1TMF3

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
232
structure length
232
Chain Sequence
b'SPIPVTVREHKGCFYSTNPDTTVPIYGKTISTPSDYMCGEFSDLLELCKLPTFLGNPNTNNKRYPYFSATNSVPATSMVDYQVALSCSCMANSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFLIAYTPPGAGKPTTRDQAMQSTYAIWDLGLNSSFNFTAPFISPTHYRQTSYTSPTITSVDGWVTVWQLTPLTYPSGTPTNSDILTLVSAGDDFTLRMPISPTKWVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
molecule tags Virus
source organism Theiler's encephalomyelitis virus
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
total genus 17
structure length 232
sequence length 232
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf300
2R071 4Q4Y2 5ACA1 5K0UB 1QQP1 2RMU2 2RR12 1H8TB 1VBE3 1HRV1 4Y4YA 4CDQC 1A6CA 1FMD2 3NAPB 1VAKA 1FMD1 2X5IB 2HWE3 2RS11 4GMP1 4CDWC 2WFF2 1BBT3 2WFF1 4Q4Y3 4RS5B 1IHMA 4YVWB 3ZFFB 1AYM1 2X5IC 2XBO2 1VBE2 2WWSA 4IV1B 1FMD3 1HRV2 4Q4W1 2BBVA 1POV3 3VBOB 3ZFGA 1ASJ1 2HWF2 4Y5Z0 1TME3 1RUC3 4RQPB 1HX6A 1TMF1 1RUF3 1C8M1 2PLV3 3VBUC 3ZFEA 1AL21 2TBVA 2WZR1 4WM8B 1FPN2 2MEV1 4GH4C 1ZBE1 1OPOA 1VRH2 1NCRB 3VBUA 1X33A 3JB4C 2GSYA 1EAH1 4JGYA 1RUH2 3VBSC 2MEV3 2WZR3 4N53B 2WS92 1RUG1 1AYN3 2RM21 5DDJ2 1RMU3 3J8F3 5AC91 4BCUA 5GKAC 4SBVA 5ACA3 3CJIC 1R1A2 1RUH3 1R093 3VDDB 1FPN1 1RUG3 2WZR2 1AR93 2WS91 4PDWA 1H8TC 1AYN1 3CJIB 5A32B 4RFT0 1BBT1 4AEDA 1F8VA 4CDUC 1PO11 1EAH3 4YVSA 3HAGA 4FSJA 3JD71 3VBHB 1ND2A 1VRH1 1M06G 1PVC1 2QQPA 1PIV1 4CEWB 1RUC1 5JZGA 1RUF1 3VBFC 2XBO3 1PGL2 4JGZA 1D4M2 1QJY3 1ZBA3 1ZBE2 4WM8C 2FZ1A 2BFUL 4Q4W3 4WM7C 1RUI2 5L7OB 3JB8A 1AYM3 2ZTNA 1RB8G 1ZBA2 4EJRA 5BNPB 2HWE2 1VRH3 5C4WA 1EV11 1AR62 3TN93 4CDQB 2HWC2 1NA1B 2R043 1AR82 4CDWB 1VBC1 5FMOL 2RS12 1R082 1VBD3 3TN91 1AR63 3LOBA 1TME2 4PDWC 4QPIC 1RHI1 5ACA2 2R072 1RUF2 4Q4V1 2IZWA 5D8AA 1CJDA 1R083 1QJU2 5BNNA 3ZFGB 1PIV3 4QPGB 1ND2C 5C8CB 1RVF1 1RUJ3 1NCQC 4YVSB 1C8NA 5A33A 3VBOC 1AUYA 4FTEA 4NWWA 1QJU3 5CFDC 3JD73 3VBFA 3VBUB 4CEYA 4RS5A 1AYN2 4GB31 4YVSC 5DDJ3 1RVF3 4IV3C 5JZGB 1RUJ2 1PO13 3ZFGC 5CFCC 1OOPA 1HRI3 2BPA2 4GB32 1ASJ3 3ZFEB 1RUI3 2XPJA 1Z7S3 1BMV2 5ABJC 4GMP0 1EAH2 3DPRA 5J98B 1AR71 3NAPC 1COV1 1VBD1 1DDLA 3TN92 1AR61 1EV12 4CDXA 4GB33 2DF7A 1PO21 3NAPA 2R042 1QQP2 1MEC3 1QJY2 1ZBE3 4Q4W2 2WLPA 4WM7B 2RMU1 4IV1A 5L7OC 1HXS2 1B35C 1D4M1 1V9U3 1TMF3 4CDUA 1AL0G 3CJIA 5A32A 2GH8A 4QPGA 2RM23 3JBG1 3VBOA 2Y26A 2R061 4YVWC 3ZFFC 1ND2B 1RUE3 1POV0 1AR83 1AR72 5BNPA 4AEDC 1FOD2 1VBB2 2RM22 1B35B 4CEWA 1NY72 1Z7S1 1F2NA 4JGZB 4CDWA 2PLV1 1PO12 1AR73 3VDDC 2WS93 1AR91 2BFUS 1VBA3 5ABJB 1PIV2 5K0UC 2RS31 1ND3A 4N43A 4NWVA 1NY71 1RUD3 3VDDA 3DPRB 1VB4A 1CD3G 5CFDB 4AEDB 4GH4A 1RVF2 1GFF2 5JZGC 2ZZQA 1QQP3 3ZXAC 1C8M2 1FOD1 4CEYB 2HWD1 3VBRA 2ZAHA 1WCDJ 1HQNA 4WM7A 1X36A 4RQPC 5C8CC 4Q4X1 1TMF2 1D4M3 4Q4V2 4QPIA 5BNNB 1RUH1 4IV1C 5C8CA 1VBB1 4RHV3 5D8AC 5J96B 3IDEA 1PO22 4RS5C 5FMOS 2R062 3VBSA 1VBE1 1VB2A 5C9AC 1AYM2 1MEC2 5BNOC 1PGL1 1AR81 2HWD2 1VBB3 1VBC3 4CDQA 4RHV1 1PVC2 4GMP3 5BNOA 3FBMA 2RR11 1OOPB 4IV3B 2XBO1 1FPN3 5CFCB 1QJY1 5C9AB 1ND3B 2RS52 1MQTC 1NA1C 5FOJB 2RS32 1RUD2 5D8AB 1RUE2 1R1A1 4RR3B 1ND3C 1FOD3 4CEYC 1COV2 4CDXB 2VQ0A 5DDJ1 2X5IA 5A33B 5C4WC 4CDXC 1MQTB 1C8M3 1K5MB 4Z92B 1B35A 1AR92 1VBA1 2HWB2 1POV1 1RMU1 3J8F1 1RHI2 1QJZA 5AC93 1TME1 4CDUB 1RUD1 1R091 2HWB3 1HRI2 3VBSB 5AC92 1PO23 2R063 3ZFEC 1Z7S2 1BEV3 1QJX3 4YVWA 3ZFFA 1VBC2 3JBG2 1K5MC 4N53A 1EV13 2HWC1 1RUI1 1SMVA 4FTBA 1V9U1 1ZBA1 4N53C 4Q4V3 5ABJA 5BNNC 1R081 3JBG3 5LK7B 4WM8A 4N43B 4RHV2 2RS53 1PGW1 2HWC3 2HWF3 1NCQB 1HXS3 1MEC1 4QPIB 2RR13 1V9U2 5K0UA 1NA1A 5CFDA 4JGYB 1H8TA 2HWD3 2HWE1 2RS13 1COV3 1NOVA 1VBD2 1OHFA 3DPRC 1PVC3 3VBHA 2WFF3 4Q4Y1 1PGW2 1BBT2 2R041 1BMV1 2R073 3VBRB 4Q4X2 3VBHC 1HRV3 3S6PA 5BNOB 1HRI1 2BUKA 1E57A 2HWB1 4PDWB 3VBRC 1RHI3 1RUC2 2RS33 4JGZC 2PLV2 4Q4X3 4RQPA 1R092 4LLFA 5L7OA 5CFCA 1NCRC 5C9AA 5BNPC 3JD72 1VBA2 4JGYC 1W39A 3VBFB 1NCRA 1RUJ1 5C4WB 4RR3A 1BEV2 1QJX2 1RUE1 2MEV2 1BEV1 1QJX1 1AL23 4GH4B 1QJU1 4RR3C 2RS51 1RMU2 3J8F2 1NG0A 4FTSA 4CEWC 1ASJ2 2HWF1 4IV3A 1MQTA 2RMU3 4N43C 1K5MA 1HXS1 1R1A3 4QPGC 2FZ2A 1RUG2 1AL22 3M8LA 1NCQA 1OOPC
chains in the Genus database with same CATH superfamily
3FLRA 5LBCA 3C7FA 5GZEA 3I3MA 4Q4Y2 3KGLA 2VTXA 4KU8A 5K0UB 3WLUA 1OQ1A 1G8WA 2PQQA 5LBBA 1HRV1 1A6CA 4MYEA 3H1YA 1YXWA 2B7YA 4HFSA 1GWMA 1REEA 3UGGA 4I0WB 3QCWA 1SLAA 2RJLA 2RS11 2X5IB 2ZPXA 2NYYA 4GMP1 1HLCA 2D44A 2WNOA 1FATA 1BQPA 2WFF2 3BIWE 4B7EA 2GP3A 4L99A 4TN7A 2EAAA 2MNGA 3FFQA 1AYM1 4BQ2A 4OFGA 2HLEA 4QX8A 2WWSA 4WBBA 5G05L 2B9UA 4GD4A 4R9BA 3ZOIA 3RZMA 1RITA 4K6BA 5DUWA 1J58A 1LOAA 4NE9A 3VHNA 2JG8A 4K21A 5H9SA 5KBFA 1J59A 1POV3 3FN9A 2ZEYA 4YRDA 1X50A 4UF0A 3ZFGA 1TME3 2G9ZA 1US2A 1W04A 2VTXJ 1HX6A 4AVTA 2GNBA 1C8M1 2C26A 2PLV3 2PHRA 3VBUC 4ZZ8A 1LTEA 3LB9A 2XHKA 2BV4A 2MEV1 4IGOA 3E5XA 1OLQA 1OPOA 5L9BA 2J1RA 1QWRA 3GALA 1BVVA 3B93A 3JCIA 4QKFA 4YFWA 1DQ5A 3KV4A 2ET1A 2NQYA 2VQUA 2JD4A 2GNDA 1L7LA 1RUH2 3KB5A 3AKSA 4XJ9A 2MEV3 1TQ5A 4J25A 2JDAA 4CDXB 3WDXA 4DO0A 4YZ4A 4YZ5A 4HT1T 1DLLA 5CAZA 3KM5A 3KV9A 3T2QA 3HNYM 1RMU3 