1TN6A

Protein farnesyltransferase complexed with a rap2a peptide substrate and a fpp analog at 1.8a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tn6A00
1TN6A 3Q7FA 4LNBA 1KZOA 4GTMA 3Q75A 1D8EA 2R2LA 1LTXA 3DSUA 1TN8A 1LD7A 2H6HA 3C72A 3E34A 3KSQA 2IEJA 4L9PA 1O1TA 4GTSA 4MBGA 2ZIRA 3HXEA 4GTQA 1LD8A 1TNOA 4GTRA 3Q73A 2ZISA 3PZ1A 1NL4A 1KZPA 3Q78A 4EHMA 3Q79A 3PZ3A 3DSSA 3EUVA 1N9AA 1TNUA 3HXBA 3DRAA 1FT1A 3PZ4A 1S64A 3HXCA 3DPYA 1QBQA 3SFXA 1O1RA 3E37A 1N4QA 1TNZA 1DCEA 1JCQA 3HXFA 1O1SA 3PZ2A 3HXDA 1N4SA 2H6IA 1SA5A 4GTPA 1N4PA 3E32A 1N4RA 1TNBA 3DSXA 2BEDA 1O5MA 1SA4A 1N94A 1TNYA 1X81A 1D8DA 4YDEA 2F0YA 3DSTA 3EU5A 3DSWA 1NI1A 1N95A 4GTTA 4LNGA 4YDOA 1FT2A 1JCSA 1JCRA 1FPPA 2H6GA 4GTVA 3SFYA 1MZCA 3KSLA 3E30A 1TN7A 2H6FA 3Q7AA 1S63A 3DSVA 4GTOA 3E33A
chains in the Genus database with same CATH superfamily
1XGWA 2ZU6B 5EYPF 3TG5A 2BKKB 2OOEA 2VSOE 2IEJA 5BXOA 1BPOA 4BX9A 3MZLB 1O1TA 4GTQA 5AYWD 4H7YA 1UN9A 2FBNA 4DK5A 3FTXA 1VDYA 3Q73A 3CSTA 4GYYA 3FEYA 3MKQB 4U7EB 3LEWA 2XENA 3LXUX 1JWFA 1S0PA 5CHEE 4WAFA 4GYOA 2AVPA 4O6FA 4O1OA 1N9AA 3JXJA 4BWRA 4FC8A 3DPYA 3FU6A 4HRLA 4DX6D 5G2NA 5KJKA 4J8YA 4JEUA 4ABNA 2X6HA 2QY7A 4N2SA 3D9LA 3OTNA 1UJKA 3LKUA 2MHKA 3U3WA 3PRZA 3G2UA 2EILE 4J7WA 1H6KA 4ANVA 2WB2A 3S7FA 2JEKA 1SW6A 1QNFA 3AG3E 2WXOA 1JCRA 3DXMG 4GTVA 4A63B 3DPDA 2VGYA 1UJJA 2IOLA 3TJPA 1MX6A 3LS8A 5FIOA 4AP2A 4HXIA 4RG9A 1YA0A 1PY1A 1GW6A 2WQ6A 4A3VA 3V30A 2P9UG 3B7TA 2A5EA 4HVBA 4LUNU 4RLYA 4UWGA 4EPZA 4N3AA 4E6HA 1IKND 4W9RA 4F53A 4I9CA 1LD8A 2IU1A 3AJIA 3BG0B 5HI7A 4JB8P 3ZVVA 1E8WA 2F8XK 1IYGA 3FU5A 3FH7A 2P9KG 2P9SG 4B93B 4GU5A 3CLJA 3HXBA 1K3ZD 5CBOA 4CGVA 2J9QA 3PZ4A 3RIBA 2C0LA 3JQ0A 2CG2A 5CMWA 2WMOA 2KBXA 3E32A 3DSXA 4B89A 2XEEA 3QKYA 2J4DA 3ULYA 4WNGA 3OXGA 4WWPA 2OCCE 5EX0A 4JVSA 1IQUA 3SNXA 4OAUC 4WNEA 4IULA 1FT2A 4F7AA 4TUUA 1DC2A 3J5QB 1OCCE 5KJMA 3FY4A 3NB2A 5HS0A 3SHFA 2GGFA 3UI2A 3OXFA 4ILIA 3QB2A 4F1SA 3O48A 1OCZE 5JJ6A 4HOUA 2IFUA 3C3OA 1HF8A 3QJZA 1MQSA 4U63A 5HKPA 5DIZA 2X3MA 1TN8A 3C72A 3UKRG 5LP0A 3E34A 4CT0A 5AQ7A 4G8KA 3RKVA 3HDXA 3FUMA 4NURA 2HR2A 4GTSA 2I6HA 3HXEA 4LSZE 4UWHA 4JPSA 3Q5MA 3SBSA 5D2MC 4ANUA 4C9BB 3AG2E 2EIJE 2IY0C 1WY6A 2JABA 2KCVA 3FWVA 1TNUA 4TXRA 2PNNA 3ABME 3X2QE 3ABLE 4KXKB 5JJTA 3CHQA 3PREA 3R7RA 5BPPA 3BQOA 2WXFA 3JUIA 1BI7B 3UIPC 1IHBA 4GZDA 1OWPA 3KS2A 3AS8A 4DX7D 3J5PA 1N4RA 2LAIA 2J09A 2PM7A 2XCCA 4DUIA 3D9HA 2HYZA 4JA7A 3DSTA 1N95A 3CQCB 1JCSA 4HS2A 5LX8A 5AENA 5FWQA 5FQ8A 5JHAA 3GZSA 4WWOA 1UN8A 3PE4A 4GTOA 2OV8A 3CK7A 3PZDA 1EYHA 2ZGDA 3TWSA 5G04J 2VYIA 1KZOA 1KLXA 1D8EA 2R2LA 4ILGA 3KEZA 4RSYA 5KJLA 5FINA 1G3NB 2L6JA 2WXPA 3FTVA 3MJWA 1UG3A 4FULA 2ZIRA 3GZ1A 3Q9UC 5A23A 1TJCA 3ZGQA 3CHSA 4I2WA 4WWNA 4LERA 1QYMA 5AN8A 3KEAA 2L9BA 1OY3D 3CVVA 2WMNA 5FZQA 5AARA 3LY7A 3SO8A 3ASHA 1OT8A 2GRRB 4H7XA 2R02A 4UQXA 3B7RL 3ZYLA 4A55A 4CYMD 5T4YA 1DCEA 3PZ2A 2H6IA 5ENSD 2KZTB 3I3NA 3HVEA 5BT1A 5JJ7A 4M7CA 4NIKA 1Y6IA 2P9NG 3NBNB 3ONKA 5E75A 4APFA 4LNGA 4YDYA 1SVXA 3PNLB 3WG7E 3FH5A 3TG4A 2NXPA 2BKGA 4LCTA 3NOGD 4OAVB 5ARFA 2WM9A 5HRYA 4CZ2D 3D9JA 5FQ6A 3ISMC 4WNFA 3U9WA 4PUCA 2XCBA 2R03A 3ML9A 3FU3A 3EHRA 3MKRA 3UM3A 4Z68A 4OYSA 1H6PA 