1TN6A

Protein farnesyltransferase complexed with a rap2a peptide substrate and a fpp analog at 1.8a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tn6A00
1KZPA 3KSQA 4YDOA 1N4PA 4GTMA 1X81A 3DRAA 1N4RA 1LD8A 3Q75A 4LNGA 3DSVA 1TN6A 3HXCA 1TNYA 3C72A 3Q79A 1N9AA 1N95A 4GTOA 1FPPA 3HXDA 3PZ4A 3DSXA 3PZ3A 1O5MA 2ZIRA 3EUVA 1O1RA 1LD7A 3DPYA 1NI1A 1JCSA 1FT1A 1TN8A 1S63A 4GTVA 3DSSA 4GTTA 1LTXA 4GTQA 3E34A 1D8DA 4EHMA 3PZ2A 4LNBA 2H6HA 1SA4A 2IEJA 1NL4A 1N4SA 1TN7A 1TNUA 4GTRA 2H6GA 1O1TA 3DSUA 3HXBA 1N4QA 1O1SA 3PZ1A 4GTSA 1DCEA 1TNOA 1FT2A 2ZISA 3EU5A 1SA5A 3E33A 3HXFA 2BEDA 2R2LA 3DSWA 3Q78A 3Q73A 1QBQA 3Q7FA 1TNZA 1D8EA 3E32A 3E37A 3E30A 3DSTA 4YDEA 1JCRA 4L9PA 2H6IA 1TNBA 3SFYA 1N94A 1S64A 1JCQA 1MZCA 1KZOA 3HXEA 3KSLA 2F0YA 4GTPA 2H6FA 3Q7AA 4MBGA 3SFXA
chains in the Genus database with same CATH superfamily
3FDHA 2P9NG 1OCRE 2KZTA 2IONA 3IHVA 3ZU7B 3D9JA 3HDXA 4LSZE 2V5QC 3UM0A 3D9PA 1AP7A 4WAFA 3FU0A 3Q75A 1TN6A 2BUGA 2EILE 2I1KA 2P9UG 2WPVA 2FBNA 3F6QA 5AIJA 3IKOB 1HH8A 4W9RA 3BG1B 2CHWA 4GZDA 4OAUC 2DWZA 3PS6A 4GTRA 5G05C 5AQ9A 2QYJA 4H7YA 5FQ4A 2X3MA 4J8YA 3MX3A 3TAXA 3ESKA 3TWUA 3FH5A 5ANRA 2EIME 4Q94A 5FINA 1B89A 2PQNA 4GU5A 3Q7FA 2I1JA 3R7RA 4UI9C 3ZVVA 1MQSA 3G2UA 2AXVA 5A7DB 4U95D 4YDEA 5EX0A 2JABA 1H2VC 1IQUA 2E0IA 3EHMA 2WXJA 2WXQA 4WUYA 5B1BE 4B94A 1OWMA 4XEIG 2AWIA 4U63A 3HIZA 1DCQA 4O60A 4ILIA 5M72A 4MLPA 5HQ8A 4JPSA 1BU9A 3RRNB 1BPOA 3V79K 1KT1A 5G2NA 1WAO1 2A4ZA 4G23A 3DXMG 4XX5A 4AY5A 3RIBA 5FQ7A 3HXCA 4U07A 2X6IA 3HHMA 1TNYA 3BUAA 3TL5A 1RW2A 3FHEA 4JVSA 4QFVA 4H7XA 2KCKA 1UG3A 3FP3A 2YNQA 3ONLA 3CHSA 1E8ZA 2KCLA 3EDTB 3HXBA 4HVBA 2DYRE 3LY8A 4I6GA 2FI7A 3QNKA 4ZHBA 2Y1LE 4EECA 5CCMA 3U64A 4BESA 1IYGA 3UT7A 1UN9A 2L0TB 4FA6A 1TEZA 3OXLA 4HXIA 3EHNA 4EZLA 1N94A 3C3OA 2GGFA 1IKND 1HX8A 2DIWA 3VLFA 4RG6A 2DZNA 3KSLA 3PUJA 4N2SA 1BI7B 4PDXA 4I1OB 4GCOA 1FCHA 1MHQA 4N5CA 2EIKE 4GTMA 3B7BA 3DXKG 4N3CA 4WNFA 3ASFA 5FJYA 3JUIA 4CZ2D 2XGMA 3Q4AB 4HOUA 2V4HC 3RK6A 1WG0A 3AU5A 2B0OE 3FTVA 2ZIRA 1UJJA 5KCMA 3DEOA 3CVVA 4ANUA 4EHMA 3FUFA 5D66A 4B89A 1N4SA 2IO2C 1V55E 3UUXA 2B6CA 3EU5A 3B7UX 4IN3B 4YNDA 2L6JA 5B3SE 1HG2A 3FUJA 5T3RA 1Z5SC 3TXNA 4HOTA 5HKPA 1HFAA 1ELRA 3CSTA 3R9MA 3IV0A 1Q2ZA 3HVEB 3J5PA 1KLXA 3I4RB 3CSFA 1ZU2A 4A3VA 5EILA 2XZDG 2HM8A 3P1UA 4DI3A 2FO1E 4O1OA 4NURA 3Q49B 4F3VA 1KZPA 3KSQA 3MGBA 1FVFA 2WXHA 3AG3E 2OEWA 3QJZA 3ZNGA 2X6KA 4JEUA 4N2QA 3CVPA 2OEVA 1S0PA 3ZGQA 3FEXA 4BEPA 3KAEA 5EYPF 2Q7FA 2P2CP 5CMWA 3CHRA 2RFAA 2WXIA 2KC7A 1LD7A 3GW4A 4HI9A 2XQ0A 1NI1A 3LDZA 3CKBA 2BF0X 1N54A 5FT9A 3IHYA 2PNNA 3FTYA 3CVYA 2GRRB 1N52A 4YVOA 1JPLA 5LFAA 4ANWA 4DI4A 4AJWA 4AOFA 4KMOA 2ZU6B 3SQVA 1P5QA 3SF4A 3CHOA 4URKA 4TXQA 3BU8A 3Q73A 2DYSE 4GA0A 4N3BA 3ZXPA 2RD0A 1QBQA 1K8KG 5CEAA 1QQEA 3U9WA 4K5AB 4G25A 3EIQC 5FZQA 2KCVA 5JHAA 3OTNA 2DZOA 4UWLA 4GCNA 2WQ6A 4CT4A 5BXOA 3GYZA 4PS7A 5T8IA 3SZ7A 1OUVA 2F8YA 4AVXA 3ZHEB 2IJGX 4JC8A 3RO2A 4YDWA 3BQOA 2AXZA 4UWGA 1BLXB 2Y4UA 5ENNA 3JYSA 3SY2A 3DRAA 5CBOA 5AYWD 3MKQB 3UIOC 4XKCA 1ZB1A 1OWOA 4GTOA 3P2BA 2Y69E 2XPIA 3PZ3A 1XGWA 1H0AA 5FIOA 3HRAA 1QYMA 1HU3A 1JCSA 1FT1A 1TN8A 4DPRA 4J8DA 3FH7A 3LS8A 2LXLA 3ASNE 3C3QA 3CLJA 2AXUA 