1TNLA

Prediction of novel serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA02
3LKWA 4GSOA 2CN0H 3RMMH 1Z6EA 1F5LA 2SGPE 4NIYA 2ZQ1A 3RM0H 1EP6A 1EPTA 1TQ0B 1WAYB 3KQEA 2NU4E 1O33A 3A87A 1MTVA 2BY6X 3GCHB 3P95A 1GJ5H 5BPEA 5C1XA 1O2JA 2ZFSA 3OU0A 3P8NA 1Z71A 2SGFE 2VVVA 1O2PA 3LGTA 1CBWC 2VWLA 1HV7A 1ELGA 3RMNH 1AN1E 3Q76A 1ELCA 3TK6A 2WPKS 4NCYA 2GGVB 3A88A 2FS9A 3TPIZ 2P59A 1FJSA 3GCTF 1BTUA 3PTBA 1UVSH 4FUHA 1SGRE 2CMYA 3GDUA 4B2CA 3UUZA 2XWAA 2A4GA 4ASHA 1TGSZ 1A61H 3SV6A 1QFKH 3SV2H 1M9UA 3EDXB 2IN2A 2FOGA 4AX9H 3MFJA 2FX6A 4DCDA 2CXVA 3SHAH 1WSSH 1HRTH 2PSXA 1P57B 1P01A 2GCTB 4WH8A 3M5LA 5EODA 4NG9H 1O5DH 1NY22 4D9RA 4UONA 1MQ6A 1XX9A 4K8YA 4MPWA 2FI5E 1S6HA 2ESTE 1HYLA 2CJIA 2G5VA 1HXEH 2FOEA 1O2TA 1Y3VA 3KEEA 2Y5HA 2BVXH 1TBZH 3P17H 3TGIE 3O8BA 3Q3YA 1OYQA 5EQQA 2QCYA 3A84A 1T4UH 1HDTH 1EAIA 5GCHF 1G3DA 4B2AA 2Z3EA 1G3BA 1MU8B 1LQDB 5JBCS 3TK5A 2ZPSA 2EEKA 2FTLE 4NA7A 1F7ZA 2M5TA 2XCFA 2ZU3A 3RXLA 2UUKB 1IHSH 1C2JA 1XUGA 1KXFA 1T7CA 2TGPZ 2OBQA 4AFZA 1GBAA 2BDHA 2GMTC 3E91A 2F9VA 1BJUA 1S84A 4F49A 2VNTA 1P09A 1A0LA 8ESTE 3CENA 3NKKA 1ZYOA 1GDNA 1HAYB 3D65E 3LT3A 1RFNA 1SHHB 4XBCA 1GBJA 1HB0B 2G8TA 1L1JA 1QCPA 2BZ6H 2C4FH 3UR6A 4JK5A 3SJ9A 2QA9E 1A0JA 1B7XB 1W0ZU 5FXLA 1TONA 1CHGA 4TPYA 2Z3DA 3A7TA 2W3IA 4YM9A 3MO3A 2G5NA 1AE5A 2Z3CA 4INHA 5IYTA 1C1RA 4MNVA 1EP5A 2P3UB 1SG8B 2O8WA 1TAWA 1KXCA 5HXFA 1SQOA 1C1QA 2FIRH 4Y7AA 4A7IB 2R2WU 1S0QA 2OQ5A 5FCRA 4IS5A 3KQCA 3S9CA 1EXFA 1V2NT 2AFQB 1HGTH 4DT7B 1PFXC 1WU1A 1ESTA 2PLXA 4IMZA 4DY7B 1GHAF 1OYTH 5LGOA 2P16A 1TPOA 2XC4A 4Q7XA 1SLWB 1VITH 4WWYA 1ANBA 4B76A 1OXGA 1XKBC 4Y10E 5F03A 2DE8A 4CRAA 3D62A 3SNBA 3UIRA 4MPVA 2VGCC 1LO6A 1V2PT 3BG4C 1MMJN 1GBTA 1GMDG 3SUDA 4BAQB 4F4OC 3GCHC 1GHBF 1EPTB 1Z7KA 4K69A 3QDZB 3M5NA 3UQVA 1KTTB 5J4QA 5DP8A 1V2VT 1MTSA 1O3CA 1LDTT 1O3GA 1C5WB 2Q6DA 3ZVCA 1GL0E 3E8LA 4AB8A 1ELFA 1Y3XA 2H5DA 3I29A 1SGPE 1RGQA 4JK6A 3PTNA 1C5NH 5DGJA 2FOFA 1DITH 4CH8B 1O34A 1ESAA 1C5QA 2B7DH 3Q3XA 3MH6A 3BTFE 1L4DA 1K1NA 1V3XA 1TOMH 1C5YB 1GHZA 3MU4A 1J17T 1O2NA 3SU2A 1GL1A 3T5FH 3QN7A 3LGYA 1WOFA 7LPRA 4IMQA 1QTFA 2A1DB 2ZU5A 2THFB 1DSUA 4ISLA 1OP8A 1FN8A 2HPPH 1Q3XA 1MKWH 1QA0A 2V35A 4CBNA 4MVNA 3ODDA 1O2MA 3A7XA 1H4WA 4AGKA 4CHAB 5H4IB 1MH0A 1ESBA 1P8VC 5FAHA 4D7GA 3PMBB 2NU3E 1SGNE 2C8XB 2PFEA 3HPTB 2GDDA 4WMEA 4AFQA 3BEFB 3B9FH 1V2MT 1TPPA 1EOLA 1SHYA 1MZAA 1AMHA 5GDSH 2BYAX 1YPHC 1BTXA 1VITG 1YPLH 4ZKRU 2WPLS 1G32B 3ZVGA 1BDAA 1PPBH 4AG2A 3RXMA 2BD3A 1PQ5A 3SGBE 5TCCA 5DG6A 1EAWA 1F5RA 1G2MA 2R2MB 2PGBB 3ZVFA 4LXBH 1ELEE 1SFIA 4Y8XA 2ZTXA 1HJ8A 1QBVH 1UTKA 1LHGH 4ABFA 4I8GA 2BTCE 3ITIA 4LOYH 1Q31A 4LK4A 1WTHD 3V12A 1S83A 