1TNGA

Prediction of novel serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tngA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tngA02
1MAXA 1TMTH 1C5XB 2TGAA 2AYWA 5DP3A 4Y11E 5EW2H 3OX7U 4A1VA 1W8BH 2VVVA 1YPJH 2CN0H 2TBSA 5LH8A 2OXSA 2GMTB 2VIWA 2A7JA 1O5FH 1Z7KA 2BQ6B 1ZYOA 2FX6A 5A8XA 1P3EA 4X1SU 1AZZA 1O2JA 1Q3XA 1Z6JH 4IS5A 4MNWA 4WVPE 2C3SA 5DJ7A 1O3DA 3V7TA 1L4ZA 2BX4A 3PTBA 5HGGA 1Q2WA 1S0RA 3DHKH 1C5LH 1IQIA 2OBQA 3V12A 3NPSA 3LDXH 2HNTC 1FNIA 1MTUA 2AGIX 2FLBH 8KME2 3RXAA 2BZ6H 1FN8A 1TABE 2ZU1A 4UEHH 4ISOA 5I46H 2Z9LA 3MH4A 1TNKA 1C5NH 1O5BB 2AFQB 5T3HA 1LHEH 1EPTC 4DCDA 1PQ7A 4I32A 5EQRA 3MU4A 4DURA 2ZZUH 1UCYK 4R0IA 3M7TA 1C1VH 3SUGA 1PFXC 2UUKB 1K1JA 1QQUA 3QTOH 4A92A 2VNTA 2PV9B 2FM2A 4U30A 3A7XA 1TLDA 1IHTH 2PUQH 1P12E 2I6QA 2Y7ZA 3FP6E 1QY6A 4X8VH 1MTNB 1UTJA 1TX8A 3S69A 3TJVA 4B2CA 3U9AH 3A86A 2C90B 1ETSH 5HM9A 5AHGH 1SFQB 2ALVA 4ESTE 3V13A 2W7UA 3W95A 1GI2A 2AMQA 4ZKRU 2BOKA 3S7KB 3A83A 1DUEA 2C8WB 1Y8TA 4WJG2 2CHAB 3K2UA 4E06H 3RXJA 3STIA 1O3AA 1B5GH 3KQBA 1IQKA 4CRBA 4XBDA 2FO9A 4H6SB 1O2QA 4DIIH 3SQEE 5EOKA 5F8ZA 1S81A 1C5YB 4D7FA 2ANMH 2O8TA 2LPRA 1Y5AT 3EYDA 1GJ4H 3TGIE 6GCHG 2F9VA 2O8UA 4ZKOU 2ZP0H 5K0HA 3QO6A 2GDDA 3L33A 2FI4E 3LJJA 3RM2H 1YPHC 1GI3A 3E1XB 4Y0ZE 1BITA 1VGCB 1NESE 1TIOA 2FTMA 1NT1A 1ZTLA 8ESTE 3ATKA 1V6DA 4NGAH 3S9BA 3UOUA 1FY1A 2BB4A 2TGTA 1C5UA 4X0WU 3T25A 1F92A 1KXAA 6GCHF 3LGUA 3NCLA 4INKA 1AQ7A 3K65B 1ELAA 1XVOA 1DLKB 4AGKA 3RUOA 2YOLA 1YPLH 1DSUA 1J14A 1TPOA 3A8BA 1DUAA 2BVSH 1HJ8A 1QQ4A 2J2UA 1S85A 1C1OA 1FY3A 2A5AA 2GTBA 1GG6B 3H7TA 1TBZH 1KTSB 2QF0A 1O34A 1EZXC 1DXWA 4K69A 4Y7AA 2PGBB 2BYAX 3Q3KA 5L2YH 1HNEE 1A0LA 3S0NA 5LPRA 1P06A 1ZSKA 3UY9A 4FUGA 1BHXB 1YC0A 2F9PA 3LGWA 1AHTH 1LQEA 2P95A 1G2MA 5TCCA 1AB9B 1GDQA 4FUJA 1GI4A 3T29A 3RMMH 4FXGH 1J15A 1T8LA 3AVZA 4JCNA 1OPHB 1YPEH 4Y8XA 2ILNA 1KTTB 4DY7B 1MD8A 3SJIA 4Y0YE 1FQ3A 1HFDA 1TMBH 9ESTA 2P8OC 4NZLA 3A8DA 1O32A 5C1UA 3UWIA 1UTMA 2ODQA 1KIGH 2J38A 4I31A 2ODPA 3MO6A 1HAXB 2Z6BD 1GJ5H 1G2LA 1LPGB 3RXFA 4UD9H 2WPKS 1O2RA 2ZCHP 2G4TA 3I78A 2Z9KA 5EGMA 3O8RA 1UHBA 3MHWU 2BM2A 4FUFA 3P92A 2F9NA 2BQWB 3TJUA 1ANEA 3TITA 1GCTB 1AFQC 2V6NA 4JK5A 1SG8B 1O3KA 3Q3XA 1TNGA 4NCYA 1LDTT 1OSSA 4MNYA 2IN2A 2ANYA 2XBVA 4D76A 1C5TA 1GHAF 1BDAA 1ZJKA 2ZPQA 3S7HB 1UVTH 3RDZA 3NKKA 3I77A 1RTKA 4Q2KA 1ESAA 1NTPA 1JWTA 3FP7E 1LHDH 2BD3A 1ELGA 3P8NA 2ANKH 2H1UA 1SFIA 4IBLH 1P0SH 2XCNA 4I8KA 4DOQA 4WY3A 1P9SA 4TYDA 1TA6A 1C4V2 4OS5A 4K8YA 5AFZH 2CHAC 1O3CA 4X2XA 4E05H 2FZZA 4UFDH 1KYNA 1C2MA 1GBAA 1SLXB 1TRNA 6ESTA 3E0PB 1D3PB 3ZZ6A 4ZMAH 2W3IA 5EXNA 4JYTA 3VGCC 2Q6FA 3AW0A 2HGTH 1C5SA 1CA0C 1LO6A 3ATWA 3LH3A 1LTOA 1NRNH 2BLOA 1K1IA 1LCYA 4VGCB 5JBTA 3LC3A 2BLWA 1WBGB 3A87A 1J8AA 1BMAA 1OOKB 2A45B 2ZC9H 4CREA 1SQTA 1T7CA 4GSOA 4ABEA 4AYYB 2Z3EA 3T26A 2FOAA 3CS7A 1GHBG 1TNLA 1BQYA 2BVRH 4ZROA 1W14U 5FPTA 1Y3XA 1GBHA 1KY9A 1D9IA 3NZIA 2ANWA 1FJSA 1GBIA 4D7GA 4CBNA 4ISHH 2TRMA 1P2IA 3URCA 5EQSA 1V2VT 4H6TA 5DPAA 1G9IE 1LKBA 2XRCA 3SU1A 5A0AE 2GZ8A 1V2WT 1O5CB 1ARCA 2VGCB 1HJAC 1BTYA 1V2KT 4BXWA 1GHAG 1MAYA 1TRYA 3ZZ5A 1SQOA 3ZZAA 1WU1A 1Y5UT 4BTIB 1UTOA 1J17T 4X8UH 1Z8JB 1T31A 3BF6H 5AVDA 2VWLA 2I6SA 3SJKA 1ZMLA 3HGNA 1HYLA 3SOSA 2ZHWH 4RSPA 3PM3A 2A2XH 3GY4A 2AS9A 1LHCH 4JZFH 1NFYA 2C4FH 1GGDC 1H8DH 2QCYA 2A0QB 4GCHF 3DD2H 2BLVA 1O2SA 2OC1A 3UR6A 4WXVA 1SGEE 1K1MA 3ODDA 2QXHA 1N8OC 3ITIA 1BT7A 3MU1A 4ZKNU 3PWBA 3KQEA 1FV9A 2VH6A 3ELAH 4ZKSU 3HATH 1AIXH 5ETXA 2FOGA 3E91A 1QHRB 2F91A 3VXEH 1Y3YA 1GHZA 2A5IA 1ANCA 4Y10E 3FFGA 1THSH 3UPEA 1BTXA 3A82A 1ZPCA 3GCHC 4QT8C 1SGDE 2HNTE 5DG6A 1GMCF 3A88A 1XX9A 4R8TB 4U32A 3BG4C 4WH8A 1E34B 1OWHA 4MVNA 1NY22 2Z94A 1GDUA 1HRTH 1B7XB 5I25A 1QL8A 4WMFA 1P3CA 3F9GA 2C8XB 1O3PB 1UVSH 3LONA 1SGFG 3ZZ7A 3M37A 2QXIA 2HNTF 1LVBA 1L1JA 5E0GA 1D4PB 1FMGA 1BIOA 4U01A 5GXPA 2G81E 1ELDE 3UQVA 4O3TA 3PLPA 5EODA 5L6NH 1OS8A 2XC4A 3T2NA 1LVMA 3LIWA 4HZHA 1Z6EA 3C1KA 3D65E 3TNTA 2OC0A 2ZHEH 4IC6A 5A09A 5FHTA 2F83A 4MLFB 1VGCC 1C9PA 4PROA 3BIVH 4ISIH 1CU1A 1UK3A 5EQQA 1A5IA 3KL6A 2FODA 3TJNA 2ZU4A 2V3OH 1O36A 2H9HA 3RMLH 1ABIH 1CHOF 2AEIH 3F9HA 2ZFQH 3TU7H 3T28A 3QGJA 3M35A 4AORA 3AW1A 2FDAA 5GDSH 1DVAH 2ZDNA 1C1MA 3BTDE 4NWLA 3BTWE 5T6DA 1N1LA 1ACBE 5C5NA 2CV3A 1ELEE 3SV2H 4KTCA 7GCHF 1UVPA 1BJUA 4OGXA 1IQFA 1XUGA 4X1NU 1HCGA 3E16B 1WTHD 5T6GA 3B9FH 1ZPBA 4MDSA 1FIWA 4X6PA 3T27A 3Q76A 2IJOB 2M5TA 1K9OE 1A7SA 4Q7XA 1TB6H 4E7NA 1ZTJA 1MTNC 2XBYA 3SV9A 2TIOA 1UTPA 3EDXB 3MI4A 3KF2A 4TWWA 1C1TA 1FDPA 1VR1H 4BAOB 1IOEA 3SW2B 2IPHA 1HB0B 1S6HA 2ZCKP 1T4UH 3KIDU 4KP0A 2FMJA 2KAIA 2QGRA 1SHYA 1YCPK 1DWCH 3K6YA 1N6YA 2EEKA 1YBWA 2ZA5A 4JZIA 4J2YB 1C1QA 1O5GH 1O30A 1TNHA 3A85A 1C2EA 3A8CA 2BX3A 3OU0A 1DITH 2FOFA 4K1SA 3F68H 1A46H 4ABAA 3M5OA 2QN5T 3M5NA 2ZO3H 1ABJH 1P02A 1F2SE 1SOTA 1F5KU 1C2KA 1JIRA 2WV5A 2GV6A 3ZZ3A 1PYTD 1EXFA 1A1RA 4FUHA 4ABHA 4Y8YA 1GL1A 2FS9A 1SB1H 3QX5H 2WYJA 2FOHA 1EX3A 4ABFA 5F03A 2JH5D 4B75A 1XUJA 1CGHA 5GJ4B 3GY2A 4ABDA 1NFWA 1BRAA 3AASA 5T6FA 1XUKA 4CRCA 