1TMCA

The three-dimensional structure of a class i major histocompatibility complex molecule missing the alpha3 domain of the heavy chain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
b'GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68)
publication title The three-dimensional structure of a class I major histocompatibility complex molecule missing the alpha 3 domain of the heavy chain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility antigen
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 1994-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1tmcA00
3HG1A 3VFTA 4HWZA 3FOMA 3QULA 2VE6A 3GMNA 4PJGA 1E28A 3MRDA 4HUUA 4S0UC 4QRPA 2MHAA 4ZUVA 3P9MA 3GJFA 1ZHLA 3V5KA 3GSOA 3O4LA 3M1BA 1ZT1A 1FFOA 2BSSA 1ZHNA 3MRRA 4NNXA 4ELMA 5HHMA 3TPUE 3HCVA 4NHUE 2V2WA 4ZAKA 3TA3A 5EU5A 3UTQA 1LP9A 5D9SA 4JQVA 1Z5LA 5D5MA 5EU6A 1I1AA 3TVMA 1HHHA 1S9XA 5DDHA 1I7UA 2CIIA 2X4OA 3H9SA 4Y4FA 3TJHA 1KPRA 3KPSA 1N5AA 1E27A 2HLAA 3GSWA 1AKJA 1QSEA 1WBYA 4JQXA 3TBVA 3VFVA 2NX5A 4NQDA 4PJ5A 4PRIA 2OI9A 3DX8A 3LKPA 1X7QA 4N0FA 3TBTA 5HGAA 5BJTA 4MQ7A 1QO3A 1LD9A 1QLFA 5D7IA 2YPKA 4PRDA 4APQA 5J6GA 3LKNA 4NQVA 1KJ3H 2X4NA 3RWHA 4PP8C 4MNQA 2CLVA 5L2JA 4O2CA 3MRJA 3LN5A 2GT9A 4PV8A 3D39A 5J1AA 4WW2C 4FFEX 2BCKA 3D2UA 5IVXA 1T7WA 2XPGA 5HHNA 1S9YA 1B0RA 3G08A 5C0GA 2UWEA 1WBZA 3L3KA 3QDMA 2X70A 5FA3A 3KPMA 1FO0H 4LNRA 3VFNA 3U0PA 3DBXA 3MRBA 4GKSA 5DEGA 3MRKA 5INCA 4LHUA 1W72A 3L3IA 1DE4A 1T7YA 3KPPA 3X12A 1EXUA 4L29A 3BEWA 1QRNA 5FDWA 1TVBA 3P73A 3QUXA 1VADA 5F1NA 1TVHA 3ERYA 2FO4A 3VFMA 2AKRA 4HV8A 2HJKA 3MROA 4LCCC 1YN6A 3X13A 5F7DA 3VXNA 3UPRA 1LEGA 2P5WA 2X4SA 3I6KA 3L3JA 5GSVA 3VXSA 3RWEA 1DUZA 1W0VA 4Y4KA 3ARFA 3BW9A 3D3VA 1AGDA 3PWNA 3BO8A 3W0WA 4D0BA 3CDGA 3VFOA 3VRJA 1P1ZA 1WBXA 2ZSVA 2FYYA 2VABA 1I1FA 4L8BA 4L3CA 3IXAA 1FFNA 2H26A 3H9HA 1KBGH 3HPJA 2WY3A 3JTCA 3P4NA 3GMLA 5D2LA 1RK0A 3BGMA 3O3BA 4N8VA 4WO4A 1IM3A 1RJYA 4N5EA 1HHGA 3X11A 1S7XA 3TZVC 4MVBA 3ROOA 1K5NA 1T0NA 1HOCA 2AV7A 2F74A 4L3EA 1SYVA 4PJ9A 4PJ7A 3KYOA 2E7LE 3QZWA 3BUYA 3VCLA 4V3DB 4U1MA 3QQ4A 3ILPA 2AXFA 5C0EA 1QR1A 3QFDA 4ZFZA 2HN7A 4G43A 4PV9A 1CG9A 2F54A 4JFQA 4L8SC 5IB3A 5C9JA 3FONA 3QUKA 1IM9A 5MEPA 1OGTA 4MNGA 4PJIA 3BVNA 3FT2A 3GMQA 3P9LA 3TBSA 3AU1A 5FKPA 1ONQA 5ACZA 2ZOLA 1U58A 4F7MA 4Z77A 3FQTA 3SCMA 5ENWA 3FQRA 5HGHA 4QOKA 4U1JA 2BSTA 3GSQA 3MGOA 4ZUWA 3TF7A 1T7VA 3MRPA 1S9WA 1K8DA 3OXRA 5INDA 4PGBA 3ARGA 1N3NA 5JHDA 4PR5A 3FOLA 3O3EA 5E8OA 4MS8A 3GSVA 5C0DA 1I1YA 3CPLA 4HX1A 3X14A 1ZT4A 4PRAA 5F1IA 3C9NA 4PRBA 2J8UA 4Z76A 1A9BA 4G9DA 1LEKA 4JFOA 5EUOA 1AGEA 3QFJA 1R3HA 2FIKA 5SWZA 1S7SA 3O9WA 3WUWA 2BNQA 5FA4A 4U6XA 4HUXA 1T7XA 3E6FA 3KPLA 1CE6A 1OGAA 2F53A 3BHBA 1DDHA 1QEWA 4QRQA 2BVPA 2BVQA 4MJIA 3S6CA 1A9EA 4PJAA 1JGDA 3BZFA 1KJVA 3KPQA 3PWPA 4IRSA 4K7FA 2DYPA 2VAAA 3KWWA 1JF1A 4Y16A 1FZOA 5IEHA 3E6HA 3MRIA 3QEQA 3VXPA 3BZEA 1I7RA 3MV8A 1XR8A 5J6HA 1S7VA 4PRHA 5GSRA 4MXQA 5C0BA 3GSNH 3VFUA 5ISZA 4N0UA 4G42A 3VJ6A 1JHTA 3MRLA 3REWA 1KJ2H 3QUYA 4CW1A 1UQSA 1N2RA 2BNRA 4FTVA 3MRNA 5C09A 2ESVA 3KPOA 1UXSA 4WWKC 3LKSA 3RGVC 1NANH 1LDPH 3VH8A 3L9RA 3C8KA 4N0CA 3VFSA 2H6PA 3SKMA 5HGBA 1JGEA 1YDPA 3P4OA 2GTZA 3BWAA 4G8GA 4X6DA 5AD0A 1KPUA 2BVOA 1ED3A 4EI5A 3KXFA 2XFXA 1GZQA 1OSZA 4U1LA 3HE6A 3MV9A 2CLRA 3MRFA 3RWJA 4L4TA 3JVGA 3MRHA 4ZUSA 5L2KA 4GUPA 2AK4A 3FRUA 4U6YA 1JPFA 3GMRA 2YEZA 3OX8A 4MJ6A 4PGCA 4D0CA 1AGFA 1LQVA 4WJ5A 3TBWA 3RWFA 1T80A 3P77A 5HGDA 2BSRA 1T20A 3D18A 3MRQA 1BIIA 3P4MA 3QUZA 3SDXA 4NO0A 3MRGA 5BRZA 3SJVA 1L8JA 3HUJA 3H7BA 1G7PA 4PJEA 3OV6A 1FZKA 3HLAA 3RL2A 3WLBA 1W0WA 1AGBA 1B3JA 4LCWA 4PJ8A 4NT6A 1A1OA 3RL1A 2Q7YA 3L3HA 3QDGA 5DEFA 1LK2A 3TN0A 2RFXA 3RTQA 5B39A 4GKNA 4U1KA 4G59A 1MWAH 4LCYA 4PG9A 1T1ZA 4XXCA 1YPZA 3FT3A 2YPLA 2VLLA 3VXOA 1NAMH 3FQUA 2NW3A 3GMMA 3DX7A 5E8NA 3VWJA 1EFXA 3D25A 4F7TA 1M05A 2GJ6A 5D7JC 1FFPA 1I4FA 4U1SA 3VFRA 2CKBH 3BXNA 4WUUA 2CIKA 4F7EA 3PWLA 3BEVA 4IIQC 5IB1A 2ZOKA 2VLRA 5C07A 1HHJA 2X4PA 3QQ3A 4NO3A 4PGDA 4X6EA 4HKJA 1N59A 3HAEA 4PJBA 1VACA 4UQ3A 1GZPA 3JTSA 3PQYA 5C0FA 5MERA 3VFWA 1S7QA 2VLKA 2GUOA 3LV3A 3GSRA 4MX7A 5C0JA 3QDJA 1I7TA 4PG2A 5IROA 5D2NA 3I6LD 3WS3A 4F7CA 3LKQA 3KLAA 4NQXA 2OL3H 3ARBA 3B6SA 5HHPA 2X4TA 1TMCA 3ES6A 3T1FA 2GTWA 5C0CA 3GSUA 4E5XA 2X4UA 3L3DA 3UTSA 4I48A 1FZMA 3FQXA 4L8CA 3VFPA 3RWCA 3AREA 5C0AA 4MJ5A 3CCHA 1MI5A 4WDIA 3KYNA 3T8XA 1B0GA 1HHKA 3MREA 4NO5A 3V5DA 4CVXA 4PGEA 1DUYA 3BH8A 3SPVA 3FQWA 5HHQA 3TFKA 3LKRA 1INQA 1G7QA 1ZS8A 3VXRA 2AXGA 5EO1A 3CC5A 4U1IA 4O2FA 3O8XA 1QSFA 3DTXA 1HHIA 1S7UA 4F7PA 5D7LA 1ZT7A 3MYJA 3ROLA 4PJDA 4HUVA 4V3EB 1HSAA 3FFCA 2GAZA 3QI9A 3PWUA 3FTGA 5IEKA 3SDDA 1ZHBA 4NO2A 4K71B 4U1NA 1OF2A 4Y2DA 5IB5A 5IB2A 2AV1A 5SWSA 5E9DA 2FWOA 1G6RH 4G9FA 4EUPA 3MRMA 5SWQA 3LN4A 4I4WA 1A1NA 1RJZA 1ZHKA 3MA7A 4G8IA 1AO7A 1JPGA 1RK1A 4EN3C 1JE6A 5E8PA 1BQHA 3PWJA 2D31A 3MR9A 4Y4HA 1MHCA 1HSBA 2P5EA 5MENA 3GIVA 3DXAA 4JFFA 3E2HA 3CZFA 1EEYA 5IM7A 1KCGC 4QRTA 5IB4A 4PRPA 3BH9A 1Q94A 3SDAA 3UBXA 3O3DA 3O3AA 4L8DA 3GSXA 3HE7A 2VLJA 3UTTA 3VXUA 1KPVA 4JFDA 3RZCA 3TBYA 1P4LA 4L9LC 1T21A 3DMMA 5EO0A 5BS0A 3SKOA 4PJCA 4IRJA 3FQNA 3AM8A 4X6CA 3GMOA 5E00A 3PWVA 4E0RA 3GMPA 2V2XA 5MEQA 1T7ZA 1HYRC 2GITA 4NQCA 5MEOA 1QVOA 4JRXA 4U1HA 2X4RA 1T22A 3JTTA 