;  4ZUW A;  1NEZ A;  4WW2 C;  3TBY A;  1TMC A;  1XR9 A;  2BNQ A;  1EEY A;  4NQD A;  3RWG A;  4WU7 A;  2GTW A;  2GAZ A;  1TVH A;  4EUP A;  5MEN A;  3MRR A;  3L9R A;  3RZC A;  1HYR C;  2X4T A;  3JTS A;  4HUX A;  3P73 A;  2PO6 A;  1VAD A;  4L3E A;  4V3E B;  3LV3 A;  1I1F A;  4PJ7 A;  3SDA A;  4U1L A;  1M6O A;  3SDC A;  1CD1 A;  3OV6 A;  3CH1 A;  1ZVS A;  3PWL A;  1C16 A;  3WS3 A;  3IXA A;  2PYE A;  3KXF A;  4PJG A;  3DX7 A;  3BHB A;  3MRL A;  5F9J A;  1I1Y A;  2VAB A;  3GSX A;  3O3E A;  3GMM A;  3KPL A;  3QDJ A;  4U1I A;  1AGF A;  1KPV A;  3QI9 A;  2ZSW A;  3JTC A;  3QUL A;  2BVQ A;  5D7L A;  1B0G A;  1KPU A;  3ES6 A;  4WJ5 A;  5E9D A;  3VXM A;  1YDP A;  5DEG A;  3TBV A;  3TZV C;  2FYY A;  3QUK A;  3PWV A;  1RJY A;  1WBY A;  5BS0 A;  3WUW A;  1KBG H;  4PRI A;  3L3J A;  1X7Q A;  1JHT A;  1P1Z A;  4PJA A;  1KTL A;  5EO0 A;  3GMO A;  4MXQ A;  1LEK A;  5C0E A;  5C0J A;  3H7B A;  3P4M A;  3O3B A;  4V3D B;  4JRX A;  5IB4 A;  5E8O A;  2BVO A;  5BXF A;  3TPU E;  3MRN A;  3RWH A;  3ARB A;  3VFN A;  4K7F A;  3OXS A;  3MRQ A;  1MI5 A;  1S8D A;  2ZOK A;  1SYS A;  1E28 A;  1U58 A;  1JUF A;  4UQ2 A;  5IEK A;  3MR9 A;  2BNR A;  3TA3 A;  3LKQ A;  3SJV A;  3D2U A;  1N2R A;  5SWQ A;  3E6H A;  5EU5 A;  3HE6 A;  4HV8 A;  3CVH A;  1M05 A;  5D7I A;  4MVB A;  5C0D A;  3MRG A;  4JQX A;  5HYJ A;  1TVB A;  3FRU A;  1KJ2 H;  1I7R A;  2HJK A;  4Y16 A;  3SDX A;  3VWK A;  3VFM A;  3BH8 A;  5H94 A;  4PJI A;  2D31 A;  3VFO A;  1FZK A;  2BVP A;  4JFP A;  5GSR A;  1G7P A;  4PRA A;  3BH9 A;  3L3G A;  1FFO A;  4G9D A;  3QFJ A;  3O3A A;  5ISZ A;  5E8P A;  3RWJ A;  5E00 A;  1AGB A;  1BD2 A;  4GKN A;  1S7T A;  3OX8 A;  2X4U A;  3MRP A;  5HHM A;  5HHP A;  4QOK A;  3MGO A;  3ILQ C;  3WS6 A;  5IEH A;  1QR1 A;  1Q94 A;  3QZW A;  4F7C A;  3RWE A;  2GJ6 A;  4PV9 A;  4L4V A;  1WBZ A;  1LP9 A;  3I6K A;  3MGT A;  1HHI A;  3AU1 A;  3B3I A;  4BKW A;  1ZT1 A;  3HPJ A;  3PWP A;  3ARE A;  1R3H A;  4WDI A;  1S7V A;  1NAM H;  3PWU A;  4NO2 A;  1A9E A;  3L3H A;  4MJ6 A;  2ZSV A;  4PDC E;  4Y4F A;  3KPQ A;  1WBX A;  3H9H A;  3MV9 A;  4PGB A;  3TO4 A;  5IB1 A;  2P5W A;  4I4W A;  3UTT A;  1EFX A;  2C7U A;  4HKJ A;  1QSE A;  4U1N A;  1GZP A;  1LK2 A;  1N59 A;  