3TLOA 1C1NA 1S81A 1DWBH 2FP7B 3E0PB 1EJAA 2HNTF 5ESTE 2BOHB 4TPIZ 1FV9A 1GPZA 1QB1A 1T8OA 2XC0A 1A5IA 1NTPA 1YYY1 5E0HA 1VJAU 2QF0A 1DVAH 5HM2A 2VIOA 2BDGA 1VGCC 2ZDNA 1JBUH 1PPCE 2BVSH 1ZTKA 1XXDA 2CF8H 1XUFA 1P2MA 2ZG0H 1GMHG 2OUAA 3S69A 4ISNA 2HWLB 1YCPH 4BXWA 1G9IE 2XRCA 4NA9H 1IQHA 1BIOA 2JH0D 3MNXA 1N8OB 5EXLA 2A7HA 3JZ2B 1QL8A 3V13A 1FQ3A 1W7XH 1IQIA 5JYIA 1MQ5A 4XE4A 3S0NA 4Y8YA 3SGQE 1BTPA 3EAJA 1O5FH 2VVCA 3V0XA 9ESTA 1ZPZA 2ZTYA 4XBDA 3U1IB 1QL7A 1VCQA 3DT0H 2ILNA 1P9SA 1JOUB 1TMUH 1TMBH 2BD9A 2VU8E 3HATH 5C20A 3FFGA 2F9OA 2G4UA 4MPXA 4SGBE 1C1VH 3DA9B 1C5RA 1P06A 2ALVA 5IDKA 2ZCLP 1D3TB 4OS7A 2PSYA 2UUYA 4WJG2 4YLUA 1DWDH 1QURH 1DWEH 1SQTA 3DHKH 4CR5A 2ZGJA 3L6PA 1E35B 1UVPA 2FYRA 4HI3A 5AF9H 1AVWA 3AAUA 2BY7X 3SJIA 2BVRH 2PHBA 1SVPA 2AIQA 2LPRA 1AO5A 1P2NA 2WV5A 3UWJH 2BY8X 5CHAB 5E8EH 3W95A 4GCHF 3AW1A 2UWPA 1Y5BT 1YLCA 1Y8TA 2ZIQH 1ANCA 1EAXA 1V2UT 3SUEA 4O3TA 2PTNA 1LVBA 2HNTE 3SW2B 1NT1A 1BMLA 2FM2A 4O97A 2WPHS 1RTKA 1QGFA 3C1KA 5PTPA 4B73A 1DOJA 5EG4A 3V7TA 2WYGA 4I33A 4JYUH 1KDQB 1O0DH 2O8MA 2BDIA 2FDAA 1EZSC 4JZDH 1BJVA 1O5GH 1ZHPA 1K2I1 1HIAB 1GBDA 3A82A 3TH2H 2FTMA 4TWYA 2CHAC 3ZZDA 1BOQA 4A5TS 4CRFA 1AUJA 4Q80A 1O3OA 5EU8A 1AZZA 1XVOA 1O5CB 4PROA 1G37A 2XWBI 1O3PB 1BB0B 2XBXA 1UTPA 2JH5D 1LQEA 3SU6A 3MU5A 1UTJA 4X8VH 1F0SA 2PW8H 1VITF 2IOTA 3M35A 2EI7A 2R3YA 1RIWB 2ZO3H 3ZVDA 5GWZA 2JETB 3B8JA 4X1QU 1FI8A 1AD8H 3MHWU 2VIWA 1FDPA 5F8XA 4OS4A 1GVLA 2BY5X 3UNSA 2WPMS 1GBCA 1GJ9B 3F9GA 3A8AA 5L6NH 1XUKA 3TJOA 2ZDKA 2C8WB 3VGCB 3ZZ7A 6ESTA 1GI4A 1ELVA 1Y3UA 3I77A 5GIBA 2ZI2H 3RM2H 4JZFH 2ANKH 1ELTA 3TGJE 1X7AC 2A32A 2SGDE 1OWDA 4X6MA 1FLEE 1K22H 4DOQA 1YP9A 2ZNKH 1IHTH 2A4OA 4I8JA 1HAVB 1GHAG 2ZHQH 1L1NA 4AYVB 1KYNA 2UUFB 2BD4A 1SL3A 2A2QH 1W11U 2RA3A 4I31A 1JMOH 1CBWB 3LC5A 1GJ8B 4FUBA 4THNH 3FP6E 3BTEE 2R0LA 2R0KA 7GCHG 2GCHG 2ZHWH 4YT7H 3UFAA 1S6FA 1C5MD 1SI5H 3BG8A 3UR9A 1BHXF 1TBRH 1P2QA 2NU0E 3UPEA 2PKSB 2OC1A 1GJBB 4ZKNU 1BITA 1O3AA 2I6QA 4NSYA 4BAMB 1S82A 1CT2E 2AERH 2BDYA 1O3EA 4DW2U 1WCZA 3VXFH 4CRBA 2A7JA 2BQ7B 2CV3A 1GHBG 1K1IA 2EI6A 2Q6GA 3RXHA 1OPHB 2FI4E 3AASA 1TNGA 4MNXA 3UWIA 1E36B 2BDBA 1QB6A 2PKAA 1Z8GA 3ELAH 2BXTH 1NESE 5EPYA 5T6GA 4X6OA 1PPGE 3G01A 4IC6A 1C5XB 4WVPE 3GY2A 5F8TA 1FY4A 1QJ6B 4X8TH 2BDCA 2H1UA 1C2LA 3MO6A 3SJKA 3DFJA 1ANEA 1C2HA 1FPHH 1HUTH 2W26A 1BUIA 3KF2A 1YM0A 1SGCA 5JBBS 3M3TA 3P70B 2Z94A 1E34B 2J94A 2SFAA 1C5TA 3Q77A 4YO9A 1UCYE 4CRGA 3SBKA 3IITA 1DLKB 4Y11E 1O2UA 2ZEBA 1QY6A 3MU1A 3SOSA 1TABE 1ELAA 8GCHG 1FZZA 4KTSA 2F9NA 3TJUA 1J14A 1E37B 4BNRA 1YF4A 3H7TA 1GCTB 2AGEX 4HFPB 2F9BH 3L3TA 2HGTH 4IN2A 4KTUA 5JB8S 4A6LA 1OSSA 3RC6A 3QWCH 3M7QA 