4JFEA 3DX6A 1M6OA 3VXMA 5EOTA 3TIDA 1NEZA 1QQDA 1SYSA 1S7RA 1S8DA 3MRCA 5HHOA 4HUWA 4HS3A 3SDCA 1JFMA 4WU5A 5EU3A 1FZJA 4CVZA 1JUFA 3OXSA 5C0IA 2FZ3A 3ECBA 5H94A 3TO4A 3V5HA 3W39A 4L4VA 1P7QA 1T1XA 3CH1A 1FG2A 4ZUTA 4PRNA 2A83A 2JCCA 1CD1A 1KJMA 3FT4A 3TIEA 1ZSDA 3LKOA 4NQEA 4PREA 4PJFA 3TO2A 3ILQC 3RUGA 3IT8D 2C7UA 1PQZA 3NFNA 4ONOA 1VGKA 4QRRA 1ZAGA 3WS6A 3RWIA 3ARDA 1XH3A 1A6ZA 3MV7A 1T1YA 3PABA 5E6IC 2PO6A 4UQ2A 1BD2A 1YN7A 4X6FA 5EFIA 1S7WA 5C08A 4WU7A 4D0DA 2HJLA 3B3IA 1T1WA 4Z78A 5HYJA 4JRYA 4PDCE 1UXWA 5B38A 3MGTA 1A1MA 4PJXA 1T0MA 3KPNA 3E3QA 3L3GA 4NNYA 1KTLA 1AGCA 3KPRA 2CLZA 4O2EA 3RWDA 1BZ9A 3M17A 3VRIA 3RWGA 4QRUA 5BXFA 3I6GA 5F9JA 4QRSA 3WL9A 1S7TA 1MHEA 3VWKA 2ZSWA 1ZVSA 4PJHA 1EEZA 5EU4A 4JFPA 1C16A 2PYEA 4IHOA 2X4QA 3BP4A 4NSKA 3CVHA 1XZ0A 4ZUUA 3BP7A 1XR9A
chains in the Genus database with same CATH superfamily
3HG1A 3VFTA 4HWZA 3FOMA 3QULA 2VE6A 3GMNA 4PJGA 1E28A 3MRDA 4HUUA 4S0UC 4QRPA 2MHAA 4ZUVA 3P9MA 3GJFA 1ZHLA 3V5KA 3GSOA 3O4LA 3M1BA 1ZT1A 1FFOA 2BSSA 1ZHNA 3MRRA 4NNXA 4ELMA 5HHMA 3TPUE 3HCVA 4NHUE 2V2WA 4ZAKA 3TA3A 5EU5A 3UTQA 1LP9A 5D9SA 4JQVA 1Z5LA 5D5MA 5EU6A 1I1AA 3TVMA 1HHHA 1S9XA 4BKWA 5DDHA 1I7UA 2CIIA 2X4OA 3H9SA 4Y4FA 3TJHA 1KPRA 3KPSA 1N5AA 1E27A 2HLAA 3GSWA 1AKJA 1QSEA 1WBYA 4JQXA 3TBVA 3VFVA 2NX5A 4NQDA 4PJ5A 4PRIA 2OI9A 3DX8A 3LKPA 1X7QA 4N0FA 3TBTA 5HGAA 5BJTA 4MQ7A 1QO3A 1LD9A 1QLFA 5D7IA 2YPKA 4PRDA 4APQA 5J6GA 3LKNA 4NQVA 1KJ3H 2X4NA 3RWHA 4PP8C 4MNQA 2CLVA 5L2JA 4O2CA 3MRJA 3LN5A 2GT9A 4PV8A 3D39A 5J1AA 4WW2C 4FFEX 2BCKA 3D2UA 5IVXA 1T7WA 2XPGA 5HHNA 1S9YA 1B0RA 3G08A 5C0GA 2UWEA 1WBZA 3L3KA 3QDMA 2X70A 5FA3A 3KPMA 1FO0H 4LNRA 3VFNA 3U0PA 3DBXA 3MRBA 4GKSA 5DEGA 3MRKA 5INCA 4LHUA 1W72A 3L3IA 1DE4A 1T7YA 3KPPA 3X12A 1EXUA 4L29A 3BEWA 1QRNA 5FDWA 1TVBA 3P73A 3QUXA 1VADA 5F1NA 1TVHA 3ERYA 2FO4A 3VFMA 2AKRA 4HV8A 2HJKA 3MROA 4LCCC 1YN6A 3X13A 5F7DA 3VXNA 3UPRA 1LEGA 2P5WA 2X4SA 3I6KA 3L3JA 5GSVA 3VXSA 3RWEA 1DUZA 1W0VA 4Y4KA 3ARFA 3BW9A 3D3VA 1AGDA 3PWNA 3BO8A 3W0WA 4D0BA 3CDGA 3VFOA 3VRJA 1P1ZA 1WBXA 2ZSVA 2FYYA 2VABA 1I1FA 4L8BA 4L3CA 3IXAA 1FFNA 2H26A 3H9HA 1KBGH 3HPJA 2WY3A 3JTCA 3P4NA 3GMLA 5D2LA 1RK0A 3BGMA 3O3BA 4N8VA 4WO4A 1IM3A 1RJYA 4N5EA 1HHGA 3X11A 1S7XA 3TZVC 4MVBA 3ROOA 1K5NA 1T0NA 1HOCA 2AV7A 2F74A 4L3EA 1SYVA 4PJ9A 4PJ7A 3KYOA 2E7LE 3QZWA 3BUYA 3VCLA 4V3DB 4U1MA 3QQ4A 3ILPA 2AXFA 5C0EA 1QR1A 3QFDA 4ZFZA 2HN7A 4G43A 4PV9A 1CG9A 2F54A 4JFQA 4L8SC 5IB3A 5C9JA 3FONA 3QUKA 1IM9A 5MEPA 1OGTA 4MNGA 4PJIA 3BVNA 3FT2A 3GMQA 3P9LA 3TBSA 3AU1A 5FKPA 1ONQA 5ACZA 2ZOLA 1U58A 4F7MA 4Z77A 3FQTA 3SCMA 5ENWA 3FQRA 5HGHA 4QOKA 4U1JA 2BSTA 3GSQA 3MGOA 4ZUWA 3TF7A 1T7VA 3MRPA 1S9WA 1K8DA 3OXRA 5INDA 4PGBA 3ARGA 1N3NA 5JHDA 4PR5A 3FOLA 3O3EA 5E8OA 4MS8A 3GSVA 5C0DA 1I1YA 3CPLA 4HX1A 3X14A 1ZT4A 4PRAA 5F1IA 3C9NA 4PRBA 2J8UA 4Z76A 1A9BA 4G9DA 1LEKA 4JFOA 5EUOA 1AGEA 3QFJA 1R3HA 2FIKA 5SWZA 1S7SA 3O9WA 3WUWA 2BNQA 5FA4A 4U6XA 4HUXA 1T7XA 3E6FA 3KPLA 1CE6A 1OGAA 2F53A 3BHBA 1DDHA 1QEWA 4QRQA 2BVPA 2BVQA 4MJIA 3S6CA 1A9EA 4PJAA 1JGDA 3BZFA 1KJVA 3KPQA 3PWPA 4IRSA 4K7FA 2DYPA 2VAAA 3KWWA 1JF1A 4Y16A 1FZOA 5IEHA 3E6HA 3MRIA 3QEQA 3VXPA 3BZEA 1I7RA 4JO8A 3MV8A 1XR8A 5J6HA 1S7VA 4PRHA 5GSRA 4MXQA 5C0BA 3GSNH 3VFUA 5ISZA 4N0UA 4G42A 3VJ6A 1JHTA 3MRLA 3REWA 1KJ2H 3QUYA 4CW1A 1UQSA 1N2RA 2BNRA 2NYKA 4FTVA 3MRNA 5C09A 2ESVA 3KPOA 1UXSA 4WWKC 3LKSA 3RGVC 1NANH 1LDPH 3VH8A 3L9RA 3C8KA 4N0CA 3VFSA 2H6PA 3SKMA 5HGBA 1JGEA 1YDPA 3P4OA 2GTZA 3BWAA 4G8GA 4X6DA 5AD0A 1KPUA 2BVOA 1ED3A 4EI5A 3KXFA 2XFXA 1GZQA 1OSZA 4U1LA 3HE6A 3MV9A 2CLRA 3MRFA 3RWJA 4L4TA 3JVGA 3MRHA 4ZUSA 5L2KA 4GUPA 2AK4A 3FRUA 4U6YA 1JPFA 3GMRA 2YEZA 3OX8A 4MJ6A 4PGCA 4D0CA 1AGFA 1LQVA 4WJ5A 3I0TA 3TBWA 3RWFA 1T80A 3P77A 5HGDA 2BSRA 1T20A 3D18A 3MRQA 1BIIA 3P4MA 3QUZA 3SDXA 4NO0A 3MRGA 5BRZA 3SJVA 1L8JA 3HUJA 3H7BA 1G7PA 4PJEA 3OV6A 1FZKA 3HLAA 3RL2A 3WLBA 1W0WA 1AGBA 1B3JA 4LCWA 4PJ8A 4NT6A 1A1OA 3RL1A 2Q7YA 3L3HA 3QDGA 5DEFA 1LK2A 3TN0A 2RFXA 3RTQA 5B39A 4GKNA 4U1KA 4G59A 1MWAH 4LCYA 4PG9A 1T1ZA 4XXCA 1YPZA 3FT3A 2YPLA 2VLLA 3VXOA 1NAMH 3FQUA 2NW3A 3GMMA 3DX7A 5E8NA 3VWJA 1EFXA 3D25A 4F7TA 1M05A 2GJ6A 5D7JC 1FFPA 1I4FA 4U1SA 3VFRA 2CKBH 3BXNA 4WUUA 2CIKA 4F7EA 3PWLA 3BEVA 4IIQC 5IB1A 2ZOKA 2VLRA 5C07A 1HHJA 2X4PA 3QQ3A 4NO3A 4PGDA 4X6EA 4HKJA 1N59A 3HAEA 4PJBA 1VACA 4UQ3A 1GZPA 3JTSA 3PQYA 5C0FA 5MERA 3VFWA 1S7QA 2VLKA 2GUOA 3LV3A 3GSRA 4MX7A 5C0JA 3QDJA 1I7TA 4PG2A 5IROA 5D2NA 3I6LD 3WS3A 4F7CA 3LKQA 3KLAA 4NQXA 2OL3H 3ARBA 3B6SA 5HHPA 2X4TA 1TMCA 3ES6A 3T1FA 2GTWA 5C0CA 3GSUA 4E5XA 2X4UA 3L3DA 3UTSA 4I48A 1FZMA 3FQXA 4L8CA 3VFPA 3RWCA 3AREA 5C0AA 4MJ5A 3CCHA 1MI5A 4WDIA 3KYNA 3T8XA 1B0GA 1HHKA 3MREA 4NO5A 3V5DA 4CVXA 4PGEA 1DUYA 3BH8A 3SPVA 3FQWA 5HHQA 3TFKA 3LKRA 1INQA 1G7QA 1ZS8A 3VXRA 2AXGA 5EO1A 3CC5A 4U1IA 4O2FA 3O8XA 1QSFA 3DTXA 1HHIA 1S7UA 4F7PA 5D7LA 1ZT7A 3MYJA 3ROLA 4PJDA 4HUVA 4V3EB 1HSAA 3FFCA 2GAZA 3QI9A 3PWUA 3FTGA 5IEKA 3SDDA 1ZHBA 4NO2A 4K71B 4U1NA 1OF2A 4Y2DA 5IB5A 5IB2A 2AV1A 5SWSA 5E9DA 2FWOA 1G6RH 4G9FA 4EUPA 3MRMA 5SWQA 3LN4A 4I4WA 1A1NA 1RJZA 1ZHKA 3MA7A 4G8IA 1AO7A 1JPGA 1RK1A 4EN3C 1JE6A 5E8PA 1BQHA 3PWJA 2D31A 3MR9A 4Y4HA 1MHCA 1HSBA 2P5EA 5MENA 3GIVA 3DXAA 4JFFA 3E2HA 3CZFA 1EEYA 5IM7A 1KCGC 4QRTA 5IB4A 