2AJAA 3L16A 3PZ2A 2JEKA 4FULA 4LNBA 1TN7A 4NIKA 3FU5A 3MKRA 3FUMA 1ELWA 1OT8A 2QC9A 4Q96A 1SA5A 4FJZA 3NZSA 4XI0A 3UT8A 3V2XA 2LAIA 4HNAD 5AQ7A 5ENRD 5KWDA 2L0IA 4JB8P 2WXFA 2H6IA 1H19A 3FEYA 3I4GA 5CBNA 3LPZA 2R03A 3APCA 3AU4A 1TYQG 4HBDA 4N3AA 3CEQA 4G2VA 3QARA 5E76A 4CDMA 3FUEA 4B93B 4LUNU 1YYHA 3PEUB 4MRUA 3SD5A 1Y8MA 3JQ1A 4NQ0A 3BG0B 3RO3A 3LVRE 3SGHA 3L54A 1MX6A 5D2MC 3Q79A 3AG2E 3UKUG 4ATZD 4CDNA 3LY7A 3CGHA 4G11A 2VQ2A 3ZPJA 5CEDB 4ABNA 3ABME 3CVUA 1FVHA 1S63A 1MX2A 4GTVA 2LSUA 4L23A 3PUKA 2XCCA 3AG1E 1A17A 1OXJA 4C9BB 3NQPA 2YHEA 3DSUA 3NBNB 1JWFA 1HS6A 1N4QA 1OWNA 5EIDA 1HE8A 3CVLA 3D9LA 3EJNA 1FT2A 2WXKA 4RG9A 3SNXA 1NZNA 5BPPA 5G05J 2J8SD 2DCPA 5ARFA 4EZJA 1VDYA 3L82A 4I6JA 4ILHB 2CG3A 5G55A 1H2TC 2PQRA 1E8XA 4GZ3A 4GZ5A 4A63B 3SHFA 5LP0A 5KNGA 1D9SA 5AJLA 4UI9J 3JXIA 2OVFA 4AP2A 3VLEA 5LOZA 3CVNA 3SFXA 3ABLE 2NC9A 2J09A 5B1AE 5EDSA 4C0EA 3PDNA 3WG7E 3FULA 3L17A 2ZGDA 2C2LA 4FLHA 1LD8A 3HVEA 3DSVA 3FTWA 4AM9A 3S7BA 3VLDA 2IF4A 3FTZA 3V30A 3PNTB 4A3TA 4KZ0A 2P9LG 3ML9A 2EINE 4G8LA 3TWXA 1KPSB 2XS8A 5CCLA 2H6HA 4WNEA 4HRLA 1HXIA 3ASGA 5HRYA 2LO6A 5JJ6A 2A5EA 5FZRA 4KT6B 2R2LA 4JZYA 5AQBA 3D9OA 4Z68A 3I5PA 2VGXB 4JA9A 2IOLA 3AG4E 4XIFA 3TWVA 3NB2A 1HZ4A 3C5RA 1PAQA 4CYMD 4HRMB 3UM2A 3SFYA 2QY7A 3PEVB 2ETCA 4DLQA 2XEHA 3IBEA 2L6BA 3NF1A 3QWVA 2H6FA 4YVQC 2VSXE 3AJIA 4ANXA 3PREA 1EDUA 3FTSA 3UQ3A 4M7CA 2V8SE 3FUDA 3OAWA 4F7AA 4F6RD 1X81A 3FUKA 4B0ZA 3ASOE 2GROB 3IXEA 4KBQA 3HYMB 3Q5MA 3NOCD 2EQXA 3L13A 3T9KA 4XE0A 3LY9A 3Q9UC 1HO8A 3CV0A 4AV7A 3APFA 1IHGA 4Y6CA 3RKVA 5BW8C 3CQGB 5ENSD 2R59A 3TWSA 3UM3A 3CHQA 1TNUA 3D9IA 3JXJA 3ML8A 3MKQA 1TNOA 2ZISA 4KXKB 2Y0BG 2VSNA 2ONDA 4IULA 5FQ6A 4UWHA 4U0ZA 1YCSB 5G04C 3FTXA 1Z6TA 5J08A 4L2YA 5CECB 4WNDA 2ETAA 4MKTA 2J49A 3DSTA 1OCZE 4UI9K 1G3NB 2HR2A 1N0QA 4I9EA 3EHQA 3KD7A 4BY6A 4CT0A 3FUIA 3DEPA 2XENA 4B8CB 5ENQD 4CCAA 4DX5D 5H7PA 4V3IA 3UM1A 1Z3YA 2UY1B 2NYJA 1U2VG 4PH4B 1QZ2A 3B7TA 2BKGA 2OV8A 3C98A 5KJKA 4GZ6A 1BD8A 4N39A 1WDYA 4BTBA 4RSYA 2V5FA 2MHKA 4WNGA 3FUNA 1E90A 3ABKE 4OVVA 4A1GA 3CKCA 5E75A 5ENOD 1OCOE 3UXGA 2YQ8A 2LSVA 5FZSA 3Q15A 4A55A 1O5MA 2Y4TA 2XEEA 4JD2G 3CVQA 2HYZA 3RRMB 3UX4A 2BKKB 1D8DA 4CRWA 1YA0A 3SFZA 3GZ2A 2BTDA 5LCWJ 1V54E 4GYYA 2XRYA 2BEDA 5LCWC 5JJTA 4LERA 3DSWA 2NSZA 1JWGA 1XNFA 3FU6A 3DBSA 3CQCB 2LXMA 2DVWA 3N71A 3S7JA 1UJKA 4JL0A 4U8YD 4BSXA 4OAVB 3ASHA 5KNHD 3D9HA 1KT0A 1W3BA 2I2OA 5KJLA 3PNLB 3AS8A 2VSOE 2LNIA 2GW1A 3Q7AA 3T8KA 4DK5A 1QNFA 5CMYA 3MJWA 3PVLA 2FULA 1H2UA 3B13A 3JCKC 4ILGA 3BEEA 3ZYKA 5A23A 1GW6A 2P9SG 3B7RL 4KVMA 5AN8A 4LNUD 4U0UA 4XKBA 3D9KA 2ZXWE 2XPYA 4HFGA 1N9AA 2QZAA 3B95A 4JHJA 1Z3XA 4K5CA 4FHJA 3ZYQA 3DSXA 2XS1A 4JA7A 4KVOA 3T8MA 4J0UA 4OYSA 3UMVA 4BX9A 4PS8A 1O1RA 3ZFWA 2EIJE 3R9AB 5AJDA 4GMLA 4RLYA 4GTTA 1LTXA 5ENPD 1SA4A 4L2LA 1NL4A 4FLBA 3QKYA 3G2VA 5CRUA 1O1SA 3QDNA 3ZW3A 3RJVA 4HQDA 2IFUA 3MEKA 5HS0A 3Q47B 3KEZA 4ACKA 5EX3A 3Q78A 4O6FA 3RSEG 3UPVA 3TG4A 3E30A 2RG8A 3ZRHA 3HG0D 2IY0C 4M3OA 4Q69A 3O48A 1L5JA 4R7LA 2AVPA 1TR4A 2J4DA 5DBKA 3T5XA 1SW6A 3PE4A 1LF8A 3CR3A 3QAQA 4GTPA 3OXGA 4U0SA 2GRQB 3R7QA 5JA4D 4CGVA 2IOSA 3CHPA 2VGXA 3MA5A 3MV3B 3EHRA 4K0RA 3FUHA 4D10C 1S70B 3VTYA 3AS4A 