1TMF3

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
232
structure length
232
Chain Sequence
b'SPIPVTVREHKGCFYSTNPDTTVPIYGKTISTPSDYMCGEFSDLLELCKLPTFLGNPNTNNKRYPYFSATNSVPATSMVDYQVALSCSCMANSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFLIAYTPPGAGKPTTRDQAMQSTYAIWDLGLNSSFNFTAPFISPTHYRQTSYTSPTITSVDGWVTVWQLTPLTYPSGTPTNSDILTLVSAGDDFTLRMPISPTKWVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
molecule tags Virus
total genus 17
structure length 232
sequence length 232
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf300
1H8TB 2RS53 1R1A2 5BNOC 1RUG3 3S6PA 1ND3B 2MEV3 1C8M2 1R1A1 2BFUS 5CFDB 3JBG3 4PDWA 1AYM1 1D4M3 1C8M1 5FMOL 4RHV2 1AR82 1RVF3 4RQPA 1AL0G 1RUJ3 3VBRA 1HXS2 4RHV1 1AR81 5BNOA 1NG0A 3TN92 4IV3B 3CJIB 1VBE3 3ZXAC 2BPA2 1VAKA 5AC92 1HXS1 2XPJA 1QJY3 4NWVA 4RFT0 3VDDC 5AC91 2R042 1AR62 4CEYB 5BNNB 1MQTC 2WFF2 1HRI1 4JGYB 4WM7C 1BBT2 3JB4C 5ABJC 1RUD3 3VBHC 1VB4A 1A6CA 2WFF1 4CDXA 5C9AC 1QJZA 1POV1 5C8CC 1BBT1 3VBUC 1RUH3 2MEV2 4YVWB 5A32A 2RMU3 2DF7A 4WM7A 1B35A 1RVF2 4GH4C 1NOVA 3VBHA 1RUJ2 2RR12 5C8CA 3DPRB 1VBE2 4Q4W3 2RR11 4GMP1 1W39A 1QJY2 5ACA3 1COV3 3JB8A 2BFUL 1QJX3 3VDDB 1PIV3 1K5MA 3LOBA 3HAGA 1MQTB 3NAPB 4Q4X1 1PO11 4FTSA 1BEV1 4YVSB 1RUD2 4GB33 5ABJB 4JGZB 1VB2A 1CJDA 2XBO2 5C9AB 1RUH2 1AL22 4N53A 3VBUB 1H8TA 4Q4V3 2XBO1 2RMU2 3ZFGC 1ND3A 1AL21 2R073 4IV3C 5K0UB 5CFDA 2FZ2A 2WZR1 4GH4B 2RMU1 1HRV1 1Z7S3 3M8LA 1NY71 1FMD1 1TMF3 4CEYC 1RUC1 4QPIC 2RS33 1RMU1 4Q4W2 2WLPA 1COV2 4IV3A 3CJIA 2RM22 1QJX2 3VBSC 1ZBA2 1PIV2 2QQPA 1PO23 1VBB1 2RM21 1QJX1 4YVWC 3VBFC 1ZBA1 5D8AC 4CEYA 2X5IC 5BNNA 4GB32 4JGYA 2RS13 1QQP3 1RHI2 2FZ1A 2PLV3 4N43B 2GH8A 4Z92B 3IDEA 1CD3G 1MEC3 4CDWC 2HWC2 4WM8B 5CFCC 1NA1B 1RHI1 1RUE2 4Q4V2 1AYN3 3DPRC 1EV12 4YVWA 2HWC1 3ZFGB 1VBC2 1RUE1 4Q4V1 1AR93 1EV11 1Z7S2 1VBD3 2WS93 3TN91 1VBC1 1TMF2 1DDLA 1VBA2 3ZFEC 1OOPB 2HWD3 5C4WC 1FPN3 2RS32 4QPIB 4SBVA 3NAPC 1TMF1 3DPRA 1VBA1 4Y4YA 4EJRA 1ASJ2 1AR61 1QJU2 2R041 1NCRB 4YVSC 4JGZC 2HWB2 3VBSB 1ZBE3 2RS52 1ASJ1 1QJU1 2HWB1 1RUG2 3VDDA 3VBFB 5LK7B 2R063 1VRH3 2RS51 5D8AB 2Y26A 2X5IB 3J8F3 2RS12 1MQTA 3NAPA 3JBG2 1RUG1 2IZWA 5K0UC 2MEV1 2TBVA 1D4M2 1FOD3 4YVSA 5ABJA 4JGZA 4CDWB 1ND2B 5CFCB 3JBG1 1AUYA 4CDUB 5C9AA 1BMV2 1D4M1 1AYN2 1RVF1 3VBUA 1RUJ1 5L7OB 1BMV1 1AR73 4CDQB 1AR92 1AYN1 2WS92 5K0UA 1VBE1 4QPGB 1PGL2 1PVC3 4GH4A 3ZFEB 5DDJ3 1QJY1 1FPN2 2WS91 1R083 5C4WB 2HWF3 1PGL1 1NCQB 1FPN1 4N43C 4Q4Y3 1ZBE2 1R093 4RR3B 4WM8C 2BBVA 1NA1C 1RUD1 2R062 1VRH2 3VBOC 1X36A 1RUH1 1FOD2 4CEWB 1AYM3 1E57A 1EAH3 1VRH1 5J98B 4N43A 4IV1C 1OOPC 4WM8A 1NA1A 4RHV3 1AR83 4AEDC 1AR72 5JZGB 5ACA2 3ZFGA 1NCRC 1PVC2 4Q4W1 5DDJ2 5ACA1 4FTBA 1COV1 1R082 1IHMA 1SMVA 3FBMA 1OOPA 2WWSA 1PIV1 1HRI3 5DDJ1 4QPIA 1R081 4Q4Y2 1R092 1NCRA 4PDWC 2WFF3 1ND2C 3VBSA 4GB31 1POV3 5J96B 1BBT3 1R091 4CDUC 4RQPC 3VBOB 3VBFA 3VBRC 1PGW2 2R072 5L7OC 5D8AA 1AYM2 1EAH2 2X5IA 4CDQC 1OHFA 1PGW1 2R071 4QPGC 3ZFFB 3JD73 4IV1B 5BNPB 1EAH1 4CDWA 1ND2A 5CFCA 4CDUA 1RUI3 1Z7S1 4RS5C 1F2NA 4AEDB 4FTEA 5FOJB 1NCQC 2RR13 4GMP3 5L7OA 2RS31 5A33B 4CDQA 4RR3C 1PO22 4CDXC 4QPGA 3ZFEA 1HRI2 2BUKA 5C4WA 1PO21 4RS5A 4Q4X3 1PO13 1QQP2 2PLV2 2ZTNA 1BEV3 2ZZQA 4CEWC 1F8VA 1NCQA 1C8NA 1MEC2 1TME3 4PDWB 1B35C 2RS11 1QQP1 2PLV1 4RR3A 4RQPB 1MEC1 4BCUA 1OPOA 2XBO3 3VBRB 5BNOB 1AL23 5JZGC 1POV0 1M06G 1VBD2 2WZR3 4CEWA 1HRV3 3JD72 1RB8G 1FMD3 4FSJA 2HWD2 1AR91 1RUF3 2GSYA 1RUI2 1VBD1 1V9U3 4RS5B 3JD71 1RUC3 1K5MC 1RMU3 2HWD1 1RUI1 4NWWA 5JZGA 5FMOS 2HWE3 4CDXB 1VBB3 4GMP0 2RM23 1HX6A 1ZBE1 2ZAHA 1ZBA3 4N53C 4Q4X2 1GFF2 1H8TC 3J8F2 1PO12 4LLFA 1R1A3 1BEV2 5A32B 1ND3C 2R061 1TME2 1WCDJ 1C8M3 3J8F1 4WM7B 1B35B 5CFDC 3ZFFC 5BNPC 1RHI3 1FOD1 3VBHB 1TME1 1HQNA 4Y5Z0 2HWC3 3VBOA 5C8CB 1RUE3 2WZR2 1HXS3 1HRV2 1EV13 3TN93 1NY72 1VBC3 1FMD2 1AR71 3CJIC 1RUF2 3ZFFA 5AC93 4IV1A 5BNPA 1V9U2 1X33A 1RUC2 2HWF2 1RMU2 1PVC1 1K5MB 1RUF1 1VBA3 4AEDA 1AR63 2R043 1V9U1 5BNNC 2HWF1 2VQ0A 4JGYC 2HWE2 5A33A 1ASJ3 1QJU3 4Q4Y1 1VBB2 5GKAC 2HWB3 4N53B 2HWE1
chains in the Genus database with same CATH superfamily
1H8TB 1R1A2 2ZX4A 4XF1A 3VV1A 2NQYA 4PF5A 1DYKA 5FYBA 4HVQA 1QOOA 1QY4A 3NNFA 3Q8BA 2MEV3 3ES1A 5FUIA 1ZZCA 1JYIA 1QXPA 1OH4A 5LK5A 3LSDA 3RI8A 3VDAA 5CFDB 2E26A 3JBG3 3IAPA 1VLNA 4UI9L 3BTYA 3FLRA 1LGCA 4LOSA 1D4M3 1C8M1 1WMFA 5FMOL 2BGCA 3GZUC 4UFIA 1UCXA 2ZGPA 5GZFA 2GNTA 5IVYA 3C7GA 3JQWA 3MW4A 4ISQA 3RWNA 5C71A 4XHXA 4RHV1 4PI2A 1AR81 5BNOA 2G19A 2WNUB 1NG0A 5FBJA 4ZZ5A 4K21A 2ZZJA 1FX5A 5C3QA 4TYSA 3POYA 4AAXA 4CPBD 5AFEA 3CJIB 2RJKA 3ZXAC 1YEWA 2BPA2 1KEXA 2J1EA 4DUVA 2Q1FA 4MLOA 4W8JA 1A34A 4NE9A 2V73A 3RS6A 1J84A 1IS4A 3U14A 5A6ZA 4M4RA 1OSGA 2R042 4XAAA 5A3LA 3VGIA 3IDCB 3W5NA 4JRLA 3WQ1A 2LM3A 4OMCA 5FZ6A 2WBKA 4UFMA 1V6JA 3JB4C 2IXJA 4OHXA 1NZCA 1KJRA 2SLIA 4AOCA 1EY2A 1PMJX 4CDXA 4GWIA 3CMGA 4OQ8A 1O4TA 1VMJA 1BBT1 2VCAA 2NZ9A 3A22A 3VZNA 5J3UA 1YI9A 1CZTA 2A6WA 2IXKA 1QXJA 2OA2A 3WD5A 3O1PA 2Q1MA 2FQPA 3AJYA 5JCTA 1JHJA 1RVF2 2EIEA 1S0DA 3D0JA 4GH4C 1G9BA 3HVDA 1OLRA 3NNJA 4LORA 2HBUA 3HN1A 5EJZB 3NVCA 5KXBA 