4PRPA 3BH9A 1Q94A 3SDAA 3UBXA 3O3DA 3O3AA 4L8DA 3GSXA 3HE7A 2VLJA 3UTTA 3VXUA 1KPVA 4JFDA 3RZCA 3TBYA 1P4LA 4L9LC 1T21A 3DMMA 5EO0A 5BS0A 3SKOA 4PJCA 4IRJA 3FQNA 3AM8A 4X6CA 3GMOA 5E00A 3PWVA 4E0RA 3GMPA 2V2XA 5MEQA 1T7ZA 1HYRC 2GITA 4NQCA 5MEOA 1QVOA 4JRXA 4U1HA 2X4RA 1T22A 3JTTA 4JFEA 2IA1A 1M6OA 3DX6A 3VXMA 5EOTA 3TIDA 1NEZA 1QQDA 1SYSA 1S7RA 1S8DA 3MRCA 5HHOA 4HUWA 4HS3A 3SDCA 1JFMA 4G59C 4WU5A 5EU3A 1FZJA 4CVZA 1JUFA 3OXSA 5C0IA 2FZ3A 3ECBA 5H94A 3TO4A 3V5HA 3W39A 4L4VA 1P7QA 1T1XA 3CH1A 1FG2A 4ZUTA 4PRNA 2A83A 2JCCA 1CD1A 1KJMA 3FT4A 3TIEA 1ZSDA 3LKOA 4NQEA 4PREA 4PJFA 3TO2A 3ILQC 3RUGA 3IT8D 2C7UA 1PQZA 3NFNA 4ONOA 1VGKA 4QRRA 1ZAGA 3WS6A 3RWIA 3ARDA 1XH3A 1A6ZA 3MV7A 1T1YA 3PABA 5E6IC 2PO6A 4UQ2A 1BD2A 1YN7A 4X6FA 5EFIA 1S7WA 5C08A 4WU7A 4D0DA 2HJLA 3B3IA 1T1WA 4Z78A 5HYJA 4JRYA 4PDCE 1UXWA 5B38A 3MGTA 1A1MA 4PJXA 1T0MA 3KPNA 3E3QA 3L3GA 4NNYA 1KTLA 1AGCA 3KPRA 2CLZA 4O2EA 3RWDA 1BZ9A 3M17A 3VRIA 3RWGA 4QRUA 5BXFA 3I6GA 5F9JA 4QRSA 2O5NA 3WL9A 1S7TA 1MHEA 3VWKA 2ZSWA 1ZVSA 4PJHA 1EEZA 5EU4A 4JFPA 1C16A 2PYEA 4IHOA 2X4QA 3BP4A 4NSKA 3CVHA 1XZ0A 4ZUUA 3BP7A 1XR9A
chains in the Genus database with same CATH topology
3HG1A 3VFTA 4HWZA 3FOMA 3QULA 2VE6A 3GMNA 4PJGA 1E28A 3MRDA 4HUUA 4S0UC 4QRPA 2MHAA 4ZUVA 3P9MA 3GJFA 1ZHLA 3V5KA 3GSOA 3O4LA 3M1BA 1ZT1A 1FFOA 2BSSA 1ZHNA 3MRRA 4NNXA 4ELMA 5HHMA 3TPUE 3HCVA 4NHUE 2V2WA 4ZAKA 3TA3A 5EU5A 3UTQA 1LP9A 5D9SA 4JQVA 1Z5LA 5D5MA 5EU6A 1I1AA 3TVMA 1HHHA 1S9XA 5DDHA 1I7UA 2CIIA 2X4OA 3H9SA 4Y4FA 3TJHA 1KPRA 3KPSA 1N5AA 1E27A 2HLAA 3GSWA 1AKJA 1QSEA 1WBYA 4JQXA 3TBVA 3VFVA 2NX5A 4NQDA 4PJ5A 4PRIA 2OI9A 3DX8A 3LKPA 1X7QA 4N0FA 3TBTA 5HGAA 5BJTA 4MQ7A 1QO3A 1LD9A 1QLFA 5D7IA 2YPKA 4PRDA 4APQA 5J6GA 3LKNA 4NQVA 1KJ3H 2X4NA 3RWHA 4PP8C 4MNQA 2CLVA 5L2JA 4O2CA 3MRJA 3LN5A 2GT9A 4PV8A 3D39A 5J1AA 4WW2C 4FFEX 2BCKA 3D2UA 5IVXA 1T7WA 2XPGA 5HHNA 1S9YA 1B0RA 3G08A 5C0GA 2UWEA 1WBZA 3L3KA 3QDMA 2X70A 5FA3A 3KPMA 1FO0H 4LNRA 3VFNA 3U0PA 3DBXA 3MRBA 4GKSA 5DEGA 3MRKA 5INCA 4LHUA 1W72A 3L3IA 1DE4A 1T7YA 3KPPA 3X12A 1EXUA 4L29A 3BEWA 1QRNA 5FDWA 1TVBA 3P73A 3QUXA 1VADA 5F1NA 1TVHA 3ERYA 2FO4A 3VFMA 2AKRA 4HV8A 2HJKA 3MROA 4LCCC 1YN6A 3X13A 5F7DA 3VXNA 3UPRA 1LEGA 2P5WA 2X4SA 3I6KA 3L3JA 5GSVA 3VXSA 3RWEA 1DUZA 1W0VA 4Y4KA 3ARFA 3BW9A 3D3VA 1AGDA 3PWNA 3BO8A 3W0WA 4D0BA 3CDGA 3VFOA 3VRJA 1P1ZA 1WBXA 2ZSVA 2FYYA 2VABA 1I1FA 4L8BA 4L3CA 3IXAA 1FFNA 2H26A 3H9HA 1KBGH 3HPJA 2WY3A 3JTCA 3P4NA 3GMLA 5D2LA 1RK0A 3BGMA 3O3BA 4N8VA 4WO4A 1IM3A 1RJYA 4N5EA 1HHGA 3X11A 1S7XA 3TZVC 4MVBA 3ROOA 1K5NA 1T0NA 1HOCA 2AV7A 2F74A 4L3EA 1SYVA 4PJ9A 4PJ7A 3KYOA 2E7LE 3QZWA 3BUYA 3VCLA 4V3DB 4U1MA 3QQ4A 3ILPA 2AXFA 5C0EA 1QR1A 3QFDA 4ZFZA 2HN7A 4G43A 4PV9A 1CG9A 2F54A 4JFQA 4L8SC 5IB3A 5C9JA 3FONA 3QUKA 1IM9A 5MEPA 1OGTA 4MNGA 4PJIA 3BVNA 3FT2A 3GMQA 3P9LA 3TBSA 3AU1A 5FKPA 1ONQA 5ACZA 2ZOLA 1U58A 4F7MA 4Z77A 3FQTA 3SCMA 5ENWA 3FQRA 5HGHA 4QOKA 4U1JA 2BSTA 3GSQA 3MGOA 4ZUWA 3TF7A 1T7VA 3MRPA 1S9WA 1K8DA 3OXRA 5INDA 4PGBA 3ARGA 1N3NA 5JHDA 4PR5A 3FOLA 3O3EA 5E8OA 4MS8A 3GSVA 5C0DA 1I1YA 3CPLA 4HX1A 3X14A 1ZT4A 4PRAA 5F1IA 3C9NA 4PRBA 2J8UA 4Z76A 1A9BA 4G9DA 1LEKA 4JFOA 5EUOA 1AGEA 3QFJA 1R3HA 2FIKA 5SWZA 1S7SA 3O9WA 3WUWA 2BNQA 5FA4A 4U6XA 4HUXA 1T7XA 3E6FA 3KPLA 1CE6A 1OGAA 2F53A 3BHBA 1DDHA 1QEWA 4QRQA 2BVPA 2BVQA 4MJIA 3S6CA 1A9EA 4PJAA 1JGDA 3BZFA 1KJVA 3KPQA 3PWPA 4IRSA 4K7FA 2DYPA 2VAAA 3KWWA 1JF1A 4Y16A 1FZOA 5IEHA 3E6HA 3MRIA 3QEQA 3VXPA 3BZEA 1I7RA 3MV8A 1XR8A 5J6HA 1S7VA 4PRHA 5GSRA 4MXQA 5C0BA 3GSNH 3VFUA 5ISZA 4N0UA 4G42A 3VJ6A 1JHTA 3MRLA 3REWA 1KJ2H 3QUYA 4CW1A 1UQSA 1N2RA 2BNRA 4FTVA 3MRNA 5C09A 2ESVA 3KPOA 1UXSA 4WWKC 3LKSA 3RGVC 1NANH 1LDPH 3VH8A 3L9RA 3C8KA 4N0CA 3VFSA 2H6PA 3SKMA 5HGBA 1JGEA 1YDPA 3P4OA 2GTZA 3BWAA 4G8GA 4X6DA 5AD0A 1KPUA 2BVOA 1ED3A 4EI5A 3KXFA 2XFXA 1GZQA 1OSZA 4U1LA 3HE6A 3MV9A 2CLRA 3MRFA 3RWJA 4L4TA 3JVGA 3MRHA 4ZUSA 5L2KA 4GUPA 2AK4A 3FRUA 4U6YA 1JPFA 3GMRA 2YEZA 3OX8A 4MJ6A 4PGCA 4D0CA 1AGFA 1LQVA 4WJ5A 3TBWA 3RWFA 1T80A 3P77A 5HGDA 2BSRA 1T20A 3D18A 3MRQA 1BIIA 3P4MA 3QUZA 3SDXA 4NO0A 3MRGA 5BRZA 3SJVA 1L8JA 3HUJA 3H7BA 1G7PA 4PJEA 3OV6A 1FZKA 3HLAA 3RL2A 3WLBA 1W0WA 1AGBA 1B3JA 4LCWA 4PJ8A 4NT6A 1A1OA 3RL1A 2Q7YA 3L3HA 3QDGA 5DEFA 1LK2A 3TN0A 2RFXA 3RTQA 5B39A 4GKNA 4U1KA 4G59A 1MWAH 4LCYA 4PG9A 1T1ZA 4XXCA 1YPZA 3FT3A 2YPLA 2VLLA 3VXOA 1NAMH 3FQUA 2NW3A 3GMMA 3DX7A 5E8NA 3VWJA 1EFXA 3D25A 4F7TA 1M05A 2GJ6A 5D7JC 1FFPA 1I4FA 4U1SA 3VFRA 2CKBH 3BXNA 4WUUA 2CIKA 4F7EA 3PWLA 3BEVA 4IIQC 5IB1A 2ZOKA 2VLRA 5C07A 1HHJA 2X4PA 3QQ3A 4NO3A 4PGDA 4X6EA 4HKJA 1N59A 3HAEA 4PJBA 1VACA 4UQ3A 1GZPA 3JTSA 3PQYA 5C0FA 5MERA 3VFWA 1S7QA 2VLKA 2GUOA 3LV3A 3GSRA 4MX7A 5C0JA 3QDJA 1I7TA 4PG2A 5IROA 5D2NA 3I6LD 3WS3A 4F7CA 3LKQA 3KLAA 4NQXA 2OL3H 3ARBA 3B6SA 5HHPA 2X4TA 1TMCA 3ES6A 3T1FA 2GTWA 5C0CA 3GSUA 4E5XA 2X4UA 3L3DA 3UTSA 4I48A 1FZMA 3FQXA 4L8CA 3VFPA 3RWCA 3AREA 5C0AA 4MJ5A 3CCHA 1MI5A 4WDIA 3KYNA 3T8XA 1B0GA 1HHKA 3MREA 4NO5A 3V5DA 4CVXA 4PGEA 1DUYA 3BH8A 3SPVA 3FQWA 5HHQA 3TFKA 3LKRA 1INQA 1G7QA 1ZS8A 3VXRA 2AXGA 5EO1A 3CC5A 4U1IA 4O2FA 3O8XA 1QSFA 3DTXA 1HHIA 1S7UA 4F7PA 5D7LA 1ZT7A 3MYJA 3ROLA 4PJDA 4HUVA 4V3EB 1HSAA 3FFCA 2GAZA 3QI9A 3PWUA 3FTGA 5IEKA 3SDDA 1ZHBA 4NO2A 4K71B 4U1NA 