2V0PA 4MBGA 5BV0A 5BW8C 5DBKA 1TNOA 3PEVB 3RK6A 4HOTA 4UI9K 4YNDA 1IXVA 3ULQA 4ACKA 2DCPA 5J08A 3B7BA 2RD0A 2XQ0A 3ZXPA 3EUVA 3FTUA 4KZCA 1H19A 1BI8B 3TWTA 3HXCA 2L0IA 3JQ1A 4I6JA 2LXMA 3E37A 2B0OE 1JWGA 4X8QA 2V4HC 1JUQA 4KVMA 4AY6A 1MX2A 3I5PA 5T8IA 2CFUA 4U95D 5ENQD 3ZYQA 2WXLA 2E0IA 3SD5A 4JL0A 1X81A 1ELKA 5FT9A 3SI5A 4NACA 3CIAA 3ZHEA 5EYLA 3S2AA 1BLXB 1SZ9A 2V5QC 3ZHEB 3ASFA 2C2LA 2BF0X 4I1OB 1HG2A 4IRUA 4I43A 3E33A 2CG3A 4BSXA 2J07A 4OVUA 2HE0A 4GCOA 2YHEA 4M3OA 4DLOA 4CCAA 4P29A 3RO3A 3V31A 5M72A 4L9PA 3FH8A 3Q47B 4GZ5A 4OVVA 1INZA 5AAOA 2EINE 4ATGA 3S7JA 2BUGA 2KCKA 3BEEA 4C0MA 5FJYA 5G04C 4N39A 3ZPJA 3C5RA 3ENEA 4HORA 2A4ZA 5FZRA 2DWZA 1Z5SC 3SZ7A 4MS6A 4U04A 2JLBA 3SFXA 3UX4A 3T5VA 4QFVA 5ANLA 5T3RA 3HXFA 1K8KG 3JYSA 4U8YD 3LPZA 3MV3B 3LVQE 2AW6A 3W9FA 4DLQA 1V55E 3FP3A 3L54A 2XPYA 3RRNB 4GTTA 1BD8A 4L7TA 3TGOA 4MKTA 5JHBA 1NA0A 4KBQA 1KPSB 4JD2G 3CVYA 4TXQA 4XKCA 3PNTB 4A1SA 3NAWA 3QK0A 1H2VC 3EIQC 3NF1A 3NZUA 4FHJA 4CRWA 5AJDA 4CDNA 3LDZA 5BV1A 4U96D 3DSUA 3L08A 3AG1E 3RRMB 3RSEG 2V5FA 2VTBA 3OAWA 2XPIA 2VGXA 4L2YA 3I4GA 4AM9A 3CVPA 2WXIA 3PUKA 5ENRD 3TWQA 2MYOA 4JW1A 4XX5A 1OXJA 4U8VD 3MGBA 4EZKA 2CHXA 2PZIA 2DYRE 2ZXWE 4EHMA 1HFAA 5LOZA 3OXLA 3DSSA 3C3RA 3ZEFA 1WM5A 4GA0A 4I2ZA 4EBAA 1HZ4A 2XGOA 4GZCA 1O1SA 2BTDA 2GRNB 5CRVA 2KATA 1AWCB 3CGHA 3TWWA 1OCOE 4AVXA 4GA2A 2V4LA 1TNYA 1SZAA 2ZGGA 3L17A 4KMOA 4IN3B 3EU9A 3LVRE 2WVIA 3TXNA 3QOUA 4FU3A 4ANWA 5CEAA 1MZCA 3QDNA 3TL5A 3V79K 3L16A 1PAQA 5BNWA 2PM6A 3PDNA 3DSVA 4D10C 2HO1A 2UWJG 3UUXA 2P9IG 1N11A 2WQHA 2XEVA 4LNBA 1NP7A 3FUEA 1Q2ZA 1SQMA 4J8EA 1P5QA 4TUMA 4L23A 5B3SE 4F3VA 3SQVA 3EHMA 4K5CA 5G55A 2Y69E 4J8SA 4FJZA 3ONLA 2LSUA 4JC8A 4C0EA 4R7LA 4CDMA 3VTYA 1PC2A 4ME2A 1IQRA 4JA9A 4FHKA 4GCNA 5AJLA 2A5UA 3ESKA 5CERB 1S64A 3LJNA 4G26A 1V54E 2F8YA 3IHYA 4PH4B 2ONDA 5ANRA 2Y4UA 4KYOB 3ZYMA 1MYOA 5CEDB 4YVOA 2V8SE 3RO2A 3FUIA 4YVQC 2Y4TA 1TNBA 4N5CA 1SA4A 5KBAA 3RU0A 5FTPA 3C3QA 5ARGA 5AIJA 3P2BA 3CKBA 3DWLG 4N3BA 2X6IA 4GMJA 3PH0C 2GRPB 3KSLA 1HU3A 2RFMA 2XS1A 3ASDA 1ZBPA 4K5BA 2KZTA 3UINC 2XZTG 4CEMA 4U0ZA 4APOA 5EKQD 1E7UA 1DNPA 2E2EA 4DJAA 2DIWA 3UPVA 3MYVA 1NA3A 2KCLA 1ZB1A 5LCWC 4HNAD 1U3CA 2VSXE 4GTRA 3DBSA 5CBNA 3FUNA 3CHPA 3B95A 3ZUVB 3CVLA 2VGXB 3AS5A 4MRUA 3E4BA 4UI9C 2X38A 3G2VA 4EECA 3PZ3A 3SF4A 3T9KA 2YINA 3UT7A 3EDTB 3NZSA 3AAAC 4BEPA 4I6GA 2EQXA 3KD7A 2IONA 5D0QD 3SFZA 1JCQA 3T8MA 3HHMA 1N4SA 2GROB 3ASOE 1IHGA 1N52A 3DEPA 1QZ2A 4K03A 4Y6WA 2R17C 2AXUA 3D9MA 1L5JA 2J8SD 1EPUA 1NFIE 5C1DA 3AG4E 4FJYA 2AXVA 3APFA 2NSZA 3Q15A 4AXHA 4BY6A 3E30A 2LNIA 3G2SA 4GZ6A 1TN6A 3EJNA 3Q7FA 5D66A 2LAHA 4J0UA 4GAAA 3K9IA 4BX8A 2HM8A 2LUHA 4G11A 5G05C 2YHCA 1ZU2A 2WXNA 5IY5E 2EIME 1N54A 4N3CA 4HLLA 1WDYA 3ZRHA 3Q78A 4TXPA 4V3IA 3IBEA 2IOSA 3UMVA 4CT4A 5KCMA 4U0SA 4PS3A 3PE3A 3O4ZA 4C48B 2GRMA 5CRUA 3L13A 2L6BA 5G05J 3HXDA 1Y8MA 3CVQA 4RQIA 3CVXA 2XRYA 2IF4A 4AIFA 1K1BA 5ENNA 3NOCD 3JXIA 1X5BA 3FUKA 1B89A 4G2VA 4K5AB 4YDEA 3UQ3A 1AP7A 2NYJA 4TV3A 4ZHBA 2KM4A 1NZNA 3CR3A 2FO1E 3L6AA 4BSZB 3U66A 3UM0A 3APCA 1OWNA 3SY2A 2LSVA 3D3MA 4YDWA 5KNGA 4UWKA 4GPMA 3IHVA 2XRZA 1DCQA 1LTXA 3KSQA 2H6HA 2VSNA 1HO8A 2R5SA 3BUAA 3QAQA 2LXLA 3PS6A 3APDA 