5BT1A 2QFCA 1WY6A 1SZ9A 3UI2A 3RU0A 3AS5A 3G2SA 4PS3A 3T5VA 4UQYA 1IXVA 2I9CA 3EUVA 4F53A 4J6IA 2KBXA 4GA2A 3PH0C 3NZUA 4TUUA 4ZFHA 1NA3A 2CFZA 3KEAA 4GYWA 2J9QA 2GRMA 4ATGA 4GTSA 1SVXA 5AQAA 2V0PA 4GB9A 2FF4A 3V31A 3LKUA 4MS6A 5KJMA 5AAOA 2LAHA 1MX4A 1EPUA 1ZBPA 3QWPA 3CVXA 4F1PA 2XGOA 4BFRA 3TG5A 4AEZC 2WM9A 4HLLA 2HE0A 3G2WA 3ZXSA 4DRXE 1IHBA 3GZSA 5EYLA 4BTAA 4YDYA 1TNBA 4QQIA 3CK8A 5HI7A 2HO1A 4GMJA 1INZA 4U04A 2CHXA 3W9FA 2ZGGA 4Y6WA 4U96D 4I2WA 2M63A 3LCAA 4FC8A 3U66A 4GAAA 1H6OA 2CG2A 4CDRA 1N4PA 3SBTB 2WQHA 2PM7A 4DUIA 4LCTA 5FWQA 4BWRA 2JLBA 3V2OA 1IQRA 2CFUA 3ULYA 1NA0A 3W9GA 1FPPA 4AY6A 2X38A 3ZKJA 4BT8A 2QYUA 5J90A 3JUEA 2UY1A 5CHEE 3DSSA 3MYVA 4HOSA 5FTPA 4GTQA 4UQZA 3C3RA 5A6CA 3ENEA 3PE3A 4DX2A 5C1DA 4E85A 1OWPA 3URZA 2WXRA 3LYAA 4L7TA 4EBAG 4LG6A 1OCCE 4GPMA 3D9NA 2VTBB 4K03A 3L22A 5LX8A 1TJCA 3E33A 4RQIA 2WMOA 3J5QB 1JUQA 1NP7A 4HLEA 2R02A 4CGWA 3TWQA 3S2AA 4JHRA 1DNPA 3E32A 4HRNA 3GZ1A 1JCRA 3ZEFA 4DLOA 4A1SA 5KBAA 3LJNA 4IRUA 3WXXA 1JCQA 4FHKA 5FQ8A 4TV3A 3S7FA 3HXEA 3ZYMA 4I1MA 2VGYA 2CHZA 4HS2A 3QB2A 4HOQA 2R17C 3L9TA 1YMPA 3PZDA 2J07A 3ULQA 3UIPC 3DPDA 1A5EA 4YDOA 3E4BA 4K5BA 2OVBA 3OXFA 2XGSA 3TGOA 1OWLA 3QK0A 2PL2A 3C72A 3UINC 2MOWA 1N95A 3ONKA 5BV1A 3HXDA 3TXMA 4GYOA 3PZ4A 1SZAA 1X5BA 2C0LA 2KXPC 4LEUA 1K1BA 2KM4A 2C0MA 3UTMA 2PZIA 2H6GA 4WWNA 1NFIE 1PY1A 4I2ZA 4P29A 2OOEA 2WXLA 2YINA 4JHKA 3ZHEA 1ELKA 3VTXA 4XI9A 4DX1A 2RFMA 4ACLA 1TNZA 2KZTB 1HG5A 2GRPB 2PM6A 3MZLB 4J8EA 5G04J 4U8VD 2X6JA 4N5QA 3MCXA 2VJ8A 1BI8B 2ILRA 1KZOA 4BETA 4CEMA 4JEHA 4AXHA 4PUCA 2F0YA 5AARA 1DVPA 3RRUA 3FTUA 5ITZF 3TWTA 5T4YA 4B8AA 3ASDA 3QWWA 4C0MA 2P9IG 2WXPA 3NOGD 4I9CA 1E8WA 2P9PG 1H6PA 1N4RA 2XZTG 4LNGA 4IYPA 4G1TA 2A5UA 2R5SA 1DC2A 5CERB 1MJ0A 4BSZB 3FH8A 2VGEA 2AW6A 4U8HA 3DPYA 5JJ7A 3D3MA 4DX7D 3FWVA 2VYIA 1AWCB 2UWJG 3D9MA 4APOA 4AIFA 3I3NA 1DCEA 3TWRA 2DBAA 3B7SA 5IY5E 3LJ3A 3CIAA 2WB2A 4C48B 2IQCA 1Y6IA 4G24A 3LEWA 2WXGA 1TJFA 2I6HA 4EQFA 4O1PA 4HI8A 2X6HA 1S64A 4ANVA 5JHBA 2FO7A 1K1AA 2J4BA 4TXRA 1E8YA 1UN8A 3ZIMA 1UW4B 2WQ7A 4TRQA 4X8QA 1N11A 2OCCE 3IEGA 1WM5A 4FP7A 4APFA 4RVBA 5DIZA 2WXNA 4BERA 3O4ZA 3ZYLA 3U3WA 4F1SA 3S7DA 3X2QE 2RKKA 5BUZA 4DJAA 4FADA 4J7WA 2MYOA 4GPKA 3L6AA 3FY4A 2L9BA 3EIJA 3AAAC 4L1BA 1U3CA 2V4LA 1PC2A 2XEVA 5D0OD 1K3ZD 4JW1A 3FFLA 1RZ4A 4UWFA 2IEJA 2WMNA 4XZ4A 1E7VA 4J8SA 4EBAA 4TXPA 1O1TA 2Y3AA 4I17A 4J8FA 1EF1C 5AENA 4WWPA 4EZKA 1MYOA 4GZCA 5D0QD 2KATA 5KJNA 2E2EA 1H6KA 5EKQD 4BT9A 2XCBA 4OVUA 4G26A 1D8EA 1N0RA 2P58C 3ISMC 4L9PA 3RAUA 3EU9A 1UOHA 2GRLA 3MV2B 4E6HA 2VTBA 3CHMA 3QOUA 4WWOA 3JQ0A 3ESLA 2J08A 4FU3A 2IO3C 3UKRG 3ZN3A 1OY3D 4FJYA 4G8KA 3CK7A 5BNWA 3FU3A 4U7EB 3SI5A 4KYOB 3ULEG 2FEZA 4NACA 5EIBE 5ENTD 3G2TA 3UT4A 3TJPA 4HB5A 4HORA 5BXUA 2YHCA 3APDA 5EN5D 1U3DA 2NXPA 4GA1A 4NRHB 1HF8A 5JMND 4TUMA 2ETBA 3K9IA 2X6FA 4ME2A 3E34A 2WXOA 4EPZA 2XPZA 2F8XK 4BX8A 3PRZA 5CRVA 3QC1A 4KZCA 4DX6D 3PZ1A 1EYHA 3CVWA 2R05A 1E7UA 3U4TA 2XRZA 1SQMA 3NAWA 3HXFA 5ARGA 2IU1A 2MRIA 2XHEA 4UWKA 3TWWA 5BV0A 3DWLG 4LRZA 3CK9A 3LVQE 4UUCA 5C2YA 2F37A 2WVIA 3E37A 3SBSA 2P9KG 3KS2A 2VSYA 4I6EA 4GMRA 2WXMA 3ZUVB 3SO8A 3LXUX 2LUHA 3Q9NC 4UQXA 1MZCA 4JXTA 5ANLA 1E96B 3L08A 2GRNB 4I43A 4MBGA 4I1AA