1OF2A 4Y2DA 5IB5A 5IB2A 2AV1A 5SWSA 5E9DA 2FWOA 1G6RH 4G9FA 4EUPA 3MRMA 5SWQA 3LN4A 4I4WA 1A1NA 1RJZA 1ZHKA 3MA7A 4G8IA 1AO7A 1JPGA 1RK1A 4EN3C 1JE6A 5E8PA 1BQHA 3PWJA 2D31A 3MR9A 4Y4HA 1MHCA 1HSBA 2P5EA 5MENA 3GIVA 3DXAA 4JFFA 3E2HA 3CZFA 1EEYA 5IM7A 1KCGC 4QRTA 5IB4A 4PRPA 3BH9A 1Q94A 3SDAA 3UBXA 3O3DA 3O3AA 4L8DA 3GSXA 3HE7A 2VLJA 3UTTA 3VXUA 1KPVA 4JFDA 3RZCA 3TBYA 1P4LA 4L9LC 1T21A 3DMMA 5EO0A 5BS0A 3SKOA 4PJCA 4IRJA 3FQNA 3AM8A 4X6CA 3GMOA 5E00A 3PWVA 4E0RA 3GMPA 2V2XA 5MEQA 1T7ZA 1HYRC 2GITA 4NQCA 5MEOA 1QVOA 4JRXA 4U1HA 2X4RA 1T22A 3JTTA 4JFEA 3DX6A 1M6OA 3VXMA 5EOTA 3TIDA 1NEZA 1QQDA 1SYSA 1S7RA 1S8DA 3MRCA 5HHOA 4HUWA 4HS3A 3SDCA 1JFMA 4WU5A 5EU3A 1FZJA 4CVZA 1JUFA 3OXSA 5C0IA 2FZ3A 3ECBA 5H94A 3TO4A 3V5HA 3W39A 4L4VA 1P7QA 1T1XA 3CH1A 1FG2A 4ZUTA 4PRNA 2A83A 2JCCA 1CD1A 1KJMA 3FT4A 3TIEA 1ZSDA 3LKOA 4NQEA 4PREA 4PJFA 3TO2A 3ILQC 3RUGA 3IT8D 2C7UA 1PQZA 3NFNA 4ONOA 1VGKA 4QRRA 1ZAGA 3WS6A 3RWIA 3ARDA 1XH3A 1A6ZA 3MV7A 1T1YA 3PABA 5E6IC 2PO6A 4UQ2A 1BD2A 1YN7A 4X6FA 5EFIA 1S7WA 5C08A 4WU7A 4D0DA 2HJLA 3B3IA 1T1WA 4Z78A 5HYJA 4JRYA 4PDCE 1UXWA 5B38A 3MGTA 1A1MA 4PJXA 1T0MA 3KPNA 3E3QA 3L3GA 4NNYA 1KTLA 1AGCA 3KPRA 2CLZA 4O2EA 3RWDA 1BZ9A 3M17A 3VRIA 3RWGA 4QRUA 5BXFA 3I6GA 5F9JA 4QRSA 3WL9A 1S7TA 1MHEA 3VWKA 2ZSWA 1ZVSA 4PJHA 1EEZA 5EU4A 4JFPA 1C16A 2PYEA 4IHOA 2X4QA 3BP4A 4NSKA 3CVHA 1XZ0A 4ZUUA 3BP7A 1XR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HG1 A;  3VFT A;  4HWZ A;  3FOM A;  3QUL A;  2VE6 A;  3GMN A;  4PJG A;  1E28 A;  3MRD A;  4HUU A;  4S0U C;  4QRP A;  2MHA A;  4ZUV A;  3P9M A;  3GJF A;  1ZHL A;  3V5K A;  3GSO A;  3O4L A;  3M1B A;  1ZT1 A;  1FFO A;  2BSS A;  1ZHN A;  3MRR A;  4NNX A;  4ELM A;  5HHM A;  3TPU E;  3HCV A;  4NHU E;  2V2W A;  4ZAK A;  3TA3 A;  5EU5 A;  3UTQ A;  1LP9 A;  5D9S A;  4JQV A;  1Z5L A;  5D5M A;  5EU6 A;  1I1A A;  3TVM A;  1HHH A;  1S9X A;  5DDH A;  1I7U A;  2CII A;  2X4O A;  3H9S A;  4Y4F A;  3TJH A;  1KPR A;  3KPS A;  1N5A A;  1E27 A;  2HLA A;  3GSW A;  1AKJ A;  1QSE A;  1WBY A;  4JQX A;  3TBV A;  3VFV A;  2NX5 A;  4NQD A;  4PJ5 A;  4PRI A;  2OI9 A;  3DX8 A;  3LKP A;  1X7Q A;  4N0F A;  3TBT A;  5HGA A;  5BJT A;  4MQ7 A;  1QO3 A;  1LD9 A;  1QLF A;  5D7I A;  2YPK A;  4PRD A;  4APQ A;  5J6G A;  3LKN A;  4NQV A;  1KJ3 H;  2X4N A;  3RWH A;  4PP8 C;  4MNQ A;  2CLV A;  5L2J A;  4O2C A;  3MRJ A;  3LN5 A;  2GT9 A;  4PV8 A;  3D39 A;  5J1A A;  4WW2 C;  4FFE X;  2BCK A;  3D2U A;  5IVX A;  1T7W A;  2XPG A;  5HHN A;  1S9Y A;  1B0R A;  3G08 A;  5C0G A;  2UWE A;  1WBZ A;  3L3K A;  3QDM A;  2X70 A;  5FA3 A;  3KPM A;  1FO0 H;  4LNR A;  3VFN A;  3U0P A;  3DBX A;  3MRB A;  4GKS A;  5DEG A;  3MRK A;  5INC A;  4LHU A;  1W72 A;  3L3I A;  1DE4 A;  1T7Y A;  3KPP A;  3X12 A;  1EXU A;  4L29 A;  3BEW A;  1QRN A;  5FDW A;  1TVB A;  3P73 A;  3QUX A;  1VAD A;  5F1N A;  1TVH A;  3ERY A;  2FO4 A;  3VFM A;  2AKR A;  4HV8 A;  2HJK A;  3MRO A;  4LCC C;  1YN6 A;  3X13 A;  5F7D A;  3VXN A;  3UPR A;  1LEG A;  2P5W A;  2X4S A;  3I6K A;  3L3J A;  5GSV A;  3VXS A;  3RWE A;  1DUZ A;  1W0V A;  4Y4K A;  3ARF A;  3BW9 A;  3D3V A;  1AGD A;  3PWN A;  3BO8 A;  3W0W A;  4D0B A;  3CDG A;  3VFO A;  3VRJ A;  1P1Z A;  1WBX A;  2ZSV A;  2FYY A;  2VAB A;  1I1F A;  4L8B A;  4L3C A;  3IXA A;  1FFN A;  2H26 A;  3H9H A;  1KBG H;  3HPJ A;  2WY3 A;  3JTC A;  3P4N A;  3GML A;  5D2L A;  1RK0 A;  3BGM A;  3O3B A;  4N8V A;  4WO4 A;  1IM3 A;  1RJY A;  4N5E A;  1HHG A;  3X11 A;  1S7X A;  3TZV C;  4MVB A;  3ROO A;  1K5N A;  1T0N A;  1HOC A;  2AV7 A;  2F74 A;  4L3E A;  1SYV A;  4PJ9 A;  4PJ7 A;  3KYO A;  2E7L E;  3QZW A;  3BUY A;  3VCL A;  4V3D B;  4U1M A;  3QQ4 A;  3ILP A;  2AXF A;  5C0E A;  1QR1 A;  3QFD A;  4ZFZ A;  2HN7 A;  4G43 A;  4PV9 A;  1CG9 A;  2F54 A;  4JFQ A;  4L8S C;  5IB3 A;  5C9J A;  3FON A;  3QUK A;  1IM9 A;  5MEP A;  1OGT A;  4MNG A;  4PJI A;  3BVN A;  3FT2 A;  3GMQ A;  3P9L A;  3TBS A;  3AU1 A;  5FKP A;  1ONQ A;  5ACZ A;  2ZOL A;  1U58 A;  4F7M A;  4Z77 A;  3FQT A;  3SCM A;  5ENW A;  3FQR A;  5HGH A;  4QOK A;  4U1J A;  2BST A;  3GSQ A;  3MGO A;  4ZUW A;  3TF7 A;  1T7V A;  3MRP A;  1S9W A;  1K8D A;  3OXR A;  5IND A;  4PGB A;  3ARG A;  1N3N A;  5JHD A;  4PR5 A;  3FOL A;  3O3E A;  5E8O A;  4MS8 A;  3GSV A;  5C0D A;  1I1Y A;  3CPL A;  4HX1 A;  3X14 A;  1ZT4 A;  4PRA A;  5F1I A;  3C9N A;  4PRB A;  2J8U A;  4Z76 A;  1A9B A;  4G9D A;  1LEK A;  4JFO A;  5EUO A;  1AGE A;  3QFJ A;  1R3H A;  2FIK A;  5SWZ A;  1S7S A;  3O9W A;  3WUW A;  2BNQ A;  5FA4 A;  4U6X A;  4HUX A;  1T7X A;  3E6F A;  3KPL A;  1CE6 A;  1OGA A;  2F53 A;  3BHB A;  1DDH A;  1QEW A;  4QRQ A;  2BVP A;  2BVQ A;  4MJI A;  3S6C A;  1A9E A;  4PJA A;  1JGD A;  3BZF A;  1KJV A;  3KPQ A;  3PWP A;  4IRS A;  4K7F A;  2DYP A;  2VAA A;  3KWW A;  1JF1 A;  4Y16 A;  1FZO A;  5IEH A;  3E6H A;  3MRI A;  3QEQ A;  3VXP A;  3BZE A;  1I7R A;  3MV8 A;  1XR8 A;  5J6H A;  1S7V A;  4PRH A;  5GSR A;  4MXQ A;  5C0B A;  3GSN H;  3VFU A;  5ISZ A;  4N0U A;  4G42 A;  3VJ6 A;  1JHT A;  3MRL A;  3REW A;  1KJ2 H;  3QUY A;  4CW1 A;  1UQS A;  1N2R A;  2BNR A;  4FTV A;  3MRN A;  5C09 A;  2ESV A;  3KPO A;  1UXS A;  4WWK C;  3LKS A;  3RGV C;  1NAN H;  1LDP H;  3VH8 A;  3L9R A;  3C8K A;  4N0C A;  3VFS A;  