3MIEA 2X8KA 1WD3A 2VUDA 4Q26A 3T1MA 1SLTA 3IKWA 2ATFA 2FCTA 3T1LA 4RN5A 1KRIA 1DQ2A 3OGGA 3GBFA 1O59A 1C5HA 2RR11 1W39A 1QJY2 1OKOA 1UO9A 5ACA3 1UF2C 3OPTA 3BOWA 3U75A 2GMPA 3WQ0A 2W2IA 2FDHA 3NQHA 4M0NA 4P9YA 4CCNA 1NQJA 5A7QA 3ACGA 4KWKA 4AGVA 3VKOA 4P02B 3TBDA 3QH7A 3NAPB 5GZEA 3FN9A 3WDYA 1HN0A 1PMHX 3CLPA 2VY0A 3A0KA 4GB33 3ZDSA 2VZ1A 3AKTA 1CJDA 1RXFA 2XBO2 1WLDA 2Y8KA 3POFA 2VTFA 4GWNA 1IQAA 1PK6B 1VAMA 4L2NA 4XFHA 2XVLA 3BGAA 4E8DA 4AQ2A 3DEMA 3N9PA 3GHMA 3HBZA 2XQRA 1O5UA 1W8OA 4LO4B 1H4GA 1AL21 2RDSA 3DV8A 4W6XA 3NJVA 3LDBA 3WXPA 5K0UB 5HCBA 5F5IA 3ZSJA 2WZR1 2RMU1 4WBBA 1Z7S3 1CIWA 3H1MA 2WN3A 4KQ7A 1BK0A 1TMF3 5JPMB 3B9IA 4CTEA 3A4UA 3S57A 4LO8A 5A80A 1RMU1 1ULPA 1RITA 2O8OA 4META 1H1IA 1W6PB 2VZTA 3CDZB 3NRUA 5SV5A 3KQRA 5DUUA 4IV3A 3VKMA 3HBKA 4KNCA 1ZBA2 1PIV2 5GLUA 1OQ1A 2GALA 4U36A 4CXWA 1VBB1 1W8HA 3OBAA 3VKNA 3VBFC 5IW0A 4UAPA 5T5OA 5FY4A 2XLAA 1XE0A 2YY1A 4I02A 2J1VA 2X5IC 5FYIA 3ZXDA 1Z0HA 2FMDA 3POIA 2HEVF 2CV6A 2NLRA 2OUJA 1DZQA 1BK1A 1QQP3 4IEXA 4JGYA 5FK8A 3VKFC 4PT6A 4MGTA 3WNLA 2D7FA 4LPLA 4UWDA 4AI0A 2JB4A 4MXWB 5FLIA 4M3CE 1GZTA 1R1ZA 2QVSB 3ILFA 1RHI1 3PUIA 3WDTA 4AW7A 3TYJA 5DN2A 5FQ0A 1SPPA 2H0VA 5HI0A 4FOQA 4YG6A 4YVWA 4EN9B 2HWC1 1F4HA 4BHPA 4DMIA 1O8PA 3WDXA 2VZQA 3MHZA 1W6QA 1CPNA 5FR3A 4KBZA 1W9WA 2DWRA 5G05L 1VBC1 3AMPA 1RIRA 1CAVA 3AXDA 4FFIA 4MV2A 4UW5A 1RXGA 4V2VA 1VBA2 2WYFA 3I2OA 1OOPB 2WABA 4OUMA 3HEIA 1XNAA 4XFCA 5K8SA 5J1XA 4QPIB 3UNPA 4SBVA 3KT1A 5FJKA 4P9IA 4J6GA 2VZVA 3PHMA 3A0NA 1LU1A 5DAXA 2W39A 5DABA 4BM8A 2D44A 3ZMOA 1IPSA 5IVFA 1PHMA 4YVSC 2I07B 5C3PA 1LOCA 1H30A 3NMBA 3VBSB 1JZ6A 5IK5A 2W1SA 4LHLA 1W9YA 1CESA 5DMYA 3ZLIA 1QJU1 2PAEA 4FPFA 4Q0QA 4IERA 2HWB1 2C26A 2VZPA 2FCUA 5J48A 1O7FA 3DGTA 1GLHA 1UKRA 2BERA 2JWPA 2Y26A 2W1UA 5CIRA 4QQOA 3BUCA 4Y3OA 3JBG2 4DXRA 2R6QA 1RUG1 1W06A 2GZWA 1D4M2 1GZWB 2JDPA 3GGLA 1LHWA 1O5LA 2YC4A 2FD8A 3WF2A 4JGZA 1ND2B 1W9SA 3KF3A 1N1SA 4BQ4A 1BMV2 1NLRA 2QKDA 3OYWA 4AVBA 2CSGA 2CU5A 3AK0A 1W6OA 1W8TA 1YQ8A 1LHUA 3H42B 1JYNA 3THTA 2Z4FA 1RUNA 3MDPA 3OBRA 3J9SA 1VBE1 2J1SA 1PGL2 4GH4A 5LRSA 2VUJA 1HB3A 2P37A 4JKMA 1FPN2 4BYYA 5A3UA 2OZJA 3RDIA 2WS91 3O7OA 4HG6B 1WCKA 1VR3A 1HN1A 2YFZA 1C57A 4QKNA 3S30A 3ZYJB 1QDOA 1QIQA 1GNHA 3ZR5A 2CGPA 5H9PA 1ENQA 3I3EA 5IAXA 1OXCA 3LDRA 4Q4Y3 5JWPA 4MGYE 3TAYA 1S55A 3SKJE 4Y20A 2W1WA 1Y9MA 2V5YA 1F5FA 4RR3B 2W5FA 1NA1C 2RJ2A 4B8EA 1QOSA 1EPWA 1RUD1 3E6BA 5CU1A 4BU2A 1OT5A 2V4AA 2WINB 4FXGB 4XMIA 3VBOC 1NYWA 1X36A 3EYPA 1A3KA 5FZLA 2HH9A 3AJZA 2VH9A 2JDYA 2XJVA 2PMWB 2R32A 1U12A 3E5XA 3VLBB 1XXNA 2VVDA 1C28A 2D6OX 1AYM3 1E57A 1EAH3 1ST8A 1VRH1 2QQKA 2ZGQA 2OPWA 3AKQA 4ZHNA 1S4CA 3WQBA 1AZDA 2R1BA 3WX5A 1DBNA 4IV1C 1FI2A 4OYUA 4AQSA 2ADDA 3LA3A 1I6XA 3UYJA 3F2ZA 4WM8A 2F4PA 2DVDA 2AENA 4XVHA 3QH6A 1WCSA 3K4DA 4TLGA 1SDDB 4AEDC 1DLLA 1ACCA 3DKQA 1IZ3A 1R64A 3R05A 3OGJA 2VBPA 5ACA2 4QB1A 2Y6FA 3BYWA 4FPCA 4P9GA 1YWKA 4XMAA 2W92A 4PLNA 5I0DA 3ZX7A 1SBDA 3MZHA 4YW2A 5DDJ2 2BOIA 5JXIA 4XW3A 3VD3A 1COV1 1R082 1OPMA 1LU2A 2A70A 2C1FA 3ZM8A 1OQDA 1SMVA 1W6MA 2ZEWA 3AZWA 3POBA 1PNGA 1NAEA 5E8AA 4E8CA 3ILRA 1WW5A 1X9TA 2OQ7A 2PAMA 3J7MA 3O1OA 4WVMA 5IVVA 1GOFA 1NCRA 1Q5OA 1W2TA 1YIPA 1YQ6A 2Z2SB 2ZMKA 3HR9A 4JQRA 4P9LA 3VD5A 4FPOB 1S0IA 1POV3 1JZ3A 1W9TA 3ITQA 2WKKA 3PURA 4CDUC 5LA0A 4RQPC 1GWLA 4AF9A 3VL9A 4KBBA 1PM4A 2HJIA 4QX3A 3I59B 5KBFA 1AXZA 3WT3A 5JIAA 3VBFA 3VBRC 1S2KA 2UY8A 4B7KA 1G9DA 5C3SA 3I54A 5C5UA 1QNWA 2X5IA 5EYXA 1D7PM 3BTXA 1OHFA 2D98A 4G3YC 3WW2A 4QDQA 2MHFA 1UU6A 4BISA 4LIVA 2VMDA 3PIJA 4QPGC 3CIHA 3JD73 3CL1A 1W3VA 4FOWA 4N7UA 4YZ1A 4LT5A 4QDRA 3VHRA 2JIJA 1JOJA 1UOFA 4RS5C 2ZA9A 4CCOA 1UIKA 3IBMA 2OW4A 2OVUA 4E4ZA 4KWJA 3HQUA 5FYYA 2FDFA 4GMP3 2VOXA 1DZRA 4MXVA 3RFRA 4COYA 4CDQA 4M3CA 1S2BA 2WNVC 5GJ6A 3S5QA 3AX4A 2VBDA 2D3PA 2XWBB 4WVZA 2WO2A 5I0SA 1KFUL 1RGSA 2YHJA 4NVPA 2DCJA 1W28A 1WA4A 4AZZA 3T2PA 5FZHA 5FZOA 4BMBA 2CAUA 3IMMA 1QQP2 1Q8VA 4ZU5A 4FVVA 5GLTA 1Z78A 2ZX3A 3KHBA 4NR1A 2CHHA 4V1PA 4U2AA 2JG8C 4PDWB 4KMQA 2YC2A 3ALQA 5B4XA 3NO8A 2RS11 2VMIA 5F7UA 5CG9A 2LRPA 4AHZA 1YFWA 3RJRA 1MEC1 4BCUA 4A45A 1PMIA 2H0BA 1EP0A 3AP9A 2IFRA 5A7WB 4C1XA 5EIYB 1E5IA 4AE2A 2P3YA 5EZWA 3DXUA 4P08A 4TSVA 3PU3A 5CKMA 4YNIA 1M06G 1DIWA 1WMDA 1XJAA 2CDPA 2Q8DA 4CEWA 3DUIA 3P3PA 4Q8KA 2FDKA 4E9KA 4R9AA 1O4ZA 4GA9A 2GSYA 4MGZE 1RUI2 1VBD1 2ZGTA 3MFAA 5JMCA 3FC0A 3C7EA 4AAPA 2A6VA 2VXRA 1K5MC 4NPMA 4W65A 5HCFA 2VGDA 5M0TA 2E63A 4WZCA 1QH7A 5JZGA 4LMFA 2VULA 3FL7A 3ZXLA 1ZNPA 3WHUA 2Y6GA 4HONA 3T08A 1JUIA 2BVVA 5FPAA 1UZ0A 2J22A 3ZIWA 4AVTA 2D6NA 2RM23 3ETPA 1GNZA 3LEIA 2YYOA 3FX3A 4IEUA 4LBJA 4N53C 4CXXA 5CG8A 3IM0A 4BQ3A 4LLFA 1R1A3 4QHOA 2XJSA 3AFKA 5FY5A 3WNOA 5JOYA 3DN7A 2RDNA 5A32B 1YFXA 4E4HA 2R061 1WCDJ 3AXEA 2J1AA 3OBZA 4I3PA 4UW4A 2VMFA 5JVVA 3ZFFC 2A75A 3FLPA 4AEMA 4EE2A 1LHVA 2VZRA 1FOD1 2ZGMA 3GBWA 1ULGA 3WG2A 3H3ZA 2EF6A 4Y5Z0 4YM1A 3OTFA 4AVCA 3OEAA 2DFBA 3VBOA 3H3UA 3FHAA 4C1WA 5F39A 5DZEA 4B4QA 2WZR2 3KV5A 3WNMA 4C0BA 1EV13 1XRUA 3AYCA 1GANA 1NZIA 1AR71 2UWBA 2JX9A 2WRAA 4HKWA 1GP4A 4UW6A 3F95A 4IV1A 