4BIFA 3AJZA 5GKAC 1MVQA 2V4VA 3LA3A 5KR7A 3WD5A 3BN6A 2XWJB 5A6XA 4AGVA 1R1A2 2GNMA 2VUCA 4ZU5A 2VMCA 3LZZA 4FVVA 1AR93 1GNYA 1QOOA 2DBIA 3SEEA 4HVOA 1C5HA 3WG2A 1H8TC 5C7GA 4AI9A 2Q5TA 4HPKA 5BNQA 2JDNA 2W91A 1JYCA 1OQEA 3LEIA 5KC6A 4BQ5A 1UW8A 1WLTA 3BGAA 5JPNB 4A3ZA 1CVNA 3JD71 3PNAA 3M2MA 1LGNA 2L9LA 1LGCA 1JYVA 5LRSA 2QQPA 2V09A 1GLHA 2PA7A 3N9LA 2O14A 3IWZA 3PIGA 4KWUA 4CEWB 1RUC1 3OBZA 4IXLA 3MIEA 3Q8EA 2VUJA 1RUF1 1PGL2 2XBO3 4K7JA 5JXHA 4JGZA 2ETEA 2D6NA 3ZSLA 4COZA 4ZHNA 1QJY3 5A80A 3EYPA 5CKNA 5FJKA 2QCSB 1H1IA 1DGWX 2ADDA 5LY1A 3WNXA 1H2LA 3MLKA 2CTVA 4HKOA 5T50A 4AR2A 1LHOA 1JZ8A 5FLIA 1UY1A 2JECA 1SFYA 2QQLA 4LXLA 1ZA4A 4R9CA 1GQPA 2FMYA 1XYOA 2IXKA 5BNPB 1VRH3 2Q1FA 3IT8A 4TZDA 3TB0A 3TN93 5A3OA 3WV6A 4CDQB 3RZHA 1UF2C 3IM0A 4CUBA 5FZ8A 2C24A 5GZGA 3HPNA 5FO7B 1AR82 2ZS6B 1VBC1 3G6JB 2Y0OA 3UT0A 5FYTA 1VBD3 4QQLA 5JIUA 4UW4A 3TN91 1JUIA 4CCDA 4E8CA 1QGLA 4AXOA 3H1MA 3LA2A 1D7PM 5FPVA 5FBZA 2VTFA 1BJQA 5ACA2 2OQ7A 4LKSA 2DFCA 4QDSA 5J48A 1O4YA 2XGXA 4Q4V1 4LOSA 5FV3A 5FYCA 1CJDA 1VMHA 5FY8A 4PF1A 3BB6A 1FV2A 1PIV3 1KRIA 4FXKB 4INDA 3FUOA 1VIWB 4U2AA 1GOGA 1NCQC 2J1TA 1JI6A 1V70A 2G4IA 5FZKA 4D3WA 4MX3A 4Q27A 3A0KA 3GBGA 4WZFA 3VBOC 4D7TA 4E8DA 4FBFA 2KM2A 5JR7B 5I0SA 4AHYA 4CP0A 1UIKA 4MHUA 4CEYA 3QLQA 4RS5A 4XUOA 4YVSC 5A3MA 5IFPA 3LEGA 4IV3C 5LCWL 3GZAA 5JZGB 1EYBA 2X29A 1W6MA 3OEAA 4P9JA 2XL7A 3OPWA 2VZUA 3QD6A 4W65A 2YMZA 4BXFA 3QH7A 3OD0A 4NPMA 2W47A 5CFCC 5IK8A 1SQ4A 5IAVA 3KSCA 2HEWF 3FLPA 2H6CA 5HXMA 5CBLA 4Y20A 2JDYA 4GB32 1ASJ3 3VZNA 2QJVA 2VBBA 3ZFEB 5C5UA 4WZCA 4B4RA 5ABJC 4E2SA 1EPWA 3VZKA 1ZM1A 1XB9A 5FKBA 3WCRA 3NAPC 2JENA 1GZCA 4LTAA 2W1QA 4OHWA 5F5QA 1YQ6A 4QMAA 3I2OA 4HPKB 4PIXA 5DAXA 3U1XA 4OULA 5EYXA 1W90A 5A7WA 4YM2A 3WW1A 5T54A 5IVBA 1OKQA 4XHBA 2NLRA 1ENRA 1JU3A 1SEFA 2ZBJA 3A7QA 1PM7A 3AXEA 3D4KA 3K46A 4JC1A 3IDBB 4QB6A 5A6ZA 3DN7A 3GDBA 1UKRA 4XFFA 3TRSB 2VO5A 3K2OA 3FFZA 4LUMA 4IL7A 4Q4W2 5FYHA 3AL5A 3WNPA 3R6SA 1QOSA 4BMBA 4IV1A 1LOGA 1B35C 5KHIA 4M3CF 4UFMA 1T6BX 1TMF3 2IC1A 3FZ3A 4HG6B 1AL0G 1CR7A 4QX3A 2CHHA 2GH8A 3PVOA 5HCFA 5T52A 2H0BA 2AEZA 1W9SA 5HCAA 1JODA 5JSRA 1S4CA 2Y26A 4DEVA 2CNAA 1LU1A 2QFEA 5KXBA 2DVDA 4FAHA 2R061 2ZHKA 2ARCA 4XACA 3M3EA 3ZFFC 5FUPA 2Z69A 1ND2B 2EIGA 1POV0 3DGTA 2AZ5A 5BNPA 4XAAA 1VBB2 3OBRA 1TG7A 5L73A 4OMDA 3NW4A 2VOVA 1B35B 5ANQA 1UWWA 3MIFA 1SBFA 1NY72 2JG8C 4F8AA 4RGAA 4AGGA 4JGZB 5HV4A 1U5XA 1ODNA 1E5HA 1PO12 3X29B 1PK6B 2NN8A 1AR73 1OD3A 2D6OX 3C7OA 4AI8A 4D7SA 4RN5A 3VDDC 2WS93 3P6BA 4QXHA 4YWAA 3RNSA 3SXWA 2WT1A 5L9RA 5LRRA 4JTOA 2WFPA 1DBNA 3NQHA 4N43A 3ZXJA 1RUD3 3WXPA 1XSQA 4OI0A 1POQA 3GNEA 3L2HA 3N9MA 5FK7A 4NHMA 4DY5A 4E9KA 5FZOB 1D0HA 3ATGA 3NV4A 4MGKE 1ULFA 4UOJA 1W8NA 3QBQA 3ZYHA 4R9DA 5JZGC 3POWA 1AZDA 1ULDA 3ORJA 2WZEA 3HQUA 4I01A 4QGMA 5JDBA 3ZXAC 3SQOA 1UU6A 2WWUA 3ZXKA 3WINE 2P6CA 4C0BA 3LQCA 4COVA 3HNBM 5A70A 3OY8A 2G19A 3J9SA 3PHMA 4YW4A 4YW2A 2BWCA 3Q8BA 5F37A 3H3LA 1FXZA 1B09A 4XBQA 4RQPC 4TXWA 1LESA 2CV6A 4BQ1A 2CGOA 2VD7A 3LDRA 2RG4A 2BVBA 2J22A 2E26A 2XVKA 5JCTA 4Q1PA 4Y1UA 1D4M3 4Q4V2 4QPIA 1ZA7A 4GKXA 1HB4A 1IZ3A 5C8CA 3LDKA 1DF0A 4RHV3 5D8AC 4IE5A 2DYCA 2UWAA 2BDRA 5FMOS 5IVYA 1XU1A 1JS9A 1VBE1 1VB2A 3O5SA 4MGSA 4YNIA 1W2NA 4LNVA 2EXKA 3N36A 2GMEA 1AR81 1H9WA 3E1F1 4YGEA 3RMXA 3NNJA 2XUEA 4QQOA 3OUIA 4EV0A 1MS5A 4OUEA 1AXYA 1PX4A 1UZYA 3THPA 5IHRA 4H14A 3N9NA 2XLFA 4Y4RA 1MACA 5ISLA 1FPN3 2VNGA 4OYUA 4GULA 5A7NA 4GJZA 4CCOA 1TNFA 4M3CB 5BV6A 3V0AB 4C1XA 3HOBA 2YU2A 4FOQA 2XKPA 2BEOA 1NA1C 3LA7A 3TNPB 2ZAAA 5K7PA 2J7MA 4YM3A 2I07B 3WW2A 5D8AB 3KWVA 1RUE2 1H2NA 2VVDA 3VZJA 1UPIA 1PVXA 4CU9A 2CU5A 1AXZA 2RDRA 2VQAA 3AMMA 4CEYC 1COV2 2XWBB 2C1FA 5BUVA 2ZX0A 4XMIA 5CADA 5DDJ1 1SCSA 2X5IA 3Q8CA 5C4WC 5IK5A 1UNBA 2C0ZA 3GJBA 2CYFA 3O1RA 3T2PA 2BNNA 4CDXC 4IGPA 1Q8QA 3O1OA 1JZ6A 4FQ4A 2B42B 2LALA 1WMDA 5FXVA 2F4PA 4EZ4A 5JSOA 4X8NA 3I2IA 1GANA 1VP6A 2GMPA 4PLMA 1YCIA 5FAXA 1POV1 2QQKA 4Y1YA 5FZ9A 4RGGA 3HEIA 5AC93 1QJZA 1O91A 1DZQA 1TME1 1UYPA 4CDUB 2ET7A 3POBA 2EF6A 1ULCA 2DUOA 1RUD1 3KV5A 1R091 2G1MA 3ZXEA 1BVP1 2LM3A 2LTNA 5JXGA 2GN7A 4EN8B 1C28A 4G3YC 4CRQA 2ZA9A 4H2AA 1CIYA 4W4ZA 3LDBA 1C5IA 5T55A 5DZGA 2Y0IA 4NRPA 3B3QE 1LHNA 1M4WA 4WVWA 1MPXA 5AC92 3RZZA 2B9VA 3U10A 5CKQA 3PUQA 2VCCA 5EQUA 3O1SA 1ENXA 2DDUA 4NHKA 1WZXA 3A4UA 3W20A 3A22A 4UW3A 5DZEA 4BQYA 1W8FA 2Q0AA 3BPSA 3IMMA 1VBC2 4XILA 3JBG2 5GJ6A 3UL2A 4KL1A 2BQPA 1DFQA 1OQDA 3BVCA 5FZ0A 4GQ7A 1JOPA 3DXTA 3D5OA 1SMVA 2MHFA 3WW4A 4Z2WA 4A7YA 4ARYA 2BOJA 1OD5A 3FHAA 5C3RA 1LU2A 2YPDA 4P08A 1ZRRA 5A1LA 4A41A 4AF9A 3AJYA 1W0NA 1S0FA 2ZHNA 1H1MA 3JBG3 2B5HA 2WA4A 2IFRA 4Q8LA 5SV8A 2RS53 3NL1A 1JHNA 3SKVA 2HWC3 1YFXA 3DL3A 2ZJCA 3MPPG 3POEA 1CPNA 3T0DA 1GU3A 2RR13 3FE5A 5K0UA 2JB8A 3CMGA 1TE1B 2KD7A 2HWD3 3C7EA 1D4VB 1NOVA 4AQ6A 3AZXA 3K4AA 1OHFA 2BERA 1FAYA 4L8QA 4XUTA 2OYZA 3ZDSA 3I2KA 5T5LA 5F2WA 3CHXA 4KI5M 4UT5A 1PGW2 1TEIA 2R041 5CISA 1BMV1 4JTNA 3GJAA 1I6XA 3DF0A 4AE2A 1DP0A 2WSVA 5F3GA 3OY8B 3ZPOA 4ONUA 3T0BA 2WQ4A 2FDJA 1IKPA 1HRV3 1QXJA 4P00B 3S6PA 3AC0A 1RGSA 1HRI1 4FP3A 5BNOB 2E53A 