4HLEA 3P1UA 2KXPC 4G25A 3GYZA 4GYWA 4DI4A 1TEZA 3CVNA 3NQPA 3WXXA 3BU8A 2ZISA 1NL4A 1KZPA 3ASNE 3IXEA 4B94A 2C0MA 3FUJA 3UM2A 4HOQA 3EHQA 3D9IA 3MV2B 2IQCA 2VQ2A 5BXUA 5KWDA 4A1GA 3RJVA 3ZU7B 3FHEA 3RAUA 1QQEA 3HRAA 4PS8A 3S7BA 3UKUG 3QNKA 2BEDA 3ULEG 4AV7A 4AEZC 3ZN3A 3AU4A 3DSWA 3URZA 4BERA 4J6IA 2X6KA 1A17A 5C2YA 3SBTB 2OEVA 2YNQA 2CHZA 4DX2A 3L22A 4UQZA 2QZAA 2XS8A 1WAO1 2B6CA 1YCSB 2AXZA 2WXMA 1TJFA 2RG8A 4XIFA 1MJ0A 5LCWJ 3CVUA 3Q9NC 4GTMA 3U64A 5AQ9A 5EDSA 4MLPA 4J8FA 4BTBA 2DZOA 4EZJA 4O60A 5KJNA 4BT8A 1HE8A 1RZ4A 4QQIA 4HFGA 3QC1A 3UT8A 4CGWA 2NC9A 4JHRA 1DVPA 2ETCA 4Q69A 3MKQA 4KZ0A 3TWVA 3TAXA 4U07A 4PS7A 4UWLA 2XEHA 2X6JA 5AQBA 3B7SA 2QFCA 2FULA 2I9CA 5LFAA 4U0UA 4I6EA 3W9GA 3CKCA 5CCLA 4F1PA 5JA4D 4LG6A 3IEGA 2Y3AA 4DRXE 2WXGA 4K0RA 1E8YA 3MA5A 3HVEB 3MX3A 1D8DA 2F0YA 4IYPA 5A6CA 4UWFA 3HG0D 1E8ZA 1E96B 4B8CB 3VLFA 3AU5A 3FDHA 3SFYA 3UIOC 2VGEA 4AOFA 5ENPD 4NRHB 1S63A 3CK8A 3D9NA 2QYJA 2WXHA 3PVLA 2OEWA 2Y0BG 5ENOD 3FFLA 2XPZA 1H6OA 2GW1A 3LJ3A 2VSYA 2XGMA 2P58C 2OVFA 3R9MA 3Q49B 4HB5A 5EILA 2PQRA 3FTZA 4HOSA 4HI8A 3ZXSA 1HX8A 2CFZA 2P9PG 1HS6A 1OWLA 4XEIG 3CVWA 2AWIA 3UTMA 3ZNGA 1N0RA 3ASGA 3PZ1A 2PQNA 5FZSA 4N5QA 5CMYA 2WQ7A 5D0OD 3L82A 2QYUA 2RKKA 3R7QA 4WNDA 5AQAA 3DRAA 1FT1A 2RFAA 4DI3A 1QBQA 3IKOB 3B13A 3QWPA 3G2WA 4GTPA 4O1PA 5CECB 2FO7A 1E7VA 1A5EA 3PUJA 3QARA 1H0AA 1N94A 3EIJA 3I4RB 3FTSA 3TWXA 5HQ8A 1HH8A 4BTAA 4UI9J 3HYMB 3ZKJA 1K1AA 4HBDA 4G1TA 3EU5A 4FLHA 4JHJA 3TXMA 4UUCA 1OWOA 4JXTA 2QC9A 3QWWA 2WXRA 2I1KA 3FUHA 3ML8A 3T8KA 4G24A 2H6GA 2I2OA 4XE0A 3KAEA 2P2CP 4G8LA 1ELWA 2H6FA 3DEOA 5JMND 1UW4B 3IV0A 1KT0A 3LY8A 4BT9A 5ITZF 2Y1LE 1EDUA 3VTXA 5B1BE 3JUEA 2R59A 4EZLA 1ELRA 4EBAG 1LD7A 4WUYA 3LCAA 3ZW3A 4DX1A 5J90A 2J4BA 1H2TC 4XI9A 4BESA 1E90A 1MX4A 5FQ4A 2ILRA 3CHMA 4G23A 3JCKC 3ZIMA 2FF4A 1FVFA 2MOWA 3GZ2A 2PL2A 2WXQA 2UY1B 3CEQA 2WPVA 1FVHA 4FADA 5EX3A 4NQ0A 2VTBB 3FTWA 2R05A 1O1RA 3CSFA 4LEUA 4TRQA 2AJAA 3N71A 3FTYA 3UT4A 1SA5A 3LY9A 1JPLA 3CV0A 2WXJA 2LO6A 4HRNA 4N2QA 3GW4A 4JHKA 5B1AE 1D9SA 4HI9A 3FEXA 2CHWA 4PDXA 3ZFWA 5FQ7A 3U4TA 1N0QA 3D9PA 1FCHA 2ETAA 1Z3YA 4Y6CA 1WG0A 1FPPA 5A7DB 3DXKG 2FI7A 2DBAA 4BFRA 3Q7AA 5ENTD 5H7PA 4I9EA 3R9AB 1OUVA 1TYQG 5EIDA 2IO3C 3Q75A 3G2TA 3VLEA 4HQDA 3UXGA 4LRZA 1TR4A 1E8XA 4E85A 1Z6TA 2EIKE 3RRUA 3EHNA 3ZYKA 5KNHD 5CCMA 1U2VG 3F6QA 3L9TA 4KT6B 4L1BA 4JZYA 1H2UA 2Q7FA 4GB9A 3T5XA 4GZ3A 3MCXA 3Q79A 4KVOA 3D9KA 1MHQA 4Q94A 1OCRE 2J49A 4F6RD 4A3TA 3S7DA 1LF8A 2XHEA 3AS4A 1BU9A 1TNZA 2ETBA 3HIZA 1N4PA 3LYAA 3SGHA 4AY5A 2KC7A 4EQFA 4GPKA 1OWMA 3BG1B 2F37A 1NI1A 3B7UX 2FEZA 4URKA 4ATZD 4YDOA 1RW2A 2L0TB 3ESLA 1S70B 4GA1A 3UM1A 1U3DA 1TN7A 4GMLA 4XZ4A 4B0ZA 3PEUB 4FLBA 4UQYA 2OVBA 1HXIA 1YMPA 3CHOA 4CDRA 1EF1C 2YQ8A 2DZNA 4AJWA 3FUDA 3VLDA 4ZFHA 2MRIA 1Z3XA 3C98A 1KT1A 3CHRA 2IO2C 2J08A 4XKBA 5EN5D 1XNFA 2X6FA 5E76A 4ACLA 4I1AA 4Q96A 4L2LA 4HRMB 3Q4AB 2GRLA 4DPRA 1HG5A 3MEKA 3FU0A 3TWRA 4FA6A 4DX5D 4B8AA 2VJ8A 4LNUD 5BUZA 4ILHB 3CQGB 5EIBE 2GRQB 2I1JA 1N4QA 4I17A 4ANXA 2WXKA 4U8HA 2XZDG 3ABKE 2UY1A 3QWVA 2DYSE 2M63A 2P9LG 4J8DA 4JEHA 1O5MA 4FP7A 3FUFA 4I1MA 3V2XA 2XGSA 3TWUA 4GMRA 1UOHA 3FULA 3V2OA 4BETA 1W3BA 2IJGX 4XI0A 4RVBA 1YYHA 4RG6A 3CK9A 2DVWA 3D9OA