5F5QA 1X33A 3U10A 4N9HA 5BNPA 1KS4A 4C0HA 1RMU2 4XBLA 4S2FA 1PVC1 4XFGA 2HYKA 3OUJA 4LJHA 3R6SA 1RUF1 2CWSA 4AEDA 2R043 3VZKA 5BV6A 3NV1A 5BNNC 5B4NA 1HJGA 2VOVA 3MBWA 4QQHA 3MIGA 4ES9A 4DS0A 3POEA 2I45A 1ASJ3 4YSFA 1JH5A 1VBB2 2W87A 2YBPA 4H7MA 3RZKA 4IW3A 3O1SA 3LIHA 2JE7A 3EBRA 3FMGA 4URTA 4AEJA 4AGGA 4XUNA 4HLTA 4XFFA 2HWE1 1ULFA 2YZ4A 4FBFA 1HW5A 1A8MA 1Q8QA 2RS53 3MLJA 4Q1PA 2R0HA 4XAEA 4O9GA 5BNOC 3H3LA 3AKPA 1HJFA 3KCYA 1QOTA 3RZGA 3RZLA 2QBXA 2DURA 1ND3B 1OC1A 4KI5M 4NPLA 2BFUS 3WUDA 4BA6A 4GXLA 3LOIA 2KM2A 1CGPA 2DU1A 2ZGLA 1I5PA 3GNEA 3NV3A 3M1HA 1FYUA 3R4UA 4LKFA 4YW5A 1RVF3 4AI9A 4ATEA 2GMEA 2QE3A 2ZMLA 2JEMA 4RQPA 4Y1VA 4ASLA 1HQLA 2VMCA 3WR0A 4HT1T 4KH9A 3SCFA 3VBRA 4NHYA 5T54A 3WY6A 4LBKA 4CCCA 2BTVC 4Z07A 1XYOA 2D97A 5CVRA 4MADA 1HXS1 1QJY3 2PHXA 4NWVA 1U5XA 4EWDA 4LO6B 1UXXX 1XU1A 4RFT0 5A1FA 3VDDC 1RC6A 2AZ5A 4COWA 5AC91 2DDUA 4ASMB 1UYXA 2I2SA 4CCEA 4L0PA 3VZMA 2A73B 3W5MA 1MQTC 4ZONA 4ARXA 1SDWA 2WO1A 2XOMA 1HRI1 4LA2A 1BHGA 4QQPA 4UBHA 4A7ZA 4EN0A 3FFQA 2Z5WA 4FI9A 5E16A 5T50A 3AZZA 3MIFA 5ABJC 2WNVA 3I97A 3LZZA 3RG0A 2GP5A 4HMZA 2BZDA 2BV4A 1A6CA 2WFF1 4BWOA 1Q8SA 3HWJA 3KS7A 3POJA 5C9AC 3HQXA 3V0AA 1MZ5A 3LCPA 2D40A 3AVSA 4KGGA 4GWMA 1NXD1 2BVBA 4IUGA 3O14A 2Z69A 1ULOA 4QKBA 3OGRA 4LO5B 3AL6A 3Q8FA 1UWWA 2RG4A 5JSPA 2Y6JA 4JRAA 3UKTA 4DFSA 3E6DA 3O5SA 2K0GA 4LBQB 4N7IA 2ARAA 3MIDA 4WM7A 4X6RB 2XONA 1PX4A 3VZJA 1TNRA 4CCLA 5FMCA 1NOVA 4YPJA 3S7EA 3VBHA 2Y64A 1LENA 2EXHA 4TLFA 4LK6A 5F5CA 3IB3A 3T3YA 4MSVA 3AL5A 4YZ2A 4FPJA 1J1LA 3ZR6A 3ILNA 4XF9A 3VDBA 4K8FA 1VBE2 3UETA 4XYXA 3T2QA 1HKDA 4YGEA 1E5HA 2E7QA 4I0AA 2W08A 1NLSA 3JB8A 5DZGA 4Z2AA 4Y22B 4BLJA 2JXAA 1I3HA 4FQZA 4CP2A 2JKXA 4AI2A 4CCMA 4DO0A 3HT1A 1PIV3 5D1IA 1HLCA 4CCKA 1SACA 2P2KA 2ZKNA 4C91A 3SLIA 3NJXA 1K5MA 2W47A 1MZ6A 1I5ZA 2Y33A 1NT0A 1YXWA 2TEPA 4OULA 4YM0A 4DY3A 1SHWB 2BOJA 4RGGA 4Q4X1 4XZPA 5CBLA 1PO11 3WUCA 2Y0IA 1BEV1 4JTOA 1RUD2 4YVSB 1OVSA 1W03A 1VB2A 4J25A 3IPVA 1UD1A 4WVVA 4CCDA 1C1FA 2E53A 5LY1A 5GZDA 4N53A 5SV8A 3VBUB 3ATGA 2QQWA 1KJLA 3PLQA 4SLIA 4AQTA 2WT0A 5LEKA 1Y9GA 3LA7A 2Z79A 3ZFGC 4IV3C 4P5HA 4LIUA 1JW6A 4QU2A 3ZSEA 1DHKB 2H6BA 2FZ2A 1HRV1 4YZ5A 1J3QA 2BJSA 2JDNA 2V5DA 2R49A 2F17A 4Z2WA 4X8NA 4UFLA 3PUQA 2ZX0A 2VBBA 5J36A 2UURA 3ZXFA 4EWEA 3AMMA 3I2DA 3M3OA 2E7AA 2BNOA 2WLPA 5FUNA 2PHLA 4Y4RA 1COV2 1W8FA 4YFWA 4MHUA 2RM22 1QJX2 3W59A 2BDRA 1PGSA 1K3IA 4GQ7A 5FYSA 1QU0A 2QQPA 5FO8B 1ODMA 1SFYA 3SCHA 1SFNA 4XUTA 4YVWC 4XURA 2K46A 4NRMA 4A4AA 2JDAA 4CEYA 5KHJA 5GZCA 5BNNA 1YFUA 1LJ7A 5KC5A 5EHDA 1CQ9A 4CP9A 1Y4WA 3M3QA 5EJ3A 1CD3G 4Z8BA 2ZX1A 4CDWC 2PHUA 1NA1B 1WMEA 4Q4V2 3WV6A 1UPSA 2QDNA 3AC0A 1POQA 2G9FA 4JCKA 3AM2A 1EV12 1MS4A 5LWBA 2ZABA 3M3CA 2BP6A 1ZVFA 4L8QA 2OYZA 1RUE1 1AJKA 2CTVA 4XZUG 5BXXA 4QQ2A 5I91A 4OUSA 4B1MA 4CU6A 3KSCA 1CR7A 2PELA 3OPWA 2W46A 3ZO0B 4RGKA 3ACFA 2DVBA 3LSEA 5DPNA 1GWMA 5E89A 1GZCA 5FY7A 4P14A 4NIIA 3ZFEC 3ZXEA 4F8AA 1ENRA 2HWD3 5C4WC 2VECA 1FPN3 2ZGNA 5IK7A 5DUVA 4QD2A 1UAIA 2KR2A 4BMEA 5KXCA 5A6YA 5IUQA 1F9KA 1TMF1 3DPRA 3VDCA 5A1AA 2FCVA 3LIGA 1ASJ2 1AR61 1JBCA 2WT2A 2XLFA 4OI0A 1RJ8A 1U5ZA 4JGZC 1QJFA 4XCAA 2WC2A 1MVEA 3AZXA 2Y0OA 4DXSA 2PA7A 1H8VA 2RS52 3I2JA 3UGGA 4QB6A 4D3WA 1JYWA 1CWPA 3CF6E 3VDDA 2JD4A 2XL9A 4MGSA 5IVEA 3VD4A 2WNEA 5D8AB 1Q8OA 2ZGRA 4P5YA 4UFKA 1JZ8A 2RS12 1MQTA 3O1RA 4M00A 2Q5TA 3NSTA 2IZWA 2O0OA 3BALA 4P9XA 4Q1RA 2TBVA 2PHFA 2TUNA 5FZ1A 5T5LA 3VD7A 4DQAA 1TQ5A 4KU7A 5ABJA 1Q3EA 5LA1A 4DUWA 1LB2A 5CFCB 2VE1A 1BCXA 4FQ4A 4GALA 1AUYA 1SCRA 1RUOA 4CDUB 5C9AA 4CUGA 4FAHA 5IFTA 3UK9A 1AYN2 1BJQA 3RYRA 3IDAA 2WUHA 1DGWX 4XJ9A 1RUJ1 1EYBA 3ZN6A 2VOWA 2ZGKA 3PVEA 4PIXA 1WKYA 3SNMA 4ZKTB 1WUVA 3T2OA 1JS9A 1BKZA 1SLIA 2PHRA 5DAVA 5DUWA 3TNPB 1TNFA 3BI3A 2ZX2A 1CPMA 1GNYA 5CAZA 2ZEYA 4QPGB 1CAUB 4FFFA 4JX0A 4NMIA 2XL7A 5DDJ3 1URXA 1OQEA 3WG1A 1H4HA 1GU3A 1R083 1V6LA 2C9AA 2ZACA 2ZJCA 4QHZA 5T55A 3KLSA 3ZPYA 2HWF3 1KDKA 4TXWA 1NX9A 5LZ6A 1JOBA 1LEMA 5KHIA 4R52A 2ZXQA 3ZYHA 3WP6A 1ZREA 4YARA 1UOGA 1U5YA 4QX5A 3J7NA 4FP3A 1EPZA 1H6YA 4FXKB 3NV2A 2VZSA 5T52A 2RJLA 4LBLA 1LOFC 5L36A 4WM8C 3S5AA 1N3OA 2BBVA 1WMXA 1VE0A 3HNMA 2QQUA 3N9LA 2PHDA 1Q43A 3GZTB 4DB5A 4BIOA 3LGRA 1DQ1A 2R062 3PMSA 3OY8A 4AFAA 5HXMA 5IVBA 3H8RA 1RUH1 2YV8A 3I2KA 4XEZA 1FOD2 1W2OA 5J98B 4N43A 4AFDA 2JG8B 1GP5A 5F3IA 2VZUA 2X05A 1UXZA 4INDA 3WEZA 3R4SA 1OFNA 1CAWB 3MPBA 3BOPA 4DUXA 1IOAA 2JG9C 5FY1A 4AFBA 3MV11 4QHBA 4A7YA 5C7GA 1MPXA 2GC3A 4NN0A 1AR83 4RHV3 5FZCA 1AR72 2W9XA 1XU2A 3H9AA 3PMEA 3ZFGA 1RL3A 2UYAA 1NCRC 4GKXA 3DYOA 4UF0B 1WW7A 1WCQA 5A7PA 3W21A 5CADA 1H1MA 2JDHA 4LE3A 3USUB 2VZ3A 1PVC2 2AUYA 4Q4W1 3VHPA 5EFUA 1UY4A 1W8UA 2AYHA 3IZOA 4QB2A 4Y5TA 4QGNA 3IAQA 1S0GA 3FHQA 2O8QA 1WW6A 4XJZA 1H0BA 2DUPA 4AHWA 5GLZA 3ZYBA 4S2HA 1OD3A 3CNAA 3I7DA 1O8SA 1R092 2VVEA 4QX7A 4HSLA 1OA3A 1YUDA 1C3HA 3WNPA 3CHXA 2ZHKA 1H1AA 1ODNA 4MX3A 5FZDA 4YM3A 1BBT3 3UJOA 4EWAA 3IN9A 4BOWA 1L7RA 3MUZ1 3W58A 3AKRA 1HV0A 1BQPA 1XE8A 3CKHA 4Q0UA 2ZBJA 4Q0SA 1BLZA 3E97A 2PHTA 3NJZA 1IS6A 2C9KA 1S0CA 1XPWA 3M2MA 3V0BA 4CDQC 3I8TA 4MG2A 