1VAMA 2QQVA 4PI0A 1XNTA 2X09A 3JU9A 3MV01 3OBAA 1OUXA 3VBRC 3VD3A 1WCSA 4Y33A 3D0SA 1H1AA 5M0TA 5TSWA 4QXKA 4AOCA 4RQPA 2WQZC 3GCWA 1R092 5HI0A 1DYOA 3IDAA 5C9AA 5CG9A 4N9IA 5BNPC 4PQ9A 4XXAA 2UYBA 5F1RA 1XE8A 4PF5A 4P9LA 3NO8A 3IBMA 3OSDA 4XDQA 1NCRA 1RUJ1 2PHLA 4O9GA 4HVQA 4R4ZA 2OXBA 5C4WB 3MICA 4N8MA 3AP6A 2R49A 3PIJA 4FT8A 4RR3A 5BPXA 1BEV2 4LOTA 3LE0A 1QJX1 4K8RB 3SNMA 3VLBB 1WLDA 1W8TA 1XSRA 4A42A 2YY1A 3CU7A 1QJU1 3WQ1A 1TZOA 4L92A 2O8OA 4YZ2A 3GXUA 4F7ZA 1G9FA 1V6NA 3J8F2 3GCXA 1OH3A 2ZEZA 4XUQA 3H3UA 4FTSA 3I59A 4AQTA 4CVUA 3VKLA 3KT1A 1T2XA 2HEVF 3FHIB 1MS1A 3D82A 4N43C 3VKOA 4QB2A 1LNSA 1QEXA 4IEYA 2ZGQA 5JMCA 2FZ2A 1K45A 2XJTA 4D7YA 4MXWA 4XUPA 2OZJA 4YFZA 2WIIB 1LHUA 4NN0A 1UD1A 3RJRA 3CLPA 5LWBA 1W03A 1V6LA 4J6GA 5DUXA 1IPKA 1H8TB 5LBEA 1CGPA 5IATA 5FY9A 5I8SA 2LRPA 3IZOA 3NNMA 2W1WA 2Y6JA 5I0TA 2PXJA 4BLJA 3BYWA 2HWE3 2VVEA 4DIQA 2BWAA 2FCVA 4CDWC 4WVMB 1KFXL 2W39A 2XVLA 2WFF1 4Q4Y3 3ZYGA 2OPKA 1GWKA 2FCTA 3ZFFB 5C8WA 2BBAA 3ZYIB 5A7SA 3WHTA 1XRUA 2H6BA 1YUDA 3USUB 3FMGA 1W8UA 3BKZA 5FXZA 3PVEA 1CAXB 2UURA 1AVBA 3IMNA 4NRQA 3I7DA 4MO3M 5D21A 1ASJ1 2HWF2 1OC1A 4XEZA 5CA6A 1JTZX 1UZ0A 2DCTA 2VMDA 3WZ1A 1WMXA 4OVEA 2DVGA 3CEWA 3RWNA 3KMHA 2Z5WA 3AYAA 4QKNA 3ZFEA 4LHNA 1O5UA 4OI2A 4PQQA 1QY4A 4WM8B 4GH4C 2WDBA 1ZRDA 4TTGA 5E16A 4K8FA 4UW5A 1L7RA 4Q0VA 1F4AA 1MS4A 1YO8A 3IB3A 5H9PA 3ETQA 3MIBA 3GBWA 2GSYA 2J1EA 2QKDA 4JGYA 4OLLA 5GLVA 1OPMA 1SACA 3VHPA 2W1SA 1XC6A 3SMHA 3POYA 2WZR3 4FXGB 5FP4A 1Z0HA 2WZ8A 4LLOA 3HN1A 1ONAA 4ORFA 5DDJ2 1JUHA 5FWEA 4YPJA 1DYPA 3U4XA 2Y34A 1ZRCA 2ZABA 4C1WA 4SBVA 1X8EA 5JVVA 4JRLA 1YQ5A 2D5FA 1HV0A 1RUH3 2WAAA 4XDOA 4Y5SA 3WQ7A 2WUHA 1FPN1 2VOKA 3E5QA 1WGPA 5F2SA 2W9XA 5LK5A 4A45A 4BIOA 1W0OA 3DYOA 4PDWA 4FOYA 5DAPA 1AYN1 2JD9A 3SISA 3ZXDA 4LBJA 1WW7A 4IEZA 4RFT0 3PUAA 5JWPA 1OA3A 1H30A 2ZZJA 1PZ7A 1WBLA 4AVSA 1EAH3 2ZXQA 4YVSA 5JI7A 3I3QA 1VRH1 2X8KA 3VBHB 4MH0E 4CXYA 2WRAA 1M06G 1K12A 3AMHA 4TLFA 4BDVB 4XYXA 1W2UA 1PIV1 3OYWB 1UY4A 1QDCA 4SLIA 5D1IA 2D3SA 1AXKA 5FY1A 3VBFC 3B00A 2YU1A 1YJLA 2WWJA 5LA0A 3WDVA 4JDOA 1ZBE2 1ZBA3 4EWEA 5J37A 4XETA 2Y8KA 3N7JA 1FI2A 2FZ1A 4JCKA 2Y33A 4Q4W3 3RI9A 1N3OA 1DGLA 1CAWB 2IUWA 2XJVA 1UL9A 3DEMA 4N90A 4XFGA 4WM7C 1RUI2 2B39A 4D0QA 4NIDA 3KHBA 1NAEA 3MUY1 4XTPA 4E2GA 2LW8A 1FX5A 3TEXA 3ILNA 1H2KA 1V00A 4LHLA 4EJRA 2JDUA 1O59A 1W06A 2VUAA 5IVCA 5IUQA 2AYHA 5JOYA 5JI9A 1AR62 4AVBA 5KXEA 1JZ3A 1UIJA 4MZUA 1E5SA 1OLMA 1NA1B 3ZSEA 4D69A 2FDGA 3NVCA 5DUVA 1V6JA 2OS2A 2WINB 1JXNA 5GZFA 2ZGMA 5A3WA 1W6OB 4NR1A 3IN9A 2VZQA 2X05A 5LZ6A 4I3GA 1VALA 5FZIA 1AR63 1YJKA 3T1LA 1VRBA 3ZN6B 4CXXA 2K0GA 2E32A 2P4EA 2ZGNA 4QPIC 1RHI1 2R072 3Q8AA 1RUF2 2IZWA 3M3IA 1E5RA 3I3DA 4IE0A 4YG3A 1QJU2 2E7QA 2BW8A 5BNNA 2OUHA 4EN0A 3ZYBA 1MZ6A 2VU9A 3OGVA 1XNCA 4QPGB 4ARXA 1ND2C 3BALA 4ES9A 5IWFA 3RJ2X 1RVF1 3MPBA 4B4QA 3POJA 4YVSB 3CL1A 3ELNA 4QKBA 3N7LA 4AFBA 5FPZA 5AFBA 5FOBB 4FCAA 4E27A 2E63A 1H6YA 2A7AA 3VBFA 5CFDC 3PL0A 4OUMA 3R0RA 4OHZA 3NNGA 4DMIA 1WMFA 1RVF3 3U4SA 4HKWA 3RFRA 1HV1A 4XQ4A 1A78A 5FMCA 4CE8A 2DU1A 3O0XA 1XE7A 2WBKA 3I49A 3T0AA 1LRHA 1PGSA 3K3NA 3N9OA 3BU0A 4K3UA 3BTZA 2WNVA 2N7GA 1X7NA 1MS0A 5T5PA 1NXMA 1OOPA 4RSUA 4OZXA 2JDPA 4BJ0A 2Q1ZB 1N47A 1QKQA 5CEHA 4PIZA 2Y6HA 4N7IA 5FZ6A 4M3CA 5FYMA 1SBEA 2R32A 2ZGTA 3PTRB 3PU3A 3JZVA 1JYNA 2XKOA 3RG0A 1DCSA 1I3HA 1PM4A 1QOTA 4P5YA 1HN1A 4EN9B 3WG4A 5J98B 1AR71 1NQDA 1COV1 2VMEA 4A2UA 5KHJA 1VBD1 1BCXA 4YG6A 3TN92 3N4MA 4KH9A 1EV12 4GB33 2DF7A 1PO21 2B4KA 2R042 1YHFA 3V65A 1QQP2 5HCHA 1CZSA 1WBFA 3AYCA 3DV8A 3JUUA 4QDRA 4CUGA 2MPFA 4URTA 1MVEA 3BIEA 3RWKX 2PMWB 4YW6A 4FPCA 1Q43A 3ALQA 3T30A 3B02A 5B4XA 2IXIA 2VG9A 2E7TA 3OBTA 4CCKA 2WJSA 4A4AA 4WM7B 4W6XA 4NMIA 1A3KA 1ZZ6A 2QTWB 3O1PA 1UKGA 4CDUA 3ZPYA 2YFZA 5FXWA 1GKBA 4MG2A 3VBOA 2W46A 4LKFA 2Y6GA 4MGQA 2VW0A 2UY8A 5EP9A 1YQCA 5A3PA 2J1SA 2ZX3A 5A3NA 1UOJA 1OH4A 3D8CA 4LQRA 5HXVA 3UJOA 3SH5A 4LITA 2XJQA 4IQPA 1RUE3 1W8OA 5EXOA 1QDOA 1YFYA 1ULGA 3O1VA 4AEDC 1K42A 3O1UA 4CUAA 1LOBA 4P5HA 5FZDA 1JZ7A 1GQGA 1XQNA 1GMMA 2WSUA 4ET7A 4CEWA 2PQSA 4QGLA 5FY4A 3RMYA 2VM9A 4AGRA 5SV5A 4CDWA 2PTMA 3I2FA 4AFMA 1W99A 1STMA 3ZYFA 3ZYJB 2DU0A 4CCLA 5J3UA 2A3WA 1OFNA 4HK9A 3KF5A 4Q0SA 1X82A 4DXRA 2BFUS 1G9DA 1W05A 1LECA 5JSPA 4AHXA 3KCXA 2XG3A 3CDZB 3O12A 2OPWA 5E89A 1ND3A 2KXLA 4ISRA 4NWVA 1Q8VA 5DUUA 1O7FA 2W94A 3ENRA 3S30A 5D2AA 3DPRB 5FCCA 5DQ0A 3EO6A 3W5MA 1CD3G 3W58A 4NIGA 5CFDB 1S1AA 1V0AA 3VGIA 3ZSMA 4HN0A 5ANNA 4AEDB 4QM8A 4AI3A 5KHKA 1ZRFA 4NHYA 5A3UA 1MR5A 3OTFA 1GFF2 1RL3A 3WNMA 1AX1A 5F39A 5FPXA 4LHKA 3VUOA 1C8M2 2V73A 1FOD1 3NV3A 4IUGA 3WG3A 2IXLA 1W6NA 2YC0A 4QGNA 1EPZA 2VBPA 3J7LA 2YHJA 2ZAHA 1SLIA 1WCDJ 5FYUA 5A7OA 5C8CC 1A8DA 2ZKLA 3F95A 3ZIWA 2GC2A 1DLCA 1TMF2 2J1UA 1PMIA 5FREA 4XFBA 5FXXA 3WDTA 5J1XA 5JPMB 1VBB1 1CAWA 1GV9A 3GGLA 3IIIA 1HB2A 3OPZA 3SKJE 4B1MA 1JYWA 3U14A 1LENA 4CP9B 1BHGA 5DAQA 1PO22 3BI3A 4HOOA 3I97A 5L9VA 2R062 4LBLA 4Y26A 2W08A 1TNRA 2ENRA 1AJKA 2ZGSA 3MLLA 4M3CE 4PLNA 1CZTA 1W2OA 3WDWA 4BB3A 5F3IA 2C4XA 3VHRA 1SZBA 1VBB3 3UGFA 3MUZ1 4EWAA 1H2MA 2YGMA 1N1VA 