2OP9A 3DUXH 4FUEA 4NA8A 1ANDA 1CE5A 3MNSA 4K60A 2A32A 4IGDA 1TQ7B 2G4UA 4UFFH 3JZ1B 3MYWA 1Q31A 2ZU5A 2ZGBH 4YOIA 2ZFFH 4B2BA 1ZZZA 2HALA 1XKBC 1EOJA 2BD2A 5FBEA 3E3TA 3VPKA 1GMHF 2AERH 1WOFA 4AOQA 3GICB 1NU7B 1AD8H 2QAAA 5DGJA 1A4WH 2Y6TA 1Z8RA 1O3GA 3QWCH 4MNVA 1VITG 2ZGHA 1DE7H 2DE8A 3DFJA 5DK1A 4X8SH 6CHAC 3RXTA 2HVXA 2C8ZB 1MTSA 4AYVB 3UUZA 4JYVH 1CBWC 4B74A 1RD3B 1C2IA 2F9UA 1A2CH 1O2MA 1UTKA 2W7SA 2FTLE 1HAIH 1QGFA 2GMTC 4B1TA 1UTNA 1TALA 3L6PA 3VB7A 3RC6A 3BIUH 2TGPZ 3PV4A 3BN9A 3SGQE 2HPQH 1GI5A 1VCQA 1O2ZA 1QR3E 4GVUA 1FZZA 4BAHB 1EP6A 1O2TA 1OWJA 1DX5M 1XUHA 1F0SA 1NRSH 1UJ1A 2P8OB 5EXMA 2NU0E 2R3YA 4GHTA 2BY6X 2BD7A 4O3UA 3A81A 1BB0B 5K7RA 1OP2A 1S83A 3AAVA 1DFPA 3PB1E 3SNBA 5E8EH 3RU4T 2VU8E 1UK2A 1SOZA 3UOPA 1C2JA 3T62A 1TPSA 1EP5A 1EKBB 1AU8A 2IOTA 3IG6B 3TGKE 1BTUA 3RXPA 1W7XH 1O3MA 2A4RA 4ABIA 3OTJE 3SHCH 3M36A 1C1UH 2ZPSA 1K22H 1IQMA 2BXUH 3HGPA 3RXUA 1O3NA 3EAJA 1O2PA 5DP6A 1AI8H 3LC5A 1ELVA 5IYTA 1NM6A 1J9CH 5FPYA 4KTUA 1DM4B 3RU4D 1S84A 3SV6A 3QN7A 3VB5A 1PYTC 4JZEH 1PQ8A 3KEEA 3FANA 2R9PA 3GDUA 3MOCA 1DOJA 3VXFH 3A84A 1PQAA 4CR9A 2BY9X 2D1JA 4JYUH 2R2MB 5CHAB 1IQGA 3HKIB 1HAOH 1O2XA 2ZFSA 2Q6GA 3RXRA 3GDSA 1P9UA 2AMDA 3BG8A 1V2QT 1SLUB 4AG1A 2P3UB 1RFNA 1EZQA 1HAVA 4KGAA 1AVXA 3TVJB 1A61H 4OS7A 1PPFE 1CT0E 5FXLA 1DWEH 1NU9A 4OS4A 1DY9A 3SI4H 1AE8H 2DE9A 1PQ5A 4ISLA 4M7GA 1EAIA 1G37A 1QJ1B 2FLRH 2YNAA 1NPMA 2B0FA 1QIXB 1DT2A 1TOMH 1FI8A 3M7QA 1RS0A 1ZHPA 3OY6U 5EXLA 2ZGCA 1GL0E 1IQEA 2BDGA 3MH6A 1P11E 2ZTXA 1MUEB 1K21H 1GJBB 2WUBA 4I33A 4AFZA 3GCOA 1ZSJA 2ZTZA 3BTQE 4AFSA 1O3OA 1V2OT 2XCFA 3QTVH 2JH6D 3SUEA 2J92A 1W0YH 3GCHB 1AWHB 3PMJA 4NFFA 3U69H 2BLQA 1WAYB 1TGNA 3BEFB 2Z7FE 2VWNA 2FYRA 2GCTC 1ZOMA 3LKWA 1TBRH 1ELBA 1PPGE 1QCPA 3SORA 3PMHB 5GCHG 4JZ1A 1O3EA 3O8BA 1ID5H 2A31A 4THNH 3ZVEA 1XM1A 1S82A 1TOCB 1TQ0B 3PLKA 2RA0A 4HFPB 1OP0A 4CRFA 5DP8A 1QFKH 1UMAH 1CT2E 3T5FH 2PR3A 4D8NA 1UK4A 3U1IB 2ZDKA 5G4BA 2K1QA 1O2OA 1TMUH 5EPNA 4YOJA 4CHAB 1XKAC 2F3CE 2H5CA 1O2YA 5CE1A 1OXGA 1E0FD 3B8JA 1JRTA 1EOLA 4XE4A 1BRBE 4YLUA 3PWCA 2ZGXH 3ATLA 1KXDA 2VIPA 2ZDVH 1F0TA 2O8WA 1HJAB 1GJ8B 2ZIQH 1KLTA 3TH3H 1MBQA 1ZMJA 1SGFA 1AMHA 5ESTE 1B0EA 1CGJE 2OD3B 3UNSA 2G5VA 4UE7H 4IMZA 1HAGE 4AB8A 1GPZA 2A2QH 4Y71A 3PLBA 2F9OA 2PSYA 1L2EA 4OGYA 4ZHLU 1HAYB 4NA7A 4FUDA 2BDAA 3BG4B 4DJZB 2J94A 3S9AA 3PROA 3MO3A 4I8JA 2ZGJA 3P70B 2BDHA 1O3IA 2BMGB 4CH8B 1YP9A 4XOJA 2OUAA 3RXMA 1WCZA 4X6NA 3LJOA 1INCA 1GI9B 2HRVA 5PTPA 3U8OH 1OP8A 4BAMB 2OBOA 1KXFA 4TPYA 3CP7A 4X2YA 3SGBE 1O3HA 1P2JA 3UQOA 1MTWA 5C1XA 4I8GA 1O0DH 1C1RA 4MG3A 1P05A 4YM9A 3VB3A 1YYY1 1W7GH 1WTGH 1BTZA 5EU8A 3LU9B 3BV9B 1V2PT 1BBRH 3ESTA 2DUCA 1O2HA 2UWPA 3ATIA 3I29A 1V2JT 2WPHS 2SGPE 3EA8A 2PUXB 4NIWA 5J4SA 1IQLA 2ZU2A 2W3KA 1YCPM 1CHOG 8GCHG 1AVGH 1QB1A 1GJ9B 3G01A 1T4VH 1C4Y2 1FAKH 5A0BA 5JBCS 3P8GA 1BJVA 3D62A 1DANH 2ZEBA 2A5KA 2BDYA 2UUYA 4Y76A 2Y5GA 4BXSA 3U8RH 4XBBA 1TNJA 1EAUA 3FZDA 1EAXA 2P93A 5DP4A 3GCTF 1FLEE 3PO1C 1AZ8A 1EZUC 1OX1A 1C5VA 3GCNA 1BHXF 2Z3DA 4X2WA 5JPMH 5LPEA 1VCWA 2QXGA 4RKJB 1GI1A 3RXCA 1MU6B 3SU2A 3KN2A 1YKTA 4CRDA 2A7HA 1O31A 2EA3A 1T8MA 1TYNA 1F5RA 4OS6A 4CH2B 4AX9H 1V2MT 3V0XA 2PHBA 1OYTH 1W0ZU 3P8OA 3H7OA 1MBMA 2FOEA 2G8TA 2O9QA 2XWAA 1PPBH 2P59A 2ZFPH 2PLXA 1SPJA 1UVOA 4ZAEA 5J4QA 1MMJN 3EA7A 1AWFH 3VEQB 2RA3A 1CT4E 1HIAB 3UREA 1MKWH 1GMCG 1WQSA 4SGAE 1KSNA 1O2WA 1L0ZA 5DP5A 1V2NT 1MU8B 2ZPRA 3A7WA 2XWBI 4O9VA 3GOVB 3HKJB 1QURH 3GISB 1C5ZB 1C5QA 1JOUB 2ZHDA 4FUBA 1Z1IA 4B71A 1GBFA 1AE5A 1RXPA 2SGQE 1E38B 4WMDA 5HMAA 1MKWK 1W3CA 3RXGA 1O2NA 4A5TS 2Z9JA 1EQ9A 4FVDA 3ZVAA 3AAUA 1SVPA 3IWMA 3PO1B 3ZVFA 2Y7XA 6LPRA 3DA9B 4XDEA 3QLPH 2CMYA 2GT7A 4LK4A 2QA9E 2G00A 2EI7A 1O3BA 2GT8A 4NIXA 2ZKSA 5HXFA 2FOMB 2VWMA 4IMQA 4K8BA 1PPHE 2OQ5A 1GBBA 1SC8U 1SR5C 1GCTC 4FU7A 5E2OA 2D8WA 1P2QA 1GVKB 3MFJA 3ZZCA 4YT6H 3E6PH 4MPXA 2J9NA 1C1PA 1TPAE 2VVUA 3M5LA 1HUTH 1SGNE 1O2GH 2XTTB 1RIWC 2ZFRH 3LGIA 4TY6A 1C1SA 4GHQA 5DP9A 1KDQB 1WSSH 1GJ7B 3RXDA 1GBDA 1VZQH 2PKAA 1C5RA 2JETB 1V3XA 2B7DH 1MCVA 2XBWA 1P01A 4WH6A 1H1BA 1QTFA 4IN2A 2A4QA 3HK6B 4XSKU 8LPRA 1EPTA 4ZH8A 2STBE 2R3UA 5SGAE 1X7AC 3A7YA 2ZF0H 4YESB 9LPRA 2CXVA 2A1DB 1GG6C 2OC8A 4DW2U 1EPTB 1NZQH 1XVMA 5TCAA 1J16A 2VGCC 1D3QB 2C8YB 3A7VA 1F0UA 3F9FA 3P8FA 3SNEA 2VIDA 1F0RA 4X6MA 1V2ST 2ZG0H 3ZVDA 5FCKA 1C1WH 1UHBB 4A6LA 2ZHQH 3SU5A 2V35A 1PPCE 5C5OA 4O97A 3FZZA 3BTME 4DT7B 4A7IB 1YLCA 2A4GA 1BA8B 4K2YA 1P2OA 2V0BA 3ENSB 1KLIH 1IHSH 1FAXA 2J4IA 4ZUHA 2RG3A 3SNCA 3M7UA 4INLA 1ZRBA 3HPTB 2ZDLA 1NC6A 1P8VC 1C9TA 3PTNA 1DWBH 1H8IH 1NS3A 4UFEH 1BTPA 2SNVA 5FAHA 1ZR0A 1FY4A 1P10A 1AVWA 2HPPH 3DFLA 3GYLB 1EASA 1H9IE 3EQ0H 2GD4B 3OSYA 1O2IA 1XUIA 5C67A 4AN7A 2Y5FA 1GJCB 1GMDG 1QRXA 2G52A 2NWNA 3SGAE 4I7YH 4ABJA 1UTLM 1SLWB 5HM2A 3SV8A 1G30B 1PPEE 5GIBA 1ZGVA 5E0HA 2QY0B 3N7OA 4HI3A 3KHVA 1T32A 1TPPA 2BVXH 3MH5A 4RN6A 1N8OB 1IQNA 2R2WU 4NG9H 3BTFE 5H4IB 4DG4A 2BZAA 4X1PU 2QC2A 5DO4H 1UCYH 2AMPA 2B9LA 2P3TB 1VCPA 3UNRA 2NU2E 3PYHA 5EW1H 5BRRE 4MPVA 1XUFA 5C3NA 