1TNLA

Prediction of novel serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA02
3RXGA 1MQ5A 2VWLA 1RTLA 4Y11E 4X0WU 5GCHF 2PR3A 1V2NT 4J2YB 3SV9A 2Y7XA 4MNXA 1DSUA 2GCHG 5E2PA 3PTNA 4A92A 1GJDB 4JMYA 3A7XA 4UFDH 1E38B 1O2TA 1D3PB 1T7CA 1GMCF 3ENSB 3BTTE 1UVPA 2A4RA 4OS7A 4CRBA 1PPCE 3PO1C 3PM3A 1C5QA 2Z9IA 1GI8B 5AF9H 1DY9A 1LCYA 1C5MD 2A2XH 1C1NA 1S84A 3RXBA 1ELEE 1SI5H 4H6SB 3QGJA 1JBUH 1GMHF 1BZXE 1H9IE 2RCEA 2XW9A 1P09A 3Q76A 1T8NA 1YPEH 1HBTH 1C5WB 1FPHH 3STIA 1Z6JH 1MTSA 1BTPA 1EOLA 3A83A 3QTVH 2W3KA 1MU8B 1Z6EA 4CR9A 5EXNA 1G9IE 2F9UA 2H6MA 2VIOA 1J8AA 2G81E 3ZZBA 1WTHD 1XUHA 2AMPA 1O5AB 1EXFA 2BD2A 2ZHFH 1YKTA 2ZDAH 3HKJB 2G4UA 1Z8IB 2VIPA 1IQIA 3O8BA 1TYNA 2VJ1A 2FOEA 2SNVA 1Y3XA 2A31A 2DE8A 3D62A 4XFQA 2ZQ2A 1NZQH 1T32A 2ZCLP 3MNXA 3GY5A 1FXYA 1C2GA 5FX5A 1QQUA 1GVZA 1L4DA 1OOKB 4CH2B 2JKHA 2ZHQH 2I6SA 4Y10E 5B6OA 3UWIA 2O9QA 2ZEBA 1CSOE 2NU4E 4LK4A 2D26C 1TNHA 2HVXA 4K1TA 1G37A 3U9AH 1N8OB 1ZGIA 2PLXA 2FS8A 1C2HA 1FLEE 2VINA 1FIZA 1P2IA 2SFAA 1BMNH 1J16A 3GCNA 3RDZA 3SNBA 1C5TA 5DPAA 5ESTE 5T6DA 1QL7A 1QRXA 3MNBA 4MTBA 3H7TA 3A89A 1BJVA 1GBEA 1FY4A 1GBDA 1YPJH 5DP6A 5L6NH 3FAOA 3STJA 5LPRA 1C4U2 1O2IA 1GCTC 2GV7A 4TWYA 1FAKH 1O2XA 4IN1A 4FU7A 1SBWA 1K1LA 1GGDB 3O8DA 4ZHLU 2QXIA 3RXMA 4GLYA 4Y8XA 1SOZA 5AFYH 4E06H 1FY1A 1PFXC 3GISB 2P3TB 3M61U 1NPMA 2FMJA 2ODQA 1RD3B 3RXUA 2EI6A 3P8GA 3QN7A 1XXDA 1ZTKA 4YT7H 1TOCB 1DXPA 3FZDA 1O3OA 1AKSB 4TY6A 3PV4A 5HM9A 1IAUA 2W7UA 1PQ7A 4NSYA 1CA0B 2FO9A 4ABDA 1BTXA 3E3TA 2EI8A 2M5TA 1BRCE 1SB1H 1HRTH 1Y3YA 2PKAB 5IDKA 1NFUA 3LOXA 1LVYA 2P3UB 1KXEA 1A46H 1DXWA 3SU1A 3QO6A 1MKWH 1UVUH 1FZZA 2A7CA 2RA3A 2VGCC 1A0JA 3S9CA 1CBWB 3A8DA 3SJIA 2WPIS 1ANBA 1DM4B 1O2WA 1ELAA 2BM2A 2OUAA 2G5VA 4U32A 1DVAH 2QXHA 3LU9B 2FI5E 5GXPA 1IQLA 1N6XA 5FBIA 1JXPA 3RXDA 1N6YA 4XBDA 1KDQB 1Z8JB 3M5MA 2FTMA 1ZZZA 3RLWH 4LZ4B 5GDSH 1TLDA 2C93B 4I8HA 2BD9A 4K8YA 4AFSA 3NK8A 5J4SA 5TCCA 1VJAU 4B1TA 1ZTJA 1H4WA 3B23B 3PMHB 1KY9A 5C5NA 2GDEH 2C4FH 4IC5A 3E6PH 2FODA 1VGCC 4ABGA 2CV3A 1IQNA 1ZMLA 3BTFE 2FP7B 2XCFA 3IITA 4GCHG 2FX4A 4DOQA 1O2RA 4MPXA 3SV8A 5EW2H 2ZECA 3RXCA 4Q7ZA 4KTUA 1CU1A 4XBBA 1TX6A 1TGTA 1M9UA 2TIOA 3S7KB 3Q00A 4A1VA 4YT6H 5DP4A 1LKAA 1BTHH 1W10U 2ZU1A 1F0RA 1ZRKA 4GHQA 3LIWA 2WV4A 4DCDA 2ZPSA 4ISOA 1WCZA 5F8ZA 5H4IB 4AORA 2P16A 3D65E 3TK6A 3GY4A 1O37A 1ESBA 4I8JA 3OYPA 2W26A 1DLEA 1QA7A 1S6FA 4I32A 1WAYB 5DK1A 1F2SE 1GBJA 4K1EA 3CENA 1KXDA 5CE1A 2BOKA 3LJOA 3UY9A 3VGCC 3VB6A 1AUJA 3P8OA 5FHTA 1O3HA 5DO4H 1HAIH 1O5CB 3SNDA 3BF6H 5JDUB 2SGFE 4D9RA 1YPHC 3AVZA 1O3GA 1AFEH 4WVPE 4DURA 3FANA 4X1NU 1GVKB 3S0NA 1G3CA 3UOUA 1BTZA 3DUXH 5C1YA 5F6MA 4D9QA 1ZPZA 1UCYK 1C5OH 1KTSB 3GICB 1O0DH 4U01A 1O2UA 2NU2E 3ATLA 1LPKB 1UTPA 3A8BA 1RIWB 2AFQB 2H1UA 4DT7B 3MH5A 3GOVB 3VXFH 5C1XA 3QUMP 2PSXA 3CS7A 2Z3EA 2Y80A 2GD4B 2Y5GA 1FDPA 2CHAB 2TGAA 2A2QH 3SOSA 2HRVA 1SGIB 1O5FH 2FX6A 4IMQA 4JYUH 3TVJB 3MO6A 1EJAA 1D3DB 4GVUA 1UK2A 3MU5A 1BJUA 5HYOA 1C1RA 1TMBH 1UCYH 2F9OA 2IN2A 4NIVA 1ZHRA 4JZIA 2H5DA 3A82A 1D3TB 1SLVB 1P2KA 2Y81A 1EOJA 3RUOA 3VGCB 4ZMAH 1DANH 2EC9H 1FUJA 3GY8A 2UWLA 1MH0A 2ANYA 4DW2U 3MTYA 1IOEA 5CMXH 1EJNA 2BLOA 3RM0H 2GT8A 1KDQA 5TJXA 4MPVA 1LHFH 1XKAC 1QRZA 2VNTA 2AMQA 4FU9A 4AB8A 1O30A 1GMDF 1YPKH 4PROA 4K5ZA 3SU0A 3EDXB 5FX6A 4WF8A 4TWWA 2JH0D 3ZZDA 2LNCA 3H7OA 1BBRH 2ALPA 4UFEH 1F0UA 1PQAA 2BLQA 3VFEA 2HPPH 1F5KU 1NRPH 1OP0A 2CMYA 3H5CB 4QT8C 1SOTA 1XVMA 3V0XA 3UNSA 3ZVFA 1S0QA 1E34B 4MPWA 4UFGH 2ZU4A 3MU4A 2XRCA 2XYAA 1NRQH 4ASHA 3NUMA 1WYKA 1K1OA 3B9FH 1O39A 2V35A 4H42U 2BLWA 1HGTH 3TNTA 1GHZA 4D7FA 1FY3A 1CGJE 4IS5A 1SGFG 3MU8A 1FMGA 4ISNA 2AIPA 1SGNE 3QLPH 4ABFA 1EZXC 5HGGA 5FAHA 4HTCH 1AFQB 4LZ1H 1BHXF 1K2I1 3ATMA 3NPSA 4JCNA 5EQSA 1QB1A 4LOYH 1DT2A 3M3VA 4E7NA 3RXSA 3LT3A 5EPYA 3TJUA 2BHGA 2XBVA 1K1IA 1VCPA 2SNWA 5DKMA 1ETSH 1AZ8A 3RXHA 1YPGH 2AMDA 2BDGA 1BB0B 1CGHA 4JZFH 2A4QA 3QZRA 1PPEE 2V3HH 1TA6A 4BAMB 2OC0A 5K7RA 3M5NA 1Q3XA 1SSXA 2PKSB 4CR5A 3P95A 5LGOA 1TB6H 2WYGA 1VJ9U 1B0FA 3AAUA 5LH8A 4MLFB 1LKBA 4DJZB 5F03A 3BSQA 2TGTA 1J14A 3QWCH 5T3HA 1C1TA 5T6FA 1RS0A 1Y5UT 2GKVE 3KF2A 3A7YA 1O3MA 1YPHE 1J15A 4YTAA 4TYDA 3PMBB 3F68H 3M7UA 1A5GH 1ESAA 4JK5A 1P3EA 2JH5D 4D8NA 2P8OB 1GI1A 1SVPA 2A1DB 2OINA 1CVWH 1TMTH 2THFB 2Z9JA 2CF8H 3SQEE 3M37A 1GWAA 3RXEA 4CHAB 1FI8A 4A5TS 4GCHF 1AB9B 1ZJKA 4GUXA 4X1SU 1NM6A 4H6TA 1Y5BT 1GG6B 2FWWA 3MNSA 1JWTA 3ZVAA 1C5LH 2ZDNA 2Y7ZA 7LPRA 2SGPE 3LH3A 1FN6A 1AMHA 5LPEA 1S5SA 1AUTC 1NTPA 3GDSA 3GCTF 2ULLA 1GBIA 2BY5X 3AW0A 1EB2A 1OWKA 1C2LA 4CRGA 1TGCA 1SR5C 2FXRA 1K22H 4AB9A 3T26A 2ZTZA 5AFZH 1LQEA 1OPHB 5DP7A 1TBQH 2IOTA 3SGAE 1YF4A 4CBNA 3SO3A 1SC8U 1HXEH 1EJMA 3LGYA 1Z1IA 2FOGA 1TNLA 1QB9A 1H8DH 4FUHA 1MAXA 4JZEH 3RXOA 1N8OC 2STAE 1GBLA 1BQYA 1DOJA 1SGEE 1V2JT 4BAOB 4ZHMU 2OQ5A 1UTQA 3KQCA 5FPYA 3ZVEA 3AAVA 1HB0B 3GCTG 3ZVDA 1O3LA 1YC0A 3BG4C 1QCPA 2TGPZ 4AX9H 1AZZA 4BANB 3MO3A 1QBNA 3SV7A 1PPBH 3E0PB 1GDQA 3L6PA 3BV9B 1ZJDA 3PWBA 1O32A 4JZ1A 1VITF 1NFXA 3DHKH 2B8OH 5CHAB 4ZKNU 5L30H 2C3SA 