4JFQ A;  1AGC A;  4X6D A;  3RUG A;  3GSU A;  5L2K A;  4PRN A;  1N3N A;  3TVM A;  3RL1 A;  4IIQ C;  1KPR A;  1T1X A;  4LHU A;  1OSZ A;  1HSB A;  4NNX A;  2A83 A;  2X4R A;  2X4S A;  1XZ0 A;  4K71 B;  1B3J A;  2IA1 A;  4PRD A;  4PV8 A;  3QQ4 A;  4N5E A;  4WO4 A;  1QO3 A;  1JPG A;  4U1J A;  4NQX A;  5HHN A;  4NNY A;  5C0F A;  4HX1 A;  1QEW A;  5INC A;  2O5N A;  2CLZ A;  4PGD A;  3MRC A;  1T22 A;  1OGT A;  3BVN A;  3DXA A;  3WLB A;  2X70 A;  4G43 A;  4F7E A;  4N8V A;  5D2N A;  2BSR A;  3D39 A;  2F54 A;  4PJC A;  4HUU A;  3W0W A;  1KJV A;  3GSW A;  2J8U A;  2NYK A;  3QDM A;  1OF2 A;  4LCY A;  4QRQ A;  1ED3 A;  3RWC A;  4APQ A;  1MHE A;  4PR5 A;  3C8K A;  5MEO A;  3VCL A;  1LQV A;  2YPK A;  3BP4 A;  3SPV A;  1ZS8 A;  3MRM A;  3GMP A;  1S7W A;  2P5E A;  3ARD A;  3FQT A;  4NO5 A;  2X4N A;  2CIK A;  1N5A A;  1T1Z A;  1S7X A;  1A9B A;  3DX8 A;  1LDP H;  1BQH A;  2CLR A;  1S7Q A;  2BST A;  3FFC A;  3LN4 A;  4U6Y A;  3TF7 A;  4NO3 A;  2F74 A;  4PJD A;  1LEG A;  3X13 A;  1A6Z A;  1AKJ A;  3T8X A;  4NQC A;  4EI5 A;  2Q7Y A;  1T0M A;  4JO8 A;  4G59 C;  3PAB A;  3TIE A;  5EUO A;  2NW3 A;  2AK4 A;  3O3D A;  4Z77 A;  3O8X A;  1PQZ A;  2FZ3 A;  4JFE A;  4LCW A;  2CLV A;  4NQV A;  1ZAG A;  5C0B A;  1S9Y A;  3DMM A;  5DEF A;  4ELM A;  1T0N A;  3TO2 A;  5C09 A;  2GIT A;  1S7U A;  3O4L A;  4MS8 A;  4E0R A;  4G8G A;  3BP7 A;  3ERY A;  3FT2 A;  1MWA H;  2X4Q A;  3VRJ A;  5EU6 A;  4MNQ A;  1RK1 A;  4O2C A;  2GT9 A;  4N0C A;  4HUV A;  2X4O A;  3MV7 A;  4PJX A;  4ONO A;  4Y4K A;  1FO0 H;  3B6S A;  3ARF A;  5FKP A;  1VGK A;  2YEZ A;  3E3Q A;  4HS3 A;  3JVG A;  3VXR A;  3BZE A;  1IM3 A;  3HUJ A;  1ZT7 A;  1HHK A;  1GZQ A;  2V2X A;  2JCC A;  3PWN A;  4MNG A;  3FQU A;  5GSV A;  4EN3 C;  4ZUS A;  1JE6 A;  1K8D A;  1T7Y A;  3X11 A;  1B0R A;  4ZUT A;  4NHU E;  2H6P A;  2NX5 A;  2VLL A;  1JGD A;  4PJ8 A;  3KPM A;  1HHJ A;  3GSV A;  3KYO A;  2E7L E;  1A1N A;  1W72 A;  4L29 A;  4Y4H A;  1KJM A;  3VFT A;  4PP8 C;  5DDH A;  2F53 A;  5ACZ A;  3L3D A;  2CII A;  2XFX A;  1JPF A;  3GIV A;  4MX7 A;  5IM7 A;  3QUZ A;  3MRI A;  1T7X A;  4U6X A;  2HN7 A;  4UQ3 A;  4D0B A;  2VLR A;  3GMQ A;  3KYN A;  4ZFZ A;  2GUO A;  4F7T A;  3FTG A;  3GSR A;  3VFV