chains in the Genus database with same CATH topology
1KZPA 3KSQA 4YDOA 1N4PA 4GTMA 1X81A 3DRAA 1N4RA 1LD8A 3Q75A 4LNGA 3DSVA 1TN6A 3HXCA 1TNYA 3C72A 3Q79A 1N9AA 1N95A 4GTOA 1FPPA 3HXDA 3PZ4A 3DSXA 3PZ3A 1O5MA 2ZIRA 3EUVA 1O1RA 1LD7A 3DPYA 1NI1A 1JCSA 1FT1A 1TN8A 1S63A 4GTVA 3DSSA 4GTTA 1LTXA 4GTQA 3E34A 1D8DA 4EHMA 3PZ2A 4LNBA 2H6HA 1SA4A 2IEJA 1NL4A 1N4SA 1TN7A 1TNUA 4GTRA 2H6GA 1O1TA 3DSUA 3HXBA 1N4QA 1O1SA 3PZ1A 4GTSA 1DCEA 1TNOA 1FT2A 2ZISA 3EU5A 1SA5A 3E33A 3HXFA 2BEDA 2R2LA 3DSWA 3Q78A 3Q73A 1QBQA 3Q7FA 1TNZA 1D8EA 3E32A 3E37A 3E30A 3DSTA 4YDEA 1JCRA 4L9PA 2H6IA 1TNBA 3SFYA 1N94A 1S64A 1JCQA 1MZCA 1KZOA 3HXEA 3KSLA 2F0YA 4GTPA 2H6FA 3Q7AA 4MBGA 3SFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZP A;  3KSQ A;  4YDO A;  1N4P A;  4GTM A;  1X81 A;  3DRA A;  1N4R A;  1LD8 A;  3Q75 A;  4LNG A;  3DSV A;  1TN6 A;  3HXC A;  1TNY A;  3C72 A;  3Q79 A;  1N9A A;  1N95 A;  4GTO A;  1FPP A;  3HXD A;  3PZ4 A;  3DSX A;  3PZ3 A;  1O5M A;  2ZIR A;  3EUV A;  1O1R A;  1LD7 A;  3DPY A;  1NI1 A;  1JCS A;  1FT1 A;  1TN8 A;  1S63 A;  4GTV A;  3DSS A;  4GTT A;  1LTX A;  4GTQ A;  3E34 A;  1D8D A;  4EHM A;  3PZ2 A;  4LNB A;  2H6H A;  1SA4 A;  2IEJ A;  1NL4 A;  1N4S A;  1TN7 A;  1TNU A;  4GTR A;  2H6G A;  1O1T A;  3DSU A;  3HXB A;  1N4Q A;  1O1S A;  3PZ1 A;  4GTS A;  1DCE A;  1TNO A;  1FT2 A;  2ZIS A;  3EU5 A;  1SA5 A;  3E33 A;  3HXF A;  2BED A;  2R2L A;  3DSW A;  3Q78 A;  3Q73 A;  1QBQ A;  3Q7F A;  1TNZ A;  1D8E A;  3E32 A;  3E37 A;  3E30 A;  3DST A;  4YDE A;  1JCR A;  4L9P A;  2H6I A;  1TNB A;  3SFY A;  1N94 A;  1S64 A;  1JCQ A;  1MZC A;  1KZO A;  3HXE A;  3KSL A;  2F0Y A;  4GTP A;  2H6F A;  3Q7A A;  4MBG A;  3SFX A; 
#chains in the Genus database with same CATH topology
 3FDH A;  2P9N G;  1OCR E;  2KZT A;  2ION A;  3IHV A;  3ZU7 B;  3D9J A;  3HDX A;  4LSZ E;  2V5Q C;  3UM0 A;  3D9P A;  1AP7 A;  4WAF A;  3FU0 A;  3Q75 A;  1TN6 A;  2BUG A;  2EIL E;  2I1K A;  2P9U G;  2WPV A;  2FBN A;  3F6Q A;  5AIJ A;  3IKO B;  1HH8 A;  4W9R A;  3BG1 B;  2CHW A;  4GZD A;  4OAU C;  2DWZ A;  3PS6 A;  4GTR A;  5G05 C;  5AQ9 A;  2QYJ A;  4H7Y A;  5FQ4 A;  2X3M A;  4J8Y A;  3MX3 A;  3TAX A;  3ESK A;  3TWU A;  3FH5 A;  5ANR A;  2EIM E;  4Q94 A;  5FIN A;  1B89 A;  2PQN A;  4GU5 A;  3Q7F A;  2I1J A;  3R7R A;  4UI9 C;  3ZVV A;  1MQS A;  3G2U A;  2AXV A;  5A7D B;  4U95 D;  4YDE A;  5EX0 A;  2JAB A;  1H2V C;  1IQU A;  2E0I A;  3EHM A;  2WXJ A;  2WXQ A;  4WUY A;  5B1B E;  4B94 A;  1OWM A;  4XEI G;  2AWI A;  4U63 A;  3HIZ A;  1DCQ A;  4O60 A;  4ILI A;  5M72 A;  4MLP A;  5HQ8 A;  4JPS A;  1BU9 A;  3RRN B;  1BPO A;  3V79 K;  1KT1 A;  5G2N A;  1WAO 1;  2A4Z A;  4G23 A;  3DXM G;  4XX5 A;  4AY5 A;  3RIB A;  5FQ7 A;  3HXC A;  4U07 A;  2X6I A;  3HHM A;  1TNY A;  3BUA A;  3TL5 A;  1RW2 A;  3FHE A;  4JVS A;  4QFV A;  4H7X A;  2KCK A;  1UG3 A;  3FP3 A;  2YNQ A;  3ONL A;  3CHS A;  1E8Z A;  2KCL A;  3EDT B;  3HXB A;  4HVB A;  2DYR E;  3LY8 A;  4I6G A;  2FI7 A;  3QNK A;  4ZHB A;  2Y1L E;  4EEC A;  5CCM A;  3U64 A;  4BES A;  1IYG A;  3UT7 A;  1UN9 A;  2L0T B;  4FA6 A;  1TEZ A;  3OXL A;  4HXI A;  3EHN A;  4EZL A;  1N94 A;  3C3O A;  