chains in the Genus database with same CATH topology
1TN6A 3Q7FA 4LNBA 1KZOA 4GTMA 3Q75A 1D8EA 2R2LA 1LTXA 3DSUA 1TN8A 1LD7A 2H6HA 3C72A 3E34A 3KSQA 2IEJA 4L9PA 1O1TA 4GTSA 4MBGA 2ZIRA 3HXEA 4GTQA 1LD8A 1TNOA 4GTRA 3Q73A 2ZISA 3PZ1A 1NL4A 1KZPA 3Q78A 4EHMA 3Q79A 3PZ3A 3DSSA 3EUVA 1N9AA 1TNUA 3HXBA 3DRAA 1FT1A 3PZ4A 1S64A 3HXCA 3DPYA 1QBQA 3SFXA 1O1RA 3E37A 1N4QA 1TNZA 1DCEA 1JCQA 3HXFA 1O1SA 3PZ2A 3HXDA 1N4SA 2H6IA 1SA5A 4GTPA 1N4PA 3E32A 1N4RA 1TNBA 3DSXA 2BEDA 1O5MA 1SA4A 1N94A 1TNYA 1X81A 1D8DA 4YDEA 2F0YA 3DSTA 3EU5A 3DSWA 1NI1A 1N95A 4GTTA 4LNGA 4YDOA 1FT2A 1JCSA 1JCRA 1FPPA 2H6GA 4GTVA 3SFYA 1MZCA 3KSLA 3E30A 1TN7A 2H6FA 3Q7AA 1S63A 3DSVA 4GTOA 3E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN6 A;  3Q7F A;  4LNB A;  1KZO A;  4GTM A;  3Q75 A;  1D8E A;  2R2L A;  1LTX A;  3DSU A;  1TN8 A;  1LD7 A;  2H6H A;  3C72 A;  3E34 A;  3KSQ A;  2IEJ A;  4L9P A;  1O1T A;  4GTS A;  4MBG A;  2ZIR A;  3HXE A;  4GTQ A;  1LD8 A;  1TNO A;  4GTR A;  3Q73 A;  2ZIS A;  3PZ1 A;  1NL4 A;  1KZP A;  3Q78 A;  4EHM A;  3Q79 A;  3PZ3 A;  3DSS A;  3EUV A;  1N9A A;  1TNU A;  3HXB A;  3DRA A;  1FT1 A;  3PZ4 A;  1S64 A;  3HXC A;  3DPY A;  1QBQ A;  3SFX A;  1O1R A;  3E37 A;  1N4Q A;  1TNZ A;  1DCE A;  1JCQ A;  3HXF A;  1O1S A;  3PZ2 A;  3HXD A;  1N4S A;  2H6I A;  1SA5 A;  4GTP A;  1N4P A;  3E32 A;  1N4R A;  1TNB A;  3DSX A;  2BED A;  1O5M A;  1SA4 A;  1N94 A;  1TNY A;  1X81 A;  1D8D A;  4YDE A;  2F0Y A;  3DST A;  3EU5 A;  3DSW A;  1NI1 A;  1N95 A;  4GTT A;  4LNG A;  4YDO A;  1FT2 A;  1JCS A;  1JCR A;  1FPP A;  2H6G A;  4GTV A;  3SFY A;  1MZC A;  3KSL A;  3E30 A;  1TN7 A;  2H6F A;  3Q7A A;  1S63 A;  3DSV A;  4GTO A;  3E33 A; 
#chains in the Genus database with same CATH topology
 1XGW A;  2ZU6 B;  5EYP F;  3TG5 A;  2BKK B;  2OOE A;  2VSO E;  2IEJ A;  5BXO A;  1BPO A;  4BX9 A;  3MZL B;  1O1T A;  4GTQ A;  5AYW D;  4H7Y A;  1UN9 A;  2FBN A;  4DK5 A;  3FTX A;  1VDY A;  3Q73 A;  3CST A;  4GYY A;  3FEY A;  3MKQ B;  4U7E B;  3LEW A;  2XEN A;  3LXU X;  1JWF A;  1S0P A;  5CHE E;  4WAF A;  4GYO A;  2AVP A;  4O6F A;  4O1O A;  1N9A A;  3JXJ A;  4BWR A;  4FC8 A;  3DPY A;  3FU6 A;  4HRL A;  4DX6 D;  5G2N A;  5KJK A;  4J8Y A;  4JEU A;  4ABN A;  2X6H A;  2QY7 A;  4N2S A;  3D9L A;  3OTN A;  1UJK A;  3LKU A;  2MHK A;  3U3W A;  3PRZ A;  3G2U A;  2EIL E;  4J7W A;  1H6K A;  4ANV A;  2WB2 A;  3S7F A;  2JEK A;  1SW6 A;  1QNF A;  3AG3 E;  2WXO A;  1JCR A;  3DXM G;  4GTV A;  4A63 B;  3DPD A;  2VGY A;  1UJJ A;  2IOL A;  3TJP A;  1MX6 A;  3LS8 A;  5FIO A;  4AP2 A;  4HXI A;  4RG9 A;  1YA0 A;  1PY1 A;  1GW6 A;  2WQ6 A;  4A3V A;  3V30 A;  2P9U G;  3B7T A;  2A5E A;  4HVB A;  4LUN U;  4RLY A;  4UWG A;  4EPZ A;  4N3A A;  4E6H A;  1IKN D;  4W9R A;  4F53 A;  4I9C A;  1LD8 A;  2IU1 A;  3AJI A;  3BG0 B;  5HI7 A;  4JB8 P;  3ZVV A;  1E8W A;  2F8X K;  1IYG A;  3FU5 A;  3FH7 A;  2P9K G;  2P9S G;  4B93 B;  4GU5 A;  3CLJ A;  3HXB A;  1K3Z D;  5CBO A;  4CGV A;  2J9Q A;  3PZ4 A;  3RIB A;  2C0L A;  3JQ0 A;  2CG2 A;  5CMW A;  2WMO A;  2KBX A;  3E32 A;  3DSX A;  4B89 A;  2XEE A;  3QKY A;  2J4D A;  3ULY A;  4WNG A;  3OXG A;  4WWP A;  2OCC E;  