2D8WA 3BEUA 3OX7U 1ELDE 2C8ZB 3CS0A 1SB1H 4VGCB 5A8YA 1F0UA 3A7YA 4U01A 2TPIZ 1V6DA 1AWHB 1KY9A 2PGQB 4AOQA 2OQUA 3SNCA 1PYTC 1YCPM 1N6YA 3ZYDA 3T27A 2SGEE 2BX4A 2ALPA 2O8UA 3A85A 5A0BA 4X2WA 1CHOG 2HOBA 3LJOA 1AKSB 1PPEE 4FU8A 3IWMA 6LPRA 1GJAB 1SLVB 2ZWLH 2BD2A 3SI4H 4BANB 2Y80A 1C5OH 2A2XH 3PROA 4NZQA 5GCHG 2FOBA 2FZZA 4OS6A 3VFEA 1ZRBA 3BTKE 1H9LB 1C1UH 1FAXA 1W8BH 2QXJA 3R0FA 4NGAH 2AEIH 3T25A 3P92A 1O2OA 3A7VA 5LPEA 1P2OA 4K1TA 4I32A 1AU8A 2XBYA 2ZTZA 4AN7A 3PMHB 3FANA 1OOKB 5B6OA 4BXSA 5EQSA 1BRAA 4AYYB 3UY9A 1AIXH 1LHFH 1V2ST 2QGRA 2OP9A 4K1SA 4GCHG 4KELA 1DWCH 2FPZA 4O9VA 5EOKA 1DY8A 3TITA 1GI9B 4WF8A 4DGJA 1TGNA 1GI7B 1ZPCA 1EOJA 1HIAA 3M37A 1Q2WA 1CGHA 2WINI 3LJJA 3KL6A 1ZMLA 2FS8A 1YC0A 3T62A 1W2KH 2D2DA 2FI3E 1PQAA 4MPUA 2AMPA 2QN5T 2ZDMA 1BZXE 3VEQB 1GDUA 1YPMH 2NU1E 1ZOMA 1GBLA 3I78A 4RN6A 1LPZB 1HXFH 1TB6H 1NN6A 3KN2A 3ZZAA 2ZFRH 1IAUA 3QGJA 4K60A 3ZZ5A 1GMCG 2BHGA 1DXWA 3TU7H 1O2YA 2BM2A 1NFYA 1C9TA 2BLQA 2TBSA 1C1TA 2WV4A 2J4IA 4INLA 5LPFA 1GJDB 3RXFA 1TGBA 1F0TA 2FXRA 1W14U 2J2UA 1OWJA 4HGCA 4IN1A 4B74A 2QXIA 3BV9B 1O2HA 2ZC9H 4TWWA 1E38B 2GTBA 1ZSJA 2W5EA 1UCYK 1CA8B 1O30A 3U98H 1MKXH 1L2EA 3ENSB 1K1OA 3EA8A 5JDUB 2QXHA 3BIVH 4FVBA 4QT8C 1QJ1B 5DJ7A 1F2SE 3P6ZB 1GJCB 1GWAA 2ODQA 4FUJA 4WXVA 1UK3A 2RA0A 2J92A 1O2RA 4KGAA 5HYOA 2ZGCA 1XVMA 2CF9H 3A80A 1O3KA 4CHAC 3F9HA 3BSQA 3RMLH 1S85A 1TNHA 4CRDA 1B0FA 1KLJH 1T32A 4H6SB 1C5UA 1AI8H 3T29A 1TNLA 2ODPA 5G4BA 3M61U 2Y7ZA 3FZZA 2A5AA 3K65B 4H6TA 2F3CE 1F5KU 1O32A 1CA0B 1DDJA 2FEQH 1Y3YA 4X2XA 3FZDA 2FOAA 2BLOA 1CU1A 4JCNA 1GHWH 4KTCA 3M36A 3GY5A 1GBBA 1ZLRA 3ODFA 2G51A 1RTLA 1MU6B 1Z6JH 4D7FA 2GV6A 1KXAA 1P02A 1BMNH 3VB4A 1O3BA 2OC7A 1WQVH 3SGAE 4B71A 2ANWA 4YESB 1TPAE 2DUCA 3EGKH 3RXUA 2G55A 2XTTB 1UCYH 1DUAA 4K2YA 3RXCA 1LVOA 1Y5UT 3LH3A 3RXAA 4K3JA 5LPRA 1QIXB 1UVOA 4VGCC 3Q00A 5JBAS 2Y81A 3GYMA 1O2VA 5C5NA 1XUJA 4A1XA 4CR9A 4X1RU 1ZHRA 2H5CA 1HJAB 2O8TA 3PB1E 4Y0YE 2KAIA 3RC5A 1TPSA 2ZCKP 3QTVH 3GISB 3LH1A 1BTHH 1XUHA 5FBEA 2ZU4A 5SGAE 1T8MA 5HM9A 3E6PH 1MTUA 1W13U 4R0IA 4YOGA 2EC9H 2NWNA 2Y82A 3FP8E 4Q7YA 4D9QA 1A1RA 4IW4E 5FBIA 3RXPA 1TRNA 2VB0A 1C2MA 1GHYH 1SGYE 1O2LA 7GCHF 4K5ZA 5FPSA 1H8IH 1LKBA 2HPQH 4MQAA 4ZMAH 2G00A 1O3FA 2YNBA 3K9XB 1MBQA 4BTUB 1DS2E 2K1QA 2AS9A 1D3QB 2WPJS 3AW0A 2ZFTA 3S9BA 3RUOA 1UHBA 2WUCA 1UO6A 4LZ1H 2PR3A 2B9LA 1FXYA 4WMDA 4I8KA 4X8UH 3SU0A 3BF6H 3L33A 5A0CA 1IQKA 2ZGHA 4ABBA 4UFDH 4XOJA 3RU4D 4A1TA 5GPIB 1ZTJA 3SNEA 4Y0ZE 4BOHA 4CRCA 1P12E 1P9UA 2A4QA 3GY3A 3MTYA 2OXSA 1TNIA 4FXGH 1SGDE 3U1JB 2EA3A 1A3BH 3LGUA 9LPRA 3ATIA 4MTBA 1QHRB 1LHCH 1G3CA 1KDQA 1TALA 5C1UA 1KIGH 2G52A 3NZIA 1JIRA 1L0ZA 1PQ8A 