2GGF A;  1IKN D;  1HX8 A;  2DIW A;  3VLF A;  4RG6 A;  2DZN A;  3KSL A;  3PUJ A;  4N2S A;  1BI7 B;  4PDX A;  4I1O B;  4GCO A;  1FCH A;  1MHQ A;  4N5C A;  2EIK E;  4GTM A;  3B7B A;  3DXK G;  4N3C A;  4WNF A;  3ASF A;  5FJY A;  3JUI A;  4CZ2 D;  2XGM A;  3Q4A B;  4HOU A;  2V4H C;  3RK6 A;  1WG0 A;  3AU5 A;  2B0O E;  3FTV A;  2ZIR A;  1UJJ A;  5KCM A;  3DEO A;  3CVV A;  4ANU A;  4EHM A;  3FUF A;  5D66 A;  4B89 A;  1N4S A;  2IO2 C;  1V55 E;  3UUX A;  2B6C A;  3EU5 A;  3B7U X;  4IN3 B;  4YND A;  2L6J A;  5B3S E;  1HG2 A;  3FUJ A;  5T3R A;  1Z5S C;  3TXN A;  4HOT A;  5HKP A;  1HFA A;  1ELR A;  3CST A;  3R9M A;  3IV0 A;  1Q2Z A;  3HVE B;  3J5P A;  1KLX A;  3I4R B;  3CSF A;  1ZU2 A;  4A3V A;  5EIL A;  2XZD G;  2HM8 A;  3P1U A;  4DI3 A;  2FO1 E;  4O1O A;  4NUR A;  3Q49 B;  4F3V A;  1KZP A;  3KSQ A;  3MGB A;  1FVF A;  2WXH A;  3AG3 E;  2OEW A;  3QJZ A;  3ZNG A;  2X6K A;  4JEU A;  4N2Q A;  3CVP A;  2OEV A;  1S0P A;  3ZGQ A;  3FEX A;  4BEP A;  3KAE A;  5EYP F;  2Q7F A;  2P2C P;  5CMW A;  3CHR A;  2RFA A;  2WXI A;  2KC7 A;  1LD7 A;  3GW4 A;  4HI9 A;  2XQ0 A;  1NI1 A;  3LDZ A;  3CKB A;  2BF0 X;  1N54 A;  5FT9 A;  3IHY A;  2PNN A;  3FTY A;  3CVY A;  2GRR B;  1N52 A;  4YVO A;  1JPL A;  5LFA A;  4ANW A;  4DI4 A;  4AJW A;  4AOF A;  4KMO A;  2ZU6 B;  3SQV A;  1P5Q A;  3SF4 A;  3CHO A;  4URK A;  4TXQ A;  3BU8 A;  3Q73 A;  2DYS E;  4GA0 A;  4N3B A;  3ZXP A;  2RD0 A;  1QBQ A;  1K8K G;  5CEA A;  1QQE A;  3U9W A;  4K5A B;  4G25 A;  3EIQ C;  5FZQ A;  2KCV A;  5JHA A;  3OTN A;  2DZO A;  4UWL A;  4GCN A;  2WQ6 A;  4CT4 A;  5BXO A;  3GYZ A;  4PS7 A;  5T8I A;  3SZ7 A;  1OUV A;  2F8Y A;  4AVX A;  3ZHE B;  2IJG X;  4JC8 A;  3RO2 A;  4YDW A;  3BQO A;  2AXZ A;  4UWG A;  1BLX B;  2Y4U A;  5ENN A;  3JYS A;  3SY2 A;  3DRA A;  5CBO A;  5AYW D;  3MKQ B;  3UIO C;  4XKC A;  1ZB1 A;  1OWO A;  4GTO A;  3P2B A;  2Y69 E;  2XPI A;  3PZ3 A;  1XGW A;  1H0A A;  5FIO A;  3HRA A;  1QYM A;  1HU3 A;  1JCS A;  1FT1 A;  1TN8 A;  4DPR A;  4J8D A;  3FH7 A;  3LS8 A;  2LXL A;  3ASN E;  3C3Q A;  3CLJ A;  2AXU A;  2AJA A;  3L16 A;  3PZ2 A;  2JEK A;  4FUL A;  4LNB A;  1TN7 A;  4NIK A;  3FU5 A;  3MKR A;  3FUM A;  1ELW A;  1OT8 A;  2QC9 A;  4Q96 A;  1SA5 A;  4FJZ A;  3NZS A;  4XI0 A;  3UT8 A;  3V2X A;  2LAI A;  4HNA D;  5AQ7 A;  5ENR D;  5KWD A;  2L0I A;  4JB8 P;  2WXF A;  2H6I A;  1H19 A;  3FEY A;  3I4G A;  5CBN A;  3LPZ A;  2R03 A;  3APC A;  3AU4 A;  1TYQ G;  4HBD A;  4N3A A;  3CEQ A;  4G2V A;  3QAR A;  5E76 A;  4CDM A;  3FUE A;  4B93 B;  4LUN U;  1YYH A;  3PEU B;  4MRU A;  3SD5 A;  1Y8M A;  3JQ1 A;  4NQ0 A;  3BG0 B;  3RO3 A;  3LVR E;  3SGH A;  3L54 A;  1MX6 A;  5D2M C;  3Q79 A;  3AG2 E;  3UKU G;  4ATZ D;  4CDN A;  3LY7 A;  3CGH A;  4G11 A;  2VQ2 A;  3ZPJ A;  5CED B;  4ABN A;  3ABM E;  3CVU A;  1FVH A;  1S63 A;  1MX2 A;  4GTV A;  2LSU A;  4L23 A;  3PUK A;  2XCC A;  3AG1 E;  1A17 A;  1OXJ A;  4C9B B;  3NQP A;  2YHE A;  3DSU A;  3NBN B;  1JWF A;  1HS6 A;  1N4Q A;  1OWN A;  5EID A;  1HE8 A;  3CVL A;  3D9L A;  3EJN A;  1FT2 A;  2WXK A;  4RG9 A;  3SNX A;  1NZN A;  5BPP A;  5G05 J;  2J8S D;  2DCP A;  5ARF A;  4EZJ A;  1VDY A;  3L82 A;  4I6J A;  4ILH B;  2CG3 