2AEYA 3RZKA 4XDPA 3C3VA 1MZFA 4LA3A 5BNOA 4V1PA 3FBMA 1UO9A 1RJ7A 2CL2A 1XOYA 4NIHA 3HT1A 1UY0A 2RR11 1G86A 5IT6A 3B01A 4IV3B 3WNLA 4QQ2A 2XBO1 5F3CA 4LBMA 2YUEA 3APBA 2VR4A 4KWKA 2DUQA 1QJY1 5DZFA 3M1HA 1XBFA 3VD4A 3I4IA 2ZGKA 1MQTC 3ZX7A 2WN3A 4QHOA 4AQSA 1H9PA 5FOJB 5T5OA 1RUD2 4MLOA 2BVVA 2ADEA 5AVAA 3H8OA 4AG4A 4KWJA 4XF3A 4XOGA 3VKNA 5FY0A 3VV1A 2JX9A 3FX3A 2VZ3A 1URXA 2VAUA 3P1IA 1KXGA 2WL1A 5GLTA 3WP4A 4BMEA 1UZVA 2IWGB 3OJBA 4GA9A 4W8JA 4HMZA 5FZGA 1ULEA 2VOTA 1CPMA 1JOJA 3UV9A 4FPEA 1RXFA 1UX7A 3CJXA 4HKLA 5KHGA 2Q8OA 3R05A 1MQTB 1Y9GA 2RHPA 1K5MB 4Z92B 2SBAA 1IS5A 3RDIA 4UBGA 4CU7A 5F5CA 2JIJA 5FZMA 4ZS3A 2HWB2 5IJRA 3DXUA 1Y43B 4NHLA 1N1TA 3J8F1 1RHI2 5EJZB 4DS0A 2HYKA 4MGTA 4PLOA 2ZMLA 3B7MA 1OLME 2TUNA 3C7GA 5A7PA 4BISA 4RL7A 4LKEA 4NPLA 2O1QA 3ROUA 1KITA 4MUVA 4GWMA 2CDPA 3VD5A 3NNLA 1BKZA 1HB1A 3E5UA 2D6MA 1YIFA 4NOTA 3VBSB 1GWLA 5JOXA 1S0DA 1JN2P 1W9TA 3M7AA 2HJIA 3GZTB 3EMRA 4LIUA 3ZFFA 2ZGPA 4LK6A 1MZ5A 1O8SA 1IQDC 3AP9A 3BTAA 4KGQA 5LB6A 3WX5A 1K5MC 1UU4A 2GMMA 1GNZA 4G9SB 2A6XA 1RUI1 1LULA 1XE0A 3ES4A 1UMHA 3K3OA 3LWCA 4LJHA 4Y1ZA 1Y7BA 3I59B 3VKMA 4R52A 2GP5A 1CQ9A 4CXWA 1EP0A 4AEKA 2ZGRA 3TOJA 5ABJA 3ZN5A 3KD4A 4HXCA 4IGQA 1GZTA 1XNAA 5LK7B 2XDVA 4N43B 1PGW1 5FYSA 3ETPA 2JKBA 4YLZA 4LPLA 3AZYA 2Y6FA 4JVAA 2IVJA 1HDKA 1OKOA 1CAVB 4LA2A 2YDEA 4AFDA 4DUWA 2JDZA 4QPIB 4HETA 5FZ4A 2GC0A 3PURA 4FPLA 2WZPP 3ZKUA 5A6QA 2RS13 4Y1XA 1COV3 2O8QA 2WN2A 4E4HA 2QZ3A 3OB8A 1YWKA 3VBHA 3OUJA 3PDQA 3H9AA 1DG6A 1G6NA 2R1BA 3PMSA 5I0UA 2QZ2A 3VBRB 4Q4X2 2HBUA 3UJQA 3VBHC 1DQ1A 1QH6A 2K46A 4O9EA 3EQEA 3N3HA 5KXDA 5C6CA 2BP6A 4L11A 1XYPA 5I0DA 4UFLA 3OGRA 5K8SA 2Z4FA 1H4HA 1RUC2 1YFUA 2EIBA 2RS33 2D40A 1GBGA 3C2UA 4IERA 3W5NA 1Y9MA 2WYFA 3L2YA 1WCUA 4LK7A 2V5YA 1SLCA 2DWRA 3N9PA 1ENSA 1GICA 4P9WA 1BYHA 1IS4A 1DQ2A 1V6MA 1HN0A 3JD72 2DBNA 4FQZA 4H55A 4LMFA 2W5FA 3AL6A 1W6QB 2D93A 2AUYA 4CA9A 4LBKA 3ACFA 5EV7A 3WUDA 4BA6A 2K2SA 4Z07A 3E97A 1WW6A 3D0JA 1R1ZA 5FYIA 1YEWA 1KEXA 1JW6A 4YG0A 4P9IA 1BEV1 4Y22A 4A6OA 3MIHA 3M3QA 3ON7A 5EYYA 5LA1A 4ZPIA 4CCEA 3BOPA 4IEXA 1GQHA 4RR3C 3RYRA 2RS51 1RMU2 2IXHA 5EFUA 2PAEA 2XJUA 3DCQA 4IV3A 5DABA 5FZ3A 2RMU3 4XURA 4JKMA 2E31A 3MF9A 4YGBA 4CCMA 1R1A3 1Y4WA 4W6YA 4KG0A 2VCMA 2JDKA 3RQ0A 2P1BA 5C5TA 3WOGA 4CCJA 2YGLA 2VVFA 3NRUA 3G7DA 1NCQA 3AYDA 3VZMA 3CKHA 3OOXA 5EPAA 2ARBA 5ACA1 1PMJX 2UWBA 3AP5A 4XQDA 3AM2A 4BH9A 2RMU2 4FPKA 3EJKA 2RR12 2DVAA 2EA7A 4CDQC 3NAPB 1FMD2 4QX0A 5CG8A 2A1XA 3POIA 1W6OA 3CIHA 4BQWA 3GBFA 3E6CC 3C7HA 1WKYA 1GZWB 1BBT3 2D6PA 2QE3A 1GYKA 2A5ZA 4RS5B 3J4UH 1LHWA 2KA3A 2DCZA 5AVPA 4MGIE 1TVGA 3AVSA 4NVPA 4QWNA 4EN6B 1W2TA 2VZVA 5J36A 3TEZA 2AACA 4IV1B 3NMBA 5GM0A 2P2KA 3HT2A 3ZSJA 3S0MA 2BBVA 3MF6A 1ULPA 1HJFA 3A23A 4FPGA 4Q1RA 4OUSA 3BCWA 3K75B 1VR3A 3VBOB 4RQPB 4I3PA 3AVRA 1TMF1 2Z2SB 2WNVC 4EROA 1UOBA 2JE9A 1W9FA 4P9GA 1AL21 5LBFA 1FPN2 4EN7B 1W6QA 1CESA 2WQ8A 4XE9A 2E51A 1NCRB 4OCTA 1CX4A 1S0IA 2C6SA 4Q0UA 4I30A 2UYAA 3T4VA 3I54A 3JB4C 1EAH1 3ACGA 5DG1A 2FDHA 3WNNA 1YIPA 4KMQA 1NQJA 1NZIA 1SDWA 3T1MA 1RUG1 4FFFA 2WNVB 5DPNA 1CONA 3CZJA 3KT7A 3HBKA 3NKGA 4BQ4A 3B9CA 1PZ9A 5AC91 2A6ZA 1O6UA 5BYNA 4BCUA 3ZXGA 1PNFA 3SH4A 4C91A 3KZ4C 3CBNA 2QUOA 2Q8CA 3AXDA 4JZRA 4BE3A 2YB7A 4QQHA 1JHJA 5FZEA 4QPWA 3VDDB 5FZFA 1RUG3 1US3A 2CGNA 2WZR2 4L0PA 4PI2A 5JXIA 1QHDA 3TAYA 3ZXLA 4KU7A 1GP6A 1W6PB 3CJIB 5A32B 4NIIA 2FDKA 4LBQD 2FHRA 4AEDA 1F8VA 3IPVB 1LKNA 2XJRA 1ZVFA 4GWIA 5FYBA 5LASA 2W2IA 3WF0A 3H0OA 2ZGOA 4FSJA 4A44A 1ND2A 4B8EA 5A1FA 4AFAA 3N35A 4COWA 5B4NA 4MGYE 2QDRA 3HWJA 3H8RA 1PVC1 4JHTA 3U78A 1PNGA 2HH9A 2PHUA 1SCRA 3RZGA 1BZWA 2PYTA 2CAVA 4Q5OA 4WM8C 1NLQA 1UAIA 2B46X 4QPYA 4V2VA 5FYVA 5BY5A 2BGCA 5FBJA 4CP1A 4IE7A 1WW5A 2DV9A 2AGSA 5L7OB 3JB8A 2LS6A 4LKDA 4CP9A 2ZTNA 1FV3A 1XNKA 3HN3A 3KF3A 1ZBA2 3KLSA 5CKMA 3HQXA 5E8AA 1EV11 3H1WA 4I02A 4D6SA 4DEQA 2HWC2 3LSDA 3QOPA 4KBBA 3Q9OA 1C3HA 2VCBA 3OEBA 1KD7A 4Y22B 5I0RA 1XJAA 4PHZA 4LE3A 1W8HA 5FMOL 3SHRA 2RS12 3JXSA 3T2OA 1EUUA 2VXRA 1W0PA 2EALA 1PK6C 1U12A 1OSGA 1TME2 4PDWC 2ZEWA 3GHMA 3S7IA 4MXWB 2HYXA 1QMJA 4TWTA 5GZDA 2DCKA 3L9JT 3WDYA 1CAXA 1S0GA 3B9IA 1UMZA 2FMDA 4XFCA 1K3IA 3MO4A 2XLAA 4UF0B 3ZFGB 3EB7A 1UYXA 2CY6A 5FZOA 2J1VA 5C8CB 1UN1A 2D98A 3O0WA 2CAUA 4BZ4A 4TSVA 4K1ZA 4S2FA 4B1LA 3SCHA 1QIQA 1AUYA 5J7MA 3GM8A 4FTEA 4FOWA 4NWWA 3VD9A 3RYKA 1QJU3 3JD73 3VL8A 3VBUB 1X8MA 1AYN2 2AH2A 4GB31 1RINA 1FNZA 3D6EA 4JV4A 4RGKA 2ZX4A 1CZVA 2HKXA 2ILMA 4ISQA 2YBPA 1PO13 3USUA 3ZFGC 4M0HA 1W8WA 2A75A 2P5BA 2VZRA 4GWNA 2E9QA 2WYSA 3PVNA 3HJRA 1W8ZA 4XZUG 5EJ1B 1HRI3 3BOWA 4HONA 3M3OA 1OVSA 4AEJA 2BPA2 4XBNA 1HQWA 1RUI3 3WNOA 5FUIA 1IOAA 2VOWA 1OF3A 2XJSA 3KQ4B 4Y3OA 4Q0PA 4W6WA 2FBEA 4DZGA 5FP3A 4AAXA 4Y1VA 3H3ZA 1UOGA 3LF7A 4QQPA 5CVRA 5FLJA 4QHZA 1OT5A 1GOFA 1AR61 2BU9A 5ERLA 1KJLA 3O14A 4IEPA 4IE6A 4XJ8A 5KC5A 2WO3A 4WVVA 2QDNA 2VPVA 2ZHMA 1BK1A 2CSGA 3I2JA 3K4ZA 3ZO0B 1QJY2 1OURA 1APNA 2G9FA 2NP0A 1ZZCA 1QF3A 2Y64A 1RUNA 1G9AA 4JX0A 1CX1A 3AKPA 1LB2A 5FUNA 4O61A 3V0AA 2RDQA 1LR5A 4JRAA 3K77A 4COUA 2RMU1 5L7OC 4I0BA 4YW7A 1HXS2 5FO9B 1D4M1 