A;  3M1B A;  3QUY A;  5EO1 A;  3ECB A;  5IRO A;  5B38 A;  2MHA A;  3ILP A;  5D2L A;  3SDD A;  3VXS A;  4D0D A;  1ZT4 A;  1K5N A;  2ZOL A;  4GKS A;  4IRJ A;  3LN5 A;  4JFD A;  5FA3 A;  5C0G A;  1I7U A;  1LD9 A;  2FIK A;  3HE7 A;  4L8D A;  4X6E A;  4NSK A;  3RWD A;  3UPR A;  1G7Q A;  3PWJ A;  3CDG A;  3VH8 A;  1T7Z A;  3VJ6 A;  1QRN A;  3VFR A;  4HWZ A;  5JHD A;  1JGE A;  4HUW A;  1ONQ A;  3RL2 A;  5IVX A;  1CE6 A;  2V2W A;  3SKO A;  3MRB A;  3VRI A;  1QSF A;  4D0C A;  5J6H A;  3LKS A;  3C9N A;  1T20 A;  3FQW A;  3QEQ A;  5ENW A;  1DE4 A;  4Z78 A;  3DBX A;  4U1H A;  1YN6 A;  3KWW A;  4NO0 A;  4G8I A;  1P7Q A;  4IHO A;  4PJ9 A;  1BII A;  2VAA A;  3MA7 A;  4L9L C;  3KLA A;  3DX6 A;  3HCV A;  3BXN A;  1VAC A;  2AKR A;  3P4N A;  4S0U C;  5EOT A;  3KPN A;  4NT6 A;  3VFP A;  1BZ9 A;  4L8S C;  5C0C A;  4IRS A;  1FZM A;  3W39 A;  1FFP A;  1AGD A;  1YN7 A;  1QVO A;  5C0I A;  4GUP A;  5MEQ A;  5SWZ A;  5HGB A;  4F7P A;  1AO7 A;  3FQR A;  3I6L D;  1DDH A;  2AV7 A;  2BCK A;  1T7W A;  1XR8 A;  5MEP A;  2RFX A;  3TBT A;  1P4L A;  5F1N A;  1FZJ A;  5IB5 A;  3E2H A;  3X12 A;  1W0W A;  3MRO A;  4PRB A;  3VXU A;  3FOM A;  2VLJ A;  3ROO A;  3BWA A;  2AXG A;  2FO4 A;  4Y2D A;  2UWE A;  3BZF A;  1INQ A;  1FG2 A;  5J6G A;  5D9S A;  5IB3 A;  5IND A;  3KPR A;  1HSA A;  3CZF A;  3VFU A;  1S7S A;  4L8C A;  4XXC A;  1IM9 A;  3LKN A;  3IT8 D;  4U1S A;  3AM8 A;  3P4O A;  2HJL A;  3UTQ A;  1A1M A;  3WL9 A;  3LKR A;  4MJ5 A;  3NFN A;  1W0V A;  2GTZ A;  5BRZ A;  2X4P A;  3UBX A;  4FTV A;  3TN0 A;  1L8J A;  4X6F A;  1YPZ A;  3DTX A;  3GML A;  5D5M A;  4QRP A;  4I48 A;  3X14 A;  3BGM A;  1T1Y A;  5F7D A;  3FQN A;  5EFI A;  1EEZ A;  5HGA A;  5J1A A;  4QRS A;  4L8B A;  1RJZ A;  4PG2 A;  3FOL A;  4QRT A;  1G6R H;  4MQ7 A;  3QFD A;  1Z5L A;  3VXO A;  3CPL A;  3RWF A;  3I6G A;  2HLA A;  2XPG A;  5AD0 A;  3BEV A;  3KPS A;  1QLF A;  3LKP A;  4PJE A;  1T7V A;  2AXF A;  3M17 A;  1KCG C;  1T21 A;  3MRF A;  3MRE A;  5EU4 A;  5B39 A;  1KJ3 H;  3BUY A;  1EXU A;  1I1A A;  3GSN H;  4LCC C;  3P77 A;  4LNR A;  1A1O A;  4PJH A;  4PJF A;  4CVX A;  1HHH A;  3D25 A;  3MRH A;  4QRR A;  3OXR A;  5E8N A;  1T1W A;  1CG9 A;  4ZAK A;  1I7T A;  3SCM A;  4N0F A;  