2RCEA 2TGDA 1QL9A 1AWFH 2GZ9A 2HVXA 3SQHE 4ZHMU 1G2LA 2ZDLA 3STIA 2D1JA 2QV1A 2ULLA 3NXPA 3TNSA 2A5KA 3OY5U 1ZSLA 2G4TA 3SO3A 3AVZA 3DD2H 1H9HE 2H2ZA 1O2KA 2AH4X 1O3IA 2XBVA 3QTOH 4ABEA 1MD7A 5T6FA 3EA7A 1NFXA 3RXSA 3U69H 4ABIA 1BHXB 4ZKOU 1RIWC 3ZVBA 4BTTB 1S5SA 4HZHA 2ZPQA 1HCGA 2GT8A 1NU7B 3TIUA 3VB5A 2XCNA 2UWLA 5FX5A 4AGJA 2B8OH 3URDA 1TRYA 2Z9GA 1OWKA 1GBFA 1DANH 2FOCA 1WUNH 1LVMA 3MNSA 2OLGA 1AQ7A 1O5EH 3F9FA 2H6MA 3NK8A 1QA7A 3MI4A 1O39A 1G3EA 3F9EA 3E0NB 4B75A 1HBTH 1IQMA 3RLWH 2P3TB 2ZQ2A 2AGIX 1C5PA 2PWXA 3T28A 2ZPRA 1DLEA 3ZZ4A 3M7UA 1RD3B 2Q6FA 2QC2A 2VINA 2SGQE 4ABHA 4NWKA 4I7YH 3GDSA 2V3OH 1FIWA 1BQYA 4Y7BA 1LKAA 3Q3KA 2H9TH 4HTCH 1YBWA 2BLWA 2VGCB 1A0HB 4TY6A 3RDZA 3M3VA 1KLTA 1ZGVA 4Q7ZA 1C5ZB 3HGPA 5DKMA 1WBGB 3RC4A 7KMEH 3TGKE 2Y5FA 4Y8ZA 1CVWH 1SGEE 3RXRA 1MTNB 2ZHFH 1O2QA 5A0AE 5HGGA 5A8XA 3BTME 2AIPA 1NZQH 1ETSH 4U30A 5T6DA 1PPZA 3SJ8A 2J9NA 1UK2A 3PLBA 3VB3A 1C1WH 1GI5A 1V2KT 1ZHMA 1W10U 1FIZA 3LIWA 4CBOA 4XBBA 1INCA 1HJ9A 2Y6TA 1HJAC 3SHCH 1UTNA 4INKA 1O31A 1FNIA 2A0QB 2ANYA 1NC6A 1NFUA 1BBRK 1EUFA 4YOJA 5FPTA 1XM1A 4Z0KA 2VWNA 5EW1H 4NFFA 4D8NA 1PQ7A 1LPKB 1LPGB 3KIDU 4DURA 2PUQH 1O2WA 1XXFA 2W3KA 2P93A 3PO1B 1RJXB 1H9IE 1XKAC 2VIPA 1RRKA 1B0EA 4AFSA 1K21H 1XUIA 1DFPA 8KME2 5EW2H 3ZVAA 1GJ4H 2VJ1A 2VH6A 3UTUH 1JRSA 3LC3A 3PO1C 1K1PA 4UFEH 1EZUC 2VIQA 2P95A 2ZA5A 4YLQH 4ZKSU 3MOCA 3HKIB 2I6SA 3ZZCA 1AFEH 3RXJA 2JH6D 1HLTH 3LGVA 1MTWA 4X6NA 3UQOA 4UEHH 3K6ZA 3A8BA 7ESTE 1G36A 3B23B 1P3EA 4RKJB 1BTZA 3A8CA 1SR5C 3H5CB 4Y79A 1N8OC 5FPYA 1OKXA 3ZZ8A 4R8TB 1JIMA 3GY6A 3IG6B 1IQGA 3NCLA 3RP2A 3U8TH 2C3SA 3TNTA 3F68H 1DSTA 1QRZA 3A83A 3ATKA 3E90B 2V6NA 3TVJB 1GG6C 1HPGA 1K1MA 1V2WT 1Z1JA 4MDSA 4UDWH 1SBWA 5BRRE 1GCTC 1CO7E 3A7WA 3GDVA 2GZ7A 1ZMJA 1BTYA 1SGFG 3ZV8A 4BAHB 4TY7A 3KHVA 2F9UA 4MNWA 4BTIB 1AUTC 3RXKA 1SFQB 3SN8A 4ABDA 1TGCA 2FOMB 1J9CH 1YPHE 1ANDA 3NWUA 4ISOA 1TLDA 4UFFH 5L2ZH 1IQFA 1O5AB 1GBMA 3UNQA 1OWHA 5EQRA 1W0YH 5FCKA 2J34A 2YOLA 2SNVA 2Z6BD 4WXIA 3S7HB 4Z6AH 1TX6A 2XXLA 2BY9X 3M5MA 5HMAA 5EGMA 3MYWA 1LHEH 3PMJA 1SGTA 3T26A 4YOIA 4Y71A 5FHTA 1QR3E 1SGQE 5C1YA 1N1LA 3DFLA 1E0FD 1GJ6A 1WYKA 2STBE 5JB9S 1BMAA 3KCGH 1ETTH 1SQAA 1LMWB 3O8CA 3A7ZA 5EXMA 1Z1IA 5DK1A 1O3HA 3PM3A 5DP4A 4BAKB 1AB9B 1CSOE 5E2OA 1NM6A 4AB9A 1PYTD 4JZEH 1T8NA 4X0WU 4MLFB 2FLRH 1KXDA 4FUEA 1V2TT 3BTHE 2WYJA 2VVUA 3RXBA 3ZZBA 2FYQA 5DP7A 2A5IA 2KAIB 4NSVA 2BQWB 1JRTA 2Y5GA 1UTQA 4O3UA 2BB4A 1A46H 2JKHA 3GYLB 4IGDA 3ZZ6A 2BD8A 1Z8IB 4IBLH 2GDEH 1AHTH 4E7RG 2C93B 3SI3H 3PLPA 2FESH 4J1YA 3QZQA 1MZDA 3E1XB 2FO9A 1FY8E 4FUDA 5C5OA 3GCNA 1O3JA 3MH7A 2FWWA 1V2JT 2R3UA 1OP0A 3LPRA 4KP0A 1ZSKA 1ACBE 1DICA 