5FP3A 4NRQA 1LNSA 2D5HA 3ES4A 4LBNA 3TEXA 1PGW1 2R071 3U0ZA 3ZFFB 5FOBB 1EAH1 4AK3A 4CDWA 4YG0A 5H9SA 4A2UA 4QPYA 4ZU7A 1RUI3 4QXKA 1X7NA 1JYVA 1PVXA 1WLCA 1V6NA 4HXCA 4XQWA 1DZTA 5FOJB 2RR13 1S2EA 3K4ZA 2V09A 3APBA 1LULA 2Y6LA 2RS31 3KVAA 5L7OA 2GNBA 5A33B 2YGLA 4F7ZA 2VUAA 3FWEA 3U1XA 3DYPA 5FFOC 4ZS3A 2VCCA 3UV9A 5FPZA 1JXNA 2GC2A 3THCA 1X8MA 3ZFEA 1SQ4A 1HRI2 3AFGA 5C4WA 1FV3A 4R9BA 1PO21 4RFRB 4TWTA 4XXPA 5CA6A 4DINB 2E32A 2YC0A 2ZZQA 4CEWC 1NCQA 2W52A 2YB7A 1REDA 4BB3A 4M4PA 4YGCA 1B35C 2WWUA 4OFGA 2G9ZA 4A3ZA 2PLV1 4KU8A 3ZIXA 4ATFA 3JXSA 3N9QA 5FZIA 3PTYA 4HANA 4H2AA 4HPKA 3EJKA 5CNAA 2FMYA 1XNBA 4IE7A 3B7MA 3AP5A 3M7AA 5BNOB 3ABZA 1AL23 2AEZA 3INAA 5JZGC 2VNGA 4CRQA 3J7LA 4QX2A 3V65A 3LAGA 2DCKA 2WZR3 1SLCA 5FYVA 1JHNA 2ZS6B 2CGOA 3M4FA 4XPVA 4LR4A 2HWD2 1AR91 2ETEA 4D6SA 5HXVA 3P1IA 5GLVA 1ZRFA 3RNSA 3JD71 5L19A 1V6KA 2XDVA 1RMU3 5GLWA 3U37A 3T4VA 1UZZA 5AVPA 4GZ9A 4IL7A 4NWWA 3T0BA 1A78A 1DYOA 3ON7A 2DVFA 5FMOS 4YRDA 1UY3A 1H2LA 4FOYA 4I3GA 3WF4A 3JUUA 4CDXB 3NL1A 5TSWA 3HPNA 1VBB3 4N9IA 4PQ9A 1D2QA 1ZBE1 2PQSA 1ZZ7A 2VC9A 2GN3A 3ME2A 3U4XA 4Q4X2 1GFF2 1H8TC 5FYTA 1PO12 5DAWA 1Y7BA 1W6NA 1YQ5A 2A71A 1BEV2 3K3OA 3N36A 4K9SA 1HB4A 4QKFA 4ARYA 2VVFA 1LGBA 3SH3A 1K5JA 4OUEA 3BIEA 1RINA 1TME2 4D8MA 5A3OA 4FFHA 2OT7A 3J8F1 2EIDA 5CFDC 2XHKA 4NAMA 3O1TA 5BNPC 1DP0A 1F4AA 4IESA 1RHI3 1JODA 2XJTA 4PIZA 5F3CA 1LOFA 2WAAA 5FPVA 1HDKA 1HQNA 1SBFA 5FO7B 2IVIB 2P6CA 3HJRA 1WWYA 4MH0E 1PNFA 4AHYA 1YO8A 2HWC3 3DKWA 3KV9A 3C7OA 5E6HA 1O3TA 1G6NA 3PVBB 4LKDA 5IHRA 1YJKA 4F3JA 4CP1A 1HRV2 2WN2A 4HVRA 3ZKUA 4PBOA 1KDMA 2K2SA 5F6LB 1VBC3 3CJIC 3CJXA 4O7XA 5FLHA 1UY2A 3JZVA 2ILMA 4N90A 1VP6A 1J1TA 1V9U2 3ZPOA 2HWF2 3WF1A 2ADEA 2AGSA 2JG9A 3D4KA 1JMUB 1SLBA 5FZEA 1T2XA 1XNKA 2AR6A 4KWLA 3L2HA 3VUOA 2A7AA 5JOWA 2A6YA 3H1YA 4HETA 3I2GA 4MHRA 1DQ0A 3L9JT 4ONUA 1S0EA 3WNXA 2KD7A 4G9SB 1QJU3 2P3KA 1C5IA 1MS1A 2HWB3 2JB8A 1DG6A 3BTAA 3EMRA 1A8DA 2I74A 2PFWA 4YM2A 2C24A 4NIAA 3OPZA 3THPA 3TEYA 4LA3A 4OHWA 3KMHA 5A7SA 3BVCA 4B7EA 1RUG3 1H2MA 3S6PA 4X8PA 2XH6A 1C8M2 4LE4A 3P5BA 2J42A 1R1A1 3GCXA 4C8DA 2RV9A 4MOAA 2P6HA 1FNYA 4ZPIA 1IG0A 2XKOA 3JCIA 4JKKA 5I8TA 1CX4A 4RHV2 1AR82 3I3DA 4COVA 3WF3A 3HQRA 4ASKA 5C33A 1AL0G 1VALA 2NYYA 2E9QA 1KS5A 4HBNA 5HPOA 3RJ2X 4HK9A 1OA4A 4XF3A 3VKLA 2DFCA 3P3NA 4DEQA 1YFYA 3K51A 2R16A 4DY5A 4KL1A 3OGVA 4IV3B 2EXIA 5A3TA 3E6CC 1VBE3 3LQCA 1VAKA 2ARCA 5F9TA 4AFCA 3MEPA 4AI8A 3Q9OA 3KD4A 3QOPA 1QHDA 2HEYF 4R4XA 4YZ4A 1L3JA 4XFIA 4HKLA 4LBMA 5C3RA 3JQXA 4KG8A 1AR62 3CZJA 4BDVB 1O4YA 1AHSA 1MZFA 4LEJA 3P6BA 4AVAA 4JGYB 1TVGA 4YW4A 5APAA 2P34A 2GP3A 4WM7C 2ARBA 4DPNA 1JZ7A 1NE6A 2A3YA 3QCWA 1BBT2 1PX3A 5FP8A 5CYYA 1RUD3 2QQMA 2CY6A 3VBHC 4A6SA 2DUOA 3MPPG 5FXWA 1WLTA 1D0HA 4JKLA 1S1AA 4HFSA 1NLQA 1SPPB 5FQ0B 4IE5A 1G9FA 4AFMA 2Q8EA 4BIFA 2Q8OA 4YVWB 3EQEA 4YW6A 1XSQA 2AEYA 3BU7A 4O9EA 4CU7A 2CDOA 2FHRA 4AXOA 1W6QB 3UL2A 5D21A 5L73A 2DF7A 2XGXA 4I2OA 3DCQA 4LHKA 1B35A 1CAVB 4MVTA 5DZFA 3RZZA 5C3OA 4QM8A 5ANQA 2YPJA 1DYPA 4LK7A 4MUVA 1RUJ2 4BE3A 2RR12 1GYKA 2JDMA 4XIOA 1LEDA 5C8CA 2EAAA 1CAXA 3KQ4B 4YFZA 5KHKA 4R8HA 1GZ9A 4XXAA 3PVOA 5FWEA 2D6LX 1YI7A 4Z1VA 4P9JA 2OQ6A 4FPKA 4HZFA 1IQDC 4BQYA 4LTAA 1COV3 1QJX3 4RSUA 5FXXA 4H7LA 3O1UA 2PTMA 4BPZA 3KCXA 3A7QA 4IEYA 1N1YA 1MS8A 2B42B 5JSOA 3EXUA 1YRZA 1WW4A 3LOBA 3HAGA 1W2AX 5FYZA 3WF0A 3WG3A 4M3CF 3GZEA 5FK7A 2Y38A 1JYXA 4JGZB 1UMIA 4HOOA 5FUPA 4QXHA 2UWAA 4UXAA 3OEBA 5FZ0A 3MO4A 2GMMA 5HBAA 3FE5A 2QQOA 3JU9A 4OI4A 3OYWB 4W6WA 3S0MA 1RUH2 4Z82A 1AL22 1W6OB 5LBBA 3IIIA 1LHOA 1H8TA 3WQ7A 4Q4V3 5JDBA 2B46X 2XBO1 4EZHA 2D43A 3MW3A 2RMU2 5EWSA 4LBQD 1YQCA 3MW2A 2GNDA 3WCRA 4DXTA 5A1LA 1BVVA 1L7LA 3HIFA 4GD4A 5E88A 1ALYA 5E1RA 5FMDA 5CFDA 4GH4B 4Q27A 3PIGA 1YLLA 1IS3A 1GMMA 3OG2A 2G9GA 4NIGA 1FMD1 1MZEA 3LEKA 2ZHNA 5DUXA 5EP9A 1YC61 5I0RA 2UU8A 4K8RB 1H6XA 1UYPA 4CEYC 3I3QA 1RUC1 4QPIC 1W8NA 4NUBA 4Q4W2 2QQIA 3OCPA 1SLLA 5FPBA 5FZ8A 2WNUA 3SH5A 3KV6A 1H9WA 1KFXL 2RHPA 4Y20B 5FREA 4AEKA 3UKVA 2QZ3A 3CJIA 3PVNA 5F5AA 5FPUA 3VBSC 3POGA 3AYAA 1ULEA 4DXZA 4LQRA 5A7OA 1LODA 1MACA 3ZSLA 3N3HA 1U0AA 2BEOA 3K2OA 1YIFA 4LXLA 3WINE 5A3NA 1ZBA1 4I0BA 1DU3D 2VUCA 4IETA 4YG3A 4AL9A 4RA0A 2A3WA 2L9LA 2VNVA 3RI9A 3VHOA 2BWCA 3PUHA 3MF9A 3B69A 3AB0A 2RS13 1NXMA 1RHI2 2FZ1A 4UFHA 3BPSA 4Z92B 2CWMA 3ZXGA 1MEC3 2X29A 5KR7A 4HSJA 5CZKA 1G7YA 3BB6A 3H7YA 2DCYA 1HIXA 2HWC2 4WM8B 2PQQA 4Y26A 4CSWA 4G4FA 2WIIB 4B29A 4AG4A 3EO6A 2DBIA 1WCUA 2QQJA 2SBAA 4BQ5A 1AYN3 3DPRC 1W0PA 2DYCA 1VBC2 1TE1B 1MS3A 5JI9A 5ISLA 5FZFA 2ZGSA 3NWKA 1V6OA 1VBD3 1LHNA 3TN91 3J4UH 4Q0VA 4GWJA 4GAZA 2JE9A 2VM9A 2XUMA 4DNYA 1DDLA 1W6MB 1D4VB 1C4RA 3MLKA 3QD6A 4XC9A 3W20A 3I2IA 2RS32 4A42A 2B9UA 4NHMA 4PIYA 1BVP1 1DFQA 2XMLA 1UX6A 2YXSA 1VBA1 4NHKA 4Y4YA 4EJRA 5L9VA 1QJU2 4WVMB 3FUOA 2IFWA 3MYXA 2B4KA 1NCRB 4Y1ZA 2H6CA 2HWB2 1TG7A 5JXHA 2FBEA 3MICA 4UOJA 4B4PA 1AVBA 1ONAA 5FZGA 2XXZA 4I09A 2G1MA 2W91A 2CAVA 4X6QB 2JDZA 1C1LA 4CUCA 1H2NA 1JYTA 1RUG2 4JDOA 4XBNA 3VBFB 1W8ZA 1GSLA 1KITA 2HEWF 2V72A 5LK7B 2R063 1QH6A 3KM5A 4AVVA 2X5IB 2JJ6A 