5C0A A;  1XH3 A;  4PRP A;  4ZUU A;  1DUY A;  3D18 A;  5C08 A;  4JRY A;  3TBW A;  1HOC A;  3GMR A;  3L3K A;  5MER A;  1FFN A;  4WU5 A;  3HLA A;  3QDG A;  5C07 A;  1JF1 A;  3TJH A;  3FT3 A;  2VLK A;  3JTT A;  1OGA A;  1T80 A;  3D3V A;  3E6F A;  5F1I A;  3VFS A;  4JQV A;  5HGH A;  1S9X A;  4Z76 A;  4E5X A;  4O2F A;  3O9W A;  3CC5 A;  5BJT A;  4G42 A;  2YPL A;  2OI9 A;  3MRJ A;  2OL3 H;  4CW1 A;  4PGE A;  1I4F A;  3VWJ A;  4FFE X;  4G9F A;  3RWI A;  4U1M A;  5HGD A;  5EU3 A;  1UXW A;  4PJB A;  3VXN A;  1S7R A;  1UXS A;  1ZHB A;  3MYJ A;  3ROL A;  3BO8 A;  2FWO A;  3LKO A;  3QUX A;  3MRD A;  1S9W A;  3GMN A;  5D7J C; 
#chains in the Genus database with same CATH homology
 3HAE A;  4U1K A;  4CVZ A;  3MV8 A;  4WWK C;  4JFO A;  3KPP A;  3RTQ A;  3TID A;  4ZUV A;  4PJ5 A;  4N0U A;  2VE6 A;  4NQE A;  4O2E A;  3U0P A;  3GSO A;  4MJI A;  1RK0 A;  4PG9 A;  5HHQ A;  2WY3 A;  2BSS A;  2DYP A;  3G08 A;  4X6C A;  4QRU A;  2AV1 A;  3FT4 A;  3KPO A;  3SKM A;  1FZO A;  1HHG A;  1ZHL A;  1NAN H;  3FON A;  3V5H A;  5SWS A;  1ZHN A;  3HG1 A;  3P9M A;  5E6I C;  5HHO A;  3V5D A;  3V5K A;  3MRK A;  3VFW A;  3FQX A;  3TFK A;  4PRH A;  4JFF A;  3TBS A;  1E27 A;  1DUZ A;  3CCH A;  4L4T A;  4PRE A;  5IB2 A;  5L2J A;  5FDW A;  3BEW A;  3GSQ A;  1ZSD A;  1SYV A;  1ZHK A;  3REW A;  1MHC A;  3VXP A;  3S6C A;  2ESV A;  4L3C A;  1JFM A;  1AGE A;  3PQY A;  3RGV C;  1QQD A;  3ARG A;  4WUU A;  3T1F A;  4F7M A;  5C9J A;  3P9L A;  1UQS A;  3BW9 A;  3GJF A;  3UTS A;  4G59 A;  5FA4 A;  2CKB H;  3L3I A;  2H26 A;  3QQ3 A;  3H9S A;  4PGC A;  4ZUW A;  1NEZ A;  4WW2 C;  3TBY A;  1TMC A;  1XR9 A;  2BNQ A;  1EEY A;  4NQD A;  3RWG A;  4WU7 A;  2GTW A;  2GAZ A;  1TVH A;  4EUP A;  5MEN A;  3MRR A;  3L9R A;  3RZC A;  1HYR C;  2X4T A;  3JTS A;  4HUX A;  3P73 A;  2PO6 A;  1VAD A;  4L3E A;  4V3E B;  3LV3 A;  1I1F A;  4PJ7 A;  3SDA A;  4U1L A;  1M6O A;  3SDC A;  1CD1 A;  3OV6 A;  3CH1 A;  1ZVS A;  3PWL A;  1C16 A;  3WS3 A;  3IXA A;  2PYE A;  3KXF A;  4PJG A;  3DX7 A;  3BHB A;  3MRL A;  5F9J A;  1I1Y A;  2VAB A;  3GSX A;  3O3E A;  3GMM A;  3KPL A;  3QDJ A;  4U1I A;  1AGF A;  1KPV A;  3QI9 A;  2ZSW A;  3JTC A;  3QUL A;  2BVQ A;  5D7L A;  1B0G A;  1KPU A;  3ES6 