3LONA 3UOPA 1TA6A 1HFDA 5K7RA 1TWXB 1UTOA 2OC0A 1TIOA 1DPOA 2Z9LA 3LGWA 1P2IA 5A09A 2QAAA 4YTAA 3JZ1B 1GHVH 1FY1A 5LH8A 1GVZA 1O2SA 3O8RA 3A8DA 1O36A 2GV7A 1C2FA 4GPGA 3M7TA 1ZGIA 4DIIH 1WTGH 1BRBE 2EI8A 2ZZUH 1P10A 4DJZB 1DE7H 1C1PA 1OS8A 4X1NU 1FY3A 5ESBA 4E06H 1O2GH 3HK6B 1V2OT 1IOEA 3SNAA 1C9PA 6GCHF 4M7GA 3O8DA 1TYNA 2PTCE 1CA0C 1PPHE 3OYPA 2GCHF 1D6WA 1CGIE 5C67A 2A7CA 1ID5H 2F91A 4A92A 1QBOA 2XW9A 1L1GA 2B0FA 1NS3A 1ETRH 1ZTLA 1C1OA 2SNWA 1KXEA 4NIXA 2P8OC 1UTMA 4U32A 1O2IA 1H8DH 4JZ1A 1A5GH 1AY6H 3TK9A 2LNCA 2GX4A 2OD3B 1AE8H 2P8OB 1O5BB 1BA8B 1P0SH 2ZKSA 1O3LA 3KQBA 1A7SA 1D3PB 2A4RA 2HRVA 1YKTA 3F6UH 2ZU1A 3MMGA 2W7SA 1QQ4A 4UE7H 1UK4A 1CE5A 1W3CA 1GG6B 2UWOA 3VB7A 2AMQA 4X1SU 1CGJE 4CREA 2GZ8A 2QF3A 1AFQC 1O3MA 3RU4E 1ARBA 1EZXC 1ABJH 2PUXB 4I8LA 1CT4E 5ABWA 4ZH8A 1P2KA 3TJVA 4K8BA 1SPJA 1J16A 1C4U2 4X2VA 3MNCA 1AFQB 4XFQA 1TQ7B 1BMMH 1C2IA 4MG3A 3GCTG 1ZPBA 1MKXK 2PKSC 3UOUA 3PWBA 1NRPH 2C90B 2ASUB 2SGAA 1GVKB 2GT7A 1C5SA 1EAUA 1F0RA 1KXBA 1QBNA 1NFWA 4XSKU 1QNJA 3RXOA 1BCUH 3BTQE 2Q1JA 1G30B 1UVTH 3LDXH 5GJ4B 4FUFA 4ZXXH 1TFXA 1UHBB 1NPMA 1ZR0A 3D49H 3MU0A 3QZRA 1P2JA 1QB9A 4KKDA 3RXVA 4E05H 1FONA 2ZECA 1LCYA 3LOXA 4FU9A 4UFGH 5AFZH 3RLYH 5L2YH 1C4V2 1KTSB 1VR1H 2ZHEH 1YCPK 2GMTB 3F1SB 2HNTC 2A45B 4Y6DA 2ZDAH 3A89A 1J15A 1AB9C 1GI3A 3S7KB 1SGIB 3S9AA 1A5HA 4ESTE 3A81A 3MU8A 1MD8A 1AKSA 1VGCB 2F83A 1HAOH 1Z8JB 1OP2A 1NRRH 3VPKA 1EB1H 1K1LA 5CHAC 1YGCH 1THRH 2BDAA 1ZJKA 2Z7FE 2XBWA 1J8AA 1YPKH 3BIUH 3EA9A 3VXEH 3MH5A 3GY7A 3PMAB 2ZDVH 2ZGBH 1S0RA 3P8FA 2B5TB 2HLCA 3RXEA 3A86A 2H9HA 1GBHA 1FY5A 1D9IA 5AFYH 3GCOA 4X8SH 4U2WA 4JYVH 1GJ7B 5FX6A 4B1TA 1KSNA 4IC5A 1V2LT 4X1PU 3UNRA 1TE0A 1KLIH 1AVXA 1P11E 3TJNA 1TA2A 1WV7H 2NU2E 4CH2B 4Y76A 1EJNA 1GI6A 4ZUHA 1IQLA 2ZP0H 1TMTH 4OS5A 3ZVEA 2BD5A 3M5OA 3RMOH 1A3EH 1O3NA 3ATWA 1NO9H 2BLVA 4ABGA 4NFEA 3EYDA 3PYHA 1C1MA 1MTNC 2WPIS 2TGTA 1L4ZA 4H4FA 1MKWK 3ZV9A 1HAXB 3SU1A 1IQEA 3HGNA 3BN9A 1GBEA 3DUXH 2CGAA 1TNJA 3P8GA 5EXNA 1RXPA 3M3SA 4O03A 3SORA 1NRSH 2BOKA 2FMJA 3ATMA 2GVFA 1O35A 3RXDA 4NIVA 3SNDA 1CHOF 3RXIA 1O38A 2ZF0H 3K6YA 2RG3A 4DVAU 2OC8A 3SU4A 2DE9A 1XMNB 2C8YB 1FAKH 2QY0B 3R3GB 3T2NA 1BTWA 3ZZ9A 1PJPA 4E7NA 3ESTA 1DXPA 2OCVB 2G81E 3BEIB 3MH4A 3VGCC 1D6RA 1FPCH 4FVDA 4ABJA 1U6QA 4SGAE 2VWMA 4UD9H 5DP3A 1UTLM 5I46H 1HAGE 1A4WH 1GGDC 2XC5A 1TX7A 1HAVA 1OX1A 4FUCA 3NUMA 2CHAB 1FMGA 2TIOA 5I25A 3D23A 1EKBB 1F92A 2GCTC 5F8ZA 2ZCHP 2RDLA 4OGYA 1NRNH 1BT7A 2ANMH 2FLBH 1Z8RA 3BTDE 2XYAA 5TJXA 3URCA 2GP9B 1EPTC 8GCHF 2IPHA 1W7GH 1PPFE 6CHAB 4D76A 2O9QA 2BZAA 1Y3WA 3P8OA 1P3CA 3HK3B 1HAPH 1NU9A 5CE1A 2XNIA 1N6XA 3FP7E 1DUEA 1GCDA 1OWIA 1YPEH 1SSXA 