2DU0A 3NAPA 2ET7A 1AX1A 1F15A 2MEV1 3D0SA 1FOD3 2D5FA 2XVKA 2QFEA 2HKXA 4JQTA 2EAKA 5JR7B 1ENXA 3D8CA 3JBG1 2D3SA 3A21A 2NN8A 3TB0A 4H3WA 2FDIA 2GC0A 1D4M1 1WZXA 2IUWA 1JU4A 1PK6A 3BTZA 2XKPA 4Q5OA 3RWKX 5IK8A 1UU4A 3TOJA 1BMV1 4P9WA 5I0TA 1AR73 3B5LB 3N35A 1US2A 1AR92 4M3CB 5FY9A 5FZ4A 3LDKA 4CDQB 2WS92 2GAUA 3AYDA 5K0UA 4XBQA 2XJRA 3PNAA 1AJOA 3OF1A 4Q29A 1PVC3 5T5PA 3H8XA 4IEVA 3GDBA 1UYYA 3CU7A 3N9NA 1EUUA 4E27A 2DTWA 1J58A 5FZOB 5G04L 3ZOIA 2LROA 1PGL1 3ZYGA 1UYZA 2W95A 2ZOEB 3GALA 1FPN1 1NQDA 4QXCA 4N43C 3LE0A 2Q0AA 1W6PA 5CISA 1DQ6A 1KQRA 1ZBE2 1R093 3E1F1 1B09A 1XE7A 4QM9A 1RTVA 1IPKA 5A7NA 2FDJA 5LA2A 4ES8A 1F5JA 2IC1A 3MFCA 1CVNA 3ELNA 4JHTA 5FZ9A 3Q8AA 5IATA 1FT9A 1VRH2 3O1MA 3I3MA 1J83A 1ULDA 2HBTA 1ZRIA 4XQDA 2R1DA 5LBEA 4OVEA 4DIQA 5JXGA 3MUY1 4YGBA 4BK4A 4CEWB 3RQ0A 1SLAA 1ZRCA 3B93A 5A3PA 1LAJA 2CGNA 1G86A 1LOBA 1PZ9A 5IK4A 2PXJA 1LTEA 2D6KA 2XB6C 3ETQA 2IXHA 3BCWA 1DGRA 4MXWA 1YNAA 3IIAA 4BK5A 4GKYA 1DGWA 3B02A 4QMAA 4CUBA 2O14A 3C7FA 3RMXA 5JAXA 3HOBA 3FJSA 4K1ZA 2W94A 2KXLA 4EYUA 5F8PA 5JZGB 2DTYA 5EV7A 5FIXA 2ZHMA 4AHXA 4D6RA 4UBGA 4FPHA 3BU0A 2ZCWA 4BQ1A 2A3XA 4BH9A 5ACA1 3FBYA 2G4IA 2PHWA 3B3QE 3UJQA 2CNAA 3FBMA 1XNTA 1DCSA 1OOPA 3KT4A 1UMHA 2EIBA 4LUMA 4XUQA 4EN7B 1W90A 1HRI3 5DDJ1 4QPIA 3HNBM 2UWCA 1R081 2E7TA 4IGOA 3BN6A 3H50A 2VAUA 2C4XA 2IXLA 4M0HA 5LY2A 1UOJA 4PDWC 4AR2A 2WFF3 4NIHA 5DAQA 3O0VA 2YG0A 3NW4A 4H14A 3VBSA 5I8YA 2ZHLA 4GB31 2BU9A 4L11A 1MS9A 5J96B 4Y5SA 3D3AA 1G8WA 2A5ZA 3AMHA 3CO2A 3KGZA 3VBOB 5A3WA 2ARXA 1K12A 4K20A 3D6EA 1NE4A 2WT1A 4QGLA 3U78A 3MI8A 4QT6A 1LOGA 3ZKYA 5L7OC 2F6BA 3T4HB 3TEWA 2QQNA 4XDQA 5C70A 4LUKA 4ET7A 3KCCA 5FPLA 3O0XA 3KF5A 1GZWA 3AMQA 3GJBA 1GWKA 4IV1B 5BNPB 5EPAA 5KXEA 4V2WA 1ND2A 2XHNA 1RJ7A 3PJYA 4MO3M 1S0FA 3IDBB 2R30A 1Z7S1 1W0NA 3OB8A 4WV8A 2X53S 1LCLA 4AEDB 4XOGA 1X9PA 1NCQC 4E4SA 2ZKLA 1V6MA 3U07A 1REEA 2WZ8A 3OD0A 4A3XA 5JSRA 2XQXA 1UPIA 5C6CA 3KWVA 1VPHA 3MIBA 1WBLA 1LGNA 2QTWB 1DQ4A 2OXBA 4EROA 4GULA 1HB2A 4EV0A 1VRBA 1JZ2A 1QEXA 3ZMNA 2ZPXA 4JZRA 2BUKA 3G7DA 1KXGA 2QNKA 3C7HA 4Q4X3 3RMYA 4E2GA 1PO13 2ZTNA 5IFPA 2DV9A 1BEV3 5B2GB 1C8NA 1MEC2 2Q8CA 5C5TA 1PZ8A 1TME3 5DQ0A 4YLZA 3R0RA 2ORZA 1QQP1 2BRTA 4RR3A 4HVOA 5FV3A 2WNOA 3VN4A 5BY5A 1YYNA 1IG3A 3V64A 2ES3A 4RQPB 4BQWA 5HCHA 5FZKA 4XUOA 2XJQA 3VBRB 2YU2A 3ACHA 2EXJA 3H7JA 4ZXKA 2ZEXA 1POV0 3SXWA 1QDCA 4JDNA 1HB1A 1VBD2 2PN5A 3SCGA 4R9CA 4FPGA 1HRV3 3GM8A 4YWAA 2WJSA 1TZOA 4FSJA 1GQPA 2DCZA 3N4MA 1GKBA 2ET1A 1EUTA 2HLEA 1O3RA 4E2SA 2WZPP 1V9U3 4RS5B 5F2WA 3H0OA 4KGQA 3PUSA 5LCWL 1XNDA 4QX1A 4R4ZA 2JECA 4IDZA 4B1LA 1RUI1 2A6XA 1CJPA 2NM1A 1KD7A 5LBCA 2LALA 4A44A 4CUAA 1W0OA 2IXCA 3O1VA 2WNVB 1IKQA 3SKVA 3UGHA 1GP6A 3N7JA 3OUHA 4ZZ8A 3RVHA 4GJYA 4GMP0 3V0AB 3LB9A 3THDA 4YZ3A 3ZYIB 2JDKA 5L9RA 2BGOA 3GZAA 2UYBA 3WZ1A 3NNMA 3KGLA 1OA2A 5F3GA 1G9CA 3B9CA 5GZGA 2XR4A 1ND3C 5HCAA 2LUWA 5FKCA 5LATA 1UY1A 1C8M3 5FP7A 4WM7B 5FCCA 4LHSA 3E5QA 4GJZA 3PU8A 4URAA 1I1EA 2A6ZA 4JTNA 3VBHB 4OLLA 4NJ4A 1LOAA 4DEVA 3Q8CA 4IGQA 1JI6A 1T6GC 3I59A 5K4LA 1RUE3 4O65A 3J26N 4XE9A 1K45A 3VZLA 1AXYA 4OHVA 5FYCA 3AP7A 2P5BA 5FLJA 3GBGA 5FPXA 1IS5A 1FMD2 1N1TA 2AC1A 1RUF2 1DF0A 1XSRA 3K46A 1E5SA 1REFA 3WP5A 2R0FA 2Q1ZB 4BQ2A 4WVWA 1RUC2 5GM0A 3CBNA 5AFBA 5JIUA 3NV4A 2KA3A 2OS2A 1K5MB 4XETA 1BYHA 2NMOA 5JI7A 2YBKA 4D94A 3I49A 1AR63 4ZY9A 2IVJA 2GU9A 3TEZA 1LECA 2ZGOA 4FCAA 1MS5A 4S2GA 4YW7A 2HWE2 1CONA 3SQOA 4Q4Y1 1G9AA 5GKAC 4K3UA 2ZGUA 3IPVB 1MVQA 1SEFA 4OI2A 4QKDA 3KT7A 4BXFA 3AZYA 1YHFA 4N53B 2X09A 4QWNA 4XF0A 3GJAA 4UFJA 3I4IA 2OZ6A 2WQ8A 3KVBA 2R7EB 5ANNA 2NPIA 2XJUA 3V56A 5JPNB 2P3IA 3RGBA 4RL7A 4PDWA 4HK8A 1AYM1 1F35A 3D82A 4LO7A 5J7MA 5FTTC 3LFIA 5FO9B 5I93A 5IAVA 3U4SA 5LB6A 5FP9A 1RUJ3 1JUHA 5A7WA 4PLMA 1HXS2 3HT2A 4PLOA 5FXVA 3TN92 1UZVA 3WP4A 4YW1A 1W3XA 5FRAA 3KB5A 4TZDA 5AC92 1GOGA 1P8JA 2XPJA 2VNRA 3UGFA 3PTRB 4IEQA 3K3NA 1ZA4A 4COZA 5F1RA 2QQVA 2NP0A 5IYYA 2OUHA 3WW3A 3QLQA 2QDRA 4AWDA 1JYCA 1CZVA 4CEYB 1E5RA 2DVAA 1UMZA 2RDQA 5BNNB 5IWFA 2WYSA 4CP9B 2WFF2 2OX0A 4L97A 1Q56A 1ZZ9A 2W3JA 2WO7A 3VZOA 3TRSB 3LEGA 5F6KA 1H2KA 5FKBA 1VB4A 1V00A 3VL8A 1JOPA 3OUIA 5T5JA 3VB9A 3WDUA 1QJZA 2J1TA 1POV1 2DCTA 3ASIA 5C8CC 3VBUC 1RUH3 1W2UA 4XJAA 2MEV2 2FDGA 5LW9A 1OLQA 5D2AA 2VU9A 1OUXA 1V0AA 2C0ZA 1UY0A 3MIHA 2RE9A 2RMU3 5A32A 5H9RA 1W2NA 3PDQA 1OLME 2J1UA 1VJ2A 4I0WB 4DOUA 4K1YA 5FY0A 4CP0A 1V70A 2EIGA 1XOYA 4MYEA 2VNOA 3KV4A 3WNNA 5KC6A 2VR4A 3L2YA 2D6MA 3N7KA 3DPRB 4UYBA 2J1RA 1WLWA 1J59A 2O1QA 4RD7A 3AP6A 5FP4A 2WSUA 1UKGA 4Q4W3 4EN8B 3QACA 1FNZA 4GMP1 3B94A 2C6SA 5FZ3A 4DRRA 5JLVA 3B00A 2BFUL 1RYYA 3SH4A 2ID4A 4AI1A 4MGQA 2VQUA 3BPZA 3VDDB 3NKGA 2WA4A 4IE6A 4H55A 4Y1YA 1FXZA 2Y60A 2GN7A 1MQTB 3BODA 1W9FA 4MGIE 4DZGA 4TTGA 3X29B 4FTSA 2AH2A 3K4AA 4QU1A 2TNFA 4HN1A 2V4VA 3LF7A 3S7IA 1GQHA 2ORXA 5ABJB 5I0UA 3RYKA 1UNBA 1W8WA 4HN0A 3GXUA 5A6QA 4QXBA 3U11A 5C9AB 1UX7A 1XQNA 5F3EA 4PJYA 5A70A 1ZA7A 2YBSA 1SBEA 5IVJA 4DRVA 4JVAA 2JD9A 4RGAA 3ZN6B 5J37A 1M4WA 2WNUC 3K48A 4BXSV 5GALA 2VD7A 4QX8A 1ND3A 5A3MA 2B39A 2R073 3EB7A 1ZM1A 1YJLA 