2JE7A 1V9U3 2CWMA 4EYUA 1YC61 2JKXA 4FFIA 3DUIA 3W9AA 3K48A 4PBPA 5HBAA 1W9WA 4D6QA 5C71A 2NM1A 4TYSA 3Q8FA 4QX5A 1D2SA 4M01A 1UYZA 4YVWC 5I8YA 3I3EA 3AMNA 2A3YA 4XBLA 5LATA 1AR83 4HK8A 4PBOA 4HBNA 3ZYPA 4HN1A 1ZZ7A 5T5JA 2YZ4A 4RD7A 1PMHX 4LO6B 2W3JA 4META 3K51A 4LBQA 3VN4A 2QQMA 5CU1A 3IAQA 3M4FA 1Z7S1 1F2NA 2VQTA 3H8UA 3UNPA 1VAVA 1XNDA 2R0HA 1AX0A 3GYDA 2B8MA 4XFAA 3H50A 4LEJA 1AR91 3INAA 3LFIA 4JKKA 3TYJA 4FFGA 5FZBA 3RS6A 3ZR5A 2ZX2A 1AF9A 5K0UC 4H7LA 1VMFA 5HCBA 1SLTA 1HW5A 1NY71 1XYNA 5CB7A 3VDDA 4L97A 1Y3TA 4JDNA 3KGZA 1CAVA 1J3QA 2GC1A 4YYOA 4XMAA 2EIDA 4BOWA 3WF2A 2F17A 1SHWB 2BYVE 3TWIA 1J3RA 3PU8A 2W68A 3PLQA 2OZ6A 4AK3A 4GH4A 3SLIA 2QQNA 4PCRA 2WNUA 4MOAA 3ACIA 3B94A 4LIVA 2YPJA 2HWD1 1OXCA 2ORZA 3VBRA 1S2BA 2YV8A 5C3QA 5IVFA 3ZIXA 2JJ6A 1HQNA 1JYTA 4WM7A 5FFOC 1I5PA 1OI6A 1X36A 4E4ZA 3NJYA 5FR3A 1QH7A 3J26N 3GZUC 4MXVA 4OZOA 3ZMOA 5DN2A 3IAPA 5I93A 2AC1A 2E7AA 1OVPA 2ORXA 2P3JA 2PHFA 5BNNB 1OBNA 1RUH1 3AP4A 3GZEA 3VZLA 4IV1C 5F7UA 4DRVA 4B3NA 5FRAA 5J96B 4CU6A 4IEOA 2W1UA 4MSVA 1LOCA 5FIXA 1UMIA 3O1TA 5J09A 2VZSA 4O7XA 3PUSA 2OQ6A 1MEC2 5BNOC 1YQ2A 2VNOA 3GHNA 2HWD2 2V4AA 1VBC3 5F9TA 4CDQA 2JWPA 2XQRA 3VDAA 4QX2A 1A34A 2YFUA 4LO7A 4S2GA 1LAJA 4RHV1 3T3YA 3MHZA 1CN1A 1H4GA 4GMP3 3WQBA 4AWDA 4D94A 1O3RA 4JQTA 5FY7A 1UXZA 3LIHA 2VZ1A 2BZDA 2DURA 1ZZBA 1OOPB 4HSJA 1YNAA 2G9GA 3BU7A 5LEJA 3QH6A 3W21A 4FAGA 1KDKA 1LCLA 4UW6A 1V6KA 1DQ6A 3EHKA 4QAWA 4WVZA 5A7QA 3WP6A 4DXZA 3IDCB 4MV2A 2OKXA 4EE2A 1XPWA 2Q30A 3WF3A 1HIXA 4I0AA 2WC2A 5FMDA 4XJWA 2R30A 4AHWA 1O3QA 1ND3C 1FOD3 2DCJA 3ABZA 4XAEA 3URFA 1DQ0A 3POGA 4XF0A 4IEQA 4A3XA 5A7WB 3LPFA 2QQOA 3KV6A 4KGGA 1J1TA 4UFJA 2JXAA 5A33B 2WNUB 4NUBA 2BNOA 5I91A 1DHKB 3ME2A 4OHVA 5FY5A 5FMBA 5FKCA 3T08A 4QKDA 4UXAA 1LEMA 5CNAA 2W92A 2P3YA 3LOIA 4CUCA 4AEMA 4K1YA 3ES1A 3FL7A 4UFHA 1S55A 1J83A 1RMU1 1GZ9A 2PHDA 2YYOA 2E6VA 1PK6A 1IG0A 3ITQA 4OQ9A 1O4TA 2ERFA 1K5JA 1G9BA 4DINB 2EIEA 3WG1A 3NNFA 1KS5A 4WV8A 4NAOA 4PIYA 5G04L 2Y6KA 5EZWA 1P8JA 2HWB3 3MI8A 1HRI2 1NZCA 3N7MA 4R9AA 4X6QB 4OI1A 1NLRA 1PO23 4M00A 1OFSA 4LBOA 4G4FA 3ZFEC 4E4SA 1VMJA 3WEZA 1QJX3 3KVBA 3DKQA 3M70A 2XB6C 4QT6A 4N9HA 2RVAA 4QHBA 3THCA 5FZ7A 3U37A 3I8TA 2JEMA 2Z42A 2OT7A 2WO2A 3ZN4A 4AAPA 3VB9A 4LR4A 4AI2A 3N9QA 4N53A 1EV13 1WLCA 2HWC1 2D43A 1IS3A 1MS3A 2R16A 3A0NA 1LOFA 3UETA 4ATEA 1VLNA 3HD8B 3VDCA 4HSLA 2A6WA 4OMCA 4IE4A 1PZ8A 1Z78A 1ZBA1 2KR2A 1W3XA 3PVBB 5BNNC 1WD3A 2R1DA 3J7MA 5IVJA 1R081 2WT0A 2W52A 4WM8A 4AQ2A 2VCAA 4RHV2 4FPHA 1Q8OA 3HVDA 2FD8A 4I2OA 4RFRB 3ECQA 2HWF3 1NCQB 1NE4A 4Q8KA 1HXS3 1MEC1 1OLRA 5E1RA 5FZCA 1NA1A 2D3RA 1H8TA 2HWE1 4NIAA 3UGHA 4JDMA 2P34A 4YGDA 3F2ZA 1VBD2 5C70A 1WCKA 5JOZA 3DPRC 2XJPA 1PVC3 2WFF3 4Q4Y1 4XPVA 1RUOA 1VJ2A 2XQXA 1SG3A 2VULA 3ST7A 2ZX1A 4FPFA 4YZ1A 5C33A 3AZVA 3CF6E 4HL0A 1LOEA 3AP7A 2BUKA 4ZS2A 5FYYA 1E57A 4BM8A 1RHI3 1N3PA 3USSA 4JGZC 2EXJA 1KQRA 1ACCA 2PLV2 4Q4X3 3RVHA 4LLFA 1AX2A 5IK4A 5L7OA 1S2KA 1NCRC 4JHZA 1YLLA 3ZLIA 3BUCA 4DXSA 3MYXA 5FP9A 5HPOA 2W95A 3BODA 5KHHA 4BK4A 3NJZA 2SLIA 3VBFB 2RJ2A 4R4XA 2D6LX 2WNUC 4ZY9A 1UX6A 1O4ZA 2OX0A 4GIQA 4XUNA 4XF1A 5FPLA 1F31A 5K9YA 3P3NA 1DGRN 1RUE1 5JMOA 2MEV2 1AL23 2D7FA 1N1SA 2DVBA 4DRRA 2JDMA 3MFCA 1ULOA 5JR2A 1DQ4A 5F8PA 3WR0A 3GF6A 3OF1A 3NWKA 4PT6A 1MQTA 3QACA 2P37A 1IGOA 2JDHA 3R4DB 4NJ4A 4ZU4A 4C0HA 1AL22 3M8LA 1J1LA 4Z82A 3AKQA 3BTXA 2GDFA 3V0BA 4UI9L 3AYEA 1CJPA 4NAMA 2R071 3AMPA 4UAPA 1QQP1 1CIWA 4AVAA 5FP8A 5JLVA 3VHOA 4QXBA 3ACHA 3IPVA 1VBE3 4Y4YA 3PMEA 2V72A 4JQRA 1RXGA 1VAKA 1FMD1 3HNMA 4MHRA 4ZONA 1Q8SA 3FLTA 1XNBA 2XUMA 2WNEA 1A8MA 2E33A 2FCUA 4K9SA 4B7KA 3MZHA 1IHMA 1ST8A 3ZSKA 4DPNA 3OYWA 4YVWB 1SDDB 4XFIA 3VZOA 2P3KA 2X5IC 2XBO2 1SLLA 1VBE2 1FMD3 4GJYA 5EWSA 5FPUA 5LW9A 1HRV2 1W6MB 1NUKA 3UKVA 2D97A 2UU8A 4Q4W1 3LFMA 1NE6A 4XHXA 4CSWA 2VBDA 2JG9B 4Y5Z0 1RUC3 3KT4A 2ID4A 5F5AA 2K9ZA 4J1WA 1RUF3 4AZZA 5GLUA 4DXTA 2TBVA 1HJGA 1RYYA 2WZR1 1F5FA 2EAKA 1ZBE1 1YYNA 5DXDA 3SH3A 1VRH2 4BLIA 5GZCA 2VC9A 4IEVA 3VBUA 3WF1A 2YXSA 4JAAA 1O3TA 2A3XA 1X33A 1LJ7A 4LBQB 3TEYA 2C9AA 1NYWA 4QU1A 2OIIA 1Q3EA 1ZYBA 4FPJA 3H42B 4BPZA 3ZM8A 1X9PA 5IYYA 5FZLA 3VBSC 4OHYA 3ZDVA 5EIYB 4ZKTB 4N53B 1DIWA 3FJSA 2WS92 3I2GA 3WSOA 1WWYA 2VGDA 1AYN3 2VZPA 2RM21 2NPIA 2VMFA 4CPBD 2VH9A 3J8F3 2A6VA 2VUDA 4ASKA 3EBRA 4BK5A 1UY2A 4OI4A 4S2DA 5ACA3 3ZXFA 3CJIC 3NJXA 1N3QA 3AB0A 4GZ9A 3W59A 1W3VA 5IVVA 5IK7A 1R093 2Q4SA 2YC2A 4XC9A 4Z8BA 2PAKA 3PUIA 4BQXA 3A21A 2WS91 2DTYA 1UOFA 3KS7A 4FOVA 4J1XA 2WAOA 5I8TA 5GLZA 3KHCA 4R8HA 4Q2FA 2JB4A 1BBT1 1AHSA 4CDUC 3CNAA 1PX3A 2XLGA 1PO11 1N1YA 2FDIA 4QU2A 3HAGA 4GAZA 4BQ3A 1JU4A 3CQOA 4NRMA 1ZZ8A 3U07A 2WO7A 1OF4A 2BOIA 3MW4A 1YFWA 3N7KA 3OUHA 4JKLA 4WVMA 3ZYRA 1RJ8A 1UXXX 1OMIA 1ENQA 3PTYA 4HLTA 2CDOA 3B69A 5JZGA 4LO5B 1SFNA 5DMYA 3H8XA 2GAUA 2GU9A 4YM0A 1D4M2 3FBYA 3UK9A 1QNWA 4BYYA 4UFIA 1F9KA 3ILRA 2VE1A 3AFGA 4XF9A 5DG2A 1I9RA 4H3WA 2WO1A 1UU5A 4UFKA 2BFUL 1U5IA 3SCFA 3E6DA 4LULA 3TNQA 4URAA 3OGJA 4Y20B 1QNYA 4X6RB 4QXCA 1AYM3 5JUVA 1FT9A 4EWDA 2IVIB 1D2QA 4XCAA 4HVRA 1RB8G 1JYIA 1UPSA 2Q8EA 3WF4A 1C4RA 2R7EB 