2H6P A;  3SKM A;  5HGB A;  1JGE A;  1YDP A;  3P4O A;  2GTZ A;  3BWA A;  4G8G A;  4X6D A;  5AD0 A;  1KPU A;  2BVO A;  1ED3 A;  4EI5 A;  3KXF A;  2XFX A;  1GZQ A;  1OSZ A;  4U1L A;  3HE6 A;  3MV9 A;  2CLR A;  3MRF A;  3RWJ A;  4L4T A;  3JVG A;  3MRH A;  4ZUS A;  5L2K A;  4GUP A;  2AK4 A;  3FRU A;  4U6Y A;  1JPF A;  3GMR A;  2YEZ A;  3OX8 A;  4MJ6 A;  4PGC A;  4D0C A;  1AGF A;  1LQV A;  4WJ5 A;  3TBW A;  3RWF A;  1T80 A;  3P77 A;  5HGD A;  2BSR A;  1T20 A;  3D18 A;  3MRQ A;  1BII A;  3P4M A;  3QUZ A;  3SDX A;  4NO0 A;  3MRG A;  5BRZ A;  3SJV A;  1L8J A;  3HUJ A;  3H7B A;  1G7P A;  4PJE A;  3OV6 A;  1FZK A;  3HLA A;  3RL2 A;  3WLB A;  1W0W A;  1AGB A;  1B3J A;  4LCW A;  4PJ8 A;  4NT6 A;  1A1O A;  3RL1 A;  2Q7Y A;  3L3H A;  3QDG A;  5DEF A;  1LK2 A;  3TN0 A;  2RFX A;  3RTQ A;  5B39 A;  4GKN A;  4U1K A;  4G59 A;  1MWA H;  4LCY A;  4PG9 A;  1T1Z A;  4XXC A;  1YPZ A;  3FT3 A;  2YPL A;  2VLL A;  3VXO A;  1NAM H;  3FQU A;  2NW3 A;  3GMM A;  3DX7 A;  5E8N A;  3VWJ A;  1EFX A;  3D25 A;  4F7T A;  1M05 A;  2GJ6 A;  5D7J C;  1FFP A;  1I4F A;  4U1S A;  3VFR A;  2CKB H;  3BXN A;  4WUU A;  2CIK A;  4F7E A;  3PWL A;  3BEV A;  4IIQ C;  5IB1 A;  2ZOK A;  2VLR A;  5C07 A;  1HHJ A;  2X4P A;  3QQ3 A;  4NO3 A;  4PGD A;  4X6E A;  4HKJ A;  1N59 A;  3HAE A;  4PJB A;  1VAC A;  4UQ3 A;  1GZP A;  3JTS A;  3PQY A;  5C0F A;  5MER A;  3VFW A;  1S7Q A;  2VLK A;  2GUO A;  3LV3 A;  3GSR A;  4MX7 A;  5C0J A;  3QDJ A;  1I7T A;  4PG2 A;  5IRO A;  5D2N A;  3I6L D;  3WS3 A;  4F7C A;  3LKQ A;  3KLA A;  4NQX A;  2OL3 H;  3ARB A;  3B6S A;  5HHP A;  2X4T A;  1TMC A;  3ES6 A;  3T1F A;  2GTW A;  5C0C A;  3GSU A;  4E5X A;  2X4U A;  3L3D A;  3UTS A;  4I48 A;  1FZM A;  3FQX A;  4L8C A;  3VFP A;  3RWC A;  3ARE A;  5C0A A;  4MJ5 A;  3CCH A;  1MI5 A;  4WDI A;  3KYN A;  3T8X A;  1B0G A;  1HHK A;  3MRE A;  4NO5 A;  3V5D A;  4CVX A;  4PGE A;  1DUY A;  3BH8 A;  3SPV A;  3FQW A;  5HHQ A;  3TFK A;  3LKR A;  1INQ A;  1G7Q A;  1ZS8 A;  3VXR A;  2AXG A;  5EO1 A;  3CC5 A;  4U1I A;  4O2F A;  3O8X A;  1QSF A;  3DTX A;  1HHI A;  1S7U A;  4F7P A;  5D7L A;  1ZT7 A;  3MYJ A;  3ROL A;  4PJD A;  4HUV A;  4V3E B;  1HSA A;  3FFC A;  2GAZ A;  3QI9 A;  3PWU A;  3FTG A;  5IEK A;  3SDD A;  1ZHB A;  4NO2 A;  4K71 B;  4U1N A;  1OF2 A;  4Y2D A;  5IB5 A;  5IB2 A;  2AV1 A;  5SWS A;  5E9D A;  2FWO A;  1G6R H;  4G9F A;  4EUP A;  3MRM A;  5SWQ A;  3LN4 A;  4I4W A;  1A1N A;  1RJZ A;  1ZHK A;  3MA7 A;  4G8I A;  1AO7 A;  1JPG A;  1RK1 A;  4EN3 C;  1JE6 A;  5E8P A;  1BQH A;  3PWJ A;  2D31 A;  3MR9 A;  4Y4H A;  1MHC A;  1HSB A;  2P5E A;  5MEN A;  3GIV A;  3DXA A;  4JFF A;  3E2H A;  3CZF A;  1EEY A;  5IM7 A;  1KCG C;  4QRT A;  5IB4 A;  4PRP A;  3BH9 A;  1Q94 A;  3SDA A;  3UBX A;  3O3D A;  3O3A A;  4L8D A;  3GSX A;  3HE7 A;  2VLJ A;  3UTT A;  3VXU A;  1KPV A;  4JFD A;  3RZC A;  3TBY A;  1P4L A;  4L9L C;  1T21 A;  3DMM A;  5EO0 A;  5BS0 A;  3SKO A;  4PJC A;  4IRJ A;  3FQN A;  3AM8 A;  4X6C A;  3GMO A;  5E00 A;  3PWV A;  4E0R A;  3GMP A;  2V2X A;  5MEQ A;  1T7Z A;  1HYR C;  2GIT A;  4NQC A;  5MEO A;  1QVO A;  4JRX A;  4U1H A;  2X4R A;  1T22 A;  3JTT A;  4JFE A;  3DX6 A;  1M6O A;  3VXM A;  5EOT A;  3TID A;  1NEZ A;  1QQD A;  1SYS A;  1S7R A;  1S8D A;  3MRC A;  5HHO A;  4HUW A;  4HS3 A;  3SDC A;  1JFM A;  4WU5 A;  5EU3 A;  1FZJ A;  4CVZ A;  1JUF A;  3OXS A;  5C0I A;  2FZ3 A;  3ECB A;  5H94 A;  3TO4 A;  3V5H A;  3W39 A;  4L4V A;  1P7Q A;  1T1X A;  3CH1 A;  1FG2 A;  4ZUT A;  4PRN A;  2A83 A;  2JCC A;  1CD1 A;  1KJM A;  3FT4 A;  3TIE A;  1ZSD A;  3LKO A;  4NQE A;  4PRE A;  4PJF A;  3TO2 A;  3ILQ C;  3RUG A;  3IT8 D;  2C7U A;  1PQZ A;  3NFN A;  4ONO A;  1VGK A;  4QRR A;  1ZAG A;  3WS6 A;  3RWI A;  3ARD A;  1XH3 A;  1A6Z A;  3MV7 A;  1T1Y A;  3PAB A;  5E6I C;  2PO6 A;  4UQ2 A;  1BD2 A;  1YN7 A;  4X6F A;  5EFI A;  1S7W A;  5C08 A;  4WU7 A;  4D0D A;  2HJL A;  3B3I A;  1T1W A;  4Z78 A;  5HYJ A;  4JRY A;  4PDC E;  1UXW A;  5B38 A;  3MGT A;  1A1M A;  4PJX A;  1T0M A;  3KPN A;  3E3Q A;  3L3G A;  4NNY A;  1KTL A;  1AGC A;  3KPR A;  2CLZ A;  4O2E A;  3RWD A;  1BZ9 A;  3M17 A;  3VRI A;  3RWG A;  4QRU A;  5BXF A;  3I6G A;  5F9J A;  4QRS A;  3WL9 A;  1S7T A;  1MHE A;  3VWK A;  2ZSW A;  1ZVS A;  4PJH A;  1EEZ A;  5EU4 A;  4JFP A;  1C16 A;  2PYE A;  4IHO A;  2X4Q A;  3BP4 A;  4NSK A;  3CVH A;  1XZ0 A;  4ZUU A;  3BP7 A;  1XR9 A; 
#chains in the Genus database with same CATH topology
 3HG1 A;  3VFT A;  4HWZ A;  3FOM A;  3QUL A;  2VE6 A;  3GMN A;  4PJG A;  1E28 A;  3MRD A;  4HUU A;  4S0U C;  4QRP A;  2MHA A;  4ZUV A;  3P9M A;  3GJF A;  1ZHL A;  3V5K A;  3GSO A;  3O4L A;  3M1B A;  1ZT1 A;  1FFO A;  2BSS A;  1ZHN A;  3MRR A;  4NNX A;  4ELM A;  5HHM A;  3TPU E;  3HCV A;  4NHU E;  2V2W A;  4ZAK A;  3TA3 A;  5EU5 A;  3UTQ A;  1LP9 A;  5D9S A;  4JQV A;  1Z5L A;  5D5M A;  5EU6 A;  1I1A A;  3TVM A;  1HHH A;  1S9X A;  4BKW A;  5DDH A;  1I7U A;  2CII A;  2X4O A;  3H9S A;  4Y4F A;  3TJH A;  1KPR A;  3KPS A;  1N5A A;  1E27 A;  2HLA A;  3GSW A;  1AKJ A;  1QSE A;  1WBY A;  4JQX A;  3TBV A;  3VFV A;  2NX5 A;  4NQD A;  4PJ5 A;  4PRI A;  2OI9 A;  3DX8 A;  3LKP A;  1X7Q A;  4N0F A;  3TBT A;  5HGA A;  5BJT A;  4MQ7 A;  1QO3 A;  1LD9 A;  1QLF A;  5D7I A;  