2J38A 3PO1B 1ZMJA 3OTJE 4AOQA 1L1GA 1IQGA 2RDLA 5EODA 1AE8H 1BOQA 4Y76A 2WUCA 4OGYA 2WINI 3SORA 2UUKB 2FESH 4FU8A 2ZU2A 1P2NA 1D6WA 3W94A 3RC6A 1A3BH 3DFLA 1P2MA 1TX8A 1KTTB 2ZPQA 4HGCA 4HFPB 4X1RU 4BNRA 2LPRA 1MZAA 3VEQB 4ABBA 3IWMA 2Z3CA 1GJ7B 1NRNH 1P03A 1DWCH 1ETRH 1TQ0B 3RXVA 1W11U 2J95A 1W12U 1SGDE 3BIVH 1YPMH 2W5EA 2AEIH 3QTOH 4SGBE 1LHCH 1TGSZ 1NS3A 3LGWA 1GL0E 3BG4B 2FYQA 3LDXH 1T8OA 2PTCE 1GBTA 4ESTE 1EAXA 1YP9A 2Y5FA 1GI6A 1EAWA 2PKAA 2ODYB 2BD4A 4K1SA 1GHXH 1NFYA 1CO7E 4IC6A 1E36B 2W7SA 1KXAA 1O2MA 3LKWA 4Q7YA 2HALA 1V2TT 2BDCA 4MDSA 3A8CA 1HV7A 1LTOA 5I46H 5A0AE 1DUAA 4OS4A 1Y3UA 1IQEA 2GT7A 2Q6DA 1O2HA 1LMWB 2PUXB 3I29A 1E37B 3RMLH 2OC7A 1HJ8A 1TPOA 2OC8A 4FUEA 2ANMH 4X6OA 2H2ZA 1DFPA 1D9IA 4WMEA 1YM0A 1S81A 2G52A 4X1PU 1ESTA 1PJPA 2A5IA 3ELAH 2FOCA 1DSTA 1QB6A 1P9SA 1MTNB 1Y8TA 3TJOA 3NCLA 2BY9X 1C1MA 1EUFA 1MD8A 1PYTD 2GMTC 2GV6A 1O2ZA 4I8GA 1DX5M 3SNCA 4O9VA 2GCTC 4WH6A 1PYTC 1C2MA 3SJ8A 1G32B 1ELCA 1AVWA 1BIOA 4YOGA 1UVOA 5A09A 1S85A 3SV6A 2O8TA 1C5XB 1EASA 3BEFB 2PV9B 1NU7B 1Z8GA 3TJNA 5T6GA 3O8CA 1C5PA 1RIWC 5BPEA 3QZQA 1GMCG 1DY8A 3LC5A 3SZNA 2BVSH 1C1WH 2BYAX 2BDBA 1P10A 5EW1H 2DE9A 5GWZA 1CGIE 3QX5H 1AHTH 1BRBE 3P70B 3SU4A 1O3IA 2FZZA 1TFXA 2Q1JA 3UTUH 1OKXA 2PKSC 2A7JA 4YZUA 2Z9GA 4TPYA 1AQ7A 1Q31A 3HK6B 3BTWE 4CREA 4SGAE 1TX7A 1MTVA 5E0GA 1C1PA 4E7RG 3A7WA 1W8BH 2TBSA 5SGAE 4ZROA 3PMJA 1N1LA 2AERH 1GDUA 4YESB 3K6YA 2ESTE 2GZ8A 4K3JA 2G55A 3TK5A 1O3EA 4D76A 1TABE 3RXIA 1HDTH 1WV7H 2OBOA 3PLBA 3MNCA 4B75A 1SHHB 5LPFA 1MBMA 2FOMB 3TGJE 3FVFB 4FUBA 2Q6GA 1HJAC 1GJ9B 1S6HA 1FNIA 1O2GH 1RTFB 2UWOA 2UUYA 3A7ZA 3ITIA 1QJ7B 1KXFA 1S0RA 1G3EA 2STBE 3S7HB 4B2CA 1RRKA 1SLXB 1YCPM 2Y5HA 1O5DH 2BDHA 3ESTA 3KL6A 3U69H 4WY3A 3ZZ5A 1O2LA 1EX3A 2A4OA 2F91A 2ZCKP 3TIUA 1MMJN 2OBQA 1GI9B 4B74A 1O3JA 1X7AC 3VXEH 3SHAH 1ZTLA 3KEEA 1A5IA 1NRRH 1ZYOA 2OXSA 2UUJB 3S9AA 9LPRA 1DDJA 3GDUA 1CHOF 3BTME 2IPHA 4YLQH 4I8LA 4UDWH 1AFQC 1TNIA 3I77A 3TH2H 4BAKB 1QJ6B 1GCDA 1QRWA 2B0FA 1FIWA 1OP2A 1THPB 1GI5A 5DJ7A 2OTVA 1U6QA 4NG9H 2BVRH 3L3TA 3BTEE 1O38A 4X6NA 1ANEA 4FUDA 2FOHA 1O3KA 1SGYE 1IHTH 2ZHDA 2ALVA 4FVDA 2ZNKH 4IN2A 3Q77A 2BQ7B 3ZZ4A 4INKA 7GCHG 2P93A 3N7OA 3ZZ3A 1GJBB 4OS6A 1EAUA 1LVBA 3UNRA 1SGCA 2BY8X 1LPGB 3KCGH 1P0SH 2P3FH 2FTLE 4FUJA 3A7VA 1HJ9A 5AVDA 8ESTE 3LGUA 4H4FA 4KTCA 4CHAC 3K9XB 2Y6TA 1HXFH 2BDYA 1BHXB 3FP8E 2O8WA 2ZKSA 3SU6A 1L4ZA 4X2WA 4U30A 1O3CA 4Z6AH 4ZKSU 3M36A 3ZVGA 2NU0E 1CT0E 1EAIA 1WBGB 2XBXA 4NZQA 1O2QA 1IQHA 1ETTH 2GVFA 4RKOB 1Y3WA 2Z9KA 1LHDH 1XUFA 1V2UT 1YPLH 3BTGE 2BY6X 2R2MB 1AVXA 2Z3DA 3GCHC 2QF3A 1C5ZB 5AHGH 1HAYB 2HLCA 4OS2A 5FPSA 3GCHB 4X6PA 2D8WA 1F5RA 1DS2E 2DUCA 4THNH 1O3FA 4IGDA 1MU6B 1NU9A 1CA8B 2SGAA 3UIRA 2A5AA 5JYIA 1ANDA 1XKBC 1ARBA 8GCHG 3TK9A 3V13A 3F9FA 4FUFA 1C2KA 3ATWA 5A8YA 2BX3A 4X2XA 3MOCA 2VWMA 1UMAH 2H9EH 1MKXH 1C1SA 2J2UA 2VU8E 4AN7A 4B73A 1UHBB 1ZSLA 1Z1JA 2ZCHP 1V2QT 1GL1A 4NA9H 4XDEA 2ANWA 2GGVB 4HZHA 1VITH 4Y8ZA 1SPJA 1P05A 1O2JA 1A1RA 1G2MA 5FCRA 1MKXK 1W14U 1XUGA 2HNTC 2W3IA 1P2QA 1SGPE 2CXVA 5JBCS 2RA0A 1C5UA 1AU8A 1TPAE 3SV2H 3RMMH 4X8TH 5EXMA 2BTCE 5E2OA 1ANCA 3R0FA 1O33A 5C5OA 1MZDA 1OX1A 5GPIB 2FDAA 5DP5A 3OU0A 2VWNA 4AYVB 2A4GA 3DT0H 1C4Y2 1ARCA 5TCAA 1VGCB 1O3AA 2C90B 1RGQA 4WWYA 1IQKA 2G51A 4Y6DA 1INCA 2ASUB 4VGCB 3UUZA 4ZUHA 3K65B 4GPGA 2QF0A 1EQ9A 2YNBA 2B5TB 1BRUP 1GBAA 1T8MA 3D49H 1HAHH 1AGJA 3C27B 1V2KT 2VH0A 4Q7XA 1DWEH 4AG1A 1V2RT 4BXSA 1QGFA 4ZKOU 3D23A 2C8YB 3UOPA 1NC6A 4XOJA 1YCPK 4R0IA 1XUKA 1V2ST 1SGFA 2ANKH 1B7XB 3EYDA 3SNEA 1MTWA 3MU0A 1C9PA 2PW8H 5DP8A 1GJCB 1NN6A 2VH6A 1WQVH 2WV5A 1HJAB 3SUEA 3M7TA 1OS8A 1SQTA 1GBHA 3V12A 4KGAA 4K8BA 4X2VA 4DGJA 2HNTF 2ZFRH 3E90B 1CA0C 2UWPA 3TU7H 4F49A 3SJKA 3A7TA 2VVUA 4J1YA 4CBOA 2FEQH 3PMAB 1TRMA 8LPRA 1C5YB 1CBWC 3MH6A 2RG3A 4NCYA 2H5CA 1HAXB 2XBWA 2VGCB 3BN9A 4AFUA 2B7DH 5HXFA 4DY7B 1C5SA 3E1XB 1RJXB 4UFFH 3A8AA 1MBQA 2PFEA 2C8XB 2ZZUH 3LH1A 2P94A 1C2FA 1TMUH 1QR3E 1QY6A 2ZGXH 4YM9A 2H9TH 2ZFFH 4WXIA 1GCTB 2QV1A 1WSSH 2WPKS 1W7XH 1JRTA 4KELA 2H9HA 2WPMS 1V2MT 4MNVA 5EQRA 4ZH8A 4NWLA 1NROH 1WQSA 3ZYDA 1QTFA 2QN5T 2NU3E 4WMDA 1AE5A 1O2KA 1MTUA 1HAZB 4GHTA 1G36A 2A5KA 1TNGA 3UPEA 4O3TA 4WJG2 3HK3B 4NZLA 3MHWU 2ZTXA 3NXPA 1GI7B 9ESTA 2QAAA 4BAHB 1NESE 5HMAA 1HYLA 3GY6A 5DP9A 1E0FD 2QIQA 2O8LA 1SQAA 4AGKA 2HOBA 5DG6A 3ZV8A 2Z94A 1O2YA 1SFQB 3EA8A 1P11E 2F3CE 4O03A 5GCHG 5GIBA 1O5GH 5JB8S 1BTUA 2O8MA 2FPZA 1AN1E 3F6UH 2C8WB 3RXPA 2QXJA 1FAXA 3I78A 3K6ZA 4CH8B 3EGKH 2IJOB 1VZQH 1O5EH 4UEHH 1LPZB 2ZTYA 4MQAA 1EZQA 1S83A 3U98H 3AASA 1BBRE 4MPUA 1F7ZA 5J4QA 1A7SA 3SU3A 3T27A 1JRSA 2GCHF 5JB9S 4O97A 1MQ6A 5I25A 1O3BA 1FONA 1LHGH 1RTKA 2HGTH 1UTNA 1P3CA 4YOIA 1FPCH 4NWKA 2J9NA 1SMFE 1G2LA 2ZO3H 5PTPA 3SJOA 4A1TA 3S69A 3KN2A 2QA9E 4DIIH 3EE0B 1QJ1B 1GJAB 3KQDA 1BCUH 2XWAA 2ZC9H 1O2VA 2ZFSA 3E91A 3LGIA 2Z6BD 2AYWA 4F4OC 2EA3A 2PSYA 1UCYE 3ZZ6A 2ZGJA 2WPHS 3P8NA 3U8RH 3W95A 3FP7E 4X8VH 1TIOA 2UUFB 4MNWA 3NKKA 1ELTA 2O8UA 4ISHH 1FY8E 1PPHE 4CRCA 3GY2A 4AZ2B 3T5FH 1NT1A 