5EX0 A;  4JVS A;  1IQU A;  3SNX A;  4OAU C;  4WNE A;  4IUL A;  1FT2 A;  4F7A A;  4TUU A;  1DC2 A;  3J5Q B;  1OCC E;  5KJM A;  3FY4 A;  3NB2 A;  5HS0 A;  3SHF A;  2GGF A;  3UI2 A;  3OXF A;  4ILI A;  3QB2 A;  4F1S A;  3O48 A;  1OCZ E;  5JJ6 A;  4HOU A;  2IFU A;  3C3O A;  1HF8 A;  3QJZ A;  1MQS A;  4U63 A;  5HKP A;  5DIZ A;  2X3M A;  1TN8 A;  3C72 A;  3UKR G;  5LP0 A;  3E34 A;  4CT0 A;  5AQ7 A;  4G8K A;  3RKV A;  3HDX A;  3FUM A;  4NUR A;  2HR2 A;  4GTS A;  2I6H A;  3HXE A;  4LSZ E;  4UWH A;  4JPS A;  3Q5M A;  3SBS A;  5D2M C;  4ANU A;  4C9B B;  3AG2 E;  2EIJ E;  2IY0 C;  1WY6 A;  2JAB A;  2KCV A;  3FWV A;  1TNU A;  4TXR A;  2PNN A;  3ABM E;  3X2Q E;  3ABL E;  4KXK B;  5JJT A;  3CHQ A;  3PRE A;  3R7R A;  5BPP A;  3BQO A;  2WXF A;  3JUI A;  1BI7 B;  3UIP C;  1IHB A;  4GZD A;  1OWP A;  3KS2 A;  3AS8 A;  4DX7 D;  3J5P A;  1N4R A;  2LAI A;  2J09 A;  2PM7 A;  2XCC A;  4DUI A;  3D9H A;  2HYZ A;  4JA7 A;  3DST A;  1N95 A;  3CQC B;  1JCS A;  4HS2 A;  5LX8 A;  5AEN A;  5FWQ A;  5FQ8 A;  5JHA A;  3GZS A;  4WWO A;  1UN8 A;  3PE4 A;  4GTO A;  2OV8 A;  3CK7 A;  3PZD A;  1EYH A;  2ZGD A;  3TWS A;  5G04 J;  2VYI A;  1KZO A;  1KLX A;  1D8E A;  2R2L A;  4ILG A;  3KEZ A;  4RSY A;  5KJL A;  5FIN A;  1G3N B;  2L6J A;  2WXP A;  3FTV A;  3MJW A;  1UG3 A;  4FUL A;  2ZIR A;  3GZ1 A;  3Q9U C;  5A23 A;  1TJC A;  3ZGQ A;  3CHS A;  4I2W A;  4WWN A;  4LER A;  1QYM A;  5AN8 A;  3KEA A;  2L9B A;  1OY3 D;  3CVV A;  2WMN A;  5FZQ A;  5AAR A;  3LY7 A;  3SO8 A;  3ASH A;  1OT8 A;  2GRR B;  4H7X A;  2R02 A;  4UQX A;  3B7R L;  3ZYL A;  4A55 A;  4CYM D;  5T4Y A;  1DCE A;  3PZ2 A;  2H6I A;  5ENS D;  2KZT B;  3I3N A;  3HVE A;  5BT1 A;  5JJ7 A;  4M7C A;  4NIK A;  1Y6I A;  2P9N G;  3NBN B;  3ONK A;  5E75 A;  4APF A;  4LNG A;  4YDY A;  1SVX A;  3PNL B;  3WG7 E;  3FH5 A;  3TG4 A;  2NXP A;  2BKG A;  4LCT A;  3NOG D;  4OAV B;  5ARF A;  2WM9 A;  5HRY A;  4CZ2 D;  3D9J A;  5FQ6 A;  3ISM C;  4WNF A;  3U9W A;  4PUC A;  2XCB A;  2R03 A;  3ML9 A;  3FU3 A;  3EHR A;  3MKR A;  3UM3 A;  4Z68 A;  4OYS A;  1H6P A;  2V0P A;  4MBG A;  5BV0 A;  5BW8 C;  5DBK A;  1TNO A;  3PEV B;  3RK6 A;  4HOT A;  4UI9 K;  4YND A;  1IXV A;  3ULQ A;  4ACK A;  2DCP A;  5J08 A;  3B7B A;  2RD0 A;  2XQ0 A;  3ZXP A;  3EUV A;  3FTU A;  4KZC A;  1H19 A;  1BI8 B;  3TWT A;  3HXC A;  2L0I A;  3JQ1 A;  4I6J A;  2LXM A;  3E37 A;  2B0O E;  1JWG A;  4X8Q A;  2V4H C;  1JUQ A;  4KVM A;  4AY6 A;  1MX2 A;  3I5P A;  5T8I A;  2CFU A;  4U95 D;  5ENQ D;  3ZYQ A;  2WXL A;  2E0I A;  3SD5 A;  4JL0 A;  1X81 A;  1ELK A;  5FT9 A;  3SI5 A;  4NAC A;  3CIA A;  3ZHE A;  5EYL A;  3S2A A;  1BLX B;  1SZ9 A;  2V5Q C;  3ZHE B;  3ASF A;  2C2L A;  2BF0 X;  4I1O B;  1HG2 A;  4IRU A;  4I43 A;  3E33 A;  2CG3 A;  4BSX A;  2J07 A;  4OVU A;  2HE0 A;  4GCO A;  2YHE A;  4M3O A;  4DLO A;  4CCA A;  4P29 A;  3RO3 A;  3V31 A;  5M72 A;  4L9P A;  3FH8 A;  3Q47 B;  4GZ5 A;  4OVV A;  1INZ A;  5AAO A;  2EIN E;  4ATG A;  3S7J A;  2BUG A;  2KCK A;  3BEE A;  4C0M A;  5FJY A;  5G04 C;  4N39 A;  3ZPJ A;  3C5R A;  3ENE A;  4HOR A;  2A4Z A;  5FZR A;  2DWZ A;  1Z5S C;  3SZ7 A;  4MS6 A;  4U04 A;  2JLB A;  3SFX A;  3UX4 A;  3T5V A;  4QFV