2QUOA 4ZS2A 2W0XA 3ZXJA 4D7SA 3ZVXA 2P17A 4IEPA 1JZ5A 4O61A 3TWIA 3HN3A 3PJQA 5CKNA 2VCBA 5ERLA 1WGPA 1QNYA 3ZXKA 4D7YA 4OHZA 1FATA 1W05A 3M8LA 1NY71 1N3PA 2LW8A 1J3PA 3OJBA 2DVGA 3GF6A 5JUVA 4I30A 2ENRA 4W4ZA 1YQ2A 2RS33 2P1BA 2XG3A 2PAKA 3UT0A 3E5UA 4FPYA 4LITA 4XABA 1XYPA 3UESA 3NNLA 4COUA 3OGSA 2EICA 1LKNA 4N8MA 3RZJA 4LHNA 3DF0A 1O3QA 1U5IA 1PO23 3FUQA 3ACLA 3ZSMA 4L92A 3WNKA 1QKQA 1QJX1 2RM21 3AP4A 2Z42A 3OY8B 4L99A 2GC1A 5LA9A 4NOTA 4A41A 5D8AC 3ZN4A 2YUEA 3WCSA 4XACA 1J3RA 4GB32 4B4RA 5JMOA 1Y3TA 4N43B 2PLV3 3T30A 5FZMA 2GH8A 5HV4A 1ZYBA 3IDEA 3NJYA 3PUAA 1N1VA 3BKZA 1K42A 5KHGA 3MLLA 3K77A 5FZBA 2N7GA 5CFCC 4D0QA 1RUE2 4JV4A 1VAVA 3LA2A 2BQPA 2XVGA 4CU9A 4FPEA 4XJ8A 1ZRDA 4IXLA 2EXKA 2XLGA 4QPWA 3VD9A 3ZFGB 1O6UA 4JC1A 4PF1A 3RSJA 4EN6B 5F32A 4IE4A 1ZZ6A 3SC7X 4Q4V1 3M3EA 2OPKA 2VMGA 1AR93 3C3VA 4Y24A 1PZ7A 1I9RA 1EV11 1Z7S2 2VW0A 2WS93 1D0GA 4LBQA 1VMFA 2P3JA 2YPDA 4ZU4A 1UW8A 1XBFA 5FYHA 1TMF2 2LS6A 5H9QA 1GBGA 3H8OA 1O91A 3ROUA 1WBFA 1VIWB 3AZVA 4LOTA 2WWJA 4XJUA 2QZ2A 5DXDA 5C8WA 3ZSKA 3N7LA 1UN1A 4B3NA 3IMNA 3CEWA 4HL0A 1OF4A 3RZMA 3NAPC 5A6XA 5FYMA 4XDPA 3SITA 2WDBA 2D3RA 1V6IA 2R041 4A6OA 1LR5A 4NIDA 4F83A 3AVRA 4PQQA 2WQZC 4K7JA 3LPFA 2WFPA 1ZBE3 1SCSA 1FV2A 1ZRRA 2WA3A 5FZAA 1LRHA 4IQPA 5K9YA 1ASJ1 2WR9A 4Y22A 1OUSA 3ZYRA 3OOXA 5K7PA 2GNMA 1PK6C 3GCWA 4UT5A 4XILA 5BNQA 4KWUA 3LPGA 2X10A 2JKBA 2YROA 1VRH3 2RS51 3N9MA 3SISA 2VZOA 4OMDA 3V0BB 3J8F3 2WLQA 1N3QA 5FBZA 2RDRA 5I8SA 3SMHA 5K0UC 5CKQA 1X82A 2XJPA 2CL2A 4YVSA 1ZX5A 2E51A 4CDWB 4PBPA 1AX2A 5JOXA 4XCBA 1DGRN 5JXJA 4XUPA 3URFA 5LASA 5JR2A 4D6QA 1WA6X 3BIWE 1GV9A 5AVAA 5JOZA 4XIKA 1RVF1 2B9VA 1UQXA 2QCSB 4KG0A 3T2TA 4CA9A 3VBUA 1CZSA 1LOEA 5IT6A 1QGLA 3WDVA 5L7OB 1KGYA 1AYN1 3LD8A 4HKOA 2BGPA 4BLIA 2WAOA 2DUQA 2BBAA 1ENSA 2CYFA 2GDFA 3MV01 1GOHA 3ZFEB 1UIJA 1GUIA 2QJVA 1QJY1 3I2FA 5FMBA 4CVUA 2E6VA 3DL3A 4NPRA 5C4WB 3Q8EA 3SHRA 4R9DA 2YU1A 5T3NA 1LESA 2VXJA 4AGRA 4XDOA 3WHTA 1NCQB 4LKSA 1OLMA 2EVXA 2VMEA 4IEZA 2Q4SA 4D69A 4Y1UA 4BZ4A 3EHKA 1QXRA 4NAOA 4AYUA 4XTMA 2BW8A 4BJ0A 3A23A 4HPKB 1JU3A 4W50A 3K75B 1CX1A 1US3A 2J7MA 3WW4A 2B8MA 1VMHA 2MNGA 2YFUA 4YYOA 4BQXA 3TNQA 5BPXA 4MZUA 1BXHA 2VOTA 4CCJA 1UZWA 5LEJA 2BWAA 2VG9A 1OF3A 3J7HA 1Q8PA 3LKJA 4EZ4A 3R4DB 1DLCA 1WD4A 2Q30A 4QX0A 3MF6A 1AF9A 1OOPC 4FOVA 1NA1A 1NUKA 2ZEZA 1Y43B 4C90A 5FDBA 2K9ZA 2EA7A 5HV0A 4S2DA 2AACA 3VHNA 2VQAA 3AKSA 5DAPA 5FXZA 1MS0A 1XYNA 2YDEA 3POSA 3USSA 4FTBA 4LLOA 1XNCA 1YCIA 3FZ3A 2HYXA 1IHMA 1QJEA 4IGPA 1D2SA 5IJRA 2AREA 1W6NB 4NROA 4YW3A 1QWRA 1PIV1 2WWSA 3WG4A 5FYUA 1UZYA 4Q8LA 4XJWA 4Q4Y2 1N47A 1F31A 1OFSA 1SG3A 1T6BX 3O0WA 2GH2A 3T0DA 4FT8A 3WVJA 2VOKA 1ND2C 4CYDA 3DYMA 1MR5A 2ZMNA 3NNGA 1ULCA 4ITCA 5EJ1B 4EQVA 1R091 4A7KA 1ZZBA 1GICA 4OZOA 2QQLA 1OD5A 2C5DA 3ACIA 1L7QA 4ISRA 1PGW2 2R072 4CU8A 1OBNA 3O12A 5D8AA 1DQ5A 3LFMA 1AYM2 1EAH2 3T09A 1O3SA 3RZHA 1TEIA 4XHBA 4CZSA 2BNNA 3RPQA 1UU5A 3DECA 4OI1A 4JDMA 4QDSA 2W68A 2VCMA 4NRPA 2JG9B 5FZ7A 5CFCA 4M01A 5IVCA 5FAXA 5LRRA 4CDUA 2YGMA 3ZYFA 4OZXA 1ZZ8A 1F2NA 3C8XA 3LEMA 4FTEA 1QMJA 4FAGA 4JHZA 5KXDA 2VL4A 3HMYA 4FPLA 2VQTA 5BYNA 3OD4A 1W04A 3WSOA 3SEEA 3FFZA 5J09A 4OHYA 2F4LA 2MPFA 3IT8A 2WQ4A 4RR3C 2DBNA 2B45X 3IWZA 5EYYA 1PO22 2OIIA 4NHXA 1OURA 3ZYPA 4CDXC 4QPGA 1CAUA 3HD8B 3LWCA 4QQLA 4RYDA 1DGLA 1BZWA 4IEWA 3OSDA 3H1WA 2A1XA 5DG2A 4RS5A 2IWGB 1HQWA 2Y6KA 1APNA 4I01A 3WW1A 2PLV2 5CEHA 4MGKE 2XUEA 1F8VA 3CQOA 2EALA 4XQ4A 3ST7A 2WO3A 1GR3A 4PCRA 2WL1A 4XTPA 2JIGA 3GYDA 2W1QA 1HV1A 3KZ4C 1QF3A 1PM7A 3C2UA 1XC6A 1OPOA 2UY9A 4J1XA 4ORFA 4CE8A 2XBO3 2B5HA 4PI0A 1GQGA 4LNVA 1JTZX 3M70A 1CN1A 2RVAA 2VPVA 3KHCA 1AXKA 2WSVA 4IEOA 4LKEA 3NKTA 2VW1A 3FHIB 2VTXJ 3CZUA 4NHLA 2OKXA 3G6JB 3FLTA 4Y33A 3UKNA 3JD72 1OI6A 1H9PA 3I3BA 4AI3A 4K40A 3H8UA 5CB7A 1S0JA 2JG8A 4E2QA 1RB8G 2PYTA 1FMD3 3ECQA 3N9OA 3ZN5A 4XFAA 4YGDA 1RUF3 3PL0A 1Y9QA 3HNYM 1AX0A 1CAWA 5KHHA 5BUVA 1RUC3 4J1WA 3AMNA 4QGMA 2E31A 4K6BA 2XWJB 4Q0PA 4FP2A 2HWD1 1CIYA 2JE8A 4OQ9A 3N7MA 4E4DX 1IGOA 3B01A 4GIQA 2LTNA 4UF0A 5FWJA 2ERFA 4AVSA 2HWE3 3USUA 4CXYA 5F37A 1OH3A 2P4EA 3D5OA 2E33A 1HX6A 2ZAHA 1ZBA3 4CPBA 4AQ6A 1OKQA 3J8F2 1STMA 1IKPA 2VJXA 2VW2A 3WDWA 3I2HA 3RYPA 4P00B 3SEPA 5L9BA 3POWA 1OVPA 1B35B 4PHZA 4WZFA 3ENRA 4UW3A 2NMNA 5FJHA 1JZ4A 1SFPA 1TME1 3WOGA 4LULA 4Q2FA 2B7YA 5C8CB 1CAXB 3DXTA 4W6YA 1UOBA 2Y34A 2Y6HA 4QAWA 1XB9A 5LBFA 1UL9A 1HXS3 2YMZA 5F2SA 2D6PA 3RRDA 1JN2P 2VTXA 5DG1A 1NY72 3TN93 4XF4A 2IXIA 1X50A 3ZFFA 5AC93 2D93A 2JENA 1FAYA 3MGUA 4XFBA 4IE0A 5FY8A 2JICA 3ZDVA 1NKGA 4FFGA 2BNMA 4ZXEA 1OMIA 3T0AA 2BYVE 1VBA3 3W9AA 1SZBA 3WLUA 3M3IA 4FO9A 1V9U1 2VO5A 4LBOA 3WP3A 2HWF1 2VMHA 1X8EA 4NO4A 4Y1XA 2JDUA 4OCTA 2VQ0A 4JGYC 3OBTA 4TN7A 5EXOA 5A33A 1W99A 3QBQA 1S0BA 3AYEA 3ORJA 2WZEA 3GHNA 1IPJA 2ZAAA 4JAAA 4L9BA 5KWRA 5EQUA 4D7TA
chains in the Genus database with same CATH topology