3HKIB 4OGXA 3SN8A 3UR9A 1P04A 1KYNA 3OSYA 3SI3H 1GBFA 1BTWA 3M3TA 1E35B 2ZWLH 3VB7A 1C1QA 4NA7A 1OWIA 1TALA 1A0LA 1BA8B 1XX9A 4RKJB 1ZHPA 2VVVA 1O36A 1UVSH 2XCNA 3A81A 1C5RA 4JK6A 3UWJH 4JYVH 2QGRA 1GBMA 1ZLRA 2ODPA 3M5LA 3MMGA 3QK1A 4MNYA 3T25A 3TH3H 4GAWA 1GHAG 3FZZA 2I6QA 2FI3E 2G00A 2A32A 1W3CA 3GYMA 1AKSA 4ZXYH 2VIWA 4XE4A 1LQDB 1YYY1 2R3YA 3DFJA 3KQEA 4WH8A 5A0CA 2XC5A 4K60A 1ACBE 4BOHA 3FP6E 3VB4A 2CJIA 4AFQA 1VR1H 5EGMA 2J4IA 3V7TA 1GG6C 5E0HA 3ATKA 1BITA 4YOJA 2CN0H 1TNJA 1W0YH 1Y5AT 1AB9C 1Y3VA 2OLGA 2EI7A 4CRDA 2BD7A 4DVAU 1XUIA 1QURH 2P95A 1V6DA 4I7YH 1JIRA 3MO9A 1YLCA 3ATIA 4Q80A 2VVCA 4RN6A 1MD7A 3RP2A 2F9BH 2JETB 5K0HA 5A2MH 1C5VA 3U1JB 1UTMA 2XNIA 3A80A 4O3UA 1Z7KA 1UTKA 3K2UA 3SW2B 2XC0A 1G30B 2ZFQH 4ISIH 2OCVB 3GYLB 1A3EH 3ZYEA 4WMFA 2ZHEH 1F0TA 1W2KH 3UREA 1P9UA 1PQ5A 1LVOA 4B71A 3U1IB 1ELVA 1H8IH 1ZR0A 2QC2A 1LO6A 1Y59T 1GDNA 1QFKH 4OS1A 3SQHE 3ODDA 2BDAA 2PWXA 5ABWA 3KIDU 3A84A 2ZGCA 5DP3A 3A85A 3UNQA 6CHAC 1UHBA 1GJ4H 1GMDG 1HIAA 1V2VT 1GI0A 5HM2A 1TPSA 4JZDH 3A87A 4A6LA 1OSSA 5CHAC 4NSVA 1OWEA 4IBLH 1HPGA 2FOBA 5E0JA 1W7GH 3BTKE 1H9HE 1UK4A 5F8TA 1XXFA 5EOKA 2Q6FA 1C5NH 2P8OC 4A1XA 1AWFH 1OP8A 1ZRBA 4ZKRU 2A45B 1L1NA 3BEUA 2VIVA 1MCVA 1SL3A 2BDIA 3NZIA 7KMEH 1IQFA 1DITH 3BTDE 1B0EA 5GJ4B 1C1VH 1PPFE 4INHA 5L2ZH 2K1QA 1QBVH 5C1UA 3RC4A 1KLIH 1QQ4A 1TRNA 1AWHB 2FOAA 1ORFA 1DWBH 2CGAA 1QNJA 4NIYA 1HAVA 4YLUA 2ZDVH 1GHYH 1HFDA 1O34A 5EG4A 5EXLA 4X8UH 3SJ9A 3L33A 4D7GA 2J34A 1C2EA 4Z0KA 2OQUA 5C2ZA 2ZIQH 3HPTB 1K1NA 2FIRH 1SG8B 1HAGE 3Q3KA 2Y82A 1EPTB 1Z71A 3T29A 4BTUB 3WY8A 2QCYA 1J9CH 1FY5A 2AGEX 5L2YH 4AGJA 2SGQE 5FBEA 3PLPA 1SLUB 1V3XA 1BUIA 2J94A 4ABJA 1P57B 4JYTA 3A86A 1GHAF 1HAOH 3RU4T 4TPIZ 1WOFA 1O2SA 1A2CH 4LXBH 3RXKA 3RXLA 4CRAA 5JBBS 1ELGA 1DLKB 1FQ3A 4CRFA 3BTQE 1MCTA 2D1JA 4ABHA 1ZPBA 3FFGA 3MWIU 3PWCA 3JZ1B 2ZU5A 1T31A 1OWDA 1QIXB 1ZGVA 2NWNA 2ZDLA 3ZZCA 1D6RA 1GBKA 1OXGA 3UQVA 1NRSH 1GHBF 1C1OA 1ID5H 1Q2WA 4MG3A 5G4BA 2SGEE 2ZQ1A 1CE5A 1H9LB 1ZPCA 1TE0A 3PYHA 3Q3XA 3EA9A 1GI4A 1TGBA 1EZSC 3TNSA 3MI4A 4DG4A 1KXCA 2ZGHA 3OX7U 1MKWK 3OY6U 1AVGH 2ZPRA 3P92A 2ZU3A 4Y0YE 1CQQA 4OS5A 1ZSJA 4WXVA 1P2JA 1J17T 3E8LA 3SUFA 4FUIA 1K1MA 1PQ8A 7ESTE 6GCHF 3AW1A 1OWJA 3F9GA 1ABIH 3GY7A 1AI8H 1C1UH 1HLTH 2BZAA 3TGKE 4BTTB 1DE7H 1L2EA 1FN8A 3F9HA 3QDZB 1ZSKA 2ZG0H 1K1PA 2GP9B 2Z7FE 1MUEB 3RU4D 1TRYA 3SUGA 2ZHWH 2CHAC 1YGCH 1O3PB 3RMNH 1O2PA 1TONA 4Y7AA 1LDTT 1V2LT 1ZOMA 4HI3A 3EA7A 4ZHAA 1AD8H 1JIMA 1RFNA 5ESBA 4RSPA 2FLRH 3URCA 1SLWB 1L0ZA 8KME2 1F5LA 2V3OH 3GDVA 3PB1E 4ISLA 2AS9A 3ZVBA 2BZ6H 2ZDMA 1G3BA 2QY0B 1YBWA 1GPZA 2TPIZ 1B5GH 1PPZA 1Z8RA 4Y0ZE 1QA0A 1O31A 3B8JA 5EQQA 2G5NA 5E8EH 3SGQE 6GCHG 1K9OE 4BTIB 3U8OH 4X8SH 1CT2E 1P06A 2CF9H 1WTGH 5F8XA 2HNTE 1QL9A 3OY5U 3RXFA 1ELBA 4FXGH 4Y79A 2BD5A 3URDA 1VCQA 1K1JA 2FLBH 3LJJA 1TNKA 4TY7A 3SHCH 4GSOA 1FJSA 3P8FA 5C67A 2G8TA 3V3MA 3O8RA 4B2BA 1THSH 1GBBA 4A7IB 3F9EA 3LC3A 2VB0A 3M5OA 4AFZA 1HNEE 1HUTH 3MH7A 2GZ9A 1S82A 4VGCC 4ABIA 4ZAEA 2OD3B 3ZZAA 3U8TH 4FVBA 6ESTA 1KSNA 1ELFA 1O3NA 3UR6A 2AIQA 3EQ0H 2WUBA 3E0NB 4ABAA 3SI4H 5A8ZA 1ELDE 3DA9B 4AYYB 3SBKA 2PHBA 2NU1E 1O3DA 3SU5A 5EU8A 1EP5A 1MAYA 1SFIA 3M3SA 4X2YA 1SGRE 3TLOA 3LGVA 3ZV9A 2OP9A 1K21H 2ZI2H 1OWHA 3SNAA 4ZXXH 4ABEA 1TAWA 3SU2A 1KXBA 1GVLA 1O5BB 1HCGA 2TRMA 1XMNB 3PTBA 4IMZA 1NFWA 4NGAH 3RXAA 1GI2A 4INLA 3RXJA 2AGIX 3MFJA 3KHVA 1A61H 2FM2A 1C2IA 3T2NA 1TA2A 4E05H 3UFAA 2F9VA 3QGNB 3RXTA 3RU4E 1CT4E 2G4TA 4UONA 2AGGX 3BEIB 2BB4A 1GI3A 3GCOA 3JZ2B 5FPTA 1P01A 3ZVCA 3MH4A 2OC1A 4UE7H 4I33A 3IG6B 1O35A 2R9PA 4K69A 2WPJS 2XBYA 4NIXA 2BOHB 3Q3YA 3R3GB 2XC4A 5JBTA 1DUEA 3T28A 1D4PB 1ZMNA 2ZA5A 3F1SB 4NFEA 1GJ8B 1LHEH 2KAIA 4U2WA 2SGDE 1UK3A 2BMGB 1UTJA 1IQJA 2BD3A 2FI4E 2V6NA 2WYJA 2GDDA 2PUQH 4XSKU 1EKBB 4Q2KA 1T4VH 2FS9A 1DPOA 2XXLA 4R8TB 1GHVH 5JPMH 2GCTB 2HPQH 1GGDC 1XUJA 4I31A 3ZZ9A 1GMHG 2BXTH 2VIDA 3LGTA 3VPKA 3KNXA 1OYTH 2YOLA 1TWXB 5FXLA 1A5HA 1IHSH 2ZP0H 4AG2A 3SGBE 3TPIZ 5EPNA 1H1BA 1AY6H 3ZZ7A 2F9PA 1SGTA 2QXGA 1TGNA 1C9TA 2EEKA 4XBCA 2GTBA 2ZF0H 1WU1A 1IQMA 3S9BA 2PGBB 1V2PT 3UQOA 1P02A 1ZHMA 1C2DA 2C8ZB 3CP7A 3M35A 4KKDA 3SUDA 3M7QA 5BRRE 2D2DA 4NFFA 1W0ZU 1JMOH 3P17H 3BIUH 3TJVA 1AIXH 1GBCA 2ZFTA 3HGPA 1SQOA 1C2JA 3VB5A 1YCPH 2JH6D 4B2AA 4BAQB 3TH4H 8GCHF 2PGQB 5A0BA 3BG8A 5C20A 1SHYA 3HGNA 1THRH 1GJ6A 1G3DA 4KP0A 3TITA 4KTSA 1BTYA 1ABJH 3TGIE 1TPPA 3DD2H 2B9LA 4NIWA 1EZUC 3KQBA 1UJ1A 2BQWB 1UO6A 3RLYH 1L1JA 3RM2H 1JOUB 2R0LA 1BDAA 1K28D 2XTTB 4B76A 2YNAA 1UVTH 1TBRH 1A4WH 3PLKA 1A0HB 4IW4E 2F9NA 2TGDA 2V0BA 4Y71A 1KIGH 3KGPA 1XM1A 1EPTC 1BMLA 5A8XA 2BQ6B 1HIAB 1BMMH 1V2OT 4MVNA 2AH4X 2XWBI 1LVMA 4X6MA 2R0KA 3EAJA 1HAPH 2ILNA 1TOMH 1P2OA 1VCWA 1EP6A 3BTHE 5FCKA 3RC5A 1KLTA 2BXUH 3MYWA 1BBRK 6LPRA 1AO5A 3NWUA 2VWOA 1NO9H 4FUGA 3E16B 3C1KA 2ZFPH 3RXQA 3LONA 5DGJA 7GCHF 1GHBG 2P59A 1WUNH 2FYRA 1O2NA 2F83A 1F0SA 4DIHH 1BRAA 4Y8YA 2BLVA 1CHGA 1MTNC 1T4UH 1YLDA 3ODFA 2A7HA 1HAVB 2HWLB 1DICA 3HATH 3G01A 6CHAB 5ETXA 3ZZ8A 1BT7A 2BY7X 3MU1A 3RXRA 1UTOA 1BMAA 1TBZH 2PTNA 1CHOG 4UD9H 4FUCA 5JBAS 1V2WT 1QBOA 2BVXH 1EPTA 3RMOH 5IYTA 1D3QB 2JETC 1RXPA 1GHWH 1QL8A 1KLJH 1P8VC 1T8LA 2R2WU 1NY22 2ZGBH 1P12E 3P6ZB 5C3NA 2Z9LA 2WPLS 1EATA 4K2YA 4X1QU 1PPGE 3T62A 1GJ5H 4Y7BA 3PROA 2BD8A 4I8KA 3CS0A 1QHRB 2VIQA 1DWDH 1OYQA 1F92A 2GMTB 4M7GA 1C4V2 2A0QB 1W13U 2GX4A 1SGQE 2KAIB 2BX4A 3GY3A 2GZ7A 4NA8A 2FOFA 3A88A 4YO9A 1UTLM 3VB3A 1EB1H 1FV9A 4BXWA 1XVOA 2J92A 1O2OA 2R3UA 2ZDKA 3LPRA 2QYIA 1TQ7B 1VITG