1UO6A 1C2FA 1ZSLA 1HIAA 4X2VA 3RXBA 3UTUH 3TLOA 2ULLA 1AGJA 1HJ9A 2TGDA 2AGGX 3ATMA 1ARBA 4WWYA 4ZXXH 3UFAA 1TE0A 4NSVA 1GJAB 4BAQB 1XMNB 2CJIA 3OY5U 1ZLRA 3LOXA 2THFB 2ZDMA 1ZTKA 1G32B 2SGFE 5AFYH 1H9HE 2RCEA 3RXIA 3RXQA 8GCHF 3M3TA 2B5TB 1H4WA 3GY3A 1TGTA 4DVAU 3F6UH 3SV7A 4XFQA 2W5EA 1FIZA 4H42U 1UCYE 5B6OA 5LPFA 3DT0H 1O2UA 3ODFA 4MNXA 4JMYA 2GCHG 1T8NA 1MZAA 2PKAB 2VWOA 1CA0B 3TH2H 1LPKB 5JYIA 1EAWA 3A8AA 1ESTA 4B2AA 4GCHG 1CO7E 1DICA 4NZQA 3RXEA 3KNXA 4KTSA 2BDCA 2GZ7A 1DWDH 4E7RG 4MQAA 1GHVH 3LPRA 3UNQA 1QRZA 4NWKA 3TK6A 1O5AB 1WV7H 4IN1A 3RXSA 5A0CA 3SUFA 1ETRH 2UUJB 1QBNA 1WYKA 1BRCE 1LQDB 1K2I1 4NIVA 5AF9H 1C5PA 1D6WA 1GMDF 1T8OA 1H9LB 1W11U 1GVLA 3A7ZA 4FU8A 2G5NA 2J95A 1NRPH 1JRSA 1ZJDA 1KDQA 5ABWA 1P57B 1L4DA 3HK3B 1P09A 3ZVGA 1LVYA 1FUJA 1K1PA 5JB9S 2BD4A 1EUFA 5FBIA 2VINA 1TA2A 3RLYH 4AGJA 4ISNA 2SFAA 3GY5A 3QZRA 1GGDB 1GHBF 4Y7BA 3EA9A 1GBCA 5CMXH 3SJ8A 2J34A 1AY6H 3GY7A 1SLVB 1RTFB 1GI0A 3SHAH 5FX5A 1RTLA 3VGCB 2PFEA 3MO9A 1E36B 3U98H 5L30H 1IQHA 3BSQA 2AH4X 4FUCA 2V3HH 2OTVA 1TGSZ 1C5MD 2ZU3A 4XBCA 1QB6A 3MNCA 1O38A 5E2PA 4BTTB 1ZMNA 4ABBA 1ZHRA 2WPIS 1TONA 2Y82A 2PTCE 1PPZA 1GCDA 1Y3WA 3SU6A 1GI6A 2QV1A 1JXPA 4JZDH 5FPSA 1GVZA 3BTEE 4F4OC 1TX6A 4YZUA 4GLYA 4Q7ZA 2ZHFH 1BZXE 3GY6A 1NN6A 3BTTE 3TH4H 2BQ7B 1QA7A 1GDNA 1JMOH 2GX4A 1KXBA 3GY8A 3MTYA 2D26C 4I8LA 4A1XA 5DP7A 3ZV8A 4K5ZA 4DGJA 4GUXA 4MPWA 2GKVE 5A2MH 2WPLS 1C5OH 1HDTH 3MU8A 1LPZB 4SGBE 4Y6DA 4GAWA 3ZVCA 5A8ZA 1RRKA 2GDEH 3SQHE 2SGEE 1K1NA 1HAPH 1THRH 3BTGE 3VB4A 2H5DA 2BD5A 2D2DA 2PKSB 2Z3CA 4UFGH 5BPEA 4X6OA 3ZZ8A 2FS8A 1OWDA 3RM0H 2BDBA 5GPIB 3TNSA 1A5HA 1SGYE 3RXOA 1XXDA 1AKSA 2GZ9A 1A0JA 4BTUB 4D9RA 4ABGA 3K6ZA 1PJPA 2UWOA 1NO9H 1MKXK 7LPRA 1RGQA 5IDKA 1XXFA 2HLCA 1MQ5A 1LHFH 2FP7B 5FX6A 3ZVBA 5ESBA 1SL3A 3A89A 4AFUA 2EC9H 5JDUB 1IQJA 1NRRH 1JBUH 1P2KA 1QL9A 2A7CA 2Z9GA 2AIQA 3FP8E 1VITH 2C93B 1S6FA 1ELFA 1SHHB 2HWLB 2NU3E 3PMAB 5HYOA 2SNWA 1BBRE 1C2DA 3O8DA 3R0FA 1GBJA 1CQQA 1AFEH 1C5WB 1F5LA 4RKOB 2ZWLH 1YF4A 2XYAA 3MU5A 2ASUB 3U1JB 2PSXA 1O35A 2EI8A 2VJ1A 1D3TB 1TBQH 4K3JA 3RC4A 4B73A 2OINA 1GJDB 1F7ZA 1DDJA 1YGCH 2H9TH 4YOGA 3EGKH 1NRQH 1QB9A 4F49A 3L3TA 1GBKA 4JK6A 1QJ6B 3SU0A 2F9BH 2QF3A 1NFXA 3MH7A 4MPUA 4AB9A 2WYGA 4FUIA 2XNIA 1Z8GA 3LGYA 4FU9A 5FCRA 1G36A 1BMLA 1OWKA 3TPIZ 1JIMA 1FONA 1FY8E 7KMEH 3Q77A 3P95A 1W12U 2BD9A 3P17H 2ZTYA 1V2TT 1CGIE 1EATA 3D49H 5C20A 2ODYB 2JKHA 5EG4A 1O2KA 2BY5X 2W26A 2ZQ1A 1DSTA 4CRAA 2NU4E 4BANB 3GYMA 1A0HB 3S9CA 2AGEX 1CA8B 1AFQB 1KLJH 1G3CA 2BY7X 2GCHF 2O8LA 2R0KA 2ZDAH 3SJOA 1MZDA 4AZ2B 2WUCA 1DPOA 2R0LA 5A8YA 1P2MA 1SGPE 1G3BA 2XXLA 1TGBA 3QDZB 1FPCH 2FOBA 1OYQA 4CBOA 3MU0A 3VFEA 3LGTA 3BTHE 4ZXYH 4B76A 1CBWB 5CHAC 1HAHH 3R3GB 1YPMH 4MTBA 2VB0A 2H9EH 3TIUA 1SGRE 1DLEA 4GPGA 1DY8A 2Q1JA 1LMWB 2VIVA 3SZNA 3H5CB 2BD8A 2PGQB 4ZHAA 1WQVH 3IITA 3P6ZB 2XC5A 3ZZBA 1E35B 3LT3A 1A5GH 1ORFA 1AB9C 1G3DA 2RDLA 1V2UT 2FPZA 3ZYEA 2ZFTA 2G55A 3RC5A 1A3BH 2BXTH 1O3JA 1HBTH 3QZQA 3RMNH 1EJAA 2ZQ2A 4Q7YA 3F9EA 4BAKB 1Z1JA 1TFXA 3MWIU 1E37B 1SGIB 1EB1H 3C27B 3M3SA 1SQAA 1QNJA 4O03A 1K1OA 1S0QA 3ZZ9A 3WY8A 4TPIZ 2JH0D 3ZZ4A 1QL7A 3V3MA 1KXCA 1NFUA 5C2ZA 4TWYA 2NU1E 1ELTA 2Y81A 1MTVA 5LGOA 1DXPA 1K1LA 3KCGH 1LVOA 3TK5A 4AFQA 4Q80A 2H6MA 1OWEA 1P03A 1TAWA 2P94A 1Y3VA 1THPB 3NK8A 1A3EH 2Z9IA 1GBEA 2OCVB 1AUTC 2OLGA 1D3DB 1VITF 2PW8H 3RMOH 3NWUA 2B8OH 2FWWA 2P3FH 1GWAA 3SNDA 5JBAS 2GCTB 2UUFB 3RXLA 2SGDE 3RXVA 1TNIA 3M61U 1K28D 4U2WA 4NFEA 1CVWH 1O5EH 2ZI2H 1AKSB 2JETC 1OWIA 1SGTA 1TRMA 4NIYA 2ZECA 1ZGIA 4X8TH 2FI5E 1WUNH 1BCUH 1O3FA 1EJMA 1GHWH 1RIWB 1ETTH 4UDWH 3F1SB 1ZRKA 1CHGA 1HLTH 1HXEH 4X1RU 1YPHE 1BOQA 3RXKA 3SN8A 3A80A 1GBLA 4K1EA 1C2HA 1TX7A 4YTAA 2CGAA 3STJA 1C2GA 1FPHH 2UWLA 1O3LA 3ZZDA 3EE0B 4HGCA 2BHGA 3SU4A 2PWXA 1O2VA 4CRGA 4WXIA 4UONA 1O2LA 3MNXA 4YT7H 1MQ6A 2EI6A 6CHAB 1QBOA 1ZPZA 4LXBH 4LZ1H 2ZNKH 2GV7A 4NSYA 4HTCH 2VIQA 3M5MA 4LOYH 2FI3E 1O37A 5F8TA 1SSXA 3W94A 4BOHA 3BTKE 3NUMA 4KKDA 1BRUP 2BOHB 3ZV9A 1FY5A 1QA0A 1N6XA 2QXJA 1YLDA 2WINI 5TJXA 5GWZA 5L2ZH 4ASHA 1MD7A 1BTHH 1NROH 1SMFE 1BUIA 1DS2E 1P2NA 1V2RT 1EB2A 2FESH 3SNAA 1SBWA 4Y8ZA 4IC5A 1GHYH 3KQCA 4Z6AH 4H4FA 3UIRA 3TJOA 2O8MA 1YM0A 1SGQE 7GCHG 1C1NA 4K1TA 5JB8S 2PTNA 2BY8X 2STAE 5GCHF 5DKMA 1MH0A 2FYQA 4WMEA 1MCTA 5E0JA 3GCTG 2SGAA 4INHA 1EJNA 2GP9B 4FVBA 4YO9A 3SJ9A 1M9UA 3RP2A 2XBXA 2WPJS 4AG2A 2CF9H 3M3VA 2AIPA 1HGTH 1OKXA 2VVCA 1ANBA 1IAUA 2A4OA 1FN6A 1HV7A 4IW4E 3SUDA 2FIRH 1GHXH 3E8LA 3QK1A 2ALPA 1BMNH 1QJ7B 1W13U 1GBMA 3A7TA 3OYPA 1GI7B 2Q6DA 2PKSC 1UVUH 2FEQH 1AN1E 1GJ6A 4YLQH 1BMMH 3E0NB 1C4U2 2GGVB 1QBVH 1MKXH 4A1TA 1Z71A 3ZYDA 1HAZB 1LHGH 4ZHMU 3CENA 2LNCA 3FAOA 4D9QA 3Q3YA 1L1NA 1U6QA 1L1GA 1YPGH 1TGCA 4Z0KA 1Y59T 3QUMP 4NA9H 2FXRA 2ZCLP 2OQUA 3KGPA 2HOBA 4DIHH 2BDIA 3NXPA 1Y3UA 2OC7A 3SU3A 3MMGA 3RXHA 1HXFH 2WV4A 1BTWA 1FXYA 3D23A 1Z8IB 1QRWA 2CF8H 1G3EA 1HAVB 1KXEA 3SBKA 4BNRA 2G51A 1O39A 3LGVA 1HPGA 5EPYA 1AUJA 1SGCA 1W2KH 3B23B 3CS0A 1LKAA 1GBTA 3UWJH 4CHAC 3FVFB 3O8CA 1YPKH 1B0FA 4I8HA 4TY7A 5F8XA 2XW9A 2Y5HA 4LZ4B 1AO5A 7ESTE 4OS2A 3TK9A 1VJAU 3QGNB 1P04A 5C1YA 4KELA 4WF8A 2Y80A 3U8TH 2QYIA 2TPIZ 3E90B 1V2LT 1VJ9U 2FX4A 3VB6A 3Q00A 3KQDA 3MNBA 1S5SA 2KAIB 2XC0A 1Y5BT 4Y79A 1ZHMA 1YCPH 4X1QU 4J1YA 3K9XB 3PMBB 3SO3A 1W10U 1GMHG 3JZ2B 3RU4E 1O5DH 1EZSC 5F6MA 2H2ZA 1ESBA 3RLWH 1RJXB 2FOCA 3SI3H 1CSOE 1SI5H 2GVFA 2VIOA 3BEIB 4VGCC 1D6RA 1BBRK 2ESTE 3UR9A 3LH1A 4OS1A 4CR5A 2YNBA 2BTCE 3URDA 1TWXB 3BEUA 2WPMS 2QIQA 1C2LA 1UTQA 1O33A 3TGJE 1GI8B 5JBBS 3GDVA 2VH0A 1ELCA 2P16A