2YPK A;  4PRD A;  4APQ A;  5J6G A;  3LKN A;  4NQV A;  1KJ3 H;  2X4N A;  3RWH A;  4PP8 C;  4MNQ A;  2CLV A;  5L2J A;  4O2C A;  3MRJ A;  3LN5 A;  2GT9 A;  4PV8 A;  3D39 A;  5J1A A;  4WW2 C;  4FFE X;  2BCK A;  3D2U A;  5IVX A;  1T7W A;  2XPG A;  5HHN A;  1S9Y A;  1B0R A;  3G08 A;  5C0G A;  2UWE A;  1WBZ A;  3L3K A;  3QDM A;  2X70 A;  5FA3 A;  3KPM A;  1FO0 H;  4LNR A;  3VFN A;  3U0P A;  3DBX A;  3MRB A;  4GKS A;  5DEG A;  3MRK A;  5INC A;  4LHU A;  1W72 A;  3L3I A;  1DE4 A;  1T7Y A;  3KPP A;  3X12 A;  1EXU A;  4L29 A;  3BEW A;  1QRN A;  5FDW A;  1TVB A;  3P73 A;  3QUX A;  1VAD A;  5F1N A;  1TVH A;  3ERY A;  2FO4 A;  3VFM A;  2AKR A;  4HV8 A;  2HJK A;  3MRO A;  4LCC C;  1YN6 A;  3X13 A;  5F7D A;  3VXN A;  3UPR A;  1LEG A;  2P5W A;  2X4S A;  3I6K A;  3L3J A;  5GSV A;  3VXS A;  3RWE A;  1DUZ A;  1W0V A;  4Y4K A;  3ARF A;  3BW9 A;  3D3V A;  1AGD A;  3PWN A;  3BO8 A;  3W0W A;  4D0B A;  3CDG A;  3VFO A;  3VRJ A;  1P1Z A;  1WBX A;  2ZSV A;  2FYY A;  2VAB A;  1I1F A;  4L8B A;  4L3C A;  3IXA A;  1FFN A;  2H26 A;  3H9H A;  1KBG H;  3HPJ A;  2WY3 A;  3JTC A;  3P4N A;  3GML A;  5D2L A;  1RK0 A;  3BGM A;  3O3B A;  4N8V A;  4WO4 A;  1IM3 A;  1RJY A;  4N5E A;  1HHG A;  3X11 A;  1S7X A;  3TZV C;  4MVB A;  3ROO A;  1K5N A;  1T0N A;  1HOC A;  2AV7 A;  2F74 A;  4L3E A;  1SYV A;  4PJ9 A;  4PJ7 A;  3KYO A;  2E7L E;  3QZW A;  3BUY A;  3VCL A;  4V3D B;  4U1M A;  3QQ4 A;  3ILP A;  2AXF A;  5C0E A;  1QR1 A;  3QFD A;  4ZFZ A;  2HN7 A;  4G43 A;  4PV9 A;  1CG9 A;  2F54 A;  4JFQ A;  4L8S C;  5IB3 A;  5C9J A;  3FON A;  3QUK A;  1IM9 A;  5MEP A;  1OGT A;  4MNG A;  4PJI A;  3BVN A;  3FT2 A;  3GMQ A;  3P9L A;  3TBS A;  3AU1 A;  5FKP A;  1ONQ A;  5ACZ A;  2ZOL A;  1U58 A;  4F7M A;  4Z77 A;  3FQT A;  3SCM A;  5ENW A;  3FQR A;  5HGH A;  4QOK A;  4U1J A;  2BST A;  3GSQ A;  3MGO A;  4ZUW A;  3TF7 A;  1T7V A;  3MRP A;  1S9W A;  1K8D A;  3OXR A;  5IND A;  4PGB A;  3ARG A;  1N3N A;  5JHD A;  4PR5 A;  3FOL A;  3O3E A;  5E8O A;  4MS8 A;  3GSV A;  5C0D A;  1I1Y A;  3CPL A;  4HX1 A;  3X14 A;  1ZT4 A;  4PRA A;  5F1I A;  3C9N A;  4PRB A;  2J8U A;  4Z76 A;  1A9B A;  4G9D A;  1LEK A;  4JFO A;  5EUO A;  1AGE A;  3QFJ A;  1R3H A;  2FIK A;  5SWZ A;  1S7S A;  3O9W A;  3WUW A;  2BNQ A;  5FA4 A;  4U6X A;  4HUX A;  1T7X A;  3E6F A;  3KPL A;  1CE6 A;  1OGA A;  2F53 A;  3BHB A;  1DDH A;  1QEW A;  4QRQ A;  2BVP A;  2BVQ A;  4MJI A;  3S6C A;  1A9E A;  4PJA A;  1JGD A;  3BZF A;  1KJV A;  3KPQ A;  3PWP A;  4IRS A;  4K7F A;  2DYP A;  2VAA A;  3KWW A;  1JF1 A;  4Y16 A;  1FZO A;  5IEH A;  3E6H A;  3MRI A;  3QEQ A;  3VXP A;  3BZE A;  1I7R A;  4JO8 A;  3MV8 A;  1XR8 A;  5J6H A;  1S7V A;  4PRH A;  5GSR A;  4MXQ A;  5C0B A;  3GSN H;  3VFU A;  5ISZ A;  4N0U A;  4G42 A;  3VJ6 A;  1JHT A;  3MRL A;  3REW A;  1KJ2 H;  3QUY A;  4CW1 A;  1UQS A;  1N2R A;  2BNR A;  2NYK A;  4FTV A;  3MRN A;  5C09 A;  2ESV A;  3KPO A;  1UXS A;  4WWK C;  3LKS A;  3RGV C;  1NAN H;  1LDP H;  3VH8 A;  3L9R A;  3C8K A;  4N0C A;  3VFS A;  2H6P A;  3SKM A;  5HGB A;  1JGE A;  1YDP A;  3P4O A;  2GTZ A;  3BWA A;  4G8G A;  4X6D A;  5AD0 A;  1KPU A;  2BVO A;  1ED3 A;  4EI5 A;  3KXF A;  2XFX A;  1GZQ A;  1OSZ A;  4U1L A;  3HE6 A;  3MV9 A;  2CLR A;  3MRF A;  3RWJ A;  4L4T A;  3JVG A;  3MRH A;  4ZUS A;  5L2K A;  4GUP A;  2AK4 A;  3FRU A;  4U6Y A;  1JPF A;  3GMR A;  2YEZ A;  3OX8 A;  4MJ6 A;  4PGC A;  4D0C A;  1AGF A;  1LQV A;  4WJ5 A;  3I0T A;  3TBW A;  3RWF A;  1T80 A;  3P77 A;  5HGD A;  2BSR A;  1T20 A;  3D18 A;  3MRQ A;  1BII A;  3P4M A;  3QUZ A;  3SDX A;  4NO0 A;  3MRG A;  5BRZ A;  3SJV A;  1L8J A;  3HUJ A;  3H7B A;  1G7P A;  4PJE A;  3OV6 A;  1FZK A;  3HLA A;  3RL2 A;  3WLB A;  1W0W A;  1AGB A;  1B3J A;  4LCW A;  4PJ8 A;  4NT6 A;  1A1O A;  3RL1 A;  2Q7Y A;  3L3H A;  3QDG A;  5DEF A;  1LK2 A;  3TN0 A;  2RFX A;  3RTQ A;  5B39 A;  4GKN A;  4U1K A;  4G59 A;  1MWA H;  4LCY A;  4PG9 A;  1T1Z A;  4XXC A;  1YPZ A;  3FT3 A;  2YPL A;  2VLL A;  3VXO A;  1NAM H;  3FQU A;  2NW3 A;  3GMM A;  3DX7 A;  5E8N A;  3VWJ A;  1EFX A;  3D25 A;  4F7T A;  1M05 A;  2GJ6 A;  5D7J C;  1FFP A;  1I4F A;  4U1S A;  3VFR A;  2CKB H;  3BXN A;  4WUU A;  2CIK A;  4F7E A;  3PWL A;  3BEV A;  4IIQ C;  5IB1 A;  2ZOK A;  2VLR A;  5C07 A;  1HHJ A;  2X4P A;  3QQ3 A;  4NO3 A;  4PGD A;  4X6E A;  4HKJ A;  1N59 A;  3HAE A;  4PJB A;  1VAC A;  4UQ3 A;  1GZP A;  3JTS A;  3PQY A;  5C0F A;  5MER A;  3VFW A;  1S7Q A;  2VLK A;  2GUO A;  3LV3 A;  3GSR A;  4MX7 A;  5C0J A;  3QDJ A;  1I7T A;  4PG2 A;  5IRO A;  5D2N A;  3I6L D;  3WS3 A;  4F7C A;  3LKQ A;  3KLA A;  4NQX A;  2OL3 H;  3ARB A;  3B6S A;  5HHP A;  2X4T A;  1TMC A;  3ES6 A;  3T1F A;  2GTW A;  5C0C A;  3GSU A;  4E5X A;  2X4U A;  3L3D A;  3UTS A;  4I48 A;  1FZM A;  3FQX A;  4L8C A;  3VFP A;  3RWC A;  3ARE A;  5C0A A;  4MJ5 A;  3CCH A;  1MI5 A;  4WDI A;  3KYN A;  3T8X A;  1B0G A;  1HHK A;  3MRE A;  4NO5 A;  3V5D A;  4CVX A;  4PGE A;  1DUY A;  3BH8 A;  3SPV A;  3FQW A;  5HHQ A;  3TFK A;  3LKR A;  1INQ A;  1G7Q A;  1ZS8 A;  3VXR A;  2AXG A;  5EO1 A;  3CC5 A;  4U1I A;  4O2F A;  3O8X A;  1QSF A;  3DTX A;  1HHI A;  1S7U A;  4F7P A;  5D7L A;  1ZT7 A;  3MYJ A;  3ROL A;  4PJD A;  4HUV A;  4V3E B;  1HSA A;  3FFC A;  2GAZ A;  3QI9 A;  3PWU