chains in the Genus database with same CATH superfamily
3RXGA 1MQ5A 2VWLA 4RT0A 1RTLA 4Y11E 2EY4C 4X0WU 5GCHF 1SQRA 2PR3A 1V2NT 4TT3D 4J2YB 3SV9A 2Y7XA 4MNXA 1DSUA 2GCHG 5E2PA 3PTNA 4A92A 1GJDB 4JMYA 3A7XA 4UFDH 3OFND 1E38B 1O2TA 1D3PB 1T7CA 2JIZD 1GMCF 3ENSB 3BTTE 1UVPA 2A4RA 4OS7A 4CRBA 1PPCE 3PO1C 3PM3A 1C5QA 2Z9IA 1GI8B 5AF9H 1DY9A 3F0PA 1LCYA 1C5MD 2A2XH 1C1NA 1S84A 3RXBA 1ELEE 1SI5H 3UAIC 4H6SB 3QGJA 1JBUH 1GMHF 1BZXE 1H9IE 2RCEA 2XW9A 1P09A 3Q76A 1T8NA 1YPEH 1H8ED 4ACAA 1HBTH 1C5WB 1FPHH 3STIA 1Z6JH 1MTSA 1BTPA 1EOLA 3A83A 3QTVH 2W3KA 1MU8B 1Z6EA 4CR9A 5EXNA 2KCOA 1G9IE 2F9UA 2H6MA 2XOKD 2VIOA 1J8AA 2G81E 3ZZBA 1WTHD 1XUHA 2AMPA 1O5AB 1EXFA 2BD2A 5T1VA 2ZHFH 1YKTA 2ZDAH 3HKJB 2G4UA 1Z8IB 2VIPA 2XNDD 1IQIA 3O8BA 1TYNA 2VJ1A 2FOEA 2SNVA 1Y3XA 2A31A 2DE8A 3D62A 4XFQA 2ZQ2A 1NZQH 1T32A 2ZCLP 3MNXA 1FX0B 3GY5A 2WSSD 1FXYA 1C2GA 5FX5A 1QQUA 1GVZA 1L4DA 1OOKB 4CH2B 2JKHA 2ZHQH 2I6SA 4Y10E 5B6OA 3UWIA 2O9QA 2ZEBA 3F2HA 1CSOE 2NU4E 4LK4A 2D26C 1TNHA 2HVXA 4K1TA 1G37A 3U9AH 1N8OB 1ZGIA 2PLXA 1EFRD 2FS8A 1C2HA 1FLEE 2VINA 1FIZA 1P2IA 2SFAA 1BMNH 1J16A 3GCNA 3RDZA 3SNBA 3N7DA 1C5TA 5DPAA 5ESTE 5T6DA 1QL7A 1QRXA 3MNBA 4MTBA 3H7TA 3A89A 1BJVA 1GBEA 1FY4A 1GBDA 1YPJH 5DP6A 5L6NH 3FAOA 3STJA 5LPRA 1C4U2 1O2IA 1GCTC 2GV7A 4TWYA 1FAKH 1O2XA 4IN1A 4FU7A 1SBWA 1K1LA 1GGDB 3F0OA 3O8DA 4ZHLU 2QXIA 3RXMA 4GLYA 4Y8XA 1SOZA 5AFYH 4E06H 1FY1A 1PFXC 3GISB 2P3TB 3M61U 1NPMA 2FMJA 2ODQA 1RD3B 3RXUA 2EI6A 2WZQA 1KMHB 3P8GA 3QN7A 1XXDA 1ZTKA 4YT7H 1TOCB 1DXPA 3FZDA 1O3OA 1AKSB 4TY6A 3PV4A 5HM9A 1IAUA 2W7UA 1PQ7A 4NSYA 2K8IA 1CA0B 2FO9A 4ABDA 1BTXA 3E3TA 2EI8A 2M5TA 1BRCE 1SB1H 1HRTH 1Y3YA 2PKAB 5IDKA 1NFUA 3LOXA 1LVYA 2P3UB 1KXEA 1A46H 1DXWA 3SU1A 3QO6A 1MKWH 1UVUH 1FZZA 2A7CA 2RA3A 2VGCC 1A0JA 3S9CA 1CBWB 3A8DA 3SJIA 2WPIS 1ANBA 1DM4B 1O2WA 1ELAA 2BM2A 2OUAA 2G5VA 3VG8A 4U32A 1DVAH 2QXHA 3LU9B 2FI5E 2W6ID 5GXPA 1IQLA 1N6XA 5FBIA 1JXPA 3RXDA 1N6YA 4XBDA 1KDQB 1Z8JB 3M5MA 2FTMA 1ZZZA 3RLWH 4LZ4B 5GDSH 1TLDA 2C93B 4I8HA 2BD9A 2JJ1D 4K8YA 4AFSA 3NK8A 5J4SA 5TCCA 1VJAU 1MABB 4B1TA 1ZTJA 1H4WA 3B23B 3PMHB 2QF5A 1KY9A 5C5NA 2GDEH 2C4FH 4IC5A 3E6PH 2FODA 1VGCC 4ABGA 2CV3A 1IQNA 1ZMLA 1NBME 3BTFE 2FP7B 5HIYA 2XCFA 3IITA 4GCHG 2FX4A 4DOQA 1O2RA 4MPXA 3SV8A 5EW2H 2ZECA 3RXCA 4Q7ZA 4KTUA 1CU1A 4XBBA 1TX6A 1TGTA 1M9UA 2TIOA 3S7KB 3Q00A 4A1VA 4YT6H 5DP4A 1LKAA 4XD7D 1BTHH 1W10U 2ZU1A 1F0RA 1ZRKA 4GHQA 3LIWA 2WV4A 4DCDA 2ZPSA 4ISOA 1WCZA 1E79D 5F8ZA 5H4IB 4AORA 2P16A 3D65E 3TK6A 3GY4A 1O37A 1ESBA 4I8JA 5C94A 3OYPA 2W26A 1DLEA 1QA7A 1S6FA 4I32A 1WAYB 5DK1A 1F2SE 1GBJA 4K1EA 3CENA 3PV2A 2IJD1 2HLDD 5EIYA 1KXDA 5CE1A 2BOKA 3LJOA 2AHME 3UY9A 3VGCC 3VB6A 1AUJA 3P8OA 5FHTA 1O3HA 5DO4H 1HAIH 1O5CB 3N7EA 3SNDA 3BF6H 5JDUB 2SGFE 4D9RA 1YPHC 3AVZA 1O3GA 1AFEH 4WVPE 4DURA 3FANA 4X1NU 1GVKB 3S0NA 1G3CA 3UOUA 1BTZA 3DUXH 5C1YA 5F6MA 4D9QA 1ZPZA 1UCYK 1C5OH 1KTSB 3GICB 1O0DH 4U01A 1O2UA 2NU2E 3ATLA 1LPKB 1UTPA 3A8BA 1RIWB 2AFQB 2H1UA 4DT7B 3MH5A 3GOVB 3VXFH 5C1XA 3QUMP 2PSXA 1SKYE 3CS7A 2Z3EA 2Y80A 2GD4B 2Y5GA 1FDPA 2CHAB 2TGAA 2A2QH 3SOSA 2HRVA 1SGIB 1O5FH 2FX6A 4IMQA 4JYUH 3TVJB 3MO6A 1EJAA 1D3DB 4GVUA 1UK2A 3MU5A 1BJUA 5HYOA 1C1RA 1TMBH 1UCYH 2F9OA 2IN2A 4NIVA 4ACBA 1ZHRA 2YMSD 2F43B 2YMSB 4JZIA 2H5DA 2WHXA 3A82A 1D3TB 1SLVB 1P2KA 2Y81A 1EOJA 3RUOA 3VGCB 4ZMAH 1DANH 2EC9H 3FKSD 1FUJA 3GY8A 2UWLA 1MH0A 2ANYA 4DW2U 3MTYA 1IOEA 5CMXH 1EJNA 2BLOA 3RM0H 2GT8A 1KDQA 5TJXA 4MPVA 1LHFH 1XKAC 1QRZA 2VNTA 2AMQA 4FU9A 4AB8A 1O30A 1GMDF 1YPKH 4PROA 4K5ZA 3SU0A 3EDXB 5FX6A 4WF8A 4TWWA 2JH0D 3ZZDA 2LNCA 3H7OA 1BBRH 2ALPA 4UFEH 1F0UA 1PQAA 2BLQA 3VFEA 2HPPH 1F5KU 1NRPH 1OP0A 2CMYA 3H5CB 4QT8C 1SOTA 1XVMA 3V0XA 3UNSA 3ZVFA 1S0QA 4Q4LA 1E34B 1WDIA 4MPWA 4UFGH 2ZU4A 3MU4A 2XRCA 2XYAA 1NRQH 4ASHA 3NUMA 1WYKA 1K1OA 3B9FH 1O39A 2V35A 4H42U 2BLWA 1HGTH 3TNTA 1GHZA 4D7FA 1FY3A 1CGJE 4IS5A 1SGFG 3MU8A 1FMGA 4ISNA 2AIPA 1SGNE 3QLPH 4ABFA 1EZXC 5HGGA 5FAHA 4HTCH 1AFQB 4LZ1H 1BHXF 1K2I1 2JDID 3ATMA 3NPSA 4JCNA 5EQSA 1QB1A 4LOYH 1DT2A 3M3VA 4E7NA 3RXSA 3LT3A 5EPYA 3TJUA 2BHGA 2XBVA 1K1IA 1VCPA 2JJ2D 2SNWA 5DKMA 1ETSH 1AZ8A 3RXHA 1YPGH 2AMDA 2BDGA 1BB0B 2M2AA 1CGHA 4JZFH 2A4QA 3QZRA 1PPEE 2V3HH 1TA6A 4BAMB 5B6LA 3OAAD 2OC0A 5K7RA 3DSGA 1Q3XA 1SSXA 2PKSB 3M5NA 4CR5A 3P95A 5LGOA 1TB6H 2WYGA 1VJ9U 1B0FA 3AAUA 5LH8A 4MLFB 1LKBA 4DJZB 5F03A 3BSQA 2TGTA 1J14A 3QWCH 5T3HA 1C1TA 5T6FA 1RS0A 1Y5UT 2GKVE 3KF2A 3A7YA 1O3MA 1YPHE 1J15A 4YTAA 4TYDA 3PMBB 5GNDA 3F68H 3M7UA 2WV9A 5KECA 1NBMD 1A5GH 1ESAA 4JK5A 1P3EA 2JH5D 4D8NA 