chains in the Genus database with same CATH superfamily
1MAXA 1TMTH 1C5XB 2TGAA 2AYWA 5DP3A 4Y11E 5EW2H 3OX7U 4A1VA 1W8BH 2VVVA 1YPJH 2CN0H 2TBSA 5LH8A 2OXSA 2GMTB 2VIWA 2A7JA 1O5FH 1Z7KA 2BQ6B 1ZYOA 2FX6A 5A8XA 2PP6A 1P3EA 1YY3A 4X1SU 1AZZA 2W6JD 1O2JA 1Q3XA 1Z6JH 4IS5A 3SZEA 4MNWA 4WVPE 2IJD1 2C3SA 5DJ7A 1O3DA 3V7TA 3F2HA 1L4ZA 2BX4A 3PTBA 5HGGA 1Q2WA 1S0RA 3DHKH 1C5LH 1IQIA 2OBQA 3V12A 3NPSA 3LDXH 2HNTC 1FNIA 1MTUA 2AGIX 3KYGA 2FLBH 8KME2 3RXAA 2BZ6H 1FN8A 1TABE 2ZU1A 4UEHH 4ISOA 5I46H 2Z9LA 3MH4A 1TNKA 1C5NH 1O5BB 2AFQB 5T3HA 1LHEH 1EPTC 4DCDA 1PQ7A 4I32A 5EQRA 3OE7D 2W6ID 3MU4A 4DURA 2ZZUH 1UCYK 4R0IA 3M7TA 1C1VH 3SUGA 1PFXC 2UUKB 1K1JA 1QQUA 3QTOH 4A92A 1FX0B 2VNTA 2PV9B 5FL7D 2FM2A 4U30A 3A7XA 1TLDA 1IHTH 2PUQH 2CK3D 1P12E 2I6QA 2Y7ZA 3FP6E 3U28C 1QY6A 4X8VH 1MTNB 1UTJA 1TX8A 3S69A 3TJVA 2EY4C 4B2CA 3U9AH 3A86A 2C90B 1ETSH 2JDID 5HM9A 5AHGH 1SFQB 2ALVA 4ESTE 3V13A 2W7UA 3W95A 3KYFA 1GI2A 2AMQA 4ZKRU 2BOKA 3S7KB 3A83A 1DUEA 2C8WB 1Y8TA 4WJG2 2CHAB 3K2UA 4E06H 3RXJA 3STIA 2GJGA 1O3AA 1B5GH 3KQBA 1IQKA 4CRBA 4XBDA 2FO9A 4H6SB 1O2QA 4DIIH 3SQEE 5EOKA 5F8ZA 1S81A 1C5YB 4D7FA 2ANMH 2O8TA 2LPRA 1Y5AT 3EYDA 1GJ4H 3TGIE 6GCHG 2F9VA 2O8UA 4ZKOU 2ZP0H 5K0HA 3QO6A 2GDDA 3L33A 2FI4E 3LJJA 3RM2H 1YPHC 1GI3A 3E1XB 4Y0ZE 1BITA 1VGCB 5CHBA 1NESE 1TIOA 2FTMA 1NT1A 1ZTLA 8ESTE 3ATKA 1V6DA 4NGAH 3S9BA 3UOUA 1FY1A 2BB4A 2TGTA 1C5UA 4X0WU 3PV5A 3T25A 1F92A 1KXAA 6GCHF 3LGUA 3NCLA 4INKA 1AQ7A 3K65B 1ELAA 1XVOA 1DLKB 4AGKA 3RUOA 2YOLA 1YPLH 1DSUA 1J14A 1TPOA 3A8BA 1DUAA 2BVSH 1HJ8A 1QQ4A 2J2UA 1S85A 1C1OA 1FY3A 2A5AA 2GTBA 1GG6B 3H7TA 1TBZH 1KTSB 2QF0A 1O34A 1EZXC 1DXWA 4K69A 3PRBA 4Y7AA 2PGBB 2BYAX 3Q3KA 5L2YH 1HNEE 1A0LA 3S0NA 5LPRA 1P06A 1ZSKA 3UY9A 4FUGA 1BHXB 1YC0A 2F9PA 3LGWA 1AHTH 1LQEA 2P95A 1G2MA 5TCCA 1AB9B 1GDQA 4FUJA 1GI4A 3OEHD 3T29A 3RMMH 4FXGH 1J15A 1T8LA 3AVZA 4JCNA 1OPHB 1YPEH 4Y8XA 2ILNA 1KTTB 4DY7B 1MD8A 3SJIA 4Y0YE 1FQ3A 1HFDA 1TMBH 9ESTA 1KMHB 2P8OC 4NZLA 3A8DA 1O32A 5C1UA 3UWIA 1UTMA 2ODQA 1KIGH 2J38A 4I31A 2ODPA 3MO6A 1HAXB 2Z6BD 1GJ5H 1G2LA 1LPGB 3RXFA 1OHHD 4UD9H 5F53A 2WPKS 1O2RA 2ZCHP 2G4TA 4ACBA 3I78A 2Z9KA 5EGMA 3O8RA 1UHBA 3MHWU 2BM2A 4FUFA 3P92A 2F9NA 2BQWB 3TJUA 1ANEA 3TITA 1GCTB 1AFQC 2V6NA 4JK5A 1SG8B 1O3KA 3Q3XA 1TNGA 4ZCNA 4NCYA 1LDTT 1OSSA 4MNYA 2IN2A 2ANYA 2XBVA 4D76A 1C5TA 1GHAF 1BDAA 1ZJKA 2ZPQA 3S7HB 1UVTH 2JIZD 3RDZA 3NKKA 3I77A 1RTKA 3FKSD 4Q2KA 1ESAA 1NTPA 1JWTA 3FP7E 3W1EA 1LHDH 2BD3A 1ELGA 3P8NA 2ANKH 2H1UA 1SFIA 4IBLH 1P0SH 2XCNA 4I8KA 4DOQA 4WY3A 1P9SA 4TYDA 1TA6A 1C4V2 4OS5A 4K8YA 5AFZH 2CHAC 1O3CA 4X2XA 4E05H 2FZZA 4UFDH 1KYNA 1C2MA 1GBAA 1SLXB 1TRNA 6ESTA 3E0PB 1D3PB 5HIZA 3ZZ6A 4ZMAH 2W3IA 5EXNA 4JYTA 3VGCC 2Q6FA 3AW0A 2HGTH 1C5SA 1CA0C 1LO6A 3ATWA 2QE7D 1LTOA 1NRNH 2BLOA 3LH3A 1K1IA 1LCYA 4VGCB 5JBTA 3LC3A 2BLWA 1WBGB 3A87A 1J8AA 1BMAA 1OOKB 2A45B 2ZC9H 3DSOA 3WWBA 4CREA 1SQTA 1T7CA 4GSOA 4ABEA 4AYYB 2Z3EA 3T26A 4RT0A 5KEDA 2FOAA 3CS7A 1GHBG 1TNLA 1BQYA 2BVRH 4ZROA 1W14U 5FPTA 1Y3XA 1GBHA 1KY9A 1D9IA 3NZIA 2ANWA 3F0PA 1FJSA 1GBIA 4D7GA 4CBNA 4ISHH 2TRMA 1P2IA 3URCA 5EQSA 1V2VT 4H6TA 5DPAA 1G9IE 1LKBA 2XRCA 3SU1A 5A0AE 2GZ8A 5KGOA 1V2WT 1O5CB 1ARCA 2VGCB 1HJAC 1BTYA 1V2KT 4BXWA 1GHAG 5C0UA 1MAYA 4FETA 1TRYA 3ZZ5A 1SQOA 3ZZAA 1WU1A 1Y5UT 4BTIB 1UTOA 1J17T 4X8UH 1Z8JB 1T31A 3BF6H 5AVDA 2VWLA 2I6SA 3SJKA 1ZMLA 3HGNA 1HYLA 3SOSA 2ZHWH 4RSPA 3PM3A 2A2XH 3GY4A 2AS9A 1LHCH 4JZFH 1NFYA 2C4FH 1GGDC 1H8DH 2QCYA 1VKYA 2A0QB 4GCHF 3DD2H 2BLVA 1O2SA 2OC1A 3UR6A 4AC9A 4WXVA 1SGEE 1K1MA 3ODDA 2QXHA 1N8OC 3ITIA 1BT7A 3MU1A 4ZKNU 3PWBA 3KQEA 1FV9A 2VH6A 3ELAH 4ZKSU 3HATH 1AIXH 5ETXA 2XOKD 2FOGA 3E91A 1QHRB 2F91A 3VXEH 1Y3YA 1GHZA 2A5IA 1ANCA 2HLDD 4Y10E 2EQNA 3FFGA 1THSH 3UPEA 1BTXA 3A82A 1ZPCA 3GCHC 4QT8C 1SGDE 2HNTE 5DG6A 1GMCF 3A88A 3NRLA 1XX9A 4R8TB 4U32A 3BG4C 4WH8A 1E34B 1OWHA 4MVNA 1NY22 2Z94A 1GDUA 1HRTH 1B7XB 5I25A 1QL8A 4WMFA 1P3CA 3F9GA 2C8XB 1O3PB 1UVSH 3LONA 1SGFG 3ZZ7A 3M37A 4YXWD 2QXIA 2HNTF 1LVBA 1L1JA 5E0GA 1D4PB 1FMGA 1BIOA 4U01A 5GXPA 2G81E 1ELDE 3UQVA 2QF5A 4O3TA 4RT1A 3PLPA 5EODA 5L6NH 1OS8A 2XC4A 3T2NA 1LVMA 3LIWA 4HZHA 1Z6EA 3C1KA 3D65E 3TNTA 2OC0A 2ZHEH 4IC6A 5A09A 5FHTA 1H8HD 2F83A 4MLFB 1VGCC 1C9PA 4PROA 3BIVH 4ISIH 1CU1A 1UK3A 5EQQA 3KQ5A 1A5IA 3KL6A 2FODA 3TJNA 2ZU4A 2V3OH 1O36A 2H9HA 3RMLH 1ABIH 1CHOF 2AEIH 3F9HA 2ZFQH 3TU7H 1YWUA 3T28A 3QGJA 3M35A 4AORA 3AW1A 2FDAA 5GDSH 1DVAH 2ZDNA 1C1MA 3BTDE 4NWLA 3BTWE 5T6DA 1N1LA 1ACBE 5C5NA 2CV3A 3GS9A 1ELEE 3SV2H 4KTCA 7GCHF 1UVPA 1BJUA 4OGXA 1IQFA 1XUGA 4X1NU 1HCGA 3E16B 1WTHD 3VG8A 5T6GA 3B9FH 1ZPBA 4MDSA 1FIWA 4X6PA 3T27A 3Q76A 5EJ1A 2IJOB 2M5TA 1K9OE 1A7SA 4Q7XA 1TB6H 4E7NA 1ZTJA 1MTNC 2XBYA 3SV9A 2TIOA 1UTPA 3EDXB 3MI4A 3KF2A 4TWWA 1C1TA 1FDPA 1VR1H 4BAOB 1IOEA 3SW2B 2KFWA 2IPHA 1HB0B 1S6HA 2ZCKP 1T4UH 3KIDU 4KP0A 2FMJA 2KAIA 2QGRA 1SHYA 1YCPK 1DWCH 3K6YA 1N6YA 2EEKA 1YBWA 2ZA5A 4JZIA 4J2YB 1C1QA 1O5GH 1O30A 1TNHA 3A85A 1C2EA 3A8CA 2BX3A 3OU0A 1DITH 2FOFA 4K1SA 3F68H 1A46H 4ABAA 3M5OA 2QN5T 3M5NA 2ZO3H 1ABJH 1P02A 1F2SE 1SOTA 1F5KU 1C2KA 3WWFA 2RDEA 1JIRA 2WV5A 2GV6A 3ZZ3A 1PYTD 1EXFA 1A1RA 4FUHA 4ABHA 4Y8YA 4B6FA 1GL1A 2J5UA 2FS9A 1SB1H 3QX5H 2WYJA 3F2FA 2FOHA 1EX3A 4ABFA 5F03A 2JH5D 4B75A 1XUJA 1CGHA 5GJ4B 3GY2A 4ABDA 1NFWA 1BRAA 3AASA 5T6FA 1XUKA 4CRCA 2OP9A 3DUXH 4FUEA 4NA8A 1ANDA 1CE5A 3MNSA 4K60A 2A32A 4IGDA 1TQ7B 2G4UA 4UFFH 3JZ1B 3MYWA 1Q31A 2ZU5A 2ZGBH 4YOIA 2ZFFH 4B2BA 1ZZZA 2HALA 1XKBC 1EOJA 2BD2A 5FBEA 3E3TA 3VPKA 1GMHF 2AERH 1WOFA 4AOQA 3GICB 1NU7B 1AD8H 2QAAA 5DGJA 1A4WH 2Y6TA 1Z8RA 1O3GA 3QWCH 4MNVA 1VITG 2ZGHA 1DE7H 2DE8A 3DFJA 5DK1A 4X8SH 6CHAC 3RXTA 2HVXA 2C8ZB 1MTSA 4AYVB 3UUZA 4JYVH 1CBWC 2LELA 4B74A 1RD3B 1C2IA 2KCPA 2F9UA 1A2CH 1O2MA 1UTKA 2W7SA 3WW7A 2FTLE 1HAIH 1QGFA 2GMTC 4B1TA 1UTNA 1TALA 3L6PA 3VB7A 3RC6A 3BIUH 2TGPZ 3PV4A 3BN9A 3SGQE 2HPQH 1GI5A 1VCQA 1O2ZA 1QR3E 4GVUA 1FZZA 4BAHB 1EP6A 1O2TA 1OWJA 1DX5M 1XUHA 1F0SA 1NRSH 1UJ1A 2P8OB 5EXMA 2NU0E 2R3YA 4GHTA 2BY6X 2BD7A 4O3UA 3A81A 1BB0B 2QF4A 5K7RA 1OP2A 1S83A 3AAVA 1DFPA 3PB1E 4I86A 5E8EH 3SNBA 3RU4T 2VU8E 1UK2A 1SOZA 3UOPA 1C2JA 3T62A 1TPSA 1EP5A 1EKBB 1AU8A 2IOTA 3IG6B 3TGKE 1BTUA 3RXPA 1W7XH 1O3MA 2A4RA 4ABIA 3OTJE 3SHCH 3M36A 3FO8D 1C1UH 2ZPSA 1K22H 1IQMA 2BXUH 3HGPA 3RXUA 1O3NA 3EAJA 1O2PA 5DP6A 2K8IA 1AI8H 3LC5A 1ELVA 5IYTA 1NM6A 1J9CH 5FPYA 4KTUA 1DM4B 3RU4D 1S84A 3SV6A 3QN7A 3VB5A 1PYTC 4JZEH 1PQ8A 3KEEA 3FANA 2R9PA 3GDUA 3MOCA 1DOJA 3VXFH 3A84A 1PQAA 4CR9A 2BY9X 2D1JA 4JYUH 2R2MB 5CHAB 1IQGA 3HKIB 4Q4LA 1HAOH 1O2XA 2ZFSA 2Q6GA 3RXRA 2HVYB 3GDSA 3OFND 1P9UA 2AMDA 2JJ1D 3BG8A 1V2QT 1SLUB 4DT4A 4AG1A 2P3UB 1RFNA 1EZQA 1HAVA 4KGAA 1AVXA 3TVJB 1A61H 4OS7A 1PPFE 1CT0E 5FXLA 1DWEH 2YMSD 1NU9A 4OS4A 1DY9A 3SI4H 1AE8H 2DE9A 1PQ5A 4ISLA 4M7GA 1EAIA 1G37A 2V3MA 1QJ1B 2FLRH 2YNAA 1NPMA 2IPQX 2B0FA 1QIXB 1DT2A 1TOMH 1FI8A 3M7QA 1RS0A 1ZHPA 3OY6U 5EXLA 2ZGCA 1GL0E 1IQEA 2OK5A 2BDGA 3MH6A 1P11E 5EJZA 2ZTXA 1MUEB 1K21H 1GJBB 2WUBA 4I33A 4AFZA 3GCOA 1ZSJA 2ZTZA 3BTQE 3UAIC 1O3OA 1V2OT 4AFSA 2XCFA 3QTVH 2JH6D 3SUEA 2J92A 1W0YH 3GCHB 1AWHB 3PMJA 4NFFA 3U69H 2BLQA 1WAYB 1TGNA 3BEFB 2Z7FE 2VWNA 2FYRA 2GCTC 1ZOMA 3LKWA 1TBRH 1ELBA 1PPGE 1QCPA 3SORA 3F0OA 3PMHB 5GCHG 4JZ1A 1O3EA 3O8BA 1ID5H 2A31A 4THNH 3ZVEA 1XM1A 1S82A 1TOCB 1TQ0B 3PLKA 2RA0A 4HFPB 1OP0A 4CRFA 5DP8A 1QFKH 1UMAH 1CT2E 3T5FH 2PR3A 4D8NA 1UK4A 3U1IB 2ZDKA 5G4BA 2K1QA 1O2OA 1TMUH 5EPNA 4YOJA 4CHAB 1XKAC 2F3CE 2H5CA 5HKKD 1O2YA 5CE1A 1OXGA 1E0FD 3B8JA 1JRTA 1EOLA 4XE4A 1BRBE 4YLUA 1W0JD 3PWCA 2ZGXH 3ATLA 1KXDA 2VIPA 2ZDVH 1F0TA 3DSGA 2O8WA 1HJAB 1GJ8B 2ZIQH 1KLTA 3TH3H 1MBQA 1ZMJA 1SGFA 1AMHA 5ESTE 1B0EA 1CGJE 2OD3B 3UNSA 2G5VA 4UE7H 4IMZA 3MQKC 1HAGE 4AB8A 1GPZA 2A2QH 4Y71A 3PLBA 2F9OA 2PSYA 1L2EA 4OGYA 4ZHLU 1HAYB 4NA7A 4FUDA 2BDAA 3BG4B 4DJZB 2J94A 3S9AA 3PROA 3MO3A 4I8JA 2ZGJA 3P70B 2BDHA 1O3IA 2BMGB 4CH8B 2KR7A 1YP9A 4XOJA 2OUAA 3RXMA 1WCZA 1YLNA 4X6NA 2F4LA 3LJOA 1INCA 1GI9B 2HRVA 5PTPA 3U8OH 1OP8A 4BAMB 2OBOA 1KXFA 4TPYA 3CP7A 4X2YA 3SGBE 1O3HA 1P2JA 3UQOA 1MTWA 5C1XA 4F48B 4I8GA 1O0DH 1C1RA 4MG3A 1P05A 4YM9A 3VB3A 1YYY1 1W7GH 1WTGH 1BTZA 5EU8A 3LU9B 3BV9B 1V2PT 1BBRH 3ESTA 2DUCA 1O2HA 2UWPA 3ATIA 3I29A 1V2JT 2WPHS 2SGPE 3EA8A 2PUXB 4NIWA 5J4SA 1IQLA 2ZU2A 2W3KA 1YCPM 1CHOG 3DCLA 8GCHG 1AVGH 1QB1A 1GJ9B 5B6LA 3G01A 1T4VH 1C4Y2 1FAKH 5A0BA 2LP6A 2J98B 3P8GA 5JBCS 1BJVA 3D62A 1DANH 2ZEBA 2A5KA 2BDYA 2UUYA 4Y76A 2Y5GA 4BXSA 3U8RH 4XBBA 1TNJA 1EAUA 3FZDA 1EAXA 2P93A 5DP4A 3GCTF 1FLEE 3PO1C 1AZ8A 1EZUC 1OX1A 1C5VA 3GCNA 1BHXF 2Z3DA 4X2WA 5JPMH 5LPEA 1VCWA 2QXGA 4RKJB 1GI1A 3RXCA 1MU6B 2WHXA 3SU2A 3KN2A 1YKTA 5EJLA 4CRDA 2A7HA 1O31A 2EA3A 1T8MA 1TYNA 1F5RA 4OS6A 4CH2B 4AX9H 1V2MT 3V0XA 2PHBA 1OYTH 1W0ZU 3P8OA 3H7OA 1MBMA 2FOEA 2G8TA 2O9QA 2XWAA 1PPBH 2P59A 2ZFPH 1H8ED 2PLXA 1SPJA 1UVOA 4ZAEA 5J4QA 1MMJN 3EA7A 1AWFH 3VEQB 2RA3A 1CT4E 1HIAB 3UREA 1MKWH 1GMCG 1WQSA 4SGAE 1KSNA 1O2WA 1L0ZA 2KCOA 5DP5A 1V2NT 1MU8B 2ZPRA 3A7WA 2WPDD 2XWBI 4O9VA 3GOVB 3HKJB 1QURH 3GISB 1C5ZB 1C5QA 1JOUB 2ZHDA 4FUBA 1Z1IA 4B71A 1GBFA 1AE5A 1RXPA 2SGQE 1E38B 4WMDA 5HMAA 1MKWK 1W3CA 3RXGA 1O2NA 4A5TS 2Z9JA 1EQ9A 4FVDA 3ZVAA 3AAUA 1SVPA 3IWMA 3PO1B 3ZVFA 2Y7XA 3AK5A 6LPRA 3DA9B 4XDEA 3QLPH 2CMYA 3EE7A 2GT7A 4LK4A 4P00A 2QA9E 2G00A 2EI7A 1O3BA 2GT8A 4NIXA 2ZKSA 5HXFA 2FOMB 2VWMA 4IMQA 4K8BA 3SYJA 1PPHE 2OQ5A 1GBBA 1SC8U 1SR5C 1GCTC 4FU7A 5E2OA 2D8WA 1P2QA 1GVKB 3MFJA 3ZZCA 4YT6H 3E6PH 4MPXA 2J9NA 1C1PA 1TPAE 2VVUA 3M5LA 1HUTH 1SGNE 1O2GH 2XTTB 1RIWC 2ZFRH 3LGIA 4TY6A 1C1SA 4GHQA 5DP9A 1KDQB 