A;  3FTG A;  5IEK A;  3SDD A;  1ZHB A;  4NO2 A;  4K71 B;  4U1N A;  1OF2 A;  4Y2D A;  5IB5 A;  5IB2 A;  2AV1 A;  5SWS A;  5E9D A;  2FWO A;  1G6R H;  4G9F A;  4EUP A;  3MRM A;  5SWQ A;  3LN4 A;  4I4W A;  1A1N A;  1RJZ A;  1ZHK A;  3MA7 A;  4G8I A;  1AO7 A;  1JPG A;  1RK1 A;  4EN3 C;  1JE6 A;  5E8P A;  1BQH A;  3PWJ A;  2D31 A;  3MR9 A;  4Y4H A;  1MHC A;  1HSB A;  2P5E A;  5MEN A;  3GIV A;  3DXA A;  4JFF A;  3E2H A;  3CZF A;  1EEY A;  5IM7 A;  1KCG C;  4QRT A;  5IB4 A;  4PRP A;  3BH9 A;  1Q94 A;  3SDA A;  3UBX A;  3O3D A;  3O3A A;  4L8D A;  3GSX A;  3HE7 A;  2VLJ A;  3UTT A;  3VXU A;  1KPV A;  4JFD A;  3RZC A;  3TBY A;  1P4L A;  4L9L C;  1T21 A;  3DMM A;  5EO0 A;  5BS0 A;  3SKO A;  4PJC A;  4IRJ A;  3FQN A;  3AM8 A;  4X6C A;  3GMO A;  5E00 A;  3PWV A;  4E0R A;  3GMP A;  2V2X A;  5MEQ A;  1T7Z A;  1HYR C;  2GIT A;  4NQC A;  5MEO A;  1QVO A;  4JRX A;  4U1H A;  2X4R A;  1T22 A;  3JTT A;  4JFE A;  2IA1 A;  1M6O A;  3DX6 A;  3VXM A;  5EOT A;  3TID A;  1NEZ A;  1QQD A;  1SYS A;  1S7R A;  1S8D A;  3MRC A;  5HHO A;  4HUW A;  4HS3 A;  3SDC A;  1JFM A;  4G59 C;  4WU5 A;  5EU3 A;  1FZJ A;  4CVZ A;  1JUF A;  3OXS A;  5C0I A;  2FZ3 A;  3ECB A;  5H94 A;  3TO4 A;  3V5H A;  3W39 A;  4L4V A;  1P7Q A;  1T1X A;  3CH1 A;  1FG2 A;  4ZUT A;  4PRN A;  2A83 A;  2JCC A;  1CD1 A;  1KJM A;  3FT4 A;  3TIE A;  1ZSD A;  3LKO A;  4NQE A;  4PRE A;  4PJF A;  3TO2 A;  3ILQ C;  3RUG A;  3IT8 D;  2C7U A;  1PQZ A;  3NFN A;  4ONO A;  1VGK A;  4QRR A;  1ZAG A;  3WS6 A;  3RWI A;  3ARD A;  1XH3 A;  1A6Z A;  3MV7 A;  1T1Y A;  3PAB A;  5E6I C;  2PO6 A;  4UQ2 A;  1BD2 A;  1YN7 A;  4X6F A;  5EFI A;  1S7W A;  5C08 A;  4WU7 A;  4D0D A;  2HJL A;  3B3I A;  1T1W A;  4Z78 A;  5HYJ A;  4JRY A;  4PDC E;  1UXW A;  5B38 A;  3MGT A;  1A1M A;  4PJX A;  1T0M A;  3KPN A;  3E3Q A;  3L3G A;  4NNY A;  1KTL A;  1AGC A;  3KPR A;  2CLZ A;  4O2E A;  3RWD A;  1BZ9 A;  3M17 A;  3VRI A;  3RWG A;  4QRU A;  5BXF A;  3I6G A;  5F9J A;  4QRS A;  2O5N A;  3WL9 A;  1S7T A;  1MHE A;  3VWK A;  2ZSW A;  1ZVS A;  4PJH A;  1EEZ A;  5EU4 A;  4JFP A;  1C16 A;  2PYE A;  4IHO A;  2X4Q A;  3BP4 A;  4NSK A;  3CVH A;  1XZ0 A;  4ZUU A;  3BP7 A;  1XR9 A; 
#chains in the Genus database with same CATH homology
 3HG1 A;  3VFT A;  4HWZ A;  3FOM A;  3QUL A;  2VE6 A;  3GMN A;  4PJG A;  1E28 A;  3MRD A;  4HUU A;  4S0U C;  4QRP A;  2MHA A;  4ZUV A;  3P9M A;  3GJF A;  1ZHL A;  3V5K A;  3GSO A;  3O4L A;  3M1B A;  1ZT1 A;  1FFO A;  2BSS A;  1ZHN A;  3MRR A;  4NNX A;  4ELM A;  5HHM A;  3TPU E;  3HCV A;  4NHU E;  2V2W A;  4ZAK A;  3TA3 A;  5EU5 A;  3UTQ A;  1LP9 A;  5D9S A;  4JQV A;  1Z5L A;  5D5M A;  5EU6 A;  1I1A A;  3TVM A;  1HHH A;  1S9X A;  5DDH A;  1I7U A;  2CII A;  2X4O A;  3H9S A;  4Y4F A;  3TJH A;  1KPR A;  3KPS A;  1N5A A;  1E27 A;  2HLA A;  3GSW A;  1AKJ A;  1QSE A;  1WBY A;  4JQX A;  3TBV A;  3VFV A;  2NX5 A;  4NQD A;  4PJ5 A;  4PRI A;  2OI9 A;  3DX8 A;  3LKP A;  1X7Q A;  4N0F A;  3TBT A;  5HGA A;  5BJT A;  4MQ7 A;  1QO3 A;  1LD9 A;  1QLF A;  5D7I A;  2YPK A;  4PRD A;  4APQ A;  5J6G A;  3LKN A;  4NQV A;  1KJ3 H;  2X4N A;  3RWH A;  4PP8 C;  4MNQ A;  2CLV A;  5L2J A;  4O2C A;  3MRJ A;  3LN5 A;  2GT9 A;  4PV8 A;  3D39 A;  5J1A A;  4WW2 C;  4FFE X;  2BCK A;  3D2U A;  5IVX A;  1T7W A;  2XPG A;  5HHN A;  1S9Y A;  1B0R A;  3G08 A;  5C0G A;  2UWE A;  1WBZ A;  3L3K A;  3QDM A;  2X70 A;  5FA3 A;  3KPM A;  1FO0 H;  4LNR A;  3VFN A;  3U0P A;  3DBX A;  3MRB A;  4GKS A;  5DEG A;  3MRK A;  5INC A;  4LHU A;  1W72 A;  3L3I A;  1DE4 A;  1T7Y A;  3KPP A;  3X12 A;  1EXU A;  4L29 A;  3BEW A;  1QRN A;  5FDW A;  1TVB A;  3P73 A;  3QUX A;  1VAD A;  5F1N A;  1TVH A;  3ERY A;  2FO4 A;  3VFM A;  2AKR A;  4HV8 A;  2HJK A;  3MRO A;  4LCC C;  1YN6 A;  3X13 A;  5F7D A;  3VXN A;  3UPR A;  1LEG A;  2P5W A;  2X4S A;  3I6K A;  3L3J A;  5GSV A;  3VXS A;  3RWE A;  1DUZ A;  1W0V A;  4Y4K A;  3ARF A;  3BW9 A;  3D3V A;  1AGD A;  3PWN A;  3BO8 A;  3W0W A;  4D0B A;  3CDG A;  3VFO A;  3VRJ A;  1P1Z A;  1WBX A;  2ZSV A;  2FYY A;  2VAB A;  1I1F A;  4L8B A;  4L3C A;  3IXA A;  1FFN A;  2H26 A;  3H9H A;  1KBG H;  3HPJ A;  2WY3 A;  3JTC A;  3P4N A;  3GML A;  5D2L A;  1RK0 A;  3BGM A;  3O3B A;  4N8V A;  4WO4 A;  1IM3 A;  1RJY A;  4N5E A;  1HHG A;  3X11 A;  1S7X A;  3TZV C;  4MVB A;  3ROO A;  1K5N A;  1T0N A;  1HOC A;  2AV7 A;  2F74 A;  4L3E A;  1SYV A;  4PJ9 A;  4PJ7 A;  3KYO A;  2E7L E;  3QZW A;  3BUY A;  3VCL A;  4V3D B;  4U1M A;  3QQ4 A;  3ILP A;  2AXF A;  5C0E A;  1QR1 A;  3QFD A;  4ZFZ A;  2HN7 A;  4G43 A;  4PV9 A;  1CG9 A;  2F54 A;  4JFQ A;  4L8S C;  5IB3 A;  5C9J A;  3FON A;  3QUK A;  1IM9 A;  5MEP A;  1OGT A;  4MNG A;  4PJI A;  3BVN A;  3FT2 A;  3GMQ A;  3P9L A;  3TBS A;  3AU1 A;  5FKP A;  1ONQ A;  5ACZ A;  2ZOL A;  1U58 A;  4F7M A;  4Z77 A;  3FQT A;  3SCM A;  5ENW A;  3FQR A;  5HGH A;  4QOK A;  4U1J A;  2BST A;  3GSQ A;  3MGO A;  4ZUW A;  3TF7 A;  1T7V A;  3MRP A;  1S9W A;  1K8D A;  3OXR A;  5IND A;  4PGB A;  3ARG A;  1N3N A;  5JHD A;  4PR5 A;  3FOL A;  3O3E A;  5E8O A;  4MS8 A;  3GSV A;  5C0D A;  1I1Y A;  3CPL A;  4HX1 A;  3X14 A;  1ZT4 A;  4PRA A;  5F1I A;  3C9N A;  4PRB A;  2J8U A;  4Z76 A;  1A9B A;  4G9D A;  1LEK A;  4JFO A;  5EUO A;  1AGE A;  3QFJ A;  1R3H A;  2FIK A;  5SWZ A;  1S7S A;  3O9W A;  3WUW A;  2BNQ A;  5FA4 A;  4U6X A;  4HUX A;  1T7X A;  3E6F A;  3KPL A;  1CE6 A;  1OGA A;  2F53 A;  3BHB A;  1DDH A;  1QEW A;  4QRQ A;  2BVP A;  2BVQ A;  4MJI A;  3S6C A;  1A9E A;  4PJA A;  1JGD A;  3BZF A;  1KJV A;  3KPQ A;  3PWP A;  4IRS A;  4K7F A;  2DYP A;  2VAA A;  3KWW A;  1JF1 A;  4Y16 A;  1FZO A;  5IEH A;  3E6H A;  3MRI A;  3QEQ A;  3VXP A;  3BZE A;  1I7R A;  3MV8 A;  1XR8 A;  5J6H A;  1S7V A;  4PRH A;  5GSR A;  4MXQ A;  5C0B A;  3GSN H;  3VFU A;  5ISZ A;  4N0U A;  4G42 A;  3VJ6 A;  1JHT A;  3MRL A;  3REW A;  1KJ2 H;  3QUY A;  4CW1 A;  1UQS A;  1N2R A;  2BNR A;  4FTV A;  3MRN A;  5C09 A;  2ESV A;  3KPO A;  1UXS A;  4WWK C;  3LKS A;  3RGV C;  1NAN H;  1LDP H;  3VH8 A;  3L9R A;  3C8K A;  4N0C A;  3VFS A;  2H6P A;  3SKM A;  5HGB A;  1JGE A;  1YDP A;  3P4O A;  2GTZ A;  3BWA A;  4G8G A;  4X6D A;  5AD0 A;  1KPU A;  2BVO A;  1ED3 A;  4EI5 A;  3KXF A;  2XFX A;  1GZQ A;  1OSZ A;  4U1L A;  3HE6 A;  3MV9 A;  2CLR A;  3MRF A;  3RWJ A;  4L4T A;  3JVG A;  3MRH A;  4ZUS A;  5L2K A;  4GUP A;  2AK4 A;  3FRU A;  4U6Y A;  1JPF A;  3GMR A;  2YEZ A;  3OX8 A;  4MJ6 A;  4PGC A;  4D0C A;  1AGF A;  1LQV A;  4WJ5 A;  3TBW A;  3RWF A;  1T80 A;  3P77 A;  5HGD A;  2BSR A;  1T20 A;  3D18 A;  3MRQ A;  1BII A;  3P4M A;  3QUZ A;  3SDX A;  4NO0 A;  3MRG A;  5BRZ A;  3SJV A;  1L8J A;  3HUJ A;  3H7B A;  1G7P A;  4PJE A;  3OV6 A;  1FZK A;  3HLA A;  3RL2 A;  3WLB A;  1W0W A;  1AGB A;  1B3J A;  4LCW A;  4PJ8 A;  4NT6 A;  1A1O A;  3RL1 A;  2Q7Y A;  3L3H A;  3QDG A;  5DEF A;  1LK2 A;  3TN0 A;  2RFX A;  3RTQ A;  5B39 A;  4GKN A;  4U1K A;  4G59 A;  1MWA H;  4LCY A;  4PG9 A;  1T1Z A;  4XXC A;  1YPZ A;  3FT3 A;  2YPL A;  2VLL A;  3VXO A;  1NAM H;  3FQU A;  2NW3 A;  3GMM A;  3DX7 A;  5E8N A;  3VWJ A;  1EFX A;  3D25 A;  4F7T A;  1M05 A;  2GJ6 A;  5D7J C;  1FFP A;  1I4F A;  4U1S A;  3VFR A;  2CKB H;  3BXN A;  4WUU A;  2CIK A;  4F7E A;  3PWL A;  3BEV A;  4IIQ C;  5IB1 A;  2ZOK A;  2VLR A;  5C07 A;  1HHJ A;  2X4P A;  3QQ3 A;  4NO3 A;  4PGD A;  4X6E A;  4HKJ A;  1N59 A;  3HAE A;  4PJB A;  1VAC A;  4UQ3 A;  1GZP A;  3JTS A;  3PQY A;  5C0F A;  5MER A;  3VFW A;  1S7Q A;  2VLK A;  2GUO A;  3LV3 A;  3GSR A;  4MX7 A;  5C0J A;  3QDJ A;  1I7T A;  4PG2 A;  5IRO A;  5D2N A;  3I6L D;  3WS3 A;  4F7C A;  3LKQ A;  3KLA A;  4NQX A;  2OL3 H;  3ARB A;  3B6S A;  5HHP A;  2X4T A;  1TMC A;  3ES6 A;  3T1F A;  2GTW A;  5C0C A;  3GSU A;  4E5X A;  2X4U A;  3L3D A;  3UTS A;  4I48 A;  1FZM A;  3FQX A;  4L8C A;  3VFP A;  3RWC A;  3ARE A;  5C0A A;  4MJ5 A;  3CCH A;  1MI5 A;  4WDI A;  3KYN A;  3T8X A;  1B0G A;  1HHK A;  3MRE A;  4NO5 A;  3V5D A;  4CVX A;  4PGE A;  1DUY A;  3BH8 A;  3SPV A;  3FQW A;  5HHQ A;  3TFK A;  3LKR A;  1INQ A;  1G7Q A;  1ZS8 A;  3VXR A;  2AXG A;  5EO1 A;  3CC5 A;  4U1I A;  4O2F A;  3O8X A;  1QSF A;  3DTX A;  1HHI A;  1S7U A;  4F7P A;  5D7L A;  1ZT7 A;  3MYJ A;  3ROL A;  4PJD A;  4HUV A;  4V3E B;  1HSA A;  3FFC A;  2GAZ A;  3QI9 A;  3PWU A;  3FTG A;  5IEK A;  3SDD A;  1ZHB A;  4NO2 A;  4K71 B;  4U1N A;  1OF2 A;  4Y2D A;  5IB5 A;  5IB2 A;  2AV1 A;  5SWS A;  5E9D A;  2FWO A;  1G6R H;  4G9F A;  4EUP A;  3MRM A;  5SWQ A;  3LN4 A;  4I4W A;  1A1N A;  1RJZ A;  1ZHK A;  3MA7 A;  4G8I A;  1AO7 A;  1JPG A;  1RK1 A;  4EN3 C;  1JE6 A;  5E8P A;  1BQH A;  3PWJ A;  2D31 A;  3MR9 A;  4Y4H A;  1MHC A;  1HSB A;  2P5E A;  5MEN A;  3GIV A;  3DXA A;  4JFF A;  3E2H A;  3CZF A;  1EEY A;  5IM7 A;  1KCG C;  4QRT A;  5IB4 A;  4PRP A;  3BH9 A;  1Q94 A;  3SDA A;  3UBX A;  3O3D A;  3O3A A;  4L8D A;  3GSX A;  3HE7 A;  2VLJ A;  3UTT A;  3VXU A;  1KPV A;  4JFD A;  3RZC A;  3TBY A;  1P4L A;  4L9L C;  1T21 A;  3DMM A;  5EO0 A;  5BS0 A;  3SKO A;  4PJC A;  4IRJ A;  3FQN A;  3AM8 A;  4X6C A;  3GMO A;  5E00 A;  3PWV A;  4E0R A;  3GMP A;  2V2X A;  5MEQ A;  1T7Z A;  1HYR C;  2GIT A;  4NQC A;  5MEO A;  1QVO A;  4JRX A;  4U1H A;  2X4R A;  1T22 A;  3JTT A;  4JFE A;  3DX6 A;  1M6O A;  3VXM A;  5EOT A;  3TID A;  1NEZ A;  1QQD A;  1SYS A;  1S7R A;  1S8D A;  3MRC A;  5HHO A;  4HUW A;  4HS3 A;  3SDC A;  1JFM A;  4WU5 A;  5EU3 A;  1FZJ A;  4CVZ A;  1JUF A;  3OXS A;  5C0I A;  2FZ3 A;  3ECB A;  5H94 A;  3TO4 A;  3V5H A;  3W39 A;  4L4V A;  1P7Q A;  1T1X A;  3CH1 A;  1FG2 A;  4ZUT A;  4PRN A;  2A83 A;  2JCC A;  1CD1 A;  1KJM A;  3FT4 A;  3TIE A;  1ZSD A;  3LKO A;  4NQE A;  4PRE A;  4PJF A;  3TO2 A;  3ILQ C;  3RUG A;  3IT8 D;  2C7U A;  1PQZ A;  3NFN A;  4ONO A;  1VGK A;  4QRR A;  1ZAG A;  3WS6 A;  3RWI A;  3ARD A;  1XH3 A;  1A6Z A;  3MV7 A;  1T1Y A;  3PAB A;  5E6I C;  2PO6 A;  4UQ2 A;  1BD2 A;  1YN7 A;  4X6F A;  5EFI A;  1S7W A;  5C08 A;  4WU7 A;  4D0D A;  2HJL A;  3B3I A;  1T1W A;  4Z78 A;  5HYJ A;  4JRY A;  4PDC E;  1UXW A;  5B38 A;  3MGT A;  1A1M A;  4PJX A;  1T0M A;  3KPN A;  3E3Q A;  3L3G A;  4NNY A;  1KTL A;  1AGC A;  3KPR A;  2CLZ A;  4O2E A;  3RWD A;  1BZ9 A;  3M17 A;  3VRI A;  3RWG A;  4QRU A;  5BXF A;  3I6G A;  5F9J A;  4QRS A;  3WL9 A;  1S7T A;  1MHE A;  3VWK A;  2ZSW A;  1ZVS A;  4PJH A;  1EEZ A;  5EU4 A;  4JFP A;  1C16 A;  2PYE A;  4IHO A;  2X4Q A;  3BP4 A;  4NSK A;  3CVH A;  1XZ0 A;  4ZUU A;  3BP7 A;  1XR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...