2JETC 5AHGH 4TYDA 1K1JA 1JXPA 2BD7A 3SJOA 3K2UA 3MO9A 1MBMA 3U9AH 1HNEE 1CT0E 3H7OA 3NPSA 2VIVA 3QUMP 4K1EA 2OTVA 1NROH 3QLPH 2OINA 5DPAA 4WMFA 1ZMNA 5JPMH 2O8LA 4ZHAA 2J38A 3KGPA 4GHTA 1GI1A 1O2ZA 2IJOB 1ZZZA 3QO6A 1YPGH 1MUEB 1VCWA 2ZFQH 3SU3A 1O3DA 1H1BA 1ORFA 1GMDF 2F9PA 1T4VH 1GGDB 5E0JA 1SOTA 1GI8B 2Z9JA 2QXGA 4WY3A 4J2YB 2V3HH 4OS1A 3SV9A 2V0BA 3BTTE 2ZFPH 5A8ZA 1C2EA 1VJ9U 2TRMA 1YPJH 4Q2KA 3LGIA 1SGFA 1LVYA 4ZAEA 1AGJA 2D26C 4GAWA 1BBRE 1TNKA 1WQSA 3N7OA 4GVUA 1UJ1A 5C3NA 1BBRH 1C2KA 5A2MH 6GCHG 1ARCA 3PLKA 1K9OE 1THSH 3C27B 1AZ8A 1EJMA 1P03A 1SMFE 3RXGA 1C2DA 1C5VA 4X2YA 1DT2A 1MAXA 3GOVB 3SUFA 1AVGH 1GBKA 4GHQA 1C5LH 1D3DB 2J95A 1DX5M 1TOCB 2VWOA 3ZYEA 4ISIH 2GD4B 3GICB 1ABIH 3RXTA 1V2RT 2Y7XA 4BAOB 1MCTA 3W94A 3QX5H 1GI0A 2AGGX 4AORA 4AZ2B 3SU5A 4ZHLU 4LZ4B 4FU7A 4MNYA 3SV8A 2AMDA 2BQ6B 4OGXA 4GUXA 2QIQA 1C1SA 3UREA 3CP7A 5CMXH 4JMYA 3EQ0H 4NWLA 3MWIU 1EATA 2ZHDA 1QRXA 1ZRKA 2PKAB 5GXPA 3WY8A 1MCVA 1UMAH 1C4Y2 1CQQA 1HAIH 1VCPA 1LHDH 4NZLA 5ETXA 4JZIA 3OTJE 3SUGA 3TH3H 4JYTA 5L30H 2HALA 1K28D 1EZQA 3RU4T 3STJA 1SC8U 3KQDA 1B5GH 3E3TA 3GY4A 1GI2A 1YLDA 5EPNA 4RKOB 3RXQA 1MAYA 3QK1A 4DIHH 2BMGB 1P05A 2ODYB 3AAVA 4ISHH 5DP5A 1IQJA 4I8HA 6CHAC 1GBIA 3PV4A 1QQUA 1T8LA 3OY6U 4YZUA 2BX3A 4AG1A 3SZNA 3ATLA 2OBOA 5DP6A 3CS7A 4YT6H 4A1VA 5DP9A 5K0HA 1HAZB 3MNBA 1QJ7B 3VB6A 4RSPA 2FOHA 1THPB 1IQNA 3FVFB 3BG4B 5TCAA 2VIDA 2QYIA 3V3MA 1FUJA 1JWTA 4FUIA 3LU9B 4AFUA 4WH6A 1V2QT 3FAOA 4ABAA 4NA8A 1TRMA 3U8RH 4ZXYH 4DG4A 2ZU2A 2STAE 1NRQH 4NIWA 1UVUH 1P04A 1T31A 2YNAA 1D4PB 3KNXA 1FN6A 1W12U 3GY8A 1TBQH 1GMCF 2ZFFH 1Y59T 3SV7A 1RS0A 5T3HA 4H42U 2P94A 2P3FH 2VH0A 3QGNB 3BTGE 5J4SA 1EASA 5DO4H 1OWEA 3TH4H 1SOZA 5JBTA 2UUJB 1A2CH 4ZROA 1EX3A 2A31A 3BTWE 1LTOA 2BXUH 4XDEA 5E2PA 1VZQH 1HAHH 2FODA 1TGTA 1BRCE 3E16B 8LPRA 2W7UA 4X6PA 1DY9A 1ELBA 1C2GA 1ZJDA 5E0GA 4FUGA 2PV9B 1GDQA 5C2ZA 2GKVE 3U8OH 4OS2A 2TGAA 1Y5AT 2AYWA 4GLYA 5F6MA 2ZGXH 1EB2A 3ZZ3A 1O37A 1BRUP 1RTFB 1EQ9A 3PWCA 3OSYA 3HKJB 2R9PA 2WUBA 1GMHF 2FX4A 1SLXB 1TX8A 4B2BA 1SLUB 1GHXH 2Z9KA 1DM4B 1O2XA 1QRWA 5AVDA 2H9EH 3SQEE 2Z9IA 3EE0B
chains in the Genus database with same CATH superfamily
3LKWA 4GSOA 2CN0H 4M9FA 1Z6EA 1F5LA 2SGPE 4NIYA 3RMMH 2ZQ1A 5FL7D 3RM0H 1EP6A 1EPTA 1TQ0B 1WAYB 3KQEA 2NU4E 1O33A 3A87A 1MTVA 2BY6X 3GCHB 3P95A 1GJ5H 5BPEA 3NRLA 1O2JA 2ZFSA 3OU0A 5C1XA 3P8NA 1Z71A 2SGFE 2VVVA 1O2PA 3LGTA 1CBWC 2VWLA 1HV7A 1ELGA 3RMNH 2KFWA 1AN1E 3Q76A 1ELCA 3TK6A 2WPKS 4NCYA 2GGVB 3A88A 2FS9A 3TPIZ 2P59A 1FJSA 3GCTF 1BTUA 3PTBA 1UVSH 4FUHA 3KYGA 5IK2D 1SGRE 2CMYA 3GDUA 4B2CA 3UUZA 2XWAA 2A4GA 4ASHA 1TGSZ 1A61H 3SV6A 1QFKH 3SV2H 2QF4A 1M9UA 3EDXB 