A;  5G55 A;  1H2T C;  2PQR A;  1E8X A;  4GZ3 A;  4GZ5 A;  4A63 B;  3SHF A;  5LP0 A;  5KNG A;  1D9S A;  5AJL A;  4UI9 J;  3JXI A;  2OVF A;  4AP2 A;  3VLE A;  5LOZ A;  3CVN A;  3SFX A;  3ABL E;  2NC9 A;  2J09 A;  5B1A E;  5EDS A;  4C0E A;  3PDN A;  3WG7 E;  3FUL A;  3L17 A;  2ZGD A;  2C2L A;  4FLH A;  1LD8 A;  3HVE A;  3DSV A;  3FTW A;  4AM9 A;  3S7B A;  3VLD A;  2IF4 A;  3FTZ A;  3V30 A;  3PNT B;  4A3T A;  4KZ0 A;  2P9L G;  3ML9 A;  2EIN E;  4G8L A;  3TWX A;  1KPS B;  2XS8 A;  5CCL A;  2H6H A;  4WNE A;  4HRL A;  1HXI A;  3ASG A;  5HRY A;  2LO6 A;  5JJ6 A;  2A5E A;  5FZR A;  4KT6 B;  2R2L A;  4JZY A;  5AQB A;  3D9O A;  4Z68 A;  3I5P A;  2VGX B;  4JA9 A;  2IOL A;  3AG4 E;  4XIF A;  3TWV A;  3NB2 A;  1HZ4 A;  3C5R A;  1PAQ A;  4CYM D;  4HRM B;  3UM2 A;  3SFY A;  2QY7 A;  3PEV B;  2ETC A;  4DLQ A;  2XEH A;  3IBE A;  2L6B A;  3NF1 A;  3QWV A;  2H6F A;  4YVQ C;  2VSX E;  3AJI A;  4ANX A;  3PRE A;  1EDU A;  3FTS A;  3UQ3 A;  4M7C A;  2V8S E;  3FUD A;  3OAW A;  4F7A A;  4F6R D;  1X81 A;  3FUK A;  4B0Z A;  3ASO E;  2GRO B;  3IXE A;  4KBQ A;  3HYM B;  3Q5M A;  3NOC D;  2EQX A;  3L13 A;  3T9K A;  4XE0 A;  3LY9 A;  3Q9U C;  1HO8 A;  3CV0 A;  4AV7 A;  3APF A;  1IHG A;  4Y6C A;  3RKV A;  5BW8 C;  3CQG B;  5ENS D;  2R59 A;  3TWS A;  3UM3 A;  3CHQ A;  1TNU A;  3D9I A;  3JXJ A;  3ML8 A;  3MKQ A;  1TNO A;  2ZIS A;  4KXK B;  2Y0B G;  2VSN A;  2OND A;  4IUL A;  5FQ6 A;  4UWH A;  4U0Z A;  1YCS B;  5G04 C;  3FTX A;  1Z6T A;  5J08 A;  4L2Y A;  5CEC B;  4WND A;  2ETA A;  4MKT A;  2J49 A;  3DST A;  1OCZ E;  4UI9 K;  1G3N B;  2HR2 A;  1N0Q A;  4I9E A;  3EHQ A;  3KD7 A;  4BY6 A;  4CT0 A;  3FUI A;  3DEP A;  2XEN A;  4B8C B;  5ENQ D;  4CCA A;  4DX5 D;  5H7P A;  4V3I A;  3UM1 A;  1Z3Y A;  2UY1 B;  2NYJ A;  1U2V G;  4PH4 B;  1QZ2 A;  3B7T A;  2BKG A;  2OV8 A;  3C98 A;  5KJK A;  4GZ6 A;  1BD8 A;  4N39 A;  1WDY A;  4BTB A;  4RSY A;  2V5F A;  2MHK A;  4WNG A;  3FUN A;  1E90 A;  3ABK E;  4OVV A;  4A1G A;  3CKC A;  5E75 A;  5ENO D;  1OCO E;  3UXG A;  2YQ8 A;  2LSV A;  5FZS A;  3Q15 A;  4A55 A;  1O5M A;  2Y4T A;  2XEE A;  4JD2 G;  3CVQ A;  2HYZ A;  3RRM B;  3UX4 A;  2BKK B;  1D8D A;  4CRW A;  1YA0 A;  3SFZ A;  3GZ2 A;  2BTD A;  5LCW J;  1V54 E;  4GYY A;  2XRY A;  2BED A;  5LCW C;  5JJT A;  4LER A;  3DSW A;  2NSZ A;  1JWG A;  1XNF A;  3FU6 A;  3DBS A;  3CQC B;  2LXM A;  2DVW A;  3N71 A;  3S7J A;  1UJK A;  4JL0 A;  4U8Y D;  4BSX A;  4OAV B;  3ASH A;  5KNH D;  3D9H A;  1KT0 A;  1W3B A;  2I2O A;  5KJL A;  3PNL B;  3AS8 A;  2VSO E;  2LNI A;  2GW1 A;  3Q7A A;  3T8K A;  4DK5 A;  1QNF A;  5CMY A;  3MJW A;  3PVL A;  2FUL A;  1H2U A;  3B13 A;  3JCK C;  4ILG A;  3BEE A;  3ZYK A;  5A23 A;  1GW6 A;  2P9S G;  3B7R L;  4KVM A;  5AN8 A;  4LNU D;  4U0U A;  4XKB A;  3D9K A;  2ZXW E;  2XPY A;  4HFG A;  1N9A A;  2QZA A;  3B95 A;  4JHJ A;  1Z3X A;  4K5C A;  4FHJ A;  3ZYQ A;  3DSX A;  2XS1 A;  4JA7 A;  4KVO A;  3T8M A;  4J0U A;  4OYS A;  3UMV A;  4BX9 A;  4PS8 A;  1O1R A;  3ZFW A;  2EIJ E;  3R9A B;  5AJD A;  4GML A;  4RLY A;  4GTT A;  1LTX A;  5ENP D;  1SA4 A;  4L2L A;  1NL4 A;  4FLB A;  3QKY A;  3G2V A;  5CRU A;  1O1S A;  3QDN A;  3ZW3 A;  3RJV A;  