A;  4WJ5 A;  5E9D A;  3VXM A;  1YDP A;  5DEG A;  3TBV A;  3TZV C;  2FYY A;  3QUK A;  3PWV A;  1RJY A;  1WBY A;  5BS0 A;  3WUW A;  1KBG H;  4PRI A;  3L3J A;  1X7Q A;  1JHT A;  1P1Z A;  4PJA A;  1KTL A;  5EO0 A;  3GMO A;  4MXQ A;  1LEK A;  5C0E A;  5C0J A;  3H7B A;  3P4M A;  3O3B A;  4V3D B;  4JRX A;  5IB4 A;  5E8O A;  2BVO A;  5BXF A;  3TPU E;  3MRN A;  3RWH A;  3ARB A;  3VFN A;  4K7F A;  3OXS A;  3MRQ A;  1MI5 A;  1S8D A;  2ZOK A;  1SYS A;  1E28 A;  1U58 A;  1JUF A;  4UQ2 A;  5IEK A;  3MR9 A;  2BNR A;  3TA3 A;  3LKQ A;  3SJV A;  3D2U A;  1N2R A;  5SWQ A;  3E6H A;  5EU5 A;  3HE6 A;  4HV8 A;  3CVH A;  1M05 A;  5D7I A;  4MVB A;  5C0D A;  3MRG A;  4JQX A;  5HYJ A;  1TVB A;  3FRU A;  1KJ2 H;  1I7R A;  2HJK A;  4Y16 A;  3SDX A;  3VWK A;  3VFM A;  3BH8 A;  5H94 A;  4PJI A;  2D31 A;  3VFO A;  1FZK A;  2BVP A;  4JFP A;  5GSR A;  1G7P A;  4PRA A;  3BH9 A;  3L3G A;  1FFO A;  4G9D A;  3QFJ A;  3O3A A;  5ISZ A;  5E8P A;  3RWJ A;  5E00 A;  1AGB A;  1BD2 A;  4GKN A;  1S7T A;  3OX8 A;  2X4U A;  3MRP A;  5HHM A;  5HHP A;  4QOK A;  3MGO A;  3ILQ C;  3WS6 A;  5IEH A;  1QR1 A;  1Q94 A;  3QZW A;  4F7C A;  3RWE A;  2GJ6 A;  4PV9 A;  4L4V A;  1WBZ A;  1LP9 A;  3I6K A;  3MGT A;  1HHI A;  3AU1 A;  3B3I A;  1ZT1 A;  3HPJ A;  3PWP A;  3ARE A;  1R3H A;  4WDI A;  1S7V A;  1NAM H;  3PWU A;  4NO2 A;  1A9E A;  3L3H A;  4MJ6 A;  2ZSV A;  4PDC E;  4Y4F A;  3KPQ A;  1WBX A;  3H9H A;  3MV9 A;  4PGB A;  3TO4 A;  5IB1 A;  2P5W A;  4I4W A;  3UTT A;  1EFX A;  2C7U A;  4HKJ A;  1QSE A;  4U1N A;  1GZP A;  1LK2 A;  1N59 A;  4JFQ A;  1AGC A;  4X6D A;  3RUG A;  3GSU A;  5L2K A;  4PRN A;  1N3N A;  3TVM A;  3RL1 A;  4IIQ C;  1KPR A;  1T1X A;  4LHU A;  1OSZ A;  1HSB A;  4NNX A;  2A83 A;  2X4R A;  2X4S A;  1XZ0 A;  4K71 B;  1B3J A;  4PRD A;  4PV8 A;  3QQ4 A;  4N5E A;  4WO4 A;  1QO3 A;  1JPG A;  4U1J A;  4NQX A;  5HHN A;  4NNY A;  5C0F A;  4HX1 A;  1QEW A;  5INC A;  2CLZ A;  4PGD A;  3MRC A;  1T22 A;  1OGT A;  3BVN A;  3DXA A;  3WLB A;  2X70 A;  4G43 A;  4F7E A;  4N8V A;  5D2N A;  2BSR A;  3D39 A;  2F54 A;  4PJC A;  4HUU A;  3W0W A;  1KJV A;  3GSW A;  2J8U A;  3QDM A;  3RWC A;  1OF2 A;  4LCY A;  4QRQ A;  1ED3 A;  4APQ A;  1MHE A;  4PR5 A;  3C8K