2IN2A 2FOGA 4AX9H 3MFJA 2FX6A 4DCDA 2CXVA 3SHAH 2JJ2D 1WSSH 1HRTH 2PSXA 1P57B 1P01A 2GCTB 4WH8A 3M5LA 5EODA 4NG9H 1O5DH 1NY22 4D9RA 4UONA 1MQ6A 1XX9A 4K8YA 4MPWA 2FI5E 1S6HA 3FN8A 2ESTE 1FX0B 1HYLA 2CJIA 2G5VA 1HXEH 3F3BA 3GS9A 2FOEA 1O2TA 1Y3VA 3KEEA 2Y5HA 2BVXH 1TBZH 3P17H 3TGIE 3O8BA 3Q3YA 4Z1MD 1OYQA 5EQQA 2QCYA 3A84A 1T4UH 1HDTH 2XNDD 1EAIA 5GCHF 1G3DA 4B2AA 2Z3EA 1G3BA 1MU8B 1LQDB 5JBCS 3TK5A 2ZPSA 2EEKA 2FTLE 4NA7A 1F7ZA 2M5TA 2XCFA 2ZU3A 3RXLA 2UUKB 1IHSH 1C2JA 1XUGA 1KXFA 1T7CA 2TGPZ 2OBQA 4AFZA 1GBAA 2BDHA 2GMTC 3E91A 2F9VA 1BJUA 1S84A 4F49A 2VNTA 1P09A 1A0LA 8ESTE 3CENA 3NKKA 1ZYOA 1GDNA 1HAYB 3D65E 3LT3A 1RFNA 1SHHB 4XBCA 1GBJA 1HB0B 2G8TA 1L1JA 1QCPA 2BZ6H 2C4FH 3UR6A 4JK5A 3SJ9A 2KCPA 2QA9E 1A0JA 1B7XB 1W0ZU 5FXLA 1TONA 1CHGA 4TPYA 2Z3DA 3A7TA 2W3IA 4YM9A 3MO3A 2G5NA 1AE5A 2Z3CA 4INHA 5IYTA 1C1RA 4MNVA 1EP5A 2P3UB 1SG8B 2O8WA 1TAWA 3OTPA 1KXCA 5HXFA 1SQOA 1C1QA 2FIRH 4Y7AA 4A7IB 2J98B 2R2WU 1S0QA 4ACBA 2OQ5A 5FCRA 4IS5A 3KQCA 3S9CA 1EXFA 1V2NT 2AFQB 1VKYA 1HGTH 4DT7B 1PFXC 1WU1A 2JIZD 1ESTA 2PLXA 4IMZA 2EY4C 4DY7B 1K0HA 1GHAF 1OYTH 5LGOA 2P16A 1TPOA 2XC4A 5EJLA 4Q7XA 1SLWB 1VITH 4WWYA 1ANBA 4B76A 1OXGA 1XKBC 4Y10E 5F03A 2DE8A 4CRAA 3D62A 3SNBA 3UIRA 4MPVA 2VGCC 1LO6A 1V2PT 3BG4C 1MMJN 2W6ID 1GBTA 1GMDG 3SUDA 4BAQB 4F4OC 3GCHC 1GHBF 1EPTB 1Z7KA 4K69A 3QDZB 3M5NA 3UQVA 1KTTB 5J4QA 5DP8A 1V2VT 1MTSA 1O3CA 1LDTT 1O3GA 1C5WB 2Q6DA 3ZVCA 1GL0E 3E8LA 4AB8A 1ELFA 1Y3XA 2H5DA 3I29A 1SGPE 1RGQA 4JK6A 3PTNA 1C5NH 5DGJA 2FOFA 1DITH 4CH8B 1O34A 1ESAA 1C5QA 2B7DH 3Q3XA 3MH6A 3BTFE 1L4DA 1K1NA 1V3XA 1TOMH 1C5YB 1GHZA 1W0KD 3MU4A 1J17T 1O2NA 3SU2A 1GL1A 3T5FH 3QN7A 3LGYA 1WOFA 7LPRA 4IMQA 1QTFA 2A1DB 2ZU5A 2THFB 1DSUA 4ISLA 1OP8A 1FN8A 2HPPH 1Q3XA 1MKWH 1QA0A 2V35A 2WV9A 4MVNA 3W1EA 4CBNA 3F2HA 3ODDA 1O2MA 3A7XA 1H4WA 4AGKA 4CHAB 5H4IB 1MH0A 1ESBA 1P8VC 5FAHA 4D7GA 3PMBB 2NU3E 1SGNE 2C8XB 2PFEA 3HPTB 2GDDA 4WMEA 2J5UA 4AFQA 3BEFB 3B9FH 1V2MT 1TPPA 1EOLA 1SHYA 1MZAA 1AMHA 2J98A 5GDSH 2BYAX 1YPHC 1BTXA 1VITG 1YPLH 4ZKRU 2WPLS 1G32B 1YLNA 3ZVGA 1BDAA 1PPBH 4AG2A 3RXMA 2BD3A 1PQ5A 3SGBE 5TCCA 5DG6A 1EAWA 1F5RA 1G2MA 2R2MB 1WXRA 2PGBB 3ZVFA 4LXBH 1ELEE 1SFIA 5EJ1A 1WDIA 4Y8XA 2ZTXA 1HJ8A 1QBVH 1UTKA 1LHGH 4ABFA 4I8GA 2BTCE 3ITIA 4LOYH 1Q31A 4LK4A 3SYJA 1WTHD 4FOUC 3V12A 1S83A 4ACAA 3TLOA 1C1NA 1S81A 1DWBH 2FP7B 1YWUA 3E0PB 1EJAA 2HNTF 5ESTE 2BOHB 4TPIZ 1FV9A 1GPZA 1QB1A 1T8OA 2XC0A 1A5IA 1NTPA 1YYY1 5E0HA 1VJAU 2QF0A 1DVAH 5HM2A 2VIOA 2BDGA 1VGCC 2ZDNA 1JBUH 1PPCE 5HKKD 2BVSH 1ZTKA 1XXDA 2CF8H 1XUFA 1P2MA 2ZG0H 1GMHG 2OUAA 3S69A 4ISNA 2HWLB 3OEED 1YCPH 4BXWA 5DSFA 1G9IE 2XRCA 1OHHD 4NA9H 1IQHA 1BIOA 2JH0D 