1WSSH 1GJ7B 1UW7A 3RXDA 1GBDA 1VZQH 2PKAA 1C5RA 2JETB 1V3XA 5C0TA 2B7DH 1MCVA 2XBWA 1P01A 4WH6A 1H1BA 1QTFA 4IN2A 2A4QA 3HK6B 4XSKU 1NBMD 8LPRA 1EPTA 4ZH8A 2STBE 2R3UA 5SGAE 1X7AC 3A7YA 1E1RD 2ZF0H 2L6OA 4YESB 9LPRA 2CXVA 2A1DB 1GG6C 2OC8A 4DW2U 2KX4A 1EPTB 1NZQH 1XVMA 5TCAA 1J16A 2VGCC 1D3QB 2C8YB 3A7VA 1F0UA 3F9FA 3P8FA 3SNEA 2VIDA 1F0RA 4X6MA 1V2ST 2ZG0H 3ZVDA 5FCKA 1C1WH 1UHBB 4A6LA 4TT3D 2ZHQH 3SU5A 2V35A 1PPCE 5C5OA 4O97A 3FZZA 3BTME 4DT7B 4A7IB 1YLCA 2A4GA 1BA8B 4K2YA 1P2OA 2V0BA 3ENSB 1KLIH 1IHSH 1FAXA 2J4IA 4ZUHA 2RG3A 3SNCA 3M7UA 4INLA 1ZRBA 3HPTB 3F2GA 2ZDLA 1NC6A 1P8VC 1C9TA 3PTNA 1DWBH 2XNDD 1H8IH 1NS3A 4UFEH 1BTPA 2SNVA 5FAHA 1ZR0A 1FY4A 1P10A 1AVWA 2HPPH 3DFLA 3GYLB 1EASA 2WV9A 1H9IE 3N99A 3EQ0H 2GD4B 3OSYA 1O2IA 1XUIA 5C67A 4AN7A 2Y5FA 1GJCB 1GMDG 1QRXA 2G52A 2NWNA 3SGAE 4I7YH 4ABJA 1UTLM 1SLWB 5HM2A 3OTPA 1SKYE 3SV8A 1G30B 1PPEE 5GIBA 1ZGVA 5E0HA 2V7QD 2QY0B 3N7OA 4HI3A 3KHVA 2VBCA 1T32A 1TPPA 2BVXH 3MH5A 4RN6A 1N8OB 1IQNA 2R2WU 4NG9H 3BTFE 5H4IB 4DG4A 2BZAA 4X1PU 2QC2A 5DO4H 1UCYH 2AMPA 2B9LA 2P3TB 1VCPA 3UNRA 2NU2E 3PYHA 5EW1H 5BRRE 4MPVA 1XUFA 5C3NA 1UO6A 1C2FA 5T1VA 1ZSLA 1HIAA 4X2VA 3RXBA 3UTUH 3TLOA 2ULLA 1AGJA 1HJ9A 2TGDA 2AGGX 3ATMA 1ARBA 4WWYA 4ZXXH 3UFAA 1TE0A 4NSVA 1GJAB 4BAQB 1XMNB 2CJIA 3OY5U 1ZLRA 3LOXA 2THFB 2ZDMA 1ZTKA 1G32B 2SGFE 5AFYH 1H9HE 2RCEA 3RXIA 3RXQA 8GCHF 3M3TA 2B5TB 1H4WA 3GY3A 1TGTA 4DVAU 3F6UH 3SV7A 4XFQA 2W5EA 1FIZA 4H42U 1UCYE 5B6OA 5LPFA 4ACAA 3DT0H 1O2UA 3ODFA 4MNXA 4JMYA 2GCHG 1T8NA 1MZAA 2PKAB 2VWOA 1CA0B 3TH2H 1LPKB 5KECA 5JYIA 1EAWA 3A8AA 1ESTA 4B2AA 4GCHG 1CO7E 1DICA 4NZQA 3RXEA 3KNXA 4KTSA 2BDCA 2GZ7A 1DWDH 4E7RG 4MQAA 1GHVH 3LPRA 3UNQA 1QRZA 4NWKA 3TK6A 1O5AB 1WV7H 4IN1A 3RXSA 5A0CA 3SUFA 1ETRH 2UUJB 1K0HA 1QBNA 1WYKA 1BRCE 1LQDB 1K2I1 4NIVA 1S6LA 2KCYA 5AF9H 1C5PA 1D6WA 1GMDF 1T8OA 1H9LB 1W11U 1GVLA 3A7ZA 4FU8A 2G5NA 2J95A 1NRPH 1JRSA 1ZJDA 1KDQA 5ABWA 1P57B 1L4DA 3N7EA 3HK3B 1P09A 3ZVGA 1LVYA 1FUJA 1K1PA 5JB9S 2BD4A 1EUFA 5FBIA 2VINA 1TA2A 3RLYH 4AGJA 4ISNA 2SFAA 3GY5A 5DN6D 3QZRA 1GGDB 1GHBF 4Y7BA 3EA9A 1GBCA 5CMXH 5C17A 3SJ8A 2J34A 1AY6H 3GY7A 4B6EA 1SLVB 1RTFB 1GI0A 3SHAH 5FX5A 1RTLA 3VGCB 2PFEA 3MO9A 1E36B 3U98H 5L30H 1IQHA 3BSQA 2AH4X 4FOUC 1EFRD 4FUCA 2V3HH 2OTVA 1TGSZ 1C5MD 1E79D 2ZU3A 4XBCA 1QB6A 3MNCA 1O38A 5E2PA 4BTTB 1ZMNA 4ABBA 1ZHRA 2WPIS 1TONA 2Y82A 2PTCE 1PPZA 1GCDA 1Y3WA 3SU6A 1GI6A 2QV1A 1JXPA 4JZDH 4TSFD 5FPSA 1GVZA 3BTEE 4F4OC 1TX6A 4YZUA 4GLYA 5CDFE 4Q7ZA 2ZHFH 1BZXE 3GY6A 4XRNA 1NN6A 3BTTE 3TH4H 2BQ7B 1QA7A 1GDNA 1JMOH 2GX4A 1KXBA 3GY8A 3MTYA 2D26C 4I8LA 4A1XA 5DP7A 3ZV8A 4K5ZA 4RI0A 4DGJA 4GUXA 4MPWA 2GKVE 5A2MH 2WPLS 1C5OH 1HDTH 3N7DA 3MU8A 1LPZB 4SGBE 4Y6DA 4GAWA 3ZVCA 5A8ZA 1RRKA 2GDEH 3SQHE 2SGEE 1K1NA 1HAPH 1THRH 3BTGE 3VB4A 2H5DA 2BD5A 3H09A 2D2DA 2PKSB 2Z3CA 4UFGH 5BPEA 4X6OA 3ZZ8A 2FS8A 1OWDA 3RM0H 2BDBA 5GPIB 3TNSA 1A5HA 1SGYE 3RXOA 1XXDA 1AKSA 2GZ9A 1A0JA 4BTUB 4D9RA 4ABGA 3K6ZA 1PJPA 2UWOA 1NO9H 1MKXK 7LPRA 1RGQA 5IDKA 1XXFA 2HLCA 1MQ5A 3OEED 3PV2A 1LHFH 5IK2D 2FP7B 5FX6A 3ZVBA 5ESBA 1SL3A 3A89A 4AFUA 2EC9H 5JDUB 1IQJA 1NRRH 1JBUH 1P2KA 2JJ2D 1QL9A 2A7CA 2Z9GA 2AIQA 3FP8E 1VITH 2C93B 1S6FA 1ELFA 1SHHB 2HWLB 2NU3E 3PMAB 5HYOA 2SNWA 1BBRE 1C2DA 3O8DA 3R0FA 1GBJA 1CQQA 1AFEH 1C5WB 1F5LA 4RKOB 2ZWLH 1YF4A 2XYAA 3MU5A 2ASUB 3U1JB 2PSXA 1O35A 2EI8A 2VJ1A 1D3TB 1TBQH 4K3JA 3RC4A 4B73A 2OINA 1GJDB 1F7ZA 2F43B 1DDJA 1YGCH 2H9TH 4YOGA 3EGKH 1NRQH 1QB9A 4F49A 3L3TA 1GBKA 4JK6A 1QJ6B 3SU0A 2F9BH 2QF3A 1NFXA 3MH7A 4MPUA 4AB9A 2WYGA 4FUIA 2XNIA 1Z8GA 3LGYA 4FU9A 5FCRA 1G36A 1BMLA 1OWKA 3TPIZ 1JIMA 1FONA 1FY8E 7KMEH 3Q77A 3P95A 1W12U 2BD9A 3P17H 2ZTYA 1V2TT 1CGIE 1EATA 3D49H 5C20A 2ODYB 2JKHA 5EG4A 1O2KA 2BY5X 2W26A 2ZQ1A 1DSTA 4P02A 4CRAA 2NU4E 4BANB 3GYMA 1A0HB 3S9CA 2AGEX 1CA8B 1AFQB 1KLJH 1G3CA 2BY7X 2GCHF 2O8LA 2R0KA 2ZDAH 3SJOA 1MZDA 4AZ2B 2WUCA 1DPOA 2R0LA 5A8YA 1P2MA 3CNRA 1SGPE 1G3BA 2XXLA 1TGBA 3QDZB 1FPCH 2FOBA 1OYQA 4CBOA 3MU0A 3VFEA 3LGTA 3BTHE 4ZXYH 5HIYA 4B76A 1CBWB 5CHAC 1HAHH 3R3GB 1YPMH 4MTBA 2VB0A 2H9EH 2YMSB 3TIUA 1SGRE 1DLEA 4GPGA 1DY8A 2Q1JA 1LMWB 2VIVA 3SZNA 3H5CB 2BD8A 2PGQB 4ZHAA 1WQVH 3IITA 3P6ZB 4XD7D 2XC5A 3ZZBA 1E35B 3LT3A 1A5GH 1ORFA 1AB9C 1G3DA 2RDLA 1V2UT 2FPZA 3ZYEA 2ZFTA 4M9FA 2G55A 3RC5A 1A3BH 2BXTH 1O3JA 1HBTH 3QZQA 3RMNH 1EJAA 2ZQ2A 4Q7YA 3F9EA 4BAKB 1Z1JA 1TFXA 3MWIU 1E37B 2YMSC 1SGIB 1EB1H 3C27B 3M3SA 1SQAA 3FN8A 1QNJA 4O03A 1K1OA 1S0QA 3ZZ9A 3WY8A 4TPIZ 2JH0D 3ZZ4A 1QL7A 3V3MA 1KXCA 1NFUA 5C2ZA 4TWYA 2NU1E 1ELTA 2Y81A 2KZ4A 1MTVA 5LGOA 1DXPA 1K1LA 3KCGH 1LVOA 3TK5A 3FOAA 4AFQA 4Q80A 2H6MA 1OWEA 1P03A 1TAWA 2P94A 1Y3VA 1THPB 3NK8A 1A3EH 2Z9IA 1GBEA 2OCVB 1AUTC 2OLGA 1D3DB 1VITF 2PW8H 3RMOH 3NWUA 2B8OH 2FWWA 1NBME 2P3FH 1GWAA 3SNDA 5JBAS 2GCTB 2UUFB 3RXLA 2SGDE 3RXVA 1SQRA 1TNIA 3M61U 1K28D 2RFKC 4U2WA 4NFEA 1CVWH 1O5EH 2ZI2H 1AKSB 2JETC 1WDIA 1OWIA 1SGTA 1TRMA 4NIYA 2ZECA 1ZGIA 4X8TH 2FI5E 1WUNH 1BCUH 1O3FA 1EJMA 1GHWH 1RIWB 1ETTH 3PRDA 3UB0A 4UDWH 3F1SB 1ZRKA 1CHGA 1HLTH 