4HQD A;  2IFU A;  3MEK A;  5HS0 A;  3Q47 B;  3KEZ A;  4ACK A;  5EX3 A;  3Q78 A;  4O6F A;  3RSE G;  3UPV A;  3TG4 A;  3E30 A;  2RG8 A;  3ZRH A;  3HG0 D;  2IY0 C;  4M3O A;  4Q69 A;  3O48 A;  1L5J A;  4R7L A;  2AVP A;  1TR4 A;  2J4D A;  5DBK A;  3T5X A;  1SW6 A;  3PE4 A;  1LF8 A;  3CR3 A;  3QAQ A;  4GTP A;  3OXG A;  4U0S A;  2GRQ B;  3R7Q A;  5JA4 D;  4CGV A;  2IOS A;  3CHP A;  2VGX A;  3MA5 A;  3MV3 B;  3EHR A;  4K0R A;  3FUH A;  4D10 C;  1S70 B;  3VTY A;  3AS4 A;  5BT1 A;  2QFC A;  1WY6 A;  1SZ9 A;  3UI2 A;  3RU0 A;  3AS5 A;  3G2S A;  4PS3 A;  3T5V A;  4UQY A;  1IXV A;  2I9C A;  3EUV A;  4F53 A;  4J6I A;  2KBX A;  4GA2 A;  3PH0 C;  3NZU A;  4TUU A;  4ZFH A;  1NA3 A;  2CFZ A;  3KEA A;  4GYW A;  2J9Q A;  2GRM A;  4ATG A;  4GTS A;  1SVX A;  5AQA A;  2V0P A;  4GB9 A;  2FF4 A;  3V31 A;  3LKU A;  4MS6 A;  5KJM A;  5AAO A;  2LAH A;  1MX4 A;  1EPU A;  1ZBP A;  3QWP A;  3CVX A;  4F1P A;  2XGO A;  4BFR A;  3TG5 A;  4AEZ C;  2WM9 A;  4HLL A;  2HE0 A;  3G2W A;  3ZXS A;  4DRX E;  1IHB A;  3GZS A;  5EYL A;  4BTA A;  4YDY A;  1TNB A;  4QQI A;  3CK8 A;  5HI7 A;  2HO1 A;  4GMJ A;  1INZ A;  4U04 A;  2CHX A;  3W9F A;  2ZGG A;  4Y6W A;  4U96 D;  4I2W A;  2M63 A;  3LCA A;  4FC8 A;  3U66 A;  4GAA A;  1H6O A;  2CG2 A;  4CDR A;  1N4P A;  3SBT B;  2WQH A;  2PM7 A;  4DUI A;  4LCT A;  5FWQ A;  4BWR A;  2JLB A;  3V2O A;  1IQR A;  2CFU A;  3ULY A;  1NA0 A;  3W9G A;  1FPP A;  4AY6 A;  2X38 A;  3ZKJ A;  4BT8 A;  2QYU A;  5J90 A;  3JUE A;  2UY1 A;  5CHE E;  3DSS A;  3MYV A;  4HOS A;  5FTP A;  4GTQ A;  4UQZ A;  3C3R A;  5A6C A;  3ENE A;  3PE3 A;  4DX2 A;  5C1D A;  4E85 A;  1OWP A;  3URZ A;  2WXR A;  3LYA A;  4L7T A;  4EBA G;  4LG6 A;  1OCC E;  4GPM A;  3D9N A;  2VTB B;  4K03 A;  3L22 A;  5LX8 A;  1TJC A;  3E33 A;  4RQI A;  2WMO A;  3J5Q B;  1JUQ A;  1NP7 A;  4HLE A;  2R02 A;  4CGW A;  3TWQ A;  3S2A A;  4JHR A;  1DNP A;  3E32 A;  4HRN A;  3GZ1 A;  1JCR A;  3ZEF A;  4DLO A;  4A1S A;  5KBA A;  3LJN A;  4IRU A;  3WXX A;  1JCQ A;  4FHK A;  5FQ8 A;  4TV3 A;  3S7F A;  3HXE A;  3ZYM A;  4I1M A;  2VGY A;  2CHZ A;  4HS2 A;  3QB2 A;  4HOQ A;  2R17 C;  3L9T A;  1YMP A;  3PZD A;  2J07 A;  3ULQ A;  3UIP C;  3DPD A;  1A5E A;  4YDO A;  3E4B A;  4K5B A;  2OVB A;  3OXF A;  2XGS A;  3TGO A;  1OWL A;  3QK0 A;  2PL2 A;  3C72 A;  3UIN C;  2MOW A;  1N95 A;  3ONK A;  5BV1 A;  3HXD A;  3TXM A;  4GYO A;  3PZ4 A;  1SZA A;  1X5B A;  2C0L A;  2KXP C;  4LEU A;  1K1B A;  2KM4 A;  2C0M A;  3UTM A;  2PZI A;  2H6G A;  4WWN A;  1NFI E;  1PY1 A;  4I2Z A;  4P29 A;  2OOE A;  2WXL A;  2YIN A;  4JHK A;  3ZHE A;  1ELK A;  3VTX A;  4XI9 A;  4DX1 A;  2RFM A;  4ACL A;  1TNZ A;  2KZT B;  1HG5 A;  2GRP B;  2PM6 A;  3MZL B;  4J8E A;  5G04 J;  4U8V D;  2X6J A;  4N5Q A;  3MCX A;  2VJ8 A;  1BI8 B;  2ILR A;  1KZO A;  4BET A;  4CEM A;  4JEH A;  4AXH A;  4PUC A;  2F0Y A;  5AAR A;  1DVP A;  3RRU A;  3FTU A;  5ITZ F;  3TWT A;  5T4Y A;  4B8A A;  3ASD A;  3QWW A;  4C0M A;  2P9I G;  2WXP A;  3NOG D;  4I9C A;  1E8W A;  2P9P G;  1H6P A;  1N4R A;  2XZT G;  4LNG A;  4IYP A;  4G1T A;  2A5U A;  2R5S A;  1DC2 A;  5CER B;  1MJ0 A;  4BSZ B;  3FH8 A;  2VGE A;  2AW6 A;  4U8H A;  3DPY A;  5JJ7 A;  