A;  5ANL A;  5T3R A;  3HXF A;  1K8K G;  3JYS A;  4U8Y D;  3LPZ A;  3MV3 B;  3LVQ E;  2AW6 A;  3W9F A;  4DLQ A;  1V55 E;  3FP3 A;  3L54 A;  2XPY A;  3RRN B;  4GTT A;  1BD8 A;  4L7T A;  3TGO A;  4MKT A;  5JHB A;  1NA0 A;  4KBQ A;  1KPS B;  4JD2 G;  3CVY A;  4TXQ A;  4XKC A;  3PNT B;  4A1S A;  3NAW A;  3QK0 A;  1H2V C;  3EIQ C;  3NF1 A;  3NZU A;  4FHJ A;  4CRW A;  5AJD A;  4CDN A;  3LDZ A;  5BV1 A;  4U96 D;  3DSU A;  3L08 A;  3AG1 E;  3RRM B;  3RSE G;  2V5F A;  2VTB A;  3OAW A;  2XPI A;  2VGX A;  4L2Y A;  3I4G A;  4AM9 A;  3CVP A;  2WXI A;  3PUK A;  5ENR D;  3TWQ A;  2MYO A;  4JW1 A;  4XX5 A;  1OXJ A;  4U8V D;  3MGB A;  4EZK A;  2CHX A;  2PZI A;  2DYR E;  2ZXW E;  4EHM A;  1HFA A;  5LOZ A;  3OXL A;  3DSS A;  3C3R A;  3ZEF A;  1WM5 A;  4GA0 A;  4I2Z A;  4EBA A;  1HZ4 A;  2XGO A;  4GZC A;  1O1S A;  2BTD A;  2GRN B;  5CRV A;  2KAT A;  1AWC B;  3CGH A;  3TWW A;  1OCO E;  4AVX A;  4GA2 A;  2V4L A;  1TNY A;  1SZA A;  2ZGG A;  3L17 A;  4KMO A;  4IN3 B;  3EU9 A;  3LVR E;  2WVI A;  3TXN A;  3QOU A;  4FU3 A;  4ANW A;  5CEA A;  1MZC A;  3QDN A;  3TL5 A;  3V79 K;  3L16 A;  1PAQ A;  5BNW A;  2PM6 A;  3PDN A;  3DSV A;  4D10 C;  2HO1 A;  2UWJ G;  3UUX A;  2P9I G;  1N11 A;  2WQH A;  2XEV A;  4LNB A;  1NP7 A;  3FUE A;  1Q2Z A;  1SQM A;  4J8E A;  1P5Q A;  4TUM A;  4L23 A;  5B3S E;  4F3V A;  3SQV A;  3EHM A;  4K5C A;  5G55 A;  2Y69 E;  4J8S A;  4FJZ A;  3ONL A;  2LSU A;  4JC8 A;  4C0E A;  4R7L A;  4CDM A;  3VTY A;  1PC2 A;  4ME2 A;  1IQR A;  4JA9 A;  4FHK A;  4GCN A;  5AJL A;  2A5U A;  3ESK A;  5CER B;  1S64 A;  3LJN A;  4G26 A;  1V54 E;  2F8Y A;  3IHY A;  4PH4 B;  2OND A;  5ANR A;  2Y4U A;  4KYO B;  3ZYM A;  1MYO A;  5CED B;  4YVO A;  2V8S E;  3RO2 A;  3FUI A;  4YVQ C;  2Y4T A;  1TNB A;  4N5C A;  1SA4 A;  5KBA A;  3RU0 A;  5FTP A;  3C3Q A;  5ARG A;  5AIJ A;  3P2B A;  3CKB A;  3DWL G;  4N3B A;  2X6I A;  4GMJ A;  3PH0 C;  2GRP B;  3KSL A;  1HU3 A;  2RFM A;  2XS1 A;  3ASD A;  1ZBP A;  4K5B A;  2KZT A;  3UIN C;  2XZT G;  4CEM A;  4U0Z A;  4APO A;  5EKQ D;  1E7U A;  1DNP A;  2E2E A;  4DJA A;  2DIW A;  3UPV A;  3MYV A;  1NA3 A;  2KCL A;  1ZB1 A;  5LCW C;  4HNA D;  1U3C A;  2VSX E;  4GTR A;  3DBS A;  5CBN A;  3FUN A;  3CHP A;  3B95 A;  3ZUV B;  3CVL A;  2VGX B;  3AS5 A;  4MRU A;  3E4B A;  4UI9 C;  2X38 A;  3G2V A;  4EEC A;  3PZ3 A;  3SF4 A;  3T9K A;  2YIN A;  3UT7 A;  3EDT B;  3NZS A;  3AAA C;  4BEP A;  4I6G A;  2EQX A;  3KD7 A;  2ION A;  5D0Q D;  3SFZ A;  1JCQ A;  3T8M A;  3HHM A;  1N4S A;  2GRO B;  3ASO E;  1IHG A;  1N52 A;  3DEP A;  1QZ2 A;  4K03 A;  4Y6W A;  2R17 C;  2AXU A;  3D9M A;  1L5J A;  2J8S D;  1EPU A;  1NFI E;  5C1D A;  3AG4 E;  4FJY A;  2AXV A;  3APF A;  2NSZ A;  3Q15 A;  4AXH A;  4BY6 A;  3E30 A;  2LNI A;  3G2S A;  4GZ6 A;  1TN6 A;  3EJN A;  3Q7F A;  5D66 A;  2LAH A;  4J0U A;  4GAA A;  3K9I A;  4BX8 A;  2HM8 A;  2LUH A;  4G11 A;  5G05 C;  2YHC A;  1ZU2 A;  2WXN A;  5IY5 E;  2EIM E;  1N54 A;  4N3C A;  4HLL A;  1WDY A;  3ZRH A;  3Q78 A;  4TXP A;  4V3I A;  3IBE A;  2IOS A;  3UMV A;  4CT4 A;  5KCM A;  4U0S A;  4PS3 A;  3PE3 A;  3O4Z A;  4C48 B;  2GRM A;  5CRU A;  3L13 A;  2L6B A;  5G05 J;  3HXD A;  1Y8M A;  