1H8TB 1R1A2 2ZX4A 4XF1A 3VV1A 2NQYA 4PF5A 1DYKA 4HVQA 1QOOA 1QY4A 2MEV3 3ES1A 1ZZCA 1JYIA 1QXPA 5LK5A 3LSDA 3RI8A 5CFDB 3JBG3 1VLNA 3FLRA 1LGCA 1D4M3 1C8M1 1WMFA 5FMOL 2BGCA 3GZUC 5GZFA 1UCXA 2ZGPA 2GNTA 3JQWA 3MW4A 4ISQA 3RWNA 4XHXA 4RHV1 5BNOA 1AR81 2WNUB 1NG0A 4K21A 2ZZJA 1FX5A 4TYSA 3POYA 5AFEA 3CJIB 2RJKA 3ZXAC 2BPA2 4MLOA 2V73A 3RS6A 1IS4A 1OSGA 2R042 5A3LA 3VGIA 3IDCB 4JRLA 3WQ1A 2LM3A 1V6JA 3JB4C 2IXJA 4OHXA 1NZCA 1KJRA 2SLIA 1EY2A 4CDXA 1O4TA 1BBT1 2NZ9A 3VZNA 1YI9A 2A6WA 2IXKA 1QXJA 2OA2A 3WD5A 2Q1MA 2FQPA 3AJYA 5JCTA 1RVF2 3D0JA 1S0DA 4GH4C 1G9BA 1OLRA 3HN1A 3NVCA 5KXBA 3MIEA 2X8KA 1WD3A 4Q26A 3T1MA 1SLTA 3IKWA 2ATFA 1KRIA 3T1LA 1DQ2A 3OGGA 3GBFA 1C5HA 2RR11 1W39A 1QJY2 5ACA3 1UF2C 3BOWA 2GMPA 3WQ0A 4M0NA 4P9YA 1NQJA 4KWKA 4AGVA 3VKOA 3TBDA 3QH7A 3NAPB 5GZEA 3WDYA 3CLPA 2VY0A 3A0KA 4GB33 3ZDSA 3AKTA 1CJDA 2XBO2 1WLDA 4GWNA 1IQAA 1PK6B 1VAMA 4L2NA 4XFHA 2XVLA 4AQ2A 3GHMA 3HBZA 1O5UA 4LO4B 1H4GA 1AL21 3DV8A 4W6XA 3WXPA 5K0UB 5HCBA 3ZSJA 2WZR1 2RMU1 4WBBA 1Z7S3 1CIWA 3H1MA 4KQ7A 1TMF3 5JPMB 3B9IA 4CTEA 3A4UA 4LO8A 1RMU1 1RITA 2O8OA 4META 1H1IA 1W6PB 5SV5A 3KQRA 5DUUA 4IV3A 3VKMA 4KNCA 1ZBA2 1PIV2 5GLUA 1OQ1A 2GALA 4U36A 1VBB1 3VKNA 3VBFC 5T5OA 2XLAA 2YY1A 4I02A 2X5IC 3ZXDA 1Z0HA 2FMDA 2HEVF 2CV6A 2NLRA 2OUJA 1DZQA 1BK1A 1QQP3 4IEXA 4JGYA 3VKFC 2D7FA 4AI0A 4MXWB 5FLIA 4M3CE 1R1ZA 2QVSB 3ILFA 1RHI1 4AW7A 3WDTA 3TYJA 5FQ0A 2H0VA 5HI0A 4FOQA 4YG6A 4YVWA 4EN9B 2HWC1 4BHPA 4DMIA 3WDXA 1W6QA 1CPNA 2DWRA 1VBC1 3AMPA 1RIRA 1CAVA 3AXDA 4MV2A 4UW5A 1VBA2 1OOPB 4OUMA 4XFCA 5K8SA 4QPIB 4SBVA 3KT1A 4P9IA 4J6GA 3PHMA 3A0NA 1LU1A 4BM8A 2W39A 2D44A 3ZMOA 1PHMA 4YVSC 2I07B 1LOCA 1H30A 3VBSB 5IK5A 4LHLA 1CESA 1QJU1 2PAEA 4FPFA 4Q0QA 4IERA 2HWB1 5J48A 1O7FA 3DGTA 1GLHA 1UKRA 2Y26A 5CIRA 4QQOA 3JBG2 2R6QA 1RUG1 2GZWA 1D4M2 1GZWB 1LHWA 1O5LA 4JGZA 1ND2B 1N1SA 1BMV2 1NLRA 2QKDA 3OYWA 4AVBA 3AK0A 1W6OA 1LHUA 3THTA 1RUNA 3MDPA 3OBRA 3J9SA 1VBE1 1PGL2 4GH4A 5LRSA 2VUJA 2P37A 1FPN2 4BYYA 2OZJA 3RDIA 2WS91 3O7OA 1WCKA 1VR3A 1C57A 3S30A 3ZYJB 1QDOA 1GNHA 2CGPA 5H9PA 1ENQA 4Q4Y3 5JWPA 4MGYE 3TAYA 1S55A 4Y20A 4RR3B 2V5YA 1F5FA 1NA1C 4B8EA 1QOSA 1EPWA 1RUD1 3E6BA 5CU1A 4FXGB 2WINB 4XMIA 3VBOC 1NYWA 1X36A 1A3KA 3AJZA 2VH9A 2XJVA 2R32A 1U12A 3E5XA 3VLBB 1XXNA 2VVDA 1C28A 2D6OX 1AYM3 1E57A 1EAH3 1VRH1 2ZGQA 3AKQA 1AZDA 2R1BA 3WX5A 1DBNA 4IV1C 1FI2A 4AQSA 3LA3A 1I6XA 4WM8A 2F4PA 2DVDA 2AENA 3QH6A 1WCSA 4AEDC 1DLLA 1IZ3A 3R05A 3OGJA 5ACA2 4FPCA 4P9GA 1YWKA 4XMAA 4PLNA 3ZX7A 1SBDA 3MZHA 4YW2A 5DDJ2 4XW3A 1COV1 1R082 1OPMA 1LU2A 2A70A 2C1FA 1OQDA 1SMVA 1W6MA 3AZWA 1PNGA 5E8AA 3ILRA 1WW5A 2PAMA 4WVMA 1NCRA 1Q5OA 2ZMKA 1YIPA 2Z2SB 3HR9A 4JQRA 4P9LA 4FPOB 1S0IA 1POV3 4CDUC 2WKKA 4RQPC 4AF9A 3VL9A 4KBBA 2HJIA 5KBFA 3I59B 1AXZA 3WT3A 5JIAA 3VBFA 3VBRC 1S2KA 2UY8A 4B7KA 1G9DA 3I54A 1QNWA 2X5IA 5EYXA 1OHFA 2D98A 4G3YC 3WW2A 2MHFA 1UU6A 4QPGC 3JD73 4N7UA 3CL1A 4FOWA 4YZ1A 4LT5A 3VHRA 1JOJA 4RS5C 2ZA9A 1UIKA 3IBMA 2OW4A 2OVUA 4E4ZA 4KWJA 4GMP3 2VOXA 1DZRA 4MXVA 4COYA 4CDQA 4M3CA 1S2BA 2WNVC 5GJ6A 3AX4A 2D3PA 2XWBB 4WVZA 5I0SA 1KFUL 1RGSA 2YHJA 4NVPA 2DCJA 1WA4A 4BMBA 2CAUA 1QQP2 1Q8VA 4ZU5A 4FVVA 5GLTA 1Z78A 2ZX3A 4NR1A 4V1PA 4U2AA 2JG8C 4PDWB 3ALQA 3NO8A 2RS11 2VMIA 5CG9A 4AHZA 1YFWA 3RJRA 1MEC1 4BCUA 1PMIA 2H0BA 1EP0A 3AP9A 2IFRA 4C1XA 4AE2A 5EZWA 4TSVA 4YNIA 1M06G 1DIWA 1WMDA 4CEWA 3DUIA 3P3PA 4Q8KA 4E9KA 4R9AA 1O4ZA 4GA9A 2GSYA 4MGZE 1RUI2 1VBD1 2ZGTA 3MFAA 5JMCA 3FC0A 2A6VA 2VXRA 1K5MC 4W65A 5HCFA 2VGDA 2E63A 4WZCA 1QH7A 5JZGA 2VULA 3ZXLA 1ZNPA 3WHUA 1JUIA 2BVVA 3ZIWA 4AVTA 2D6NA 2RM23 4IEUA 1GNZA 3RZZA 2YYOA 3FX3A 4LBJA 4N53C 5CG8A 3IM0A 4LLFA 1R1A3 2XJSA 3AFKA 5JOYA 3DN7A 5A32B 1YFXA 2R061 1WCDJ 3AXEA 4I3PA 4UW4A 5JVVA 3ZFFC 2A75A 3FLPA 4AEMA 1LHVA 1FOD1 2ZGMA 3GBWA 1ULGA 3WG2A 3H3ZA 2EF6A 4Y5Z0 4YM1A 3OTFA 4AVCA 2DFBA 3VBOA 3H3UA 4C1WA 5DZEA 4B4QA 2WZR2 4C0BA 1EV13 1XRUA 3AYCA 1GANA 1AR71 2UWBA 2JX9A 4HKWA 4UW6A 5F5QA 4IV1A 3U10A 5BNPA 1X33A 4N9HA 1KS4A 4C0HA 1RMU2 4XBLA 4S2FA 1PVC1 4XFGA 2HYKA 3R6SA 1RUF1 2CWSA 4AEDA 2R043 3VZKA 5BV6A 3NV1A 5BNNC 2VOVA 4QQHA 3MIGA 4ES9A 4DS0A 2I45A 1ASJ3 4YSFA 1JH5A 1VBB2 4H7MA 2JE7A 3EBRA 3FMGA 4URTA 4AEJA 4AGGA 4HLTA 4XFFA 2HWE1 1ULFA 2YZ4A 4FBFA 1A8MA 2RS53 1Q8QA 1HW5A 3MLJA 4Q1PA 2R0HA 4O9GA 5BNOC 3AKPA 3KCYA 1QOTA 2DURA 1ND3B 2BFUS 3WUDA 4BA6A 4GXLA 3LOIA 2KM2A 1CGPA 2DU1A 2ZGLA 3GNEA 3NV3A 3M1HA 1FYUA 3R4UA 4YW5A 1RVF3 4ATEA 2GMEA 2QE3A 2ZMLA 2JEMA 4RQPA 4Y1VA 4ASLA 1HQLA 3WR0A 4HT1T 4KH9A 3SCFA 3VBRA 5T54A 3WY6A 4LBKA 2BTVC 4Z07A 1XYOA 2D97A 5CVRA 1HXS1 1QJY3 2PHXA 4NWVA 1U5XA 4EWDA 4LO6B 1XU1A 4RFT0 3VDDC 1RC6A 2AZ5A 4COWA 5AC91 4ASMB 2I2SA 3VZMA 2A73B 1MQTC 1SDWA 4LA2A 1HRI1 4QQPA 4A7ZA 4UBHA 4EN0A 3FFQA 2Z5WA 5E16A 5T50A 3AZZA 3MIFA 5ABJC 2WNVA 3LZZA 3RG0A 4HMZA 1A6CA 2WFF1 1Q8SA 3HWJA 3KS7A 5C9AC 3HQXA 3V0AA 1MZ5A 3LCPA 2D40A 4KGGA 4GWMA 1NXD1 2BVBA 3O14A 2Z69A 4LO5B 5JSPA 4JRAA 3UKTA 4DFSA 3E6DA 3O5SA 2K0GA 4LBQB 4N7IA 4WM7A 3MIDA 4X6RB 3VZJA 1TNRA 1NOVA 3S7EA 3VBHA 4TLFA 1LENA 2EXHA 4MSVA 4YZ2A 4FPJA 1J1LA 3ILNA 4XF9A 4K8FA 1VBE2 4XYXA 1HKDA 4YGEA 2E7QA 4I0AA 2W08A 1NLSA 3JB8A 5DZGA 4Y22B 4BLJA 2JXAA 1I3HA 4FQZA 4CP2A 4AI2A 3HT1A 1PIV3 5D1IA 1HLCA 1SACA 2P2KA 2ZKNA 4C91A 3SLIA 1K5MA 1MZ6A 1I5ZA 1YXWA 2TEPA 