1QXPA 2HWE2 2J1AA 4XQWA 2JIGA 5C4WA 4M4RA 5FDBA 3MIGA 1QU0A 2W87A 4LT5A 2R043 2XH6A 4Q0QA 3ACLA 2YG0A 2ZACA 3T09A 2FDFA 2VNVA 2RDSA 4CDWB 4GKYA 1W28A 3MLJA 4GWJA 1R082 5C3SA 4QB1A 5KWRA 3S57A 3H7JA 3WDUA 1WLWA 1GZWA 3M3CA 1IG3A 1W6NB 3MW2A 1LHVA 2VZOA 2BNMA 1WMEA 2IXCA 4RYDA 4YW5A 4AI0A 3OG2A 2ZCWA 4C90A 2LUWA 4Z2AA 3LOBA 2BJSA 4U36A 1GR3A 2IFWA 4Q29A 1F5JA 1KFUL 4AYUA 4ZZ5A 2EICA 5D8AA 4D8MA 1LEDA 1QXRA 1R083 1DU3D 2EVXA 3MGUA 1W6PA 2DTWA 4ZXEA 5JOWA 1W2AX 1WUVA 2JG9A 3TBDA 1Q5OA 4B4PA 1OA2A 1ODMA 4ITCA 1RUJ3 4E4DX 1HKDA 5A3TA 2ES3A 1C8NA 5A33A 2R0FA 2ZKNA 3LIGA 1OA4A 2EXHA 5L36A 4YGCA 5CZKA 5EJ3A 2UY9A 4UWDA 4ZU7A 4RA0A 1HB3A 5DDJ3 3HBZA 2PAMA 3H7YA 3KCCA 2WA3A 3WQ0A 2X53S 4COYA 1RUJ2 4D6RA 1L3JA 4M4PA 1WA4A 4OHXA 4LORA 1SPPB 1CAUA 3HIFA 2C5DA 2X10A 4YW1A 1V6IA 3IIAA 3LCPA 2F4LA 4DFSA 2C9KA 1UZZA 2XPJA 1Z7S3 4XJZA 4Y5TA 4FPYA 2Q8DA 4F83A 4Z1VA 3I3BA 2OA2A 1G9CA 4GMP0 3RPQA 1EAH2 3CO2A 5FYZA 4KQ7A 4XF4A 3UESA 4UBHA 3DKWA 3DPRA 4AL9A 4YSFA 1JZ5A 1JBCA 3ZVXA 1UY3A 4Q26A 4DQAA 1R64A 2DUPA 3AKRA 1DDLA 4LBNA 4N7UA 1HQLA 1X9TA 1JOBA 2D3PA 2OW4A 2WKKA 2A70A 2ZHLA 4LO4B 3K4DA 4B29A 4CDXA 2YC4A 4DOUA 1W9YA 3NAPA 4GALA 3KVAA 1JH5A 2EXIA 1MEC3 3OGGA 3LEMA 5LEKA 3SCGA 1ZBE3 2VJXA 3ZN6A 1DGRA 5KXCA 1QJEA 2BGOA 4PJYA 3MBWA 1U0AA 3E6BA 1ZX5A 4XIOA 2WLPA 5FJHA 2XOMA 4ZXKA 1FNYA 5CIRA 1L7QA 4YARA 1UZWA 2O0OA 1LOFC 3MFAA 3AMQA 4DNYA 3AZZA 1JZ2A 1YI9A 1WCQA 2XL9A 5K4LA 3LD8A 3CJIA 3ZKYA 5A32A 4QPGA 2RM23 4DUXA 3JBG1 2VXJA 2BRTA 4LO8A 3FUQA 1WD4A 4F3JA 3DECA 4FI9A 1DZTA 1ZZ9A 2VW2A 3T4HB 1YRZA 3MDPA 2IXJA 5AFEA 4P9XA 3WNKA 3S7EA 1AR72 1C1FA 1FOD2 2QQIA 3R4SA 4V2WA 4OQ8A 3MIDA 2RM22 3DYPA 4KG8A 1LGBA 5C3OA 2CGPA 1BLZA 3LPGA 2Y38A 2ATFA 2JICA 2PLV1 1IQAA 3RRDA 2YBKA 2W0XA 3V64A 1PHMA 4IESA 4NHXA 3NV1A 3RI8A 4DB5A 3PJYA 1RC6A 5F6KA 1NKGA 5HV0A 1VBA3 4AHZA 5ABJB 1PIV2 1EY2A 2AENA 3AX4A 2RS31 1JMUB 4FPOB 3MEPA 4L2NA 3SC7X 3ZR6A 2XONA 3HR9A 4IETA 3V56A 2YBSA 1F35A 1DGWA 2ZMNA 3S5QA 4K40A 1VB4A 3LGRA 4BU2A 2XXZA 4CPBA 3KCYA 2GN3A 4CP2A 1RVF2 4W50A 3SEPA 4DUVA 2VECA 3ILFA 4M0NA 4ES8A 2ZZQA 5FZ1A 4A7ZA 3VKFC 1QQP3 2VMHA 5FQ0A 3AK0A 4X8PA 4HANA 4XW3A 2B45X 4XIKA 4CEYB 2OUJA 2AR6A 1S0EA 4KBZA 2DCYA 2VZTA 1REDA 2DVFA 1G7YA 2HBTA 1SLBA 3PJQA 2GH2A 2Y60A 1OUSA 3IKWA 5F6LB 5JIAA 4QX1A 4Q4X1 2R6QA 3J7HA 3WVJA 2XMLA 5FTTC 3RYPA 3RSJA 1NX9A 1S0CA 2P3IA 3IDEA 4RS5C 1KJRA 1O3SA 5IVEA 3VBSA 1WW4A 1ALYA 2ARAA 1AYM2 3VD7A 5C9AC 2QQUA 1GP5A 1PGL1 2XVGA 4GXLA 1IS6A 4XFHA 1MS9A 5FP7A 1KS4A 2VMGA 5EHDA 2QQJA 1IPJA 1MZEA 2QVSB 2VMIA 1IPSA 1PVC2 4I09A 5FPBA 4Y24A 2NMNA 2A71A 2VY0A 2VW1A 4XCBA 1DZRA 4QX7A 1CAUB 2GC3A 4KNCA 4LE4A 3VDBA 3BTYA 2JE8A 4CU8A 1U5YA 4MVTA 3CZUA 5APAA 5CFCB 1T6GC 2PFWA 4IDZA 4UYBA 5H9QA 5C9AB 5FWJA 4XVHA 3HQRA 1ND3B 2RS52 3O7OA 2QNKA 2GZWA 4H7MA 2V5DA 5A6YA 5A3LA 4AVCA 2WR9A 2RS32 1RTVA 4BHPA 1MS8A 1ZRIA 4IEUA 2I74A 2A6YA 2PHWA 2LROA 4KWLA 4NPRA 4XJAA 4ASMB 4FP2A 1R1A1 2HEYF 4RR3B 2RE9A 3RZJA 1KGYA 1YI7A 2PELA 3WT3A 1SBDA 1C57A 2QQWA 2FQPA 2VQ0A 2PN5A 1GOHA 4E2QA 3UKTA 1U5ZA 3WUCA 4MADA 1BXHA 2OVUA 1RIRA 3ZMNA 1AJOA 1UQXA 3I2HA 5FQ0B 5CYYA 1C8M3 1FYUA 5FZAA 4XXPA 5FPAA 4K20A 1B35A 4CCNA 5A1AA 1AR92 3LAGA 4EQVA 1NXD1 1C1LA 2BTVC 3LSEA 1F4HA 5IFTA 1VBA1 4MGZE 3LKJA 5E88A 1VPHA 4QD2A 2JG9C 5F5IA 3VL9A 4ASLA 3V0BB 2PHXA 3OPTA 3AFKA 5GALA 3TEWA 1SPPA 1E5IA 1WA6X 3OCPA 3AZWA 1I1EA 2P17A 3RZLA 3I2DA 1GP4A 5JAXA 4XZPA 2P6HA 3U0ZA 1S2EA 1V6OA 2RV9A 4XJUA 3S5AA 3FHQA 3WY6A 1XXNA 1O5LA 1ZNPA 2R063 1Z7S2 3DYMA 4CTEA 5IAXA 1H0BA 2ZGLA 1BEV3 5JXJA 1S0BA 2BGPA 2WLQA 4YVWA 4ATFA 3JQXA 5LA9A 4EZHA 4IEWA 3O1MA 2H0VA 1BK0A 3HMYA 3FC0A 1O8PA 1JYXA 5E6HA 4YW3A 5FZHA 4DY3A 3U75A 5LY2A 3NJVA 2NMOA 2JG8B 2J42A 1GUIA 4P02B 1UCXA 5DAVA 3WCSA 4FTBA 2TEPA 4AW7A 1V9U1 4AI1A 3C8XA 1JZ4A 2F6BA 3O0VA 3THDA 4N53C 4Q4V3 5FO8B 3MV11 1NLSA 2VNRA 3KQRA 4QDQA 1I5ZA 4XTMA 5IW0A 1CWPA 2QBXA 3WHUA 5C3PA 1Q56A 2GALA 2PHTA 2VL4A 4NROA 1V9U2 3MW3A 5CFDA 1NT0A 1IKQA 4JGYB 3B5LB 2ZMKA 2YROA 4LUKA 5B2GB 4HZFA 5GLWA 2RJKA 2XHNA 3T2TA 2NZ9A 2ZOEB 1ZREA 4O65A 3R4UA 1BBT2 2AREA 2I2SA 4FO9A 3RGBA 3UYJA 3WP3A 4CCCA 2R073 3ASIA 4P9YA 3POSA 3WW3A 4CYDA 3OD4A 2VOXA 1GNHA 4AVVA 3D3AA 4QM9A 2Z79A 3EXUA 5L19A 4NO4A 3NV2A 1H6XA 2ARXA 2WT2A 5F32A 1VE0A 2HWB1 3THTA 4PDWB 3LEKA 3NSTA 1BMV2 4XABA 2RDNA 1Y9QA 3PUHA 4BXSV 4P14A 3SITA 3UKNA 4A7KA 2A73B 2I45A 5CFCA 4CZSA 1D0GA 5H9RA 1J84A 2ZGUA 3OGSA 1REFA 1VBA2 1EUTA 2TNFA 2WABA 1W39A 4JGYC 3U11A 4IW3A 1UYYA 5FLHA 5LA2A 5F3EA 1SFPA 4L9BA 1QJX2 4LHSA 1F15A 2Y6LA 3POFA 4S2HA 3WP5A 2CWSA 3AKTA 4GH4B 3P3PA 4TLGA 3FWEA 1DYKA 3NKTA 4BWOA 2GNTA 1LODA 5T3NA 1NG0A 4A6SA 1Q8PA 4YM1A 4CEWC 1H8VA 1ASJ2 1XU2A 2HWF1 2Q1MA 4FFHA 5DAWA 5FK8A 2D5HA 3J7NA 1K5MA 1HXS1 2ZEXA 5BXXA 1KDMA 1YQ8A 2D6KA 2DFBA 4QPGC 4AFCA 3JQWA 4YZ3A 1QJFA 1RUG2 1J3PA 4C8DA 2UWCA 2XR4A 1S0JA 3P5BA 3BPZA 1GSLA 1OOPC
chains in the Genus database with same CATH topology