3CVQ A;  4RQI A;  3CVX A;  2XRY A;  2IF4 A;  4AIF A;  1K1B A;  5ENN A;  3NOC D;  3JXI A;  1X5B A;  3FUK A;  1B89 A;  4G2V A;  4K5A B;  4YDE A;  3UQ3 A;  1AP7 A;  2NYJ A;  4TV3 A;  4ZHB A;  2KM4 A;  1NZN A;  3CR3 A;  2FO1 E;  3L6A A;  4BSZ B;  3U66 A;  3UM0 A;  3APC A;  1OWN A;  3SY2 A;  2LSV A;  3D3M A;  4YDW A;  5KNG A;  4UWK A;  4GPM A;  3IHV A;  2XRZ A;  1DCQ A;  1LTX A;  3KSQ A;  2H6H A;  2VSN A;  1HO8 A;  2R5S A;  3BUA A;  3QAQ A;  2LXL A;  3PS6 A;  3APD A;  4HLE A;  3P1U A;  2KXP C;  4G25 A;  3GYZ A;  4GYW A;  4DI4 A;  1TEZ A;  3CVN A;  3NQP A;  3WXX A;  3BU8 A;  2ZIS A;  1NL4 A;  1KZP A;  3ASN E;  3IXE A;  4B94 A;  2C0M A;  3FUJ A;  3UM2 A;  4HOQ A;  3EHQ A;  3D9I A;  3MV2 B;  2IQC A;  2VQ2 A;  5BXU A;  5KWD A;  4A1G A;  3RJV A;  3ZU7 B;  3FHE A;  3RAU A;  1QQE A;  3HRA A;  4PS8 A;  3S7B A;  3UKU G;  3QNK A;  2BED A;  3ULE G;  4AV7 A;  4AEZ C;  3ZN3 A;  3AU4 A;  3DSW A;  3URZ A;  4BER A;  4J6I A;  2X6K A;  1A17 A;  5C2Y A;  3SBT B;  2OEV A;  2YNQ A;  2CHZ A;  4DX2 A;  3L22 A;  4UQZ A;  2QZA A;  2XS8 A;  1WAO 1;  2B6C A;  1YCS B;  2AXZ A;  2WXM A;  1TJF A;  2RG8 A;  4XIF A;  1MJ0 A;  5LCW J;  3CVU A;  3Q9N C;  4GTM A;  3U64 A;  5AQ9 A;  5EDS A;  4MLP A;  4J8F A;  4BTB A;  2DZO A;  4EZJ A;  4O60 A;  5KJN A;  4BT8 A;  1HE8 A;  1RZ4 A;  4QQI A;  4HFG A;  3QC1 A;  3UT8 A;  4CGW A;  2NC9 A;  4JHR A;  1DVP A;  2ETC A;  4Q69 A;  3MKQ A;  4KZ0 A;  3TWV A;  3TAX A;  4U07 A;  4PS7 A;  4UWL A;  2XEH A;  2X6J A;  5AQB A;  3B7S A;  2QFC A;  2FUL A;  2I9C A;  5LFA A;  4U0U A;  4I6E A;  3W9G A;  3CKC A;  5CCL A;  4F1P A;  5JA4 D;  4LG6 A;  3IEG A;  2Y3A A;  4DRX E;  2WXG A;  4K0R A;  1E8Y A;  3MA5 A;  3HVE B;  3MX3 A;  1D8D A;  2F0Y A;  4IYP A;  5A6C A;  4UWF A;  3HG0 D;  1E8Z A;  1E96 B;  4B8C B;  3VLF A;  3AU5 A;  3FDH A;  3SFY A;  3UIO C;  2VGE A;  4AOF A;  5ENP D;  4NRH B;  1S63 A;  3CK8 A;  3D9N A;  2QYJ A;  2WXH A;  3PVL A;  2OEW A;  2Y0B G;  5ENO D;  3FFL A;  2XPZ A;  1H6O A;  2GW1 A;  3LJ3 A;  2VSY A;  2XGM A;  2P58 C;  2OVF A;  3R9M A;  3Q49 B;  4HB5 A;  5EIL A;  2PQR A;  3FTZ A;  4HOS A;  4HI8 A;  3ZXS A;  1HX8 A;  2CFZ A;  2P9P G;  1HS6 A;  1OWL A;  4XEI G;  3CVW A;  2AWI A;  3UTM A;  3ZNG A;  1N0R A;  3ASG A;  3PZ1 A;  2PQN A;  5FZS A;  4N5Q A;  5CMY A;  2WQ7 A;  5D0O D;  3L82 A;  2QYU A;  2RKK A;  3R7Q A;  4WND A;  5AQA A;  3DRA A;  1FT1 A;  2RFA A;  4DI3 A;  1QBQ A;  3IKO B;  3B13 A;  3QWP A;  3G2W A;  4GTP A;  4O1P A;  5CEC B;  2FO7 A;  1E7V A;  1A5E A;  3PUJ A;  3QAR A;  1H0A A;  1N94 A;  3EIJ A;  3I4R B;  3FTS A;  3TWX A;  5HQ8 A;  1HH8 A;  4BTA A;  4UI9 J;  3HYM B;  3ZKJ A;  1K1A A;  4HBD A;  4G1T A;  3EU5 A;  4FLH A;  4JHJ A;  3TXM A;  4UUC A;  1OWO A;  4JXT A;  2QC9 A;  3QWW A;  2WXR A;  2I1K A;  3FUH A;  3ML8 A;  3T8K A;  4G24 A;  2H6G A;  2I2O A;  4XE0 A;  3KAE A;  2P2C P;  4G8L A;  1ELW A;  2H6F A;  3DEO A;  5JMN D;  1UW4 B;  3IV0 A;  1KT0 A;  3LY8 A;  4BT9 A;  5ITZ F;  2Y1L E;  1EDU A;  3VTX A;  5B1B E;  3JUE A;  2R59 A;  4EZL A;  1ELR A;  4EBA G;  1LD7 A;  4WUY A;  3LCA A;  3ZW3 A;  4DX1 A;  5J90 A;  2J4B A;  1H2T C;  4XI9 A;  4BES A;  1E90 A;  1MX4 A;  5FQ4 A;  2ILR A;  3CHM A;  