4OULA 4YM0A 4DY3A 4RGGA 4XZPA 4Q4X1 5CBLA 1PO11 3WUCA 2Y0IA 1BEV1 4JTOA 1RUD2 4YVSB 1VB2A 3IPVA 1UD1A 4WVVA 1C1FA 2E53A 5GZDA 4N53A 5SV8A 3VBUB 3ATGA 1KJLA 3PLQA 4SLIA 4AQTA 2WT0A 5LEKA 3LA7A 2Z79A 3ZFGC 4IV3C 4P5HA 1JW6A 4QU2A 3ZSEA 1DHKB 2H6BA 2FZ2A 1HRV1 4YZ5A 1J3QA 2R49A 4Z2WA 4X8NA 2ZX0A 5J36A 2UURA 3ZXFA 4EWEA 3AMMA 3I2DA 3M3OA 2E7AA 2BNOA 2WLPA 2PHLA 1COV2 4YFWA 2RM22 1QJX2 3W59A 1PGSA 4GQ7A 2QQPA 1QU0A 5FO8B 1SFYA 3SCHA 1SFNA 4YVWC 4CEYA 5KHJA 5GZCA 5BNNA 1YFUA 1LJ7A 5KC5A 1CQ9A 3M3QA 5EJ3A 1CD3G 4Z8BA 2ZX1A 4CDWC 2PHUA 1NA1B 1WMEA 4Q4V2 3WV6A 1UPSA 2QDNA 2G9FA 4JCKA 3AM2A 1EV12 1MS4A 2ZABA 3M3CA 4L8QA 1ZVFA 2OYZA 1RUE1 1AJKA 2CTVA 5BXXA 4QQ2A 5I91A 4OUSA 3KSCA 1CR7A 2PELA 3ZO0B 3LSEA 2DVBA 5E89A 1GZCA 4P14A 3ZFEC 3ZXEA 4F8AA 1ENRA 2HWD3 5C4WC 2VECA 1FPN3 2ZGNA 5IK7A 5DUVA 4QD2A 1UAIA 4BMEA 5KXCA 5IUQA 1F9KA 1TMF1 3DPRA 4OI0A 1ASJ2 1AR61 1JBCA 2WT2A 2XLFA 1RJ8A 1U5ZA 4JGZC 2WC2A 1MVEA 3AZXA 2Y0OA 2PA7A 1H8VA 2RS52 4D3WA 3CF6E 3VDDA 2JD4A 2XL9A 2WNEA 5D8AB 1Q8OA 2ZGRA 2RS12 1MQTA 4M00A 2Q5TA 3NSTA 2IZWA 2O0OA 3BALA 4P9XA 4Q1RA 2TBVA 2PHFA 2TUNA 5T5LA 4DQAA 1TQ5A 4KU7A 5ABJA 1Q3EA 1LB2A 5CFCB 4FQ4A 1BCXA 4GALA 1AUYA 1SCRA 1RUOA 4CDUB 5C9AA 4FAHA 3UK9A 1AYN2 1BJQA 3RYRA 1DGWX 4XJ9A 1RUJ1 1EYBA 3ZN6A 2VOWA 2ZGKA 3PVEA 4PIXA 3SNMA 4ZKTB 1WUVA 1BKZA 1SLIA 2PHRA 3TNPB 5DUWA 1TNFA 2ZX2A 1CPMA 5CAZA 4QPGB 1CAUB 2XL7A 5DDJ3 1URXA 1OQEA 3WG1A 1H4HA 1R083 1V6LA 2C9AA 2ZACA 2ZJCA 3ZPYA 5T55A 3KLSA 2HWF3 1KDKA 1LEMA 5KHIA 4R52A 3WP6A 1ZREA 4YARA 1U5YA 4QX5A 4FP3A 1EPZA 4FXKB 3NV2A 5T52A 2RJLA 4LBLA 1LOFC 5L36A 4WM8C 2BBVA 1N3OA 2PHDA 1Q43A 3GZTB 4DB5A 4BIOA 3LGRA 1DQ1A 2R062 3PMSA 3OY8A 4AFAA 1RUH1 2YV8A 4XEZA 1FOD2 5J98B 4N43A 4AFDA 2JG8B 4INDA 3R4SA 1OFNA 1CAWB 3MPBA 3BOPA 1IOAA 2JG9C 4AFBA 4A7YA 4QHBA 2GC3A 4NN0A 4RHV3 1AR83 1AR72 1XU2A 3H9AA 3PMEA 3ZFGA 1RL3A 2UYAA 1NCRC 4GKXA 5CADA 5J3UA 1WW7A 1H1MA 4LE3A 3USUB 1PVC2 2AUYA 4Q4W1 3VHPA 5EFUA 2AYHA 4QGNA 1S0GA 2O8QA 1WW6A 4XJZA 1H0BA 2DUPA 4AHWA 5GLZA 4S2HA 3CNAA 3I7DA 1R092 2VVEA 4HSLA 1OA3A 1YUDA 1C3HA 2ZHKA 1H1AA 4MX3A 4YM3A 1BBT3 3UJOA 4EWAA 3IN9A 4BOWA 3W58A 3AKRA 1HV0A 1BQPA 1XE8A 4Q0UA 2ZBJA 4Q0SA 3E97A 2PHTA 3NJZA 1IS6A 1S0CA 3M2MA 3V0BA 4CDQC 3I8TA 2D5HA 3ES4A 4LBNA 1PGW1 2R071 3U0ZA 3ZFFB 5FOBB 1EAH1 4AK3A 4CDWA 4YG0A 5H9SA 4A2UA 4QPYA 4ZU7A 1RUI3 4QXKA 1X7NA 1PVXA 1WLCA 1V6NA 4XQWA 1DZTA 5FOJB 2RR13 2V09A 3APBA 1LULA 5L7OA 2RS31 2GNBA 5A33B 2YGLA 4F7ZA 2VUAA 3FWEA 5FFOC 3UV9A 5FPZA 1JXNA 2GC2A 1X8MA 3ZFEA 1SQ4A 1HRI2 3AFGA 5C4WA 1FV3A 4R9BA 1PO21 4TWTA 4XXPA 5CA6A 4DINB 2YC0A 2ZZQA 4CEWC 1NCQA 2W52A 1REDA 4YGCA 1B35C 4OFGA 2PLV1 4KU8A 3ZIXA 4ATFA 3PTYA 4HANA 4HPKA 3EJKA 5CNAA 2FMYA 1XNBA 3B7MA 3AP5A 3M7AA 5BNOB 1AL23 3INAA 5JZGC 2VNGA 4CRQA 3V65A 3LAGA 2DCKA 2WZR3 1SLCA 1JHNA 2ZS6B 2CGOA 3M4FA 4XPVA 4LR4A 2HWD2 1AR91 2ETEA 5HXVA 5GLVA 1ZRFA 3RNSA 3JD71 5L19A 1V6KA 5GLWA 1RMU3 1UZZA 5AVPA 4IL7A 4NWWA 1A78A 2DVFA 5FMOS 4YRDA 1H2LA 4FOYA 4I3GA 3JUUA 4CDXB 3NL1A 5TSWA 1VBB3 4N9IA 4PQ9A 1D2QA 1ZBE1 1ZZ7A 3ME2A 2GN3A 3U4XA 4Q4X2 1GFF2 1H8TC 1PO12 1Y7BA 1W6NA 3N36A 2A71A 1BEV2 4BWOA 4K9SA 2VVFA 1LGBA 3SH3A 1RINA 1TME2 3J8F1 5CFDC 2XHKA 5BNPC 4IESA 1RHI3 2XJTA 4PIZA 1LOFA 1HDKA 1HQNA 1SBFA 5FO7B 4AHYA 4MH0E 1PNFA 1YO8A 2HWC3 3DKWA 1O3TA 1G6NA 3PVBB 1YJKA 4F3JA 4CP1A 1HRV2 4HVRA 4PBOA 1KDMA 2K2SA 5F6LB 1VBC3 3CJIC 3CJXA 5FLHA 3JZVA 2ILMA 4N90A 1VP6A 1J1TA 1V9U2 2HWF2 2AGSA 2JG9A 3D4KA 1SLBA 1XNKA 2AR6A 4KWLA 3L2HA 3VUOA 2A7AA 5JOWA 2A6YA 3H1YA 4HETA 1DQ0A 3L9JT 4ONUA 1S0EA 3WNXA 4G9SB 1QJU3 2P3KA 1C5IA 1MS1A 2HWB3 1DG6A 3BTAA 1A8DA 2I74A 2PFWA 4YM2A 3OPZA 3THPA 4LA3A 4OHWA 3KMHA 4B7EA 1RUG3 1H2MA 3S6PA 4X8PA 2XH6A 1C8M2 4LE4A 1R1A1 1FNYA 2XKOA 3JCIA 5I8TA 1CX4A 4RHV2 1AR82 4COVA 5C33A 1AL0G 1VALA 2NYYA 2E9QA 1KS5A 4HBNA 3RJ2X 4HK9A 1OA4A 4XF3A 3VKLA 2DFCA 3P3NA 1YFYA 3K51A 2R16A 4DY5A 4KL1A 3E6CC 4IV3B 2EXIA 1VBE3 1VAKA 5F9TA 4AFCA 3MEPA 4AI8A 3Q9OA 3KD4A 3QOPA 1QHDA 2HEYF 4R4XA 4YZ4A 1L3JA 4XFIA 4HKLA 4LBMA 3JQXA 4KG8A 1AR62 1O4YA 1AHSA 1MZFA 4LEJA 4AVAA 4JGYB 4YW4A 2P34A 4WM7C 2ARBA 4DPNA 1NE6A 2A3YA 3QCWA 1BBT2 1RUD3 2CY6A 3VBHC 2DUOA 3MPPG 1WLTA 1D0HA 1S1AA 4HFSA 5FQ0B 1G9FA 4AFMA 4BIFA 2Q8OA 4YVWB 3EQEA 3BU7A 4O9EA 2FHRA 4AXOA 1W6QB 3UL2A 5L73A 2DF7A 2XGXA 4I2OA 4LHKA 1B35A 1CAVB 4MVTA 5DZFA 4QM8A 2YPJA 1DYPA 4MUVA 1RUJ2 4BE3A 2RR12 1GYKA 4XIOA 1LEDA 5C8CA 2EAAA 1CAXA 4YFZA 5KHKA 4R8HA 1GZ9A 4XXAA 3PVOA 2D6LX 1YI7A 4Z1VA 4P9JA 4FPKA 4HZFA 4LTAA 1COV3 1QJX3 4RSUA 4H7LA 2PTMA 4BPZA 3KCXA 4IEYA 1N1YA 1MS8A 2B42B 5JSOA 3EXUA 1YRZA 1WW4A 3LOBA 3HAGA 3WG3A 4M3CF 2Y38A 4JGZB 4UXAA 2UWAA 5HBAA 2GMMA 3FE5A 3JU9A 4OI4A 3OYWB 4W6WA 3S0MA 1RUH2 4Z82A 1AL22 1W6OB 1LHOA 1H8TA 3WQ7A 4Q4V3 5JDBA 2B46X 2XBO1 2D43A 3MW3A 2RMU2 5EWSA 4LBQD 3MW2A 2GNDA 3WCRA 1BVVA 3HIFA 5E88A 5CFDA 1ALYA 5E1RA 4GH4B 4Q27A 1YLLA 1IS3A 2G9GA 1FMD1 1MZEA 2ZHNA 5DUXA 5I0RA 2UU8A 4CEYC 1RUC1 4QPIC 4Q4W2 3OCPA 1SLLA 2WNUA 3SH5A 1H9WA 1KFXL 2RHPA 4Y20B 5FREA 4AEKA 3UKVA 2QZ3A 3CJIA 3PVNA 3VBSC 3AYAA 1ULEA 4DXZA 1LODA 1MACA