3FLRA 5GZEA 4Q4Y2 3KGLA 5K0UB 4KU8A 3WLUA 1OQ1A 1G8WA 2PQQA 1HRV1 1A6CA 4MYEA 3H1YA 1YXWA 2B7YA 4HFSA 1REEA 4I0WB 3QCWA 1SLAA 2RJLA 2RS11 2X5IB 2ZPXA 2NYYA 4GMP1 1HLCA 2D44A 1FATA 1BQPA 2WFF2 3BIWE 4B7EA 4L99A 2EAAA 2MNGA 3FFQA 1AYM1 4OFGA 4WBBA 2WWSA 2B9UA 4R9BA 1RITA 4K6BA 5DUWA 1J58A 1LOAA 3VHNA 2JG8A 4K21A 5H9SA 5KBFA 1J59A 1POV3 4YRDA 1X50A 3ZFGA 1TME3 1HX6A 4AVTA 2GNBA 1C8M1 2PLV3 2PHRA 3VBUC 1LTEA 3LB9A 2XHKA 2MEV1 3E5XA 1OLQA 1OPOA 1QWRA 3GALA 1BVVA 3B93A 3JCIA 4YFWA 1DQ5A 2ET1A 2NQYA 2JD4A 2GNDA 1RUH2 3KB5A 3AKSA 4XJ9A 2MEV3 1TQ5A 3WDXA 4YZ4A 4YZ5A 4HT1T 1DLLA 5CAZA 3KM5A 1RMU3 4BIFA 3AJZA 5GKAC 1MVQA 3LA3A 3WD5A 2XWJB 4AGVA 1R1A2 2GNMA 4ZU5A 3LZZA 4FVVA 1AR93 1QOOA 4HVOA 1C5HA 3WG2A 1H8TC 2Q5TA 4HPKA 5BNQA 1JYCA 1OQEA 5KC6A 1UW8A 1WLTA 5JPNB 1CVNA 3JD71 3PNAA 3M2MA 1LGNA 1LGCA 5LRSA 2QQPA 2V09A 1GLHA 2PA7A 3IWZA 4CEWB 1RUC1 4IXLA 3MIEA 2VUJA 1RUF1 1PGL2 2XBO3 4K7JA 4JGZA 2ETEA 2D6NA 3ZSLA 4COZA 1QJY3 2QCSB 1H1IA 1DGWX 3WNXA 1H2LA 3MLKA 2CTVA 4HKOA 5T50A 1LHOA 5FLIA 2JECA 1SFYA 1ZA4A 4R9CA 2FMYA 5BNPB 1XYOA 2IXKA 1VRH3 3IT8A 4TZDA 3TB0A 3TN93 4CDQB 3WV6A 1UF2C 3IM0A 5GZGA 5FO7B 1AR82 2ZS6B 1VBC1 3G6JB 2Y0OA 1VBD3 4QQLA 5JIUA 4UW4A 3TN91 1JUIA 1QGLA 4AXOA 3H1MA 3LA2A 5FBZA 5ACA2 1BJQA 2DFCA 5J48A 1O4YA 2XGXA 4Q4V1 1CJDA 3BB6A 1FV2A 1PIV3 1KRIA 4FXKB 4INDA 3FUOA 1VIWB 4U2AA 1NCQC 4D3WA 1V70A 2G4IA 4MX3A 4Q27A 3A0KA 3GBGA 4WZFA 3VBOC 4D7TA 4FBFA 5I0SA 2KM2A 5JR7B 4AHYA 4CP0A 1UIKA 4CEYA 3QLQA 4RS5A 4YVSC 5A3MA 4IV3C 3GZAA 5JZGB 1EYBA 2X29A 1W6MA 4W65A 4P9JA 2XL7A 3QD6A 2YMZA 3QH7A 3OD0A 5CFCC 5IK8A 1SQ4A 3KSCA 2HEWF 3FLPA 2H6CA 5CBLA 4Y20A 4GB32 1ASJ3 3VZNA 2QJVA 3ZFEB 4WZCA 4B4RA 5ABJC 4E2SA 1EPWA 3VZKA 1ZM1A 3WCRA 3NAPC 2JENA 1GZCA 4LTAA 4OHWA 5F5QA 4QMAA 4HPKB 4PIXA 4OULA 5EYXA 4YM2A 3WW1A 5T54A 1OKQA 4XHBA 2NLRA 1ENRA 1SEFA 2ZBJA 3D4KA 3AXEA 1PM7A 4JC1A 3IDBB 3DN7A 4XFFA 1UKRA 3TRSB 4LUMA 3FFZA 4Q4W2 4IL7A 3R6SA 1QOSA 4BMBA 4IV1A 1LOGA 1B35C 5KHIA 4M3CF 1TMF3 2IC1A 3FZ3A 1AL0G 1CR7A 2GH8A 3PVOA 5HCFA 5T52A 2H0BA 5HCAA 5JSRA 2Y26A 2CNAA 1LU1A 2QFEA 5KXBA 2DVDA 4FAHA 2R061 2ZHKA 3ZFFC 3M3EA 2Z69A 1ND2B 2EIGA 1POV0 3DGTA 2AZ5A 5BNPA 1VBB2 3OBRA 5L73A 3NW4A 2VOVA 1B35B 3MIFA 1SBFA 1NY72 2JG8C 4F8AA 4RGAA 4AGGA 4JGZB 1U5XA 1PO12 3X29B 1PK6B 2NN8A 1AR73 2D6OX 4AI8A 4D7SA 3VDDC 2WS93 3SXWA 3RNSA 2WT1A 5LRRA 4JTOA 2WFPA 1DBNA 4N43A 3ZXJA 1RUD3 3WXPA 4OI0A 3GNEA 3L2HA 4NHMA 4DY5A 4E9KA 1D0HA 3ATGA 3NV4A 4MGKE 1ULFA 3QBQA 4R9DA 5JZGC 3POWA 1AZDA 1ULDA 4I01A 4QGMA 5JDBA 3ZXAC 1UU6A 3ZXKA 3WINE 4C0BA 4COVA 3OY8A 3PHMA 3J9SA 4YW4A 4YW2A 2BWCA 1FXZA 1B09A 4XBQA 4RQPC 1LESA 2CV6A 4BQ1A 2CGOA 2BVBA 2XVKA 5JCTA 4Q1PA 4Y1UA 1D4M3 4Q4V2 4QPIA 4GKXA 1IZ3A 5C8CA 1DF0A 4RHV3 5D8AC 2DYCA 2UWAA 5FMOS 1XU1A 1VBE1 1VB2A 3O5SA 4YNIA 4LNVA 2EXKA 3N36A 2GMEA 1AR81 1H9WA 4YGEA 3RMXA 4QQOA 4EV0A 1MS5A 1AXYA 1UZYA 3THPA 4H14A 2XLFA 1MACA 1FPN3 2VNGA 4GULA 1TNFA 4M3CB 5BV6A 3V0AB 4C1XA 3TNPB 4FOQA 2XKPA 2BEOA 1NA1C 3LA7A 2ZAAA 5K7PA 4YM3A 2I07B 3WW2A 5D8AB 1RUE2 1H2NA 2VVDA 3VZJA 1UPIA 1PVXA 3AMMA 1AXZA 2VQAA 4CEYC 1COV2 2XWBB 2C1FA 5BUVA 2ZX0A 4XMIA 5CADA 5DDJ1 1SCSA 2X5IA 5C4WC 5IK5A 2C0ZA 2CYFA 2BNNA 4CDXC 1Q8QA 4FQ4A 2B42B 2LALA 1WMDA 2F4PA 5JSOA 4X8NA 1GANA 1VP6A 2GMPA 4PLMA 1YCIA 5FAXA 1POV1 4Y1YA 4RGGA 5AC93 1QJZA 1O91A 1DZQA 1TME1 4CDUB 2ET7A 2EF6A 1ULCA 2DUOA 1RUD1 1R091 3ZXEA 1BVP1 2LM3A 2LTNA 2GN7A 4EN8B 1C28A 4G3YC 4CRQA 2ZA9A 1C5IA 5T55A 5DZGA 2Y0IA 4WVWA 3B3QE 1LHNA 1M4WA 5AC92 3RZZA 3U10A 1ENXA 4NHKA 3A4UA 4UW3A 5DZEA 2Q0AA 1VBC2 4XILA 3JBG2 5GJ6A 3UL2A 4KL1A 2BQPA 1DFQA 1OQDA 4GQ7A 3D5OA 1SMVA 2MHFA 3WW4A 4Z2WA 4A7YA 1OD5A 1LU2A 1ZRRA 4AF9A 3AJYA 1S0FA 2ZHNA 3JBG3 1H1MA 2B5HA 2WA4A 2IFRA 4Q8LA 5SV8A 2RS53 3NL1A 1JHNA 2HWC3 1YFXA 3DL3A 2ZJCA 3MPPG 1CPNA 2RR13 3FE5A 5K0UA 1TE1B 2HWD3 1D4VB 1NOVA 4AQ6A 3AZXA 3ZDSA 1OHFA 1FAYA 4L8QA 2OYZA 5T5LA 1PGW2 1TEIA 2R041 1BMV1 4JTNA 1I6XA 3DF0A 4AE2A 2WSVA 3OY8B 4ONUA 2WQ4A 1IKPA 1HRV3 1QXJA 3S6PA 1RGSA 1HRI1 4FP3A 5BNOB 2E53A 1VAMA 3JU9A 3VBRC 1WCSA 3D0SA 1H1AA 5TSWA 4QXKA 4RQPA 2WQZC 1R092 5HI0A 5C9AA 5CG9A 4N9IA 5BNPC 4PQ9A 4XXAA 2UYBA 5F1RA 1XE8A 4PF5A 4P9LA 3NO8A 3IBMA 4XDQA 1NCRA 1RUJ1 2PHLA 4O9GA 4HVQA 4R4ZA 5C4WB 3MICA 3AP6A 2R49A 4FT8A 4RR3A 5BPXA 1BEV2 1QJX1 3SNMA 3VLBB 1WLDA 2YY1A 3CU7A 1QJU1 3WQ1A 4L92A 2O8OA 4YZ2A 4F7ZA 1G9FA 1V6NA 3J8F2 4FTSA 3H3UA 3I59A 4AQTA 3VKLA 3KT1A 3FHIB 2HEVF 1MS1A 3D82A 4N43C 3VKOA 4IEYA 2FZ2A 2ZGQA 5JMCA 2XJTA 4D7YA 4MXWA 2OZJA 4YFZA 2WIIB 1LHUA 4NN0A 1UD1A 3RJRA 3CLPA 1V6LA 4J6GA 5DUXA 1IPKA 1H8TB 1CGPA 5I8SA 5I0TA 4BLJA 2HWE3 2VVEA 2BWAA 4CDWC 4WVMB 1KFXL 2W39A 2XVLA 2WFF1 4Q4Y3 3ZYGA 2OPKA 3ZFFB 5C8WA 3ZYIB 3WHTA 1XRUA 2H6BA 1YUDA 3USUB 3FMGA 3PVEA 1CAXB 2UURA 1AVBA 3IMNA 3I7DA 1ASJ1 2HWF2 4XEZA 5CA6A 1JTZX 2DCTA 3WZ1A 4OVEA 2DVGA 3CEWA 3RWNA 3KMHA 2Z5WA 3AYAA 3ZFEA 4LHNA 1O5UA 4OI2A 4WM8B 1QY4A 4GH4C 1ZRDA 5E16A 4K8FA 4UW5A 4Q0VA 1MS4A 1YO8A 5H9PA 3ETQA 3MIBA 3GBWA 2GSYA 2QKDA 5GLVA 4JGYA 4OLLA 1OPMA 1SACA 3VHPA 3SMHA 3POYA 2WZR3 4FXGB 1Z0HA 4LLOA 3HN1A 1ONAA 4ORFA 5DDJ2 1JUHA 1DYPA 3U4XA 1ZRCA 2ZABA 4C1WA 4SBVA 1X8EA 5JVVA 4JRLA 2D5FA 1HV0A 1RUH3 3WQ7A 1FPN1 2VOKA 3E5QA 1WGPA 4BIOA 5LK5A 1W0OA 4PDWA 4FOYA 1AYN1 3ZXDA 3SISA 4LBJA 1WW7A 