2P8OB 1GI1A 1SVPA 2A1DB 2OINA 1CVWH 1TMTH 2THFB 2Z9JA 2CF8H 3SQEE 3M37A 1GWAA 3RXEA 4CHAB 1FI8A 3F3BA 4A5TS 4GCHF 1AB9B 1ZJKA 4GUXA 4X1SU 5EJLA 1NM6A 4H6TA 1Y5BT 1GG6B 2FWWA 3MNSA 1JWTA 3ZVAA 4Z1MD 2VBCA 1C5LH 2ZDNA 2Y7ZA 7LPRA 2SGPE 3LH3A 1FN6A 1W0KD 3F2FA 3EE7A 1AMHA 5LPEA 1S5SA 1AUTC 1NTPA 3GDSA 3GCTF 2ULLA 1GBIA 2BY5X 3AW0A 1EB2A 1OWKA 1C2LA 4CRGA 1TGCA 1SR5C 2FXRA 1K22H 4AB9A 3T26A 2ZTZA 1H8HD 5AFZH 1LQEA 1OPHB 5DP7A 1TBQH 2IOTA 3SGAE 1YF4A 4CBNA 3SO3A 1SC8U 1HXEH 1EJMA 3LGYA 1UW7A 1Z1IA 2FOGA 1TNLA 1QB9A 1H8DH 4FUHA 2IPQX 1MAXA 4JZEH 3RXOA 4P00A 1N8OC 2STAE 1GBLA 1BQYA 1DOJA 1SGEE 1V2JT 4BAOB 4ZHMU 2OQ5A 1UTQA 3KQCA 2KFWA 5FPYA 3ZVEA 3AAVA 1HB0B 3GCTG 3ZVDA 1O3LA 1YC0A 3BG4C 1QCPA 2TGPZ 4AX9H 1AZZA 4BANB 3MO3A 1QBNA 3SV7A 1PPBH 3E0PB 1GDQA 3L6PA 3BV9B 1ZJDA 3PWBA 1O32A 4JZ1A 1VITF 1NFXA 1K0HA 3DHKH 2B8OH 3CNRA 5CHAB 4ZKNU 2C3SA 2J38A 5L30H 3PO1B 1ZMJA 3OTJE 4AOQA 1L1GA 1IQGA 2RDLA 5EODA 1AE8H 1BOQA 4Y76A 2WUCA 4OGYA 1YLNA 2WINI 4OM9A 3SORA 2UUKB 2FESH 4FU8A 2ZU2A 4B6FA 1P2NA 1D6WA 3W94A 3RC6A 1A3BH 3DFLA 1P2MA 1TX8A 1KTTB 2ZPQA 4HGCA 4HFPB 4X1RU 4BNRA 2LPRA 1MZAA 3VEQB 4ABBA 3IWMA 2Z3CA 1GJ7B 1NRNH 1P03A 1DWCH 1ETRH 1TQ0B 3RXVA 1W11U 2J95A 1W12U 1SGDE 3BIVH 1YPMH 2W5EA 2AEIH 2KM0A 3QTOH 4SGBE 1LHCH 1TGSZ 1NS3A 3LGWA 1GL0E 3BG4B 2FYQA 3LDXH 1T8OA 2PTCE 1GBTA 4ESTE 1EAXA 1YP9A 2Y5FA 1GI6A 1EAWA 2PKAA 2ODYB 2BD4A 4K1SA 1GHXH 1NFYA 1CO7E 4IC6A 1E36B 2W7SA 1KXAA 1O2MA 4XRNA 3LKWA 3SZEA 4Q7YA 2HALA 1V2TT 2BDCA 4MDSA 3A8CA 1HV7A 1LTOA 5I46H 5A0AE 1DUAA 4OS4A 1Y3UA 1IQEA 2GT7A 2Q6DA 1O2HA 1LMWB 2PUXB 3I29A 1E37B 3RMLH 2OC7A 1HJ8A 1TPOA 2OC8A 4FUEA 1YY3A 2ANMH 4X6OA 2H2ZA 1DFPA 1D9IA 4WMEA 1YM0A 1S81A 2G52A 2J97A 4X1PU 1ESTA 1PJPA 2A5IA 3ELAH 2FOCA 1DSTA 1QB6A 1P9SA 1MTNB 1Y8TA 3TJOA 3NCLA 2BY9X 2GV6A 1C1MA 1EUFA 1MD8A 1PYTD 2GMTC 1O2ZA 4I8GA 1DX5M 3SNCA 4O9VA 2GCTC 4WH6A 1PYTC 1C2MA 3SJ8A 1G32B 1ELCA 1AVWA 3DCLA 4ZCNA 1BIOA 4YOGA 1UVOA 5A09A 1S85A 3SV6A 2O8TA 1C5XB 1EASA 3BEFB 2PV9B 1NU7B 1Z8GA 3TJNA 5T6GA 3O8CA 1E1RD 5KEDA 1C5PA 1RIWC 5BPEA 3QZQA 1GMCG 1DY8A 3LC5A 3SZNA 2BVSH 1C1WH 2BYAX 2BDBA 5EJ1A 1P10A 5EW1H 2DE9A 5GWZA 1CGIE 3QX5H 1AHTH 1BRBE 3P70B 3SU4A 1O3IA 2FZZA 1TFXA 2Q1JA 3UTUH 1OKXA 2PKSC 2A7JA 4YZUA 2Z9GA 4TPYA 1AQ7A 1OHHD 1Q31A 3HK6B 3BTWE 4CREA 4SGAE 1TX7A 1MTVA 5E0GA 1C1PA 4E7RG 3A7WA 1W8BH 2TBSA 5SGAE 4ZROA 3PMJA 1N1LA 2AERH 1GDUA 4YESB 3K6YA 2ESTE 2GZ8A 4K3JA 2G55A 3TK5A 1O3EA 4D76A 1TABE 3RXIA 1HDTH 1WV7H 2OBOA 3PLBA 3MNCA 4B75A 3MQKC 1SHHB 5LPFA 1MBMA 2FOMB 3TGJE 3FVFB 4FUBA 2Q6GA 1HJAC 1GJ9B 1S6HA 1FNIA 1O2GH 1RTFB 2UWOA 2UUYA 3A7ZA 3ITIA 1QJ7B 1KXFA 1S0RA 1G3EA 2STBE 3S7HB 4B2CA 1RRKA 1SLXB 1YCPM 2Y5HA 1O5DH 2BDHA 3ESTA 3KL6A 3U69H 3UB0A 4WY3A 3ZZ5A 1O2LA 1EX3A 2A4OA 2F91A 2ZCKP 3TIUA 1MMJN 2OBQA 1GI9B 4B74A 1O3JA 2V7QD 1X7AC 3VXEH 3SHAH 1ZTLA 3KEEA 1A5IA 1NRRH 1ZYOA 2OXSA 2UUJB 3S9AA 9LPRA 1DDJA 3GDUA 1CHOF 3BTME 2IPHA 4YLQH 4HG6A 4I8LA 4UDWH 1AFQC 1TNIA 3I77A 3TH2H 4BAKB 1QJ6B 1GCDA 1QRWA 2B0FA 1FIWA 1OP2A 1THPB 1GI5A 3PV5A 2OTVA 5DJ7A 1U6QA 4NG9H 2BVRH 3DSPA 3L3TA 3BTEE 1O38A 4X6NA 1ANEA 4FUDA 2FOHA 1O3KA 1SGYE 1IHTH 2ZHDA 2PP6A 2ALVA 4FVDA 2ZNKH 4IN2A 3PRDA 3Q77A 2BQ7B 3ZZ4A 4INKA 7GCHG 2P93A 4DT4A 3N7OA 3ZZ3A 1GJBB 4OS6A 1EAUA 1LVBA 3UNRA 1SGCA 2BY8X 1LPGB 4F48B 3KCGH 1P0SH 2P3FH 2FTLE 4FUJA 3A7VA 1HJ9A 5AVDA 8ESTE 3LGUA 1S6LA 4H4FA 4KTCA 4CHAC 3K9XB 2Y6TA 1HXFH 2BDYA 1BHXB 3FP8E 2O8WA 3KQ5A 2ZKSA 3SU6A 1L4ZA 4X2WA 4U30A 1O3CA 4Z6AH 4ZKSU 3M36A 3ZVGA 2NU0E 1CT0E 1EAIA 1WBGB 2XBXA 4NZQA 1O2QA 2QF4A 1IQHA 1ETTH 2GVFA 4RKOB 1Y3WA 2Z9KA 1LHDH 1WXRA 1XUFA 1V2UT 1YPLH 3BTGE 2BY6X 2R2MB 1AVXA 2Z3DA 3GCHC 2QF3A 1C5ZB 5AHGH 1HAYB 2HLCA 4OS2A 5FPSA 2KZ4A 3GCHB 2D8WA 1F5RA 4X6PA 1DS2E 2DUCA 4THNH 1O3FA 4IGDA 1MU6B 1NU9A 1CA8B 3PRBA 2SGAA 3UIRA 2A5AA 5JYIA 1ANDA 1XKBC 1ARBA 8GCHG 3TK9A 3V13A 3F9FA 4FUFA 4I86A 1C2KA 3ATWA 5A8YA 2BX3A 4X2XA 3MOCA 2VWMA 2GJGA 1UMAH 2H9EH 1MKXH 1C1SA 2J2UA 2VU8E 4AN7A 4B73A 1UHBB 1ZSLA 1Z1JA 2ZCHP 1V2QT 2W6JD 1GL1A 4NA9H 4XDEA 2ANWA 3N99A 2GGVB 4HZHA 1VITH 4Y8ZA 1SPJA 1P05A 1O2JA 1A1RA 1G2MA 5FCRA 1MKXK 1W14U 1XUGA 2HNTC 2W3IA 1P2QA 1SGPE 2CXVA 5JBCS 2RA0A 1C5UA 1AU8A 1TPAE 3SV2H 3RMMH 4X8TH 5EXMA 2BTCE 5E2OA 1ANCA 3R0FA 1O33A 5C5OA 1MZDA 1OX1A 5GPIB 2FDAA 5DP5A 3OU0A 2VWNA 4AYVB 2A4GA 3DT0H 1C4Y2 1ARCA 5TCAA 1VGCB 1O3AA 2C90B 1RGQA 4WWYA 1IQKA 2G51A 4Y6DA 1INCA 2ASUB 4VGCB 3UUZA 4ZUHA 3K65B 4GPGA 2QF0A 1YWUA 1EQ9A 2YNBA 2B5TB 1BRUP 1GBAA 1T8MA 4FETA 3D49H 4M9FA 5C17A 1HAHH 1AGJA 3C27B 1V2KT 2VH0A 4Q7XA 1DWEH 4AG1A 1V2RT 4BXSA 1QGFA 4Q63A 3D23A 4ZKOU 2C8YB 5DSFA 1NC6A 3UOPA 4XOJA 1YCPK 4R0IA 1XUKA 1V2ST 2YMSC 1SGFA 2ANKH 1B7XB 3EYDA 3SNEA 1MTWA 3MU0A 1C9PA 5C0TA 2PW8H 5DP8A 1GJCB 1NN6A 1WQVH 1HJAB 2VH6A 2WV5A 3SUEA 3M7TA 1OS8A 1SQTA 1GBHA 3V12A 4KGAA 4K8BA 4X2VA 4DGJA 2HNTF 2ZFRH 3E90B 1CA0C 2UWPA 3TU7H 4F49A 3SJKA 3A7TA 2VVUA 4J1YA 4CBOA 2FEQH 3PMAB 1TRMA 8LPRA 1C5YB 1CBWC 3MH6A 2RG3A 4NCYA 2H5CA 1HAXB 2XBWA 2VGCB 3BN9A 4AFUA 2B7DH 