4G23 A;  3JCK C;  3ZIM A;  2FF4 A;  1FVF A;  2MOW A;  3GZ2 A;  2PL2 A;  2WXQ A;  2UY1 B;  3CEQ A;  2WPV A;  1FVH A;  4FAD A;  5EX3 A;  4NQ0 A;  2VTB B;  3FTW A;  2R05 A;  1O1R A;  3CSF A;  4LEU A;  4TRQ A;  2AJA A;  3N71 A;  3FTY A;  3UT4 A;  1SA5 A;  3LY9 A;  1JPL A;  3CV0 A;  2WXJ A;  2LO6 A;  4HRN A;  4N2Q A;  3GW4 A;  4JHK A;  5B1A E;  1D9S A;  4HI9 A;  3FEX A;  2CHW A;  4PDX A;  3ZFW A;  5FQ7 A;  3U4T A;  1N0Q A;  3D9P A;  1FCH A;  2ETA A;  1Z3Y A;  4Y6C A;  1WG0 A;  1FPP A;  5A7D B;  3DXK G;  2FI7 A;  2DBA A;  4BFR A;  3Q7A A;  5ENT D;  5H7P A;  4I9E A;  3R9A B;  1OUV A;  1TYQ G;  5EID A;  2IO3 C;  3Q75 A;  3G2T A;  3VLE A;  4HQD A;  3UXG A;  4LRZ A;  1TR4 A;  1E8X A;  4E85 A;  1Z6T A;  2EIK E;  3RRU A;  3EHN A;  3ZYK A;  5KNH D;  5CCM A;  1U2V G;  3F6Q A;  3L9T A;  4KT6 B;  4L1B A;  4JZY A;  1H2U A;  2Q7F A;  4GB9 A;  3T5X A;  4GZ3 A;  3MCX A;  3Q79 A;  4KVO A;  3D9K A;  1MHQ A;  4Q94 A;  1OCR E;  2J49 A;  4F6R D;  4A3T A;  3S7D A;  1LF8 A;  2XHE A;  3AS4 A;  1BU9 A;  1TNZ A;  2ETB A;  3HIZ A;  1N4P A;  3LYA A;  3SGH A;  4AY5 A;  2KC7 A;  4EQF A;  4GPK A;  1OWM A;  3BG1 B;  2F37 A;  1NI1 A;  3B7U X;  2FEZ A;  4URK A;  4ATZ D;  4YDO A;  1RW2 A;  2L0T B;  3ESL A;  1S70 B;  4GA1 A;  3UM1 A;  1U3D A;  1TN7 A;  4GML A;  4XZ4 A;  4B0Z A;  3PEU B;  4FLB A;  4UQY A;  2OVB A;  1HXI A;  1YMP A;  3CHO A;  4CDR A;  1EF1 C;  2YQ8 A;  2DZN A;  4AJW A;  3FUD A;  3VLD A;  4ZFH A;  2MRI A;  1Z3X A;  3C98 A;  1KT1 A;  3CHR A;  2IO2 C;  2J08 A;  4XKB A;  5EN5 D;  1XNF A;  2X6F A;  5E76 A;  4ACL A;  4I1A A;  4Q96 A;  4L2L A;  4HRM B;  3Q4A B;  2GRL A;  4DPR A;  1HG5 A;  3MEK A;  3FU0 A;  3TWR A;  4FA6 A;  4DX5 D;  4B8A A;  2VJ8 A;  4LNU D;  5BUZ A;  4ILH B;  3CQG B;  5EIB E;  2GRQ B;  2I1J A;  1N4Q A;  4I17 A;  4ANX A;  2WXK A;  4U8H A;  2XZD G;  3ABK E;  2UY1 A;  3QWV A;  2DYS E;  2M63 A;  2P9L G;  4J8D A;  4JEH A;  1O5M A;  4FP7 A;  3FUF A;  4I1M A;  3V2X A;  2XGS A;  3TWU A;  4GMR A;  1UOH A;  3FUL A;  3V2O A;  4BET A;  1W3B A;  2IJG X;  4XI0 A;  4RVB A;  1YYH A;  4RG6 A;  3CK9 A;  2DVW A;  3D9O A; 
#chains in the Genus database with same CATH homology
 1TN6 A;  3Q7F A;  4LNB A;  1KZO A;  4GTM A;  3Q75 A;  1D8E A;  2R2L A;  1LTX A;  3DSU A;  1TN8 A;  1LD7 A;  2H6H A;  3C72 A;  3E34 A;  3KSQ A;  2IEJ A;  4L9P A;  1O1T A;  4GTS A;  4MBG A;  2ZIR A;  3HXE A;  4GTQ A;  1LD8 A;  1TNO A;  4GTR A;  3Q73 A;  2ZIS A;  3PZ1 A;  1NL4 A;  1KZP A;  3Q78 A;  4EHM A;  3Q79 A;  3PZ3 A;  3DSS A;  3EUV A;  1N9A A;  1TNU A;  3HXB A;  3DRA A;  1FT1 A;  3PZ4 A;  1S64 A;  3HXC A;  3DPY A;  1QBQ A;  3SFX A;  1O1R A;  3E37 A;  1N4Q A;  1TNZ A;  1DCE A;  1JCQ A;  3HXF A;  1O1S A;  3PZ2 A;  3HXD A;  1N4S A;  2H6I A;  1SA5 A;  4GTP A;  1N4P A;  3E32 A;  1N4R A;  1TNB A;  3DSX A;  2BED A;  1O5M A;  1SA4 A;  1N94 A;  1TNY A;  1X81 A;  1D8D A;  4YDE A;  2F0Y A;  3DST A;  3EU5 A;  3DSW A;  1NI1 A;  1N95 A;  4GTT A;  4LNG A;  4YDO A;  1FT2 A;  1JCS A;  1JCR A;  1FPP A;  2H6G A;  4GTV A;  3SFY A;  1MZC A;  3KSL A;  3E30 A;  1TN7 A;  2H6F A;  3Q7A A;  1S63 A;  3DSV A;  4GTO A;  3E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...