4IEZA 4RFT0 5JWPA 1OA3A 1H30A 2ZZJA 1PZ7A 1WBLA 4AVSA 1EAH3 4YVSA 5JI7A 3VBHB 1VRH1 2X8KA 1M06G 4MH0E 3AMHA 4TLFA 4XYXA 1W2UA 1PIV1 3OYWB 1QDCA 4SLIA 5D1IA 2D3SA 1AXKA 3VBFC 3B00A 1YJLA 3WDVA 4JDOA 1ZBE2 1ZBA3 4EWEA 5J37A 4XETA 3N7JA 1FI2A 2FZ1A 4JCKA 4Q4W3 3RI9A 1N3OA 1DGLA 1CAWB 2XJVA 4N90A 1UL9A 4XFGA 4WM7C 1RUI2 2B39A 4XTPA 4E2GA 1FX5A 3ILNA 1H2KA 1V00A 4LHLA 4EJRA 2VUAA 5IUQA 2AYHA 5JOYA 5JI9A 1AR62 4AVBA 5KXEA 1UIJA 4MZUA 1NA1B 3ZSEA 4D69A 3NVCA 5DUVA 1V6JA 2WINB 5GZFA 1JXNA 2ZGMA 1W6OB 4NR1A 3IN9A 4I3GA 1VALA 3T1LA 1AR63 1YJKA 3ZN6B 2K0GA 2ZGNA 4QPIC 1RHI1 2R072 1RUF2 2IZWA 3M3IA 4YG3A 1QJU2 2E7QA 2BW8A 5BNNA 2OUHA 4EN0A 1MZ6A 2VU9A 4QPGB 1XNCA 1ND2C 3BALA 4ES9A 3RJ2X 1RVF1 3MPBA 4B4QA 4YVSB 3CL1A 3ELNA 3N7LA 4AFBA 5FPZA 5AFBA 5FOBB 4FCAA 4E27A 2E63A 2A7AA 5CFDC 3VBFA 4OUMA 3R0RA 4OHZA 4DMIA 1WMFA 1RVF3 4HKWA 1HV1A 4XQ4A 1A78A 2DU1A 3O0XA 1XE7A 1LRHA 1PGSA 4K3UA 2WNVA 2N7GA 1X7NA 1MS0A 5T5PA 1NXMA 1OOPA 4RSUA 4OZXA 2Q1ZB 1N47A 1QKQA 4PIZA 4N7IA 4M3CA 1SBEA 2R32A 2ZGTA 3JZVA 2XKOA 3RG0A 1I3HA 1QOTA 4EN9B 3WG4A 5J98B 1AR71 1NQDA 1COV1 4A2UA 5KHJA 1VBD1 1BCXA 4YG6A 3TN92 3N4MA 4KH9A 1EV12 4GB33 2DF7A 1PO21 2R042 1YHFA 3V65A 1QQP2 1WBFA 3AYCA 3DV8A 3JUUA 2MPFA 4URTA 1MVEA 4FPCA 1Q43A 3ALQA 3B02A 2IXIA 2VG9A 2E7TA 3OBTA 2WJSA 4WM7B 4W6XA 1A3KA 1ZZ6A 1UKGA 4CDUA 3ZPYA 1GKBA 3VBOA 2VW0A 2UY8A 2ZX3A 3UJOA 5HXVA 3D8CA 3SH5A 2XJQA 4IQPA 1RUE3 5EXOA 1QDOA 1YFYA 1ULGA 4AEDC 1LOBA 4P5HA 1GQGA 1XQNA 2WSUA 4CEWA 4QGLA 3RMYA 4AGRA 5SV5A 4CDWA 2PTMA 4AFMA 3ZYJB 2DU0A 5J3UA 2A3WA 1OFNA 4HK9A 4Q0SA 1X82A 2BFUS 1G9DA 1LECA 5JSPA 4AHXA 3KCXA 2XG3A 3O12A 5E89A 1ND3A 2KXLA 4ISRA 4NWVA 1Q8VA 5DUUA 1O7FA 3ENRA 3S30A 3DPRB 5FCCA 3EO6A 1CD3G 3W58A 5CFDB 1S1AA 3VGIA 3ZSMA 4AI3A 4HN0A 4AEDB 5KHKA 4QM8A 1ZRFA 1MR5A 3OTFA 1GFF2 1RL3A 1AX1A 5FPXA 4LHKA 3VUOA 1C8M2 2V73A 1FOD1 3NV3A 3WG3A 2IXLA 1W6NA 2YC0A 4QGNA 1EPZA 2YHJA 2ZAHA 1SLIA 1WCDJ 5C8CC 1A8DA 2ZKLA 3ZIWA 2GC2A 1TMF2 5FREA 1PMIA 4XFBA 3WDTA 5JPMB 1VBB1 1CAWA 1GV9A 3OPZA 1LENA 1PO22 2R062 4LBLA 4Y26A 2W08A 1TNRA 1AJKA 2ENRA 2ZGSA 3MLLA 4M3CE 4PLNA 4E4ZA 3WDWA 3VHRA 1VBB3 4EWAA 1H2MA 2YGMA 1N1VA 3C3VA 1MZFA 4LA3A 5BNOA 4V1PA 3FBMA 1RJ7A 2CL2A 3HT1A 2RR11 1G86A 5IT6A 3B01A 4IV3B 4QQ2A 2XBO1 4LBMA 2YUEA 3APBA 4KWKA 2DUQA 1QJY1 5DZFA 3M1HA 3I4IA 2ZGKA 1MQTC 3ZX7A 5FOJB 4AQSA 1H9PA 5T5OA 1RUD2 4MLOA 2BVVA 5AVAA 4AG4A 4KWJA 4XF3A 4XOGA 3VKNA 3VV1A 2JX9A 3FX3A 1URXA 4CDXB 5GLTA 1KXGA 2WL1A 3WP4A 4BMEA 2IWGB 4GA9A 3OJBA 4HMZA 1ULEA 1CPMA 1JOJA 3UV9A 4FPEA 5KHGA 3CJXA 4HKLA 2Q8OA 3R05A 1MQTB 2RHPA 1K5MB 4Z92B 2SBAA 1IS5A 3RDIA 4UBGA 2HWB2 1Y43B 4NHLA 1N1TA 3J8F1 1RHI2 4DS0A 2HYKA 4PLOA 2ZMLA 3B7MA 2TUNA 4RL7A 2O1QA 3ROUA 1KITA 4MUVA 4GWMA 1BKZA 3E5UA 2D6MA 1YIFA 4NOTA 3VBSB 5JOXA 1S0DA 1JN2P 3M7AA 2HJIA 3GZTB 3ZFFA 2ZGPA 1MZ5A 3WX5A 3AP9A 3BTAA 4KGQA 1K5MC 1UU4A 2GMMA 1GNZA 4G9SB 2A6XA 1RUI1 1LULA 3ES4A 3LWCA 4Y1ZA 1Y7BA 3I59B 3VKMA 4R52A 1CQ9A 1EP0A 4AEKA 2ZGRA 3TOJA 5ABJA 3ZN5A 3KD4A 5LK7B 4N43B 1PGW1 2JKBA 4YLZA 3AZYA 4JVAA 1HDKA 4LA2A 1CAVB 4AFDA 2YDEA 2JDZA 4QPIB 4HETA 2GC0A 4FPLA 2WZPP 2RS13 4Y1XA 1COV3 2O8QA 2QZ3A 1YWKA 3VBHA 3H9AA 1DG6A 1G6NA 2R1BA 3PMSA 5I0UA 2QZ2A 3VBRB 4Q4X2 3UJQA 3VBHC 1DQ1A 1QH6A 4O9EA 3EQEA 3N3HA 5KXDA 5C6CA 4L11A 1XYPA 5K8SA 1H4HA 1RUC2 1YFUA 2RS33 4IERA 2D40A 1GBGA 3C2UA 3L2YA 2V5YA 1SLCA 2DWRA 1ENSA 1GICA 4P9WA 1BYHA 1IS4A 1DQ2A 1V6MA 3JD72 4FQZA 4H55A 1W6QB 2D93A 2AUYA 4LBKA 5EV7A 3WUDA 4BA6A 2K2SA 4Z07A 3E97A 1WW6A 3D0JA 1R1ZA 1JW6A 4YG0A 4P9IA 1BEV1 4Y22A 3MIHA 3M3QA 5EYYA 3BOPA 4IEXA 1GQHA 4RR3C 3RYRA 2RS51 1RMU2 2IXHA 5EFUA 2PAEA 2XJUA 4IV3A 2RMU3 3MF9A 4YGBA 1R1A3 4W6YA 4KG0A 3RQ0A 3WOGA 2YGLA 2VVFA 3G7DA 1NCQA 3AYDA 3VZMA 2ARBA 5ACA1 2UWBA 3AP5A 4XQDA 3AM2A 4BH9A 2RMU2 4FPKA 3EJKA 2RR12 2DVAA 2EA7A 4CDQC 3NAPB 1FMD2 5CG8A 1W6OA 3GBFA 3E6CC 1GZWB 1BBT3 2D6PA 2QE3A 1GYKA 2A5ZA 4RS5B 3J4UH 1LHWA 2KA3A 2DCZA 5AVPA 4MGIE 4NVPA 5J36A 4EN6B 4IV1B 5GM0A 2P2KA 3HT2A 3ZSJA 3S0MA 2BBVA 3MF6A 4FPGA 4Q1RA 4OUSA 3BCWA 3VBOB 1VR3A 4RQPB 4I3PA 1TMF1 2Z2SB 2WNVC 4EROA 2JE9A 4P9GA 1AL21 1FPN2 4EN7B 1W6QA 1CESA 4XE9A 2E51A 1NCRB 1CX4A 1S0IA 4Q0UA 4I30A 2UYAA 3I54A 3JB4C 1EAH1 5DG1A 1YIPA 1NQJA 1SDWA 3T1MA 1RUG1 2WNVB 1CONA 3KT7A 3NKGA 3B9CA 1PZ9A 5AC91 2A6ZA 5BYNA 4BCUA 3ZXGA 1PNFA 3SH4A 4C91A 3KZ4C 2QUOA 3AXDA 4BE3A 4QQHA 3VDDB 1RUG3 2CGNA 2WZR2 1QHDA 3TAYA 3ZXLA 4KU7A 1W6PB 3CJIB 5A32B 4LBQD 2FHRA 4AEDA 1F8VA 3IPVB 1LKNA 2XJRA 1ZVFA 3H0OA 2ZGOA 4FSJA 1ND2A 4B8EA 4AFAA 3N35A 4COWA 4MGYE 2QDRA 3HWJA 1PVC1 1PNGA 2PHUA 1SCRA 1BZWA 2PYTA 2CAVA 4WM8C 1UAIA 2B46X 4QPYA 5BY5A 2BGCA 4CP1A 1WW5A 2DV9A 2AGSA 5L7OB 3JB8A 2ZTNA 1FV3A 1XNKA 1ZBA2 3KLSA 5E8AA 3HQXA 1EV11 3H1WA 4I02A 2HWC2 3LSDA 3QOPA 4KBBA 3Q9OA 1C3HA 1KD7A 4Y22B 5I0RA 4LE3A 5FMOL 3SHRA 2RS12 2VXRA 1W0PA 2EALA 1PK6C 1U12A 1OSGA 1TME2 4PDWC 3GHMA 3S7IA 4MXWB 5GZDA 1QMJA 4TWTA 3WDYA 2DCKA 3L9JT 1CAXA 1S0GA 3B9IA 1UMZA 2FMDA 4XFCA 2XLAA 3ZFGB 2CY6A 5C8CB 1UN1A 2D98A 3O0WA 2CAUA 4BZ4A 4TSVA 4K1ZA 4S2FA 3SCHA 1AUYA 5J7MA 4FTEA 4FOWA 4NWWA 3RYKA 1QJU3