A;  5MEO A;  3VCL A;  1LQV A;  2YPK A;  3BP4 A;  3SPV A;  1ZS8 A;  3MRM A;  3GMP A;  1S7W A;  2P5E A;  3ARD A;  3FQT A;  4NO5 A;  2X4N A;  2CIK A;  1N5A A;  1T1Z A;  1S7X A;  1A9B A;  3DX8 A;  1LDP H;  1BQH A;  2CLR A;  1S7Q A;  2BST A;  3FFC A;  3LN4 A;  4U6Y A;  3TF7 A;  4NO3 A;  2F74 A;  4PJD A;  1LEG A;  3X13 A;  1A6Z A;  1AKJ A;  3T8X A;  4NQC A;  4EI5 A;  2Q7Y A;  1T0M A;  3PAB A;  3TIE A;  5EUO A;  2NW3 A;  2AK4 A;  3O3D A;  4Z77 A;  3O8X A;  1PQZ A;  2FZ3 A;  4JFE A;  4LCW A;  2CLV A;  4NQV A;  1ZAG A;  5C0B A;  1S9Y A;  3DMM A;  5DEF A;  4ELM A;  1T0N A;  3TO2 A;  5C09 A;  2GIT A;  1S7U A;  3O4L A;  4MS8 A;  4E0R A;  4G8G A;  3BP7 A;  3ERY A;  3FT2 A;  1MWA H;  2X4Q A;  3VRJ A;  5EU6 A;  4MNQ A;  1RK1 A;  4O2C A;  2GT9 A;  4N0C A;  4HUV A;  2X4O A;  3MV7 A;  4PJX A;  4ONO A;  4Y4K A;  1FO0 H;  3B6S A;  3ARF A;  5FKP A;  1VGK A;  2YEZ A;  3E3Q A;  4HS3 A;  3JVG A;  3VXR A;  3BZE A;  1IM3 A;  3HUJ A;  1ZT7 A;  1HHK A;  1GZQ A;  2V2X A;  2JCC A;  3PWN A;  4MNG A;  3FQU A;  5GSV A;  4EN3 C;  4ZUS A;  1JE6 A;  1K8D A;  1T7Y A;  3X11 A;  1B0R A;  4ZUT A;  4NHU E;  2H6P A;  2NX5 A;  2VLL A;  1JGD A;  4PJ8 A;  3KPM A;  1HHJ A;  3GSV A;  3KYO A;  2E7L E;  1A1N A;  1W72 A;  4L29 A;  4Y4H A;  1KJM A;  3VFT A;  4PP8 C;  5DDH A;  2F53 A;  5ACZ A;  3L3D A;  2CII A;  2XFX A;  1JPF A;  3GIV A;  4MX7 A;  5IM7 A;  3QUZ A;  3MRI A;  1T7X A;  4U6X A;  2HN7 A;  4UQ3 A;  4D0B A;  2VLR A;  3GMQ A;  3KYN A;  4ZFZ A;  2GUO A;  4F7T A;  3FTG A;  3GSR A;  3VFV A;  3M1B A;  3QUY A;  5EO1 A;  3ECB A;  5IRO A;  5B38 A;  2MHA A;  3ILP A;  5D2L A;  3SDD A;  3VXS A;  4D0D A;  1ZT4 A;  1K5N A;  2ZOL A;  4GKS A;  4IRJ A;  3LN5 A;  4JFD A;  5FA3 A;  5C0G A;  1I7U A;  1LD9 A;  2FIK A;  3HE7 A;  4L8D A;  4X6E A;  4NSK A;  3RWD A;  3UPR A;  1G7Q A;  3PWJ A;  3CDG A;  3VH8 A;  1T7Z A;  3VJ6 A;  1QRN A;  3VFR A;  4HWZ A;  5JHD A;  1JGE A;  4HUW A;  1ONQ A;  3RL2 A;  5IVX A;  1CE6 A;  2V2W A;  3SKO A;  3MRB A;  3VRI A;  1QSF A;  4D0C A;  5J6H A;  3LKS A;  3C9N A;  1T20 A;  3FQW A;  3QEQ A;  5ENW A;  1DE4 A;  4Z78 A;  3DBX A;  4U1H A;  1YN6 A;  3KWW A;  4NO0 A;  4G8I A;  1P7Q A;  4IHO A;  4PJ9 A;  1BII A;  2VAA A;  3MA7 A;  4L9L C;  