5HXFA 4DY7B 1C5SA 3E1XB 1RJXB 4UFFH 3A8AA 1MBQA 2PFEA 2C8XB 2ZZUH 3LH1A 2P94A 1C2FA 1TMUH 1QR3E 1QY6A 2ZGXH 4YM9A 2H9TH 2ZFFH 4WXIA 1GCTB 2QV1A 1WSSH 2WPKS 1W7XH 1JRTA 4KELA 2H9HA 2WPMS 3GS9A 1V2MT 4MNVA 1W0JD 5EQRA 4ZH8A 4NWLA 1NROH 1WQSA 3ZYDA 1QTFA 2QN5T 2NU3E 4WMDA 1AE5A 1O2KA 1MTUA 1HAZB 4GHTA 1G36A 2A5KA 1TNGA 3UPEA 4O3TA 4WJG2 3HK3B 4NZLA 2QE7D 3MHWU 2ZTXA 3NXPA 1GI7B 9ESTA 2QAAA 4BAHB 1NESE 5HMAA 1HYLA 3DSOA 3GY6A 5DP9A 1E0FD 2QIQA 2O8LA 1SQAA 4AGKA 5IK2D 2HOBA 5DG6A 3ZV8A 2Z94A 1O2YA 1SFQB 3EA8A 1P11E 2F3CE 4O03A 5GCHG 5GIBA 1O5GH 5JB8S 1BTUA 2O8MA 2FPZA 1AN1E 3F6UH 2C8WB 3RXPA 2EQNA 2QXJA 1FAXA 3I78A 3K6ZA 4CH8B 3EGKH 2IJOB 1VZQH 2L74A 1O5EH 4UEHH 1LPZB 2ZTYA 4MQAA 1EZQA 1S83A 3U98H 3AASA 1BBRE 4MPUA 1F7ZA 5J4QA 1A7SA 3SU3A 3T27A 1JRSA 2GCHF 5JB9S 4O97A 1MQ6A 5I25A 1O3BA 1FONA 1LHGH 1RTKA 2HGTH 1UTNA 1P3CA 4YOIA 1FPCH 4NWKA 2RFKC 2J9NA 1SMFE 1G2LA 2ZO3H 3KYGA 5PTPA 3SJOA 4A1TA 3S69A 3KN2A 2QA9E 4DIIH 3EE0B 1QJ1B 5KGOA 1GJAB 3KQDA 1BCUH 2XWAA 2ZC9H 1O2VA 2ZFSA 3E91A 3LGIA 2Z6BD 2AYWA 4F4OC 2EA3A 2PSYA 5CHBA 1UCYE 3ZZ6A 2ZGJA 2WPHS 3P8NA 3U8RH 3W95A 3FP7E 4X8VH 1TIOA 2UUFB 4MNWA 3NKKA 1ELTA 2O8UA 4ISHH 1FY8E 1PPHE 4CRCA 3GY2A 4AZ2B 3T5FH 1NT1A 3WW7A 3HKIB 4OGXA 3SN8A 3UR9A 1P04A 1KYNA 3OSYA 3SI3H 1GBFA 1BTWA 3M3TA 1E35B 2ZWLH 4FOUC 3VB7A 1C1QA 4NA7A 1OWIA 1TALA 1A0LA 1BA8B 3H09A 1XX9A 4RKJB 1ZHPA 2VVVA 1O36A 1UVSH 2XCNA 3A81A 1C5RA 4JK6A 3UWJH 4JYVH 2QGRA 1GBMA 1ZLRA 2ODPA 3M5LA 3MMGA 3QK1A 4MNYA 3T25A 3TH3H 4GAWA 1GHAG 3FZZA 2I6QA 2FI3E 2G00A 2A32A 1W3CA 3GYMA 1AKSA 4ZXYH 2VIWA 4XE4A 1LQDB 1YYY1 2R3YA 3DFJA 3KQEA 4WH8A 5A0CA 2XC5A 4YXWD 4K60A 1ACBE 4BOHA 3FP6E 3VB4A 1VKYA 2CJIA 4AFQA 1VR1H 5EGMA 2J4IA 3V7TA 1GG6C 5E0HA 3ATKA 1BITA 3W1EA 4YOJA 2CN0H 1TNJA 1W0YH 1Y5AT 1AB9C 1Y3VA 2OLGA 2EI7A 2KR7A 2BD7A 4CRDA 4DVAU 1XUIA 1QURH 2P95A 1V6DA 4I7YH 1JIRA 3MO9A 1YLCA 3ATIA 4Q80A 2VVCA 4RN6A 1MD7A 2F4LA 3RP2A 2F9BH 2JETB 5K0HA 5A2MH 1C5VA 3U1JB 1UTMA 2XNIA 3A80A 4O3UA 1Z7KA 3SYJA 1UTKA 3K2UA 3SW2B 2XC0A 1G30B 2ZFQH 4ISIH 2OCVB 2J98A 3GYLB 1A3EH 3ZYEA 4WMFA 2ZHEH 1F0TA 1W2KH 3UREA 1P9UA 1PQ5A 1LVOA 4B71A 3U1IB 1ELVA 1H8IH 1ZR0A 2QC2A 1LO6A 1Y59T 1GDNA 1QFKH 2KCPA 4OS1A 3SQHE 2OK5A 3ODDA 2BDAA 2PWXA 5ABWA 3KIDU 3A84A 2ZGCA 5DP3A 3A85A 3UNQA 6CHAC 1UHBA 1GJ4H 1GMDG 1HIAA 1V2VT 1GI0A 5HM2A 4P02A 1TPSA 4JZDH 3A87A 4A6LA 1OSSA 5CHAC 4NSVA 1OWEA 4IBLH 1HPGA 2FOBA 5E0JA 1W7GH 3BTKE 1H9HE 1UK4A 5F8TA 1XXFA 5EOKA 2Q6FA 1C5NH 2P8OC 4A1XA 1AWFH 1OP8A 1ZRBA 4ZKRU 2A45B 1L1NA 3BEUA 2VIVA 2RDEA 1MCVA 1SL3A 2BDIA 3NZIA 7KMEH 1IQFA 1DITH 3BTDE 1B0EA 5GJ4B 1C1VH 1PPFE 4INHA 5L2ZH 2K1QA 1QBVH 5C1UA 3RC4A 1KLIH 1QQ4A 1TRNA 1AWHB 2FOAA 1ORFA 1DWBH 2CGAA 1QNJA 4NIYA 1HAVA 4YLUA 2ZDVH 1GHYH 1HFDA 1O34A 5EG4A 5EXLA 4X8UH 3SJ9A 3L33A 4D7GA 2J34A 5F53A 3FOAA 1C2EA 4Z0KA 2OQUA 5C2ZA 2ZIQH 3HPTB 1K1NA 2FIRH 1SG8B 1HAGE 3Q3KA 2Y82A 1EPTB 1Z71A 3T29A 4BTUB 3WY8A 2QCYA 1J9CH 1FY5A 2AGEX 5L2YH 1E1QD 4AGJA 2SGQE 5FBEA 3PLPA 1SLUB 1V3XA 1BUIA 2J94A 4ABJA 1P57B 4JYTA 3A86A 1GHAF 1HAOH 3RU4T 4TPIZ 1WOFA 1O2SA 1A2CH 2KX4A 4LXBH 3RXKA 3RXLA 4CRAA 5JBBS 1ELGA 1DLKB 1FQ3A 4CRFA 3BTQE 1MCTA 2D1JA 4ABHA 1ZPBA 3FFGA 3MWIU 3PWCA 3JZ1B 2ZU5A 1T31A 1OWDA 1QIXB 1ZGVA 2NWNA 2ZDLA 3ZZCA 1D6RA 1GBKA 1OXGA 3UQVA 1NRSH 1GHBF 1C1OA 1ID5H 5EJZA 1Q2WA 4MG3A 5G4BA 5CDFE 2SGEE 2ZQ1A 1CE5A 1H9LB 1ZPCA 1TE0A 3PYHA 3Q3XA 3EA9A 1GI4A 1TGBA 1EZSC 3TNSA 2WPDD 3MI4A 4DG4A 1KXCA 2ZGHA 3OX7U 1MKWK 3OY6U 5HIZA 1AVGH 2ZPRA 3P92A 2ZU3A 4Y0YE 1CQQA 4OS5A 1ZSJA 4F55A 4WXVA 1P2JA 1J17T 3E8LA 3SUFA 4FUIA 1K1MA 1PQ8A 7ESTE 6GCHF 3AW1A 1OWJA 3F9GA 1ABIH 3GY7A 1AI8H 1C1UH 1HLTH 3U28C 2BZAA 3TGKE 4BTTB 1DE7H 1L2EA 1FN8A 3F9HA 3QDZB 1ZSKA 2ZG0H 1K1PA 2GP9B 2Z7FE 1MUEB 3RU4D 1TRYA 3SUGA 2ZHWH 2K0QA 2CHAC 1YGCH 1O3PB 3RMNH 1O2PA 1TONA 4Y7AA 1LDTT 1V2LT 1ZOMA 2KCYA 4HI3A 3EA7A 4ZHAA 1AD8H 1JIMA 2LELA 1RFNA 2J98B 5ESBA 4RSPA 2FLRH 3URCA 1SLWB 1L0ZA 8KME2 1F5LA 2V3OH 3GDVA 3PB1E 4ISLA 2AS9A 3ZVBA 2BZ6H 2ZDMA 1G3BA 2QY0B 1YBWA 1GPZA 2TPIZ 1B5GH 1PPZA 1Z8RA 4Y0ZE 1QA0A 1O31A 3B8JA 5EQQA 2G5NA 5E8EH 4TSFD 3SGQE 6GCHG 1K9OE 4BTIB 3U8OH 4X8SH 1CT2E 1P06A 2CF9H 1WTGH 5F8XA 2HNTE 1QL9A 3AK5A 3OY5U 3RXFA 1ELBA 4FXGH 4Y79A 2BD5A 3URDA 1VCQA 1K1JA 2FLBH 3LJJA 1TNKA 4TY7A 3SHCH 4GSOA 1FJSA 3P8FA 5C67A 2G8TA 3V3MA 3O8RA 2J5UA 3OEHD 4B2BA 1THSH 1GBBA 4A7IB 3F9EA 3LC3A 2VB0A 3M5OA 3NRLA 4AFZA 1HNEE 1HUTH 3MH7A 2GZ9A 1S82A 4VGCC 4ABIA 4ZAEA 2OD3B 3ZZAA 3U8TH 4FVBA 6ESTA 1KSNA 1ELFA 1O3NA 3UR6A 2AIQA 3EQ0H 2WUBA 3E0NB 4ABAA 3SI4H 2L6OA 5A8ZA 1ELDE 3DA9B 4AYYB 3SBKA 2PHBA 2NU1E 1O3DA 3KYFA 3SU5A 5EU8A 1EP5A 1MAYA 1SFIA 3M3SA 4X2YA 1SGRE 3TLOA 3LGVA 3ZV9A 2OP9A 1K21H 2ZI2H 1OWHA 3SNAA 4ZXXH 4ABEA 1TAWA 3SU2A 1KXBA 1GVLA 1O5BB 1HCGA 2TRMA 1XMNB 3PTBA 4IMZA 1NFWA 2LP6A 4NGAH 3RXAA 1GI2A 4INLA 3RXJA 2AGIX 3MFJA 3KHVA 1A61H 2FM2A 1C2IA 3T2NA 1TA2A 4E05H 3UFAA 5C0UA 2F9VA 3QGNB 3RXTA 3RU4E 1CT4E 2G4TA 4UONA 2AGGX 3BEIB 2BB4A 1GI3A 3GCOA 3JZ2B 5FPTA 1P01A 3ZVCA 3WWBA 3MH4A 2OC1A 