3D3M A;  4DX7 D;  3FWV A;  2VYI A;  1AWC B;  2UWJ G;  3D9M A;  4APO A;  4AIF A;  3I3N A;  1DCE A;  3TWR A;  2DBA A;  3B7S A;  5IY5 E;  3LJ3 A;  3CIA A;  2WB2 A;  4C48 B;  2IQC A;  1Y6I A;  4G24 A;  3LEW A;  2WXG A;  1TJF A;  2I6H A;  4EQF A;  4O1P A;  4HI8 A;  2X6H A;  1S64 A;  4ANV A;  5JHB A;  2FO7 A;  1K1A A;  2J4B A;  4TXR A;  1E8Y A;  1UN8 A;  3ZIM A;  1UW4 B;  2WQ7 A;  4TRQ A;  4X8Q A;  1N11 A;  2OCC E;  3IEG A;  1WM5 A;  4FP7 A;  4APF A;  4RVB A;  5DIZ A;  2WXN A;  4BER A;  3O4Z A;  3ZYL A;  3U3W A;  4F1S A;  3S7D A;  3X2Q E;  2RKK A;  5BUZ A;  4DJA A;  4FAD A;  4J7W A;  2MYO A;  4GPK A;  3L6A A;  3FY4 A;  2L9B A;  3EIJ A;  3AAA C;  4L1B A;  1U3C A;  2V4L A;  1PC2 A;  2XEV A;  5D0O D;  1K3Z D;  4JW1 A;  3FFL A;  1RZ4 A;  4UWF A;  2IEJ A;  2WMN A;  4XZ4 A;  1E7V A;  4J8S A;  4EBA A;  4TXP A;  1O1T A;  2Y3A A;  4I17 A;  4J8F A;  1EF1 C;  5AEN A;  4WWP A;  4EZK A;  1MYO A;  4GZC A;  5D0Q D;  2KAT A;  5KJN A;  2E2E A;  1H6K A;  5EKQ D;  4BT9 A;  2XCB A;  4OVU A;  4G26 A;  1D8E A;  1N0R A;  2P58 C;  3ISM C;  4L9P A;  3RAU A;  3EU9 A;  1UOH A;  2GRL A;  3MV2 B;  4E6H A;  2VTB A;  3CHM A;  3QOU A;  4WWO A;  3JQ0 A;  3ESL A;  2J08 A;  4FU3 A;  2IO3 C;  3UKR G;  3ZN3 A;  1OY3 D;  4FJY A;  4G8K A;  3CK7 A;  5BNW A;  3FU3 A;  4U7E B;  3SI5 A;  4KYO B;  3ULE G;  2FEZ A;  4NAC A;  5EIB E;  5ENT D;  3G2T A;  3UT4 A;  3TJP A;  4HB5 A;  4HOR A;  5BXU A;  2YHC A;  3APD A;  5EN5 D;  1U3D A;  2NXP A;  4GA1 A;  4NRH B;  1HF8 A;  5JMN D;  4TUM A;  2ETB A;  3K9I A;  2X6F A;  4ME2 A;  3E34 A;  2WXO A;  4EPZ A;  2XPZ A;  2F8X K;  4BX8 A;  3PRZ A;  5CRV A;  3QC1 A;  4KZC A;  4DX6 D;  3PZ1 A;  1EYH A;  3CVW A;  2R05 A;  1E7U A;  3U4T A;  2XRZ A;  1SQM A;  3NAW A;  3HXF A;  5ARG A;  2IU1 A;  2MRI A;  2XHE A;  4UWK A;  3TWW A;  5BV0 A;  3DWL G;  4LRZ A;  3CK9 A;  3LVQ E;  4UUC A;  5C2Y A;  2F37 A;  2WVI A;  3E37 A;  3SBS A;  2P9K G;  3KS2 A;  2VSY A;  4I6E A;  4GMR A;  2WXM A;  3ZUV B;  3SO8 A;  3LXU X;  2LUH A;  3Q9N C;  4UQX A;  1MZC A;  4JXT A;  5ANL A;  1E96 B;  3L08 A;  2GRN B;  4I43 A;  4MBG A;  4I1A A; 
#chains in the Genus database with same CATH homology
 1KZP A;  3KSQ A;  4YDO A;  1N4P A;  4GTM A;  1X81 A;  3DRA A;  1N4R A;  1LD8 A;  3Q75 A;  4LNG A;  3DSV A;  1TN6 A;  3HXC A;  1TNY A;  3C72 A;  3Q79 A;  1N9A A;  1N95 A;  4GTO A;  1FPP A;  3HXD A;  3PZ4 A;  3DSX A;  3PZ3 A;  1O5M A;  2ZIR A;  3EUV A;  1O1R A;  1LD7 A;  3DPY A;  1NI1 A;  1JCS A;  1FT1 A;  1TN8 A;  1S63 A;  4GTV A;  3DSS A;  4GTT A;  1LTX A;  4GTQ A;  3E34 A;  1D8D A;  4EHM A;  3PZ2 A;  4LNB A;  2H6H A;  1SA4 A;  2IEJ A;  1NL4 A;  1N4S A;  1TN7 A;  1TNU A;  4GTR A;  2H6G A;  1O1T A;  3DSU A;  3HXB A;  1N4Q A;  1O1S A;  3PZ1 A;  4GTS A;  1DCE A;  1TNO A;  1FT2 A;  2ZIS A;  3EU5 A;  1SA5 A;  3E33 A;  3HXF A;  2BED A;  2R2L A;  3DSW A;  3Q78 A;  3Q73 A;  1QBQ A;  3Q7F A;  1TNZ A;  1D8E A;  3E32 A;  3E37 A;  3E30 A;  3DST A;  4YDE A;  1JCR A;  4L9P A;  2H6I A;  1TNB A;  3SFY A;  1N94 A;  1S64 A;  1JCQ A;  1MZC A;  1KZO A;  3HXE A;  3KSL A;  2F0Y A;  4GTP A;  2H6F A;  3Q7A A;  4MBG A;  3SFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...