3KLA A;  3DX6 A;  3HCV A;  3BXN A;  1VAC A;  2AKR A;  3P4N A;  4S0U C;  5EOT A;  3KPN A;  4NT6 A;  3VFP A;  1BZ9 A;  4L8S C;  5C0C A;  4IRS A;  1FZM A;  3W39 A;  1FFP A;  1AGD A;  1YN7 A;  1QVO A;  5C0I A;  4GUP A;  5MEQ A;  5SWZ A;  5HGB A;  4F7P A;  1AO7 A;  3FQR A;  3I6L D;  1DDH A;  2AV7 A;  2BCK A;  1T7W A;  1XR8 A;  5MEP A;  2RFX A;  3TBT A;  1P4L A;  5F1N A;  1FZJ A;  5IB5 A;  3E2H A;  3X12 A;  1W0W A;  3MRO A;  4PRB A;  3VXU A;  3FOM A;  2VLJ A;  3ROO A;  3BWA A;  2AXG A;  2FO4 A;  4Y2D A;  2UWE A;  3BZF A;  1INQ A;  1FG2 A;  5J6G A;  5D9S A;  5IB3 A;  5IND A;  3KPR A;  1HSA A;  3CZF A;  3VFU A;  1S7S A;  4L8C A;  4XXC A;  1IM9 A;  3LKN A;  3IT8 D;  4U1S A;  3AM8 A;  3P4O A;  2HJL A;  3UTQ A;  1A1M A;  3WL9 A;  3LKR A;  4MJ5 A;  3NFN A;  1W0V A;  2GTZ A;  5BRZ A;  2X4P A;  3UBX A;  4FTV A;  3TN0 A;  1L8J A;  4X6F A;  1YPZ A;  3DTX A;  3GML A;  5D5M A;  4QRP A;  4I48 A;  3X14 A;  3BGM A;  1T1Y A;  5F7D A;  3FQN A;  5EFI A;  1EEZ A;  5HGA A;  5J1A A;  4QRS A;  4L8B A;  1RJZ A;  4PG2 A;  3FOL A;  4QRT A;  1G6R H;  4MQ7 A;  3QFD A;  1Z5L A;  3VXO A;  3CPL A;  3RWF A;  3I6G A;  2HLA A;  2XPG A;  5AD0 A;  3BEV A;  3KPS A;  1QLF A;  3LKP A;  4PJE A;  1T7V A;  2AXF A;  3M17 A;  1KCG C;  1T21 A;  3MRF A;  3MRE A;  5EU4 A;  5B39 A;  1KJ3 H;  3BUY A;  1EXU A;  1I1A A;  3GSN H;  4LCC C;  3P77 A;  4LNR A;  1A1O A;  4PJH A;  4PJF A;  4CVX A;  1HHH A;  3D25 A;  3MRH A;  4QRR A;  3OXR A;  5E8N A;  1T1W A;  1CG9 A;  4ZAK A;  1I7T A;  3SCM A;  4N0F A;  5C0A A;  1XH3 A;  4PRP A;  4ZUU A;  1DUY A;  3D18 A;  5C08 A;  4JRY A;  3TBW A;  1HOC A;  3GMR A;  3L3K A;  5MER A;  1FFN A;  4WU5 A;  3HLA A;  3QDG A;  5C07 A;  1JF1 A;  3TJH A;  3FT3 A;  2VLK A;  3JTT A;  1OGA A;  1T80 A;  3D3V A;  3E6F A;  5F1I A;  3VFS A;  4JQV A;  5HGH A;  1S9X A;  4Z76 A;  4E5X A;  4O2F A;  3O9W A;  3CC5 A;  5BJT A;  4G42 A;  2YPL A;  2OI9 A;  3MRJ A;  2OL3 H;  4CW1 A;  4PGE A;  1I4F A;  3VWJ A;  4FFE X;  4G9F A;  3RWI A;  4U1M A;  5HGD A;  5EU3 A;  1UXW A;  4PJB A;  3VXN A;  1S7R A;  1UXS A;  1ZHB A;  3MYJ A;  3ROL A;  3BO8 A;  2FWO A;  3LKO A;  3QUX A;  3MRD A;  1S9W A;  3GMN A;  5D7J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...