4UE7H 4I33A 3OTPA 3IG6B 1O35A 2R9PA 4K69A 2WPJS 2XBYA 4NIXA 2BOHB 3Q3YA 3R3GB 2XC4A 5JBTA 1DUEA 3T28A 1D4PB 1ZMNA 2ZA5A 3F1SB 4NFEA 1GJ8B 1LHEH 2KAIA 4U2WA 2SGDE 4AC9A 1COWD 1UK3A 2BMGB 5HKKD 1UTJA 4RI0A 1IQJA 2BD3A 2FI4E 2V6NA 1BMFD 3FO8D 2WYJA 2GDDA 2PUQH 4XSKU 1EKBB 4Q2KA 1T4VH 2FS9A 1DPOA 1QZ8A 2XXLA 1GHVH 4R8TB 2GCTB 5JPMH 2HPQH 1GGDC 1XUJA 4I31A 3ZZ9A 1GMHG 2BXTH 2VIDA 3LGTA 3VPKA 3KNXA 1OYTH 2YOLA 1TWXB 5FXLA 1A5HA 1IHSH 2ZP0H 4AG2A 3SGBE 3TPIZ 5EPNA 1H1BA 1AY6H 3ZZ7A 2F9PA 1SGTA 2QXGA 1TGNA 1C9TA 2EEKA 4XBCA 2GTBA 2ZF0H 1WU1A 1IQMA 3S9BA 2KCAA 2PGBB 2V3MA 1V2PT 3UQOA 1P02A 1ZHMA 1C2DA 2C8ZB 3CP7A 3M35A 4KKDA 3SUDA 3M7QA 5BRRE 2D2DA 4NFFA 1W0ZU 1JMOH 3P17H 3BIUH 3TJVA 1AIXH 1GBCA 2ZFTA 3HGPA 1SQOA 1C2JA 3VB5A 1YCPH 3FN8A 2JH6D 3WWFA 4B2AA 4BAQB 3TH4H 8GCHF 2PGQB 5A0BA 3BG8A 5C20A 1SHYA 3HGNA 1THRH 5DN6D 1GJ6A 1G3DA 4KP0A 3TITA 4KTSA 1BTYA 1ABJH 3TGIE 1TPPA 3DD2H 2B9LA 4NIWA 1EZUC 3KQBA 1UJ1A 2BQWB 1UO6A 3RLYH 1L1JA 3RM2H 1JOUB 2R0LA 1BDAA 1K28D 2XTTB 4B76A 2YNAA 1UVTH 1TBRH 1A4WH 3PLKA 1A0HB 4IW4E 2F9NA 2TGDA 2V0BA 4Y71A 1KIGH 3KGPA 1XM1A 1EPTC 1BMLA 5A8XA 2BQ6B 1HIAB 1BMMH 1V2OT 3OEED 4MVNA 2AH4X 2XWBI 1LVMA 4X6MA 2R0KA 3EAJA 1HAPH 2ILNA 1TOMH 1P2OA 1VCWA 1EP6A 3BTHE 5FCKA 3OE7D 3RC5A 1KLTA 2BXUH 3MYWA 1BBRK 6LPRA 1AO5A 3NWUA 2VWOA 1NO9H 4FUGA 3E16B 4ASUD 3C1KA 2ZFPH 3RXQA 3LONA 5DGJA 7GCHF 1GHBG 2P59A 1WUNH 2FYRA 3F2GA 1O2NA 2F83A 1F0SA 4DIHH 1BRAA 4Y8YA 2BLVA 1CHGA 1MTNC 1T4UH 1YLDA 3ODFA 2A7HA 1HAVB 2HWLB 1DICA 3HATH 3G01A 6CHAB 5ETXA 3ZZ8A 1BT7A 2BY7X 3MU1A 3RXRA 1UTOA 1BMAA 1TBZH 2PTNA 1CHOG 4UD9H 4FUCA 5FL7D 2CK3D 5JBAS 1V2WT 1QBOA 2BVXH 4B6EA 1EPTA 3RMOH 5IYTA 1D3QB 2JETC 1RXPA 1GHWH 2HVYB 1QL8A 1KLJH 1P8VC 1T8LA 2R2WU 1NY22 4RT1A 2ZGBH 1P12E 3P6ZB 5C3NA 2Z9LA 2WPLS 1EATA 3ZIAD 4K2YA 4X1QU 1PPGE 3T62A 1GJ5H 4Y7BA 3PROA 2BD8A 4I8KA 3CS0A 1QHRB 2VIQA 1DWDH 1OYQA 1F92A 2GMTB 4M7GA 1C4V2 2A0QB 1W13U 2GX4A 1SGQE 2KAIB 2BX4A 3GY3A 2GZ7A 4NA8A 2FOFA 3A88A 4YO9A 1UTLM 3VB3A 1EB1H 1FV9A 4BXWA 1XVOA 2J92A 1O2OA 2R3UA 2ZDKA 3LPRA 2QYIA 1TQ7B 1VITG
chains in the Genus database with same CATH topology
3RXGA 1MQ5A 2VWLA 1RTLA 4Y11E 4X0WU 5GCHF 2PR3A 1V2NT 4J2YB 3SV9A 2Y7XA 4MNXA 1DSUA 2GCHG 5E2PA 3PTNA 4A92A 1GJDB 4JMYA 3A7XA 4UFDH 1E38B 1O2TA 1D3PB 1T7CA 1GMCF 3ENSB 3BTTE 1UVPA 2A4RA 4OS7A 4CRBA 1PPCE 3PO1C 3PM3A 1C5QA 2Z9IA 1GI8B 5AF9H 1DY9A 1LCYA 1C5MD 2A2XH 1C1NA 1S84A 3RXBA 1ELEE 1SI5H 4H6SB 3QGJA 1JBUH 1GMHF 1BZXE 1H9IE 2RCEA 2XW9A 1P09A 3Q76A 1T8NA 1YPEH 1HBTH 1C5WB 1FPHH 3STIA 1Z6JH 1MTSA 1BTPA 1EOLA 3A83A 3QTVH 2W3KA 1MU8B 1Z6EA 4CR9A 5EXNA 1G9IE 2F9UA 2H6MA 2VIOA 1J8AA 2G81E 3ZZBA 1WTHD 1XUHA 2AMPA 1O5AB 1EXFA 2BD2A 2ZHFH 1YKTA 2ZDAH 3HKJB 2G4UA 1Z8IB 2VIPA 1IQIA 3O8BA 1TYNA 2VJ1A 2FOEA 2SNVA 1Y3XA 2A31A 2DE8A 3D62A 4XFQA 2ZQ2A 1NZQH 1T32A 2ZCLP 3MNXA 3GY5A 1FXYA 1C2GA 5FX5A 1QQUA 1GVZA 1L4DA 1OOKB 4CH2B 2JKHA 2ZHQH 2I6SA 4Y10E 5B6OA 3UWIA 2O9QA 2ZEBA 1CSOE 2NU4E 4LK4A 2D26C 1TNHA 2HVXA 4K1TA 1G37A 3U9AH 1N8OB 1ZGIA 2PLXA 2FS8A 1C2HA 1FLEE 2VINA 1FIZA 1P2IA 2SFAA 1BMNH 1J16A 3GCNA 3RDZA 3SNBA 1C5TA 5DPAA 5ESTE 5T6DA 1QL7A 1QRXA 3MNBA 4MTBA 3H7TA 3A89A 1BJVA 1GBEA 1FY4A 1GBDA 1YPJH 5DP6A 5L6NH 3FAOA 3STJA 5LPRA 1C4U2 1O2IA 1GCTC 2GV7A 4TWYA 1FAKH 1O2XA 4IN1A 4FU7A 1SBWA 1K1LA 1GGDB 3O8DA 4ZHLU 2QXIA 3RXMA 4GLYA 4Y8XA 1SOZA 5AFYH 4E06H 1FY1A 1PFXC 3GISB 2P3TB 3M61U 1NPMA 2FMJA 2ODQA 1RD3B 3RXUA 2EI6A 3P8GA 3QN7A 1XXDA 1ZTKA 4YT7H 1TOCB 1DXPA 3FZDA 1O3OA 1AKSB 4TY6A 3PV4A 5HM9A 1IAUA 2W7UA 1PQ7A 4NSYA 1CA0B 2FO9A 4ABDA 1BTXA 3E3TA 2EI8A 2M5TA 1BRCE 1SB1H 1HRTH 1Y3YA 2PKAB 5IDKA 1NFUA 3LOXA 1LVYA 2P3UB 1KXEA 1A46H 1DXWA 3SU1A 3QO6A 1MKWH 1UVUH 1FZZA 2A7CA 2RA3A 2VGCC 1A0JA 3S9CA 1CBWB 3A8DA 3SJIA 2WPIS 1ANBA 1DM4B 1O2WA 1ELAA 2BM2A 2OUAA 2G5VA 4U32A 1DVAH 2QXHA 3LU9B 2FI5E 5GXPA 1IQLA 1N6XA 5FBIA 1JXPA 3RXDA 1N6YA 4XBDA 1KDQB 1Z8JB 3M5MA 2FTMA 1ZZZA 3RLWH 4LZ4B 5GDSH 1TLDA 2C93B 4I8HA 2BD9A 4K8YA 4AFSA 3NK8A 5J4SA 5TCCA 1VJAU 4B1TA 1ZTJA 1H4WA 3B23B 3PMHB 1KY9A 5C5NA 2GDEH 2C4FH 4IC5A 3E6PH 2FODA 1VGCC 4ABGA 2CV3A 1IQNA 1ZMLA 3BTFE 2FP7B 2XCFA 3IITA 4GCHG 2FX4A 4DOQA 1O2RA 4MPXA 3SV8A 5EW2H 2ZECA 3RXCA 4Q7ZA 4KTUA 1CU1A 4XBBA 1TX6A 1TGTA 1M9UA 2TIOA 3S7KB 3Q00A 4A1VA 4YT6H 5DP4A 1LKAA 1BTHH 1W10U 2ZU1A 1F0RA 1ZRKA 4GHQA 3LIWA 2WV4A 4DCDA 2ZPSA 4ISOA 1WCZA 5F8ZA 5H4IB 4AORA 2P16A 3D65E 3TK6A 3GY4A 1O37A 1ESBA 4I8JA 3OYPA 2W26A 1DLEA 1QA7A 1S6FA 4I32A 1WAYB 5DK1A 1F2SE 1GBJA 4K1EA 3CENA 1KXDA 5CE1A 2BOKA 3LJOA 3UY9A 3VGCC 3VB6A 1AUJA 3P8OA 5FHTA 1O3HA 5DO4H 1HAIH 1O5CB 3SNDA 3BF6H 5JDUB 2SGFE 4D9RA 1YPHC 3AVZA 1O3GA 1AFEH 4WVPE 4DURA 3FANA 4X1NU 1GVKB 3S0NA 1G3CA 3UOUA 1BTZA 3DUXH 5C1YA 5F6MA 4D9QA 1ZPZA 1UCYK 1C5OH 1KTSB 3GICB 1O0DH 4U01A 1O2UA 2NU2E 3ATLA 1LPKB 1UTPA 3A8BA 1RIWB 2AFQB 2H1UA 4DT7B 3MH5A 3GOVB 3VXFH 5C1XA 3QUMP 2PSXA 3CS7A 2Z3EA 2Y80A 2GD4B 2Y5GA 1FDPA 2CHAB 2TGAA 2A2QH 3SOSA 2HRVA 1SGIB 1O5FH 2FX6A 4IMQA 4JYUH 3TVJB 3MO6A 1EJAA 1D3DB 4GVUA 1UK2A 3MU5A 1BJUA 