1HXEH 4X1RU 1YPHE 1BOQA 3RXKA 3SN8A 3A80A 1GBLA 2WZQA 4K1EA 1C2HA 1TX7A 2L74A 4YTAA 2CGAA 3STJA 1C2GA 1FPHH 2UWLA 1O3LA 3ZZDA 3EE0B 4HGCA 2BHGA 3SU4A 2PWXA 1O2VA 4CRGA 4WXIA 4UONA 2J98A 3ZIAD 1O2LA 3MNXA 4YT7H 1MQ6A 2EI6A 6CHAB 1QBOA 1ZPZA 4LXBH 1MABB 4LZ1H 2ZNKH 2GV7A 4NSYA 4HTCH 1WXRA 2VIQA 3M5MA 4LOYH 2FI3E 1O37A 1E1QD 5F8TA 1SSXA 3W94A 4BOHA 3BTKE 3NUMA 4KKDA 1BRUP 2BOHB 3ZV9A 1FY5A 1QA0A 1N6XA 3DSPA 2QXJA 1YLDA 2WINI 5TJXA 5GWZA 5C94A 5L2ZH 4ASHA 1MD7A 1BTHH 1NROH 1SMFE 1BUIA 1DS2E 1P2NA 1V2RT 2WSSD 1EB2A 2FESH 3SNAA 1SBWA 4Y8ZA 4IC5A 1GHYH 3KQCA 4Z6AH 4H4FA 3UIRA 3TJOA 2O8MA 1YM0A 1SGQE 1BMFD 7GCHG 1C1NA 4K1TA 5JB8S 2PTNA 2BY8X 2STAE 5GCHF 5DKMA 1MH0A 2AHME 2FYQA 4WMEA 1MCTA 5E0JA 3GCTG 2SGAA 4INHA 1EJNA 2GP9B 4FVBA 4YO9A 3SJ9A 1M9UA 3RP2A 2XBXA 2WPJS 4AG2A 2CF9H 3M3VA 3F3BA 2AIPA 4OM9A 1HGTH 1OKXA 2VVCA 1ANBA 2M2AA 1IAUA 2A4OA 1FN6A 1HV7A 4IW4E 3SUDA 2FIRH 4ASUD 1GHXH 3E8LA 3QK1A 2ALPA 2J97A 1BMNH 1QJ7B 1W13U 1GBMA 3A7TA 3OYPA 1GI7B 2Q6DA 2PKSC 1UVUH 2FEQH 1AN1E 1GJ6A 4HG6A 4YLQH 1BMMH 3E0NB 1C4U2 2GGVB 1QBVH 1MKXH 4A1TA 1Z71A 3ZYDA 1HAZB 1LHGH 5EIYA 4ZHMU 3CENA 2LNCA 3FAOA 4D9QA 3Q3YA 1L1NA 1U6QA 1L1GA 1YPGH 1TGCA 4Z0KA 1Y59T 3QUMP 4NA9H 2KCAA 2FXRA 2ZCLP 2OQUA 2K0QA 3KGPA 2HOBA 4DIHH 2KM0A 2BDIA 3NXPA 1Y3UA 2OC7A 3SU3A 3MMGA 3RXHA 1HXFH 2WV4A 1BTWA 1FXYA 3D23A 1Z8IB 4F55A 1QRWA 2CF8H 1G3EA 1HAVB 1KXEA 3SBKA 4BNRA 2G51A 1O39A 3LGVA 4Q63A 1HPGA 1QZ8A 5EPYA 1AUJA 1SGCA 1W2KH 3B23B 3CS0A 1LKAA 1GBTA 3UWJH 4CHAC 3FVFB 3O8CA 1W0KD 1YPKH 1B0FA 4I8HA 4TY7A 5F8XA 2XW9A 2Y5HA 4LZ4B 1AO5A 7ESTE 4OS2A 3TK9A 1VJAU 3QGNB 1P04A 5C1YA 4KELA 4WF8A 2Y80A 3U8TH 2QYIA 2TPIZ 4Z1MD 3E90B 1V2LT 1VJ9U 2FX4A 3OAAD 3VB6A 3Q00A 3KQDA 3MNBA 1S5SA 2KAIB 1Y5BT 2XC0A 4Y79A 1ZHMA 1YCPH 4X1QU 4J1YA 3K9XB 3PMBB 3SO3A 1W10U 1GMHG 3JZ2B 3RU4E 1O5DH 1EZSC 5F6MA 1COWD 2H2ZA 1ESBA 3RLWH 1RJXB 2FOCA 3SI3H 1CSOE 1SI5H 2GVFA 2VIOA 3BEIB 4VGCC 1D6RA 1BBRK 2ESTE 3UR9A 3LH1A 4OS1A 4CR5A 2YNBA 2BTCE 3URDA 1TWXB 3BEUA 2WPMS 5GNDA 2QIQA 1C2LA 1UTQA 1O33A 3TGJE 1GI8B 5JBBS 3GDVA 5DSFA 2VH0A 1ELCA 2P16A
chains in the Genus database with same CATH topology
1MAXA 1TMTH 1C5XB 2TGAA 2AYWA 5DP3A 4Y11E 5EW2H 3OX7U 4A1VA 1W8BH 2VVVA 1YPJH 2CN0H 2TBSA 5LH8A 2OXSA 2GMTB 2VIWA 2A7JA 1O5FH 1Z7KA 2BQ6B 1ZYOA 2FX6A 5A8XA 1P3EA 4X1SU 1AZZA 1O2JA 1Q3XA 1Z6JH 4IS5A 4MNWA 4WVPE 2C3SA 5DJ7A 1O3DA 3V7TA 1L4ZA 2BX4A 3PTBA 5HGGA 1Q2WA 1S0RA 3DHKH 1C5LH 1IQIA 2OBQA 3V12A 3NPSA 3LDXH 2HNTC 1FNIA 1MTUA 2AGIX 2FLBH 8KME2 3RXAA 2BZ6H 1FN8A 1TABE 2ZU1A 4UEHH 4ISOA 5I46H 2Z9LA 3MH4A 1TNKA 1C5NH 1O5BB 2AFQB 5T3HA 1LHEH 1EPTC 4DCDA 1PQ7A 4I32A 5EQRA 3MU4A 4DURA 2ZZUH 1UCYK 4R0IA 3M7TA 1C1VH 3SUGA 1PFXC 2UUKB 1K1JA 1QQUA 3QTOH 4A92A 2VNTA 2PV9B 2FM2A 4U30A 3A7XA 1TLDA 1IHTH 2PUQH 1P12E 2I6QA 2Y7ZA 3FP6E 1QY6A 4X8VH 1MTNB 1UTJA 1TX8A 3S69A 3TJVA 4B2CA 3U9AH 3A86A 2C90B 1ETSH 5HM9A 5AHGH 1SFQB 2ALVA 4ESTE 3V13A 2W7UA 3W95A 1GI2A 2AMQA 4ZKRU 2BOKA 3S7KB 3A83A 1DUEA 2C8WB 1Y8TA 4WJG2 2CHAB 3K2UA 4E06H 3RXJA 3STIA 1O3AA 1B5GH 3KQBA 1IQKA 4CRBA 4XBDA 2FO9A 4H6SB 1O2QA 4DIIH 3SQEE 5EOKA 5F8ZA 1S81A 1C5YB 4D7FA 2ANMH 2O8TA 2LPRA 1Y5AT 3EYDA 1GJ4H 3TGIE 6GCHG 2F9VA 2O8UA 4ZKOU 2ZP0H 5K0HA 3QO6A 2GDDA 3L33A 2FI4E 3LJJA 3RM2H 1YPHC 1GI3A 3E1XB 4Y0ZE 1BITA 1VGCB 1NESE 1TIOA 2FTMA 1NT1A 1ZTLA 8ESTE 3ATKA 1V6DA 4NGAH 3S9BA 3UOUA 1FY1A 2BB4A 2TGTA 1C5UA 4X0WU 3T25A 1F92A 1KXAA 6GCHF 3LGUA 3NCLA 4INKA 1AQ7A 3K65B 1ELAA 1XVOA 1DLKB 4AGKA 3RUOA 2YOLA 1YPLH 1DSUA 1J14A 1TPOA 3A8BA 1DUAA 2BVSH 1HJ8A 1QQ4A 2J2UA 1S85A 1C1OA 1FY3A 2A5AA 2GTBA 1GG6B 3H7TA 1TBZH 1KTSB 2QF0A 1O34A 1EZXC 1DXWA 4K69A 4Y7AA 2PGBB 2BYAX 3Q3KA 5L2YH 1HNEE 1A0LA 3S0NA 5LPRA 1P06A 1ZSKA 3UY9A 4FUGA 1BHXB 1YC0A 2F9PA 3LGWA 1AHTH 1LQEA 2P95A 1G2MA 5TCCA 1AB9B 1GDQA 4FUJA 1GI4A 3T29A 3RMMH 4FXGH 1J15A 1T8LA 3AVZA 4JCNA 1OPHB 1YPEH 4Y8XA 2ILNA 1KTTB 4DY7B 1MD8A 3SJIA 4Y0YE 1FQ3A 1HFDA 1TMBH 9ESTA 2P8OC 4NZLA 3A8DA 1O32A 5C1UA 3UWIA 1UTMA 2ODQA 1KIGH 2J38A 4I31A 2ODPA 3MO6A 1HAXB 2Z6BD 1GJ5H 1G2LA 1LPGB 3RXFA 4UD9H 2WPKS 1O2RA 2ZCHP 2G4TA 3I78A 2Z9KA 5EGMA 3O8RA 1UHBA 3MHWU 2BM2A 4FUFA 3P92A 2F9NA 2BQWB 3TJUA 1ANEA 3TITA 1GCTB 1AFQC 2V6NA 4JK5A 1SG8B 1O3KA 3Q3XA 1TNGA 4NCYA 1LDTT 1OSSA 4MNYA 2IN2A 2ANYA 2XBVA 4D76A 1C5TA 1GHAF 1BDAA 1ZJKA 2ZPQA 3S7HB 1UVTH 3RDZA 3NKKA 3I77A 1RTKA 4Q2KA 1ESAA 1NTPA 1JWTA 3FP7E 1LHDH 2BD3A 1ELGA 3P8NA 2ANKH 2H1UA 1SFIA 4IBLH 1P0SH 2XCNA 4I8KA 4DOQA 4WY3A 1P9SA 4TYDA 1TA6A 1C4V2 4OS5A 4K8YA 5AFZH 2CHAC 1O3CA 4X2XA 4E05H 2FZZA 4UFDH 1KYNA 1C2MA 1GBAA 1SLXB 1TRNA 6ESTA 3E0PB 1D3PB 3ZZ6A 4ZMAH 2W3IA 5EXNA 4JYTA 3VGCC 2Q6FA 3AW0A 2HGTH 1C5SA 1CA0C 1LO6A 3ATWA 3LH3A 1LTOA 1NRNH 2BLOA 1K1IA 1LCYA 4VGCB 5JBTA 3LC3A 2BLWA 1WBGB 3A87A 1J8AA 1BMAA 1OOKB 2A45B 2ZC9H 4CREA 1SQTA 1T7CA 4GSOA 4ABEA 4AYYB 2Z3EA 3T26A 2FOAA 3CS7A 1GHBG 1TNLA 1BQYA 2BVRH 4ZROA 1W14U 5FPTA 1Y3XA 1GBHA 1KY9A 1D9IA 3NZIA 2ANWA 1FJSA 1GBIA 4D7GA 4CBNA 4ISHH 2TRMA 1P2IA 3URCA 5EQSA 1V2VT 4H6TA 5DPAA 1G9IE 1LKBA 