5HYOA 1C1RA 1TMBH 1UCYH 2F9OA 2IN2A 4NIVA 1ZHRA 4JZIA 2H5DA 3A82A 1D3TB 1SLVB 1P2KA 2Y81A 1EOJA 3RUOA 3VGCB 4ZMAH 1DANH 2EC9H 1FUJA 3GY8A 2UWLA 1MH0A 2ANYA 4DW2U 3MTYA 1IOEA 5CMXH 1EJNA 2BLOA 3RM0H 2GT8A 1KDQA 5TJXA 4MPVA 1LHFH 1XKAC 1QRZA 2VNTA 2AMQA 4FU9A 4AB8A 1O30A 1GMDF 1YPKH 4PROA 4K5ZA 3SU0A 3EDXB 5FX6A 4WF8A 4TWWA 2JH0D 3ZZDA 2LNCA 3H7OA 1BBRH 2ALPA 4UFEH 1F0UA 1PQAA 2BLQA 3VFEA 2HPPH 1F5KU 1NRPH 1OP0A 2CMYA 3H5CB 4QT8C 1SOTA 1XVMA 3V0XA 3UNSA 3ZVFA 1S0QA 1E34B 4MPWA 4UFGH 2ZU4A 3MU4A 2XRCA 2XYAA 1NRQH 4ASHA 3NUMA 1WYKA 1K1OA 3B9FH 1O39A 2V35A 4H42U 2BLWA 1HGTH 3TNTA 1GHZA 4D7FA 1FY3A 1CGJE 4IS5A 1SGFG 3MU8A 1FMGA 4ISNA 2AIPA 1SGNE 3QLPH 4ABFA 1EZXC 5HGGA 5FAHA 4HTCH 1AFQB 4LZ1H 1BHXF 1K2I1 3ATMA 3NPSA 4JCNA 5EQSA 1QB1A 4LOYH 1DT2A 3M3VA 4E7NA 3RXSA 3LT3A 5EPYA 3TJUA 2BHGA 2XBVA 1K1IA 1VCPA 2SNWA 5DKMA 1ETSH 1AZ8A 3RXHA 1YPGH 2AMDA 2BDGA 1BB0B 1CGHA 4JZFH 2A4QA 3QZRA 1PPEE 2V3HH 1TA6A 4BAMB 2OC0A 5K7RA 3M5NA 1Q3XA 1SSXA 2PKSB 4CR5A 3P95A 5LGOA 1TB6H 2WYGA 1VJ9U 1B0FA 3AAUA 5LH8A 4MLFB 1LKBA 4DJZB 5F03A 3BSQA 2TGTA 1J14A 3QWCH 5T3HA 1C1TA 5T6FA 1RS0A 1Y5UT 2GKVE 3KF2A 3A7YA 1O3MA 1YPHE 1J15A 4YTAA 4TYDA 3PMBB 3F68H 3M7UA 1A5GH 1ESAA 4JK5A 1P3EA 2JH5D 4D8NA 2P8OB 1GI1A 1SVPA 2A1DB 2OINA 1CVWH 1TMTH 2THFB 2Z9JA 2CF8H 3SQEE 3M37A 1GWAA 3RXEA 4CHAB 1FI8A 4A5TS 4GCHF 1AB9B 1ZJKA 4GUXA 4X1SU 1NM6A 4H6TA 1Y5BT 1GG6B 2FWWA 3MNSA 1JWTA 3ZVAA 1C5LH 2ZDNA 2Y7ZA 7LPRA 2SGPE 3LH3A 1FN6A 1AMHA 5LPEA 1S5SA 1AUTC 1NTPA 3GDSA 3GCTF 2ULLA 1GBIA 2BY5X 3AW0A 1EB2A 1OWKA 1C2LA 4CRGA 1TGCA 1SR5C 2FXRA 1K22H 4AB9A 3T26A 2ZTZA 5AFZH 1LQEA 1OPHB 5DP7A 1TBQH 2IOTA 3SGAE 1YF4A 4CBNA 3SO3A 1SC8U 1HXEH 1EJMA 3LGYA 1Z1IA 2FOGA 1TNLA 1QB9A 1H8DH 4FUHA 1MAXA 4JZEH 3RXOA 1N8OC 2STAE 1GBLA 1BQYA 1DOJA 1SGEE 1V2JT 4BAOB 4ZHMU 2OQ5A 1UTQA 3KQCA 5FPYA 3ZVEA 3AAVA 1HB0B 3GCTG 3ZVDA 1O3LA 1YC0A 3BG4C 1QCPA 2TGPZ 4AX9H 1AZZA 4BANB 3MO3A 1QBNA 3SV7A 1PPBH 3E0PB 1GDQA 3L6PA 3BV9B 1ZJDA 3PWBA 1O32A 4JZ1A 1VITF 1NFXA 3DHKH 2B8OH 5CHAB 4ZKNU 5L30H 2C3SA 2J38A 3PO1B 1ZMJA 3OTJE 4AOQA 1L1GA 1IQGA 2RDLA 5EODA 1AE8H 1BOQA 4Y76A 2WUCA 4OGYA 2WINI 3SORA 2UUKB 2FESH 4FU8A 2ZU2A 1P2NA 1D6WA 3W94A 3RC6A 1A3BH 3DFLA 1P2MA 1TX8A 1KTTB 2ZPQA 4HGCA 4HFPB 4X1RU 4BNRA 2LPRA 1MZAA 3VEQB 4ABBA 3IWMA 2Z3CA 1GJ7B 1NRNH 1P03A 1DWCH 1ETRH 1TQ0B 3RXVA 1W11U 2J95A 1W12U 1SGDE 3BIVH 1YPMH 2W5EA 2AEIH 3QTOH 4SGBE 1LHCH 1TGSZ 1NS3A 3LGWA 1GL0E 3BG4B 2FYQA 3LDXH 1T8OA 2PTCE 1GBTA 4ESTE 1EAXA 1YP9A 2Y5FA 1GI6A 1EAWA 2PKAA 2ODYB 2BD4A 4K1SA 1GHXH 1NFYA 1CO7E 4IC6A 1E36B 2W7SA 1KXAA 1O2MA 3LKWA 4Q7YA 2HALA 1V2TT 2BDCA 4MDSA 3A8CA 1HV7A 1LTOA 5I46H 5A0AE 1DUAA 4OS4A 1Y3UA 1IQEA 2GT7A 2Q6DA 1O2HA 1LMWB 2PUXB 3I29A 1E37B 3RMLH 2OC7A 1HJ8A 1TPOA 2OC8A 4FUEA 2ANMH 4X6OA 2H2ZA 1DFPA 1D9IA 4WMEA 1YM0A 1S81A 2G52A 4X1PU 1ESTA 1PJPA 2A5IA 3ELAH 2FOCA 1DSTA 1QB6A 1P9SA 1MTNB 1Y8TA 3TJOA 3NCLA 2BY9X 1C1MA 1EUFA 1MD8A 1PYTD 2GMTC 2GV6A 1O2ZA 4I8GA 1DX5M 3SNCA 4O9VA 2GCTC 4WH6A 1PYTC 1C2MA 3SJ8A 1G32B 1ELCA 1AVWA 1BIOA 4YOGA 1UVOA 5A09A 1S85A 3SV6A 2O8TA 1C5XB 1EASA 3BEFB 2PV9B 1NU7B 1Z8GA 3TJNA 5T6GA 3O8CA 1C5PA 1RIWC 5BPEA 3QZQA 1GMCG 1DY8A 3LC5A 3SZNA 2BVSH 1C1WH 2BYAX 2BDBA 1P10A 5EW1H 2DE9A 5GWZA 1CGIE 3QX5H 1AHTH 1BRBE 3P70B 3SU4A 1O3IA 2FZZA 1TFXA 2Q1JA 3UTUH 1OKXA 2PKSC 2A7JA 4YZUA 2Z9GA 4TPYA 1AQ7A 1Q31A 3HK6B 3BTWE 4CREA 4SGAE 1TX7A 1MTVA 5E0GA 1C1PA 4E7RG 3A7WA 1W8BH 2TBSA 5SGAE 4ZROA 3PMJA 1N1LA 2AERH 1GDUA 4YESB 3K6YA 2ESTE 2GZ8A 4K3JA 2G55A 3TK5A 1O3EA 4D76A 1TABE 3RXIA 1HDTH 1WV7H 2OBOA 3PLBA 3MNCA 4B75A 1SHHB 5LPFA 1MBMA 2FOMB 3TGJE 3FVFB 4FUBA 2Q6GA 1HJAC 1GJ9B 1S6HA 1FNIA 1O2GH 1RTFB 2UWOA 2UUYA 3A7ZA 3ITIA 1QJ7B 1KXFA 1S0RA 1G3EA 2STBE 3S7HB 4B2CA 1RRKA 1SLXB 1YCPM 2Y5HA 1O5DH 2BDHA 3ESTA 3KL6A 3U69H 4WY3A 3ZZ5A 1O2LA 1EX3A 2A4OA 2F91A 2ZCKP 3TIUA 1MMJN 2OBQA 1GI9B 4B74A 1O3JA 1X7AC 3VXEH 3SHAH 1ZTLA 3KEEA 1A5IA 1NRRH 1ZYOA 2OXSA 2UUJB 3S9AA 9LPRA 1DDJA 3GDUA 1CHOF 3BTME 2IPHA 4YLQH 4I8LA 4UDWH 1AFQC 1TNIA 3I77A 3TH2H 4BAKB 1QJ6B 1GCDA 1QRWA 2B0FA 1FIWA 1OP2A 1THPB 1GI5A 5DJ7A 2OTVA 1U6QA 4NG9H 2BVRH 3L3TA 3BTEE 1O38A 4X6NA 1ANEA 4FUDA 2FOHA 1O3KA 1SGYE 1IHTH 2ZHDA 2ALVA 4FVDA 2ZNKH 4IN2A 3Q77A 2BQ7B 3ZZ4A 4INKA 7GCHG 2P93A 3N7OA 3ZZ3A 1GJBB 4OS6A 1EAUA 1LVBA 3UNRA 1SGCA 2BY8X 1LPGB 3KCGH 1P0SH 2P3FH 2FTLE 4FUJA 3A7VA 1HJ9A 5AVDA 8ESTE 3LGUA 4H4FA 4KTCA 4CHAC 3K9XB 2Y6TA 1HXFH 2BDYA 1BHXB 3FP8E 2O8WA 2ZKSA 3SU6A 1L4ZA 4X2WA 4U30A 1O3CA 4Z6AH 4ZKSU 3M36A 3ZVGA 2NU0E 1CT0E 1EAIA 1WBGB 2XBXA 4NZQA 1O2QA 1IQHA 1ETTH 2GVFA 4RKOB 1Y3WA 2Z9KA 1LHDH 1XUFA 1V2UT 1YPLH 3BTGE 2BY6X 2R2MB 1AVXA 2Z3DA 3GCHC 2QF3A 1C5ZB 5AHGH 1HAYB 2HLCA 4OS2A 5FPSA 3GCHB 4X6PA 2D8WA 1F5RA 1DS2E 2DUCA 4THNH 1O3FA 4IGDA 1MU6B 1NU9A 1CA8B 2SGAA 3UIRA 2A5AA 5JYIA 1ANDA 1XKBC 1ARBA 8GCHG 3TK9A 3V13A 3F9FA 4FUFA 1C2KA 3ATWA 5A8YA 2BX3A 4X2XA 3MOCA 2VWMA 1UMAH 2H9EH 1MKXH 1C1SA 2J2UA 2VU8E 4AN7A 4B73A 1UHBB 1ZSLA 1Z1JA 2ZCHP 1V2QT 1GL1A 4NA9H 4XDEA 2ANWA 2GGVB 4HZHA 1VITH