2XRCA 3SU1A 5A0AE 2GZ8A 1V2WT 1O5CB 1ARCA 2VGCB 1HJAC 1BTYA 1V2KT 4BXWA 1GHAG 1MAYA 1TRYA 3ZZ5A 1SQOA 3ZZAA 1WU1A 1Y5UT 4BTIB 1UTOA 1J17T 4X8UH 1Z8JB 1T31A 3BF6H 5AVDA 2VWLA 2I6SA 3SJKA 1ZMLA 3HGNA 1HYLA 3SOSA 2ZHWH 4RSPA 3PM3A 2A2XH 3GY4A 2AS9A 1LHCH 4JZFH 1NFYA 2C4FH 1GGDC 1H8DH 2QCYA 2A0QB 4GCHF 3DD2H 2BLVA 1O2SA 2OC1A 3UR6A 4WXVA 1SGEE 1K1MA 3ODDA 2QXHA 1N8OC 3ITIA 1BT7A 3MU1A 4ZKNU 3PWBA 3KQEA 1FV9A 2VH6A 3ELAH 4ZKSU 3HATH 1AIXH 5ETXA 2FOGA 3E91A 1QHRB 2F91A 3VXEH 1Y3YA 1GHZA 2A5IA 1ANCA 4Y10E 3FFGA 1THSH 3UPEA 1BTXA 3A82A 1ZPCA 3GCHC 4QT8C 1SGDE 2HNTE 5DG6A 1GMCF 3A88A 1XX9A 4R8TB 4U32A 3BG4C 4WH8A 1E34B 1OWHA 4MVNA 1NY22 2Z94A 1GDUA 1HRTH 1B7XB 5I25A 1QL8A 4WMFA 1P3CA 3F9GA 2C8XB 1O3PB 1UVSH 3LONA 1SGFG 3ZZ7A 3M37A 2QXIA 2HNTF 1LVBA 1L1JA 5E0GA 1D4PB 1FMGA 1BIOA 4U01A 5GXPA 2G81E 1ELDE 3UQVA 4O3TA 3PLPA 5EODA 5L6NH 1OS8A 2XC4A 3T2NA 1LVMA 3LIWA 4HZHA 1Z6EA 3C1KA 3D65E 3TNTA 2OC0A 2ZHEH 4IC6A 5A09A 5FHTA 2F83A 4MLFB 1VGCC 1C9PA 4PROA 3BIVH 4ISIH 1CU1A 1UK3A 5EQQA 1A5IA 3KL6A 2FODA 3TJNA 2ZU4A 2V3OH 1O36A 2H9HA 3RMLH 1ABIH 1CHOF 2AEIH 3F9HA 2ZFQH 3TU7H 3T28A 3QGJA 3M35A 4AORA 3AW1A 2FDAA 5GDSH 1DVAH 2ZDNA 1C1MA 3BTDE 4NWLA 3BTWE 5T6DA 1N1LA 1ACBE 5C5NA 2CV3A 1ELEE 3SV2H 4KTCA 7GCHF 1UVPA 1BJUA 4OGXA 1IQFA 1XUGA 4X1NU 1HCGA 3E16B 1WTHD 5T6GA 3B9FH 1ZPBA 4MDSA 1FIWA 4X6PA 3T27A 3Q76A 2IJOB 2M5TA 1K9OE 1A7SA 4Q7XA 1TB6H 4E7NA 1ZTJA 1MTNC 2XBYA 3SV9A 2TIOA 1UTPA 3EDXB 3MI4A 3KF2A 4TWWA 1C1TA 1FDPA 1VR1H 4BAOB 1IOEA 3SW2B 2IPHA 1HB0B 1S6HA 2ZCKP 1T4UH 3KIDU 4KP0A 2FMJA 2KAIA 2QGRA 1SHYA 1YCPK 1DWCH 3K6YA 1N6YA 2EEKA 1YBWA 2ZA5A 4JZIA 4J2YB 1C1QA 1O5GH 1O30A 1TNHA 3A85A 1C2EA 3A8CA 2BX3A 3OU0A 1DITH 2FOFA 4K1SA 3F68H 1A46H 4ABAA 3M5OA 2QN5T 3M5NA 2ZO3H 1ABJH 1P02A 1F2SE 1SOTA 1F5KU 1C2KA 1JIRA 2WV5A 2GV6A 3ZZ3A 1PYTD 1EXFA 1A1RA 4FUHA 4ABHA 4Y8YA 1GL1A 2FS9A 1SB1H 3QX5H 2WYJA 2FOHA 1EX3A 4ABFA 5F03A 2JH5D 4B75A 1XUJA 1CGHA 5GJ4B 3GY2A 4ABDA 1NFWA 1BRAA 3AASA 5T6FA 1XUKA 4CRCA 2OP9A 3DUXH 4FUEA 4NA8A 1ANDA 1CE5A 3MNSA 4K60A 2A32A 4IGDA 1TQ7B 2G4UA 4UFFH 3JZ1B 3MYWA 1Q31A 2ZU5A 2ZGBH 4YOIA 2ZFFH 4B2BA 1ZZZA 2HALA 1XKBC 1EOJA 2BD2A 5FBEA 3E3TA 3VPKA 1GMHF 2AERH 1WOFA 4AOQA 3GICB 1NU7B 1AD8H 2QAAA 5DGJA 1A4WH 2Y6TA 1Z8RA 1O3GA 3QWCH 4MNVA 1VITG 2ZGHA 1DE7H 2DE8A 3DFJA 5DK1A 4X8SH 6CHAC 3RXTA 2HVXA 2C8ZB 1MTSA 4AYVB 3UUZA 4JYVH 1CBWC 4B74A 1RD3B 1C2IA 2F9UA 1A2CH 1O2MA 1UTKA 2W7SA 2FTLE 1HAIH 1QGFA 2GMTC 4B1TA 1UTNA 1TALA 3L6PA 3VB7A 3RC6A 3BIUH 2TGPZ 3PV4A 3BN9A 3SGQE 2HPQH 1GI5A 1VCQA 1O2ZA 1QR3E 4GVUA 1FZZA 4BAHB 1EP6A 1O2TA 1OWJA 1DX5M 1XUHA 1F0SA 1NRSH 1UJ1A 2P8OB 5EXMA 2NU0E 2R3YA 4GHTA 2BY6X 2BD7A 4O3UA 3A81A 1BB0B 5K7RA 1OP2A 1S83A 3AAVA 1DFPA 3PB1E 3SNBA 5E8EH 3RU4T 2VU8E 1UK2A 1SOZA 3UOPA 1C2JA 3T62A 1TPSA 1EP5A 1EKBB 1AU8A 2IOTA 3IG6B 3TGKE 1BTUA 3RXPA 1W7XH 1O3MA 2A4RA 4ABIA 3OTJE 3SHCH 3M36A 1C1UH 2ZPSA 1K22H 1IQMA 2BXUH 3HGPA 3RXUA 1O3NA 3EAJA 1O2PA 5DP6A 1AI8H 3LC5A 1ELVA 5IYTA 1NM6A 1J9CH 5FPYA 4KTUA 1DM4B 3RU4D 1S84A 3SV6A 3QN7A 3VB5A 1PYTC 4JZEH 1PQ8A 3KEEA 3FANA 2R9PA 3GDUA 3MOCA 1DOJA 3VXFH 3A84A 1PQAA 4CR9A 2BY9X 2D1JA 4JYUH 2R2MB 5CHAB 1IQGA 3HKIB 1HAOH 1O2XA 2ZFSA 2Q6GA 3RXRA 3GDSA 1P9UA 2AMDA 3BG8A 1V2QT 1SLUB 4AG1A 2P3UB 1RFNA 1EZQA 1HAVA 4KGAA 1AVXA 3TVJB 1A61H 4OS7A 1PPFE 1CT0E 5FXLA 1DWEH 1NU9A 4OS4A 1DY9A 3SI4H 1AE8H 2DE9A 1PQ5A 4ISLA 4M7GA 1EAIA 1G37A 1QJ1B 2FLRH 2YNAA 1NPMA 2B0FA 1QIXB 1DT2A 1TOMH 1FI8A 3M7QA 1RS0A 1ZHPA 3OY6U 5EXLA 2ZGCA 1GL0E 1IQEA 2BDGA 3MH6A 1P11E 2ZTXA 1MUEB 1K21H 1GJBB 2WUBA 4I33A 4AFZA 3GCOA 1ZSJA 2ZTZA 3BTQE 4AFSA 1O3OA 1V2OT 2XCFA 3QTVH 2JH6D 3SUEA 2J92A 1W0YH 3GCHB 1AWHB 3PMJA 4NFFA 3U69H 2BLQA 1WAYB 1TGNA 3BEFB 2Z7FE 2VWNA 2FYRA 2GCTC 1ZOMA 3LKWA 1TBRH 1ELBA 1PPGE 1QCPA 3SORA 3PMHB 5GCHG 4JZ1A 1O3EA 3O8BA 1ID5H 2A31A 4THNH 3ZVEA 1XM1A 1S82A 1TOCB 1TQ0B 3PLKA 2RA0A 4HFPB 1OP0A 4CRFA 5DP8A 1QFKH 1UMAH 1CT2E 3T5FH 2PR3A 4D8NA 1UK4A 3U1IB 2ZDKA 5G4BA 2K1QA 1O2OA 1TMUH 5EPNA 4YOJA 4CHAB 1XKAC 2F3CE 2H5CA 1O2YA 5CE1A 1OXGA 1E0FD 3B8JA 1JRTA 1EOLA 4XE4A 1BRBE 4YLUA 3PWCA 2ZGXH 3ATLA 1KXDA 2VIPA 2ZDVH 1F0TA 2O8WA 1HJAB 1GJ8B 2ZIQH 1KLTA 3TH3H 1MBQA 1ZMJA 1SGFA 1AMHA 5ESTE 1B0EA 1CGJE 2OD3B 3UNSA 2G5VA 4UE7H 4IMZA 1HAGE 4AB8A 1GPZA 2A2QH 4Y71A 3PLBA 2F9OA 2PSYA 1L2EA 4OGYA 4ZHLU 1HAYB 4NA7A 4FUDA 2BDAA 3BG4B 4DJZB 2J94A 3S9AA 3PROA 3MO3A 4I8JA 2ZGJA 3P70B 2BDHA 1O3IA 2BMGB 4CH8B 1YP9A 4XOJA 2OUAA 3RXMA 1WCZA 4X6NA 3LJOA 1INCA 1GI9B 2HRVA 5PTPA 3U8OH 1OP8A 4BAMB 2OBOA 1KXFA 4TPYA 3CP7A 4X2YA 3SGBE 1O3HA 1P2JA 3UQOA 1MTWA 5C1XA 4I8GA 1O0DH 1C1RA 4MG3A 1P05A 4YM9A 3VB3A 1YYY1 1W7GH 1WTGH 1BTZA 5EU8A 3LU9B 3BV9B 1V2PT 1BBRH 3ESTA 2DUCA 1O2HA 2UWPA 3ATIA 3I29A 1V2JT 2WPHS 2SGPE 3EA8A 2PUXB 4NIWA 5J4SA 1IQLA 2ZU2A 2W3KA 1YCPM 1CHOG 8GCHG 1AVGH 1QB1A 1GJ9B 3G01A 1T4VH 1C4Y2 1FAKH 5A0BA 5JBCS 3P8GA 1BJVA 3D62A 1DANH 2ZEBA 2A5KA 2BDYA 2UUYA 4Y76A 2Y5GA 4BXSA 3U8RH 4XBBA 1TNJA 1EAUA 3FZDA 1EAXA 2P93A 5DP4A 3GCTF 1FLEE 3PO1C 1AZ8A 1EZUC 1OX1A 1C5VA 3GCNA