3MNXA 1N8OB 5EXLA 2A7HA 3JZ2B 1QL8A 3V13A 1FQ3A 1W7XH 1IQIA 5JYIA 1MQ5A 4XE4A 3S0NA 3MQKC 4Y8YA 3OAAD 3SGQE 1BTPA 5T1VA 3EAJA 1O5FH 2VVCA 3V0XA 9ESTA 1ZPZA 2ZTYA 4XBDA 3U1IB 1QL7A 1VCQA 3DT0H 2ILNA 1P9SA 1JOUB 1TMUH 1TMBH 2BD9A 2VU8E 3HATH 5C20A 3FFGA 2F9OA 2G4UA 4MPXA 4SGBE 1C1VH 3DA9B 1C5RA 1P06A 2ALVA 5IDKA 2ZCLP 1BMFD 2OK5A 1D3TB 4OS7A 2PSYA 2UUYA 4WJG2 4YLUA 1DWDH 1QURH 1DWEH 1SQTA 3DHKH 2K8IA 4CR5A 2ZGJA 3L6PA 1E35B 1UVPA 2FYRA 4HI3A 5AF9H 1AVWA 3AAUA 2BY7X 3SJIA 2BVRH 2PHBA 1SVPA 2AIQA 2LPRA 3DCLA 1AO5A 1P2NA 2WV5A 3UWJH 2BY8X 5CHAB 5E8EH 3W95A 4GCHF 5CHBA 3AW1A 2UWPA 1Y5BT 1YLCA 1Y8TA 2ZIQH 1ANCA 1EAXA 1V2UT 3SUEA 4O3TA 2PTNA 1LVBA 2HNTE 5C0UA 3SW2B 1NT1A 1BMLA 2FM2A 2QE7D 4O97A 2WPHS 1RTKA 1QGFA 3C1KA 5PTPA 4B73A 1DOJA 5EG4A 3V7TA 2WYGA 4I33A 4JYUH 1KDQB 1O0DH 2O8MA 3FOAA 2BDIA 2FDAA 2QF5A 1EZSC 4JZDH 1BJVA 1O5GH 1ZHPA 1K2I1 1HIAB 1GBDA 3A82A 3TH2H 2FTMA 3UAIC 4TWYA 2CHAC 3ZZDA 1BOQA 4A5TS 4CRFA 1AUJA 4Q80A 1O3OA 5EU8A 1AZZA 2M2AA 1XVOA 1O5CB 4PROA 1G37A 1O3PB 2XWBI 1BB0B 2XBXA 1UTPA 2JH5D 2LELA 1LQEA 3SU6A 3MU5A 1UTJA 3OFND 4X8VH 1F0SA 2PW8H 1VITF 2IOTA 3M35A 2EI7A 2R3YA 1RIWB 2ZO3H 3ZVDA 5GWZA 2JETB 3B8JA 4X1QU 1FI8A 1AD8H 3MHWU 2VIWA 1FDPA 5F8XA 4OS4A 1GVLA 2BY5X 3UNSA 2WPMS 1GBCA 1GJ9B 3F9GA 3A8AA 5L6NH 1XUKA 3TJOA 2ZDKA 2C8WB 3VGCB 3ZZ7A 6ESTA 1GI4A 1ELVA 1Y3UA 3I77A 5GIBA 2ZI2H 3RM2H 4JZFH 2ANKH 1ELTA 1MABB 1X7AC 3TGJE 2A32A 2SGDE 3OE7D 1OWDA 4X6MA 1FLEE 1K22H 4DOQA 1YP9A 2ZNKH 1IHTH 2A4OA 4I8JA 1HAVB 1GHAG 2ZHQH 1L1NA 4AYVB 1KYNA 2UUFB 2BD4A 1SL3A 2A2QH 1W11U 2RA3A 4I31A 1JMOH 5KEDA 1CBWB 3LC5A 1GJ8B 4FUBA 4THNH 3FP6E 3BTEE 2R0LA 2R0KA 7GCHG 2GCHG 2ZHWH 4YT7H 3UFAA 1S6FA 1C5MD 1SI5H 3BG8A 3UR9A 1BHXF 1TBRH 1P2QA 2NU0E 3UPEA 2PKSB 2OC1A 1GJBB 4ZKNU 3KQ5A 1BITA 1O3AA 2I6QA 4NSYA 4BAMB 1S82A 1CT2E 2AERH 2BDYA 1O3EA 4DW2U 1WCZA 3VXFH 4CRBA 2A7JA 2BQ7B 2CV3A 1GHBG 1K1IA 2EI6A 2Q6GA 3RXHA 1OPHB 2FI4E 3AASA 1TNGA 4MNXA 3UWIA 1E36B 2BDBA 1QB6A 2PKAA 1Z8GA 3ELAH 2BXTH 1NESE 5EPYA 3F0PA 5T6GA 4X6OA 1PPGE 3G01A 4IC6A 4OM9A 1C5XB 4WVPE 3GY2A 5F8TA 1FY4A 1QJ6B 4X8TH 2BDCA 2H1UA 1C2LA 3MO6A 3SJKA 3DFJA 1ANEA 1C2HA 3N7EA 1FPHH 1HUTH 2W26A 1BUIA 3KF2A 1YM0A 1SGCA 5JBBS 3M3TA 3P70B 2Z94A 1E34B 2J94A 2SFAA 1C5TA 3Q77A 4YO9A 1EFRD 1UCYE 4CRGA 3SBKA 3IITA 1DLKB 4Y11E 1O2UA 4RT0A 2ZEBA 1QY6A 3MU1A 3SOSA 1TABE 5EIYA 1ELAA 8GCHG 1FZZA 4KTSA 2F9NA 3TJUA 1J14A 1E37B 4BNRA 1YF4A 3H7TA 1GCTB 2AGEX 4HFPB 2F9BH 3L3TA 2HGTH 4IN2A 2HLDD 4KTUA 4A6LA 5JB8S 1OSSA 3RC6A 3QWCH 3M7QA 2D8WA 3BEUA 3OX7U 1ELDE 2C8ZB 3CS0A 1SB1H 4VGCB 5A8YA 1F0UA 3A7YA 4U01A 2TPIZ 1V6DA 4RI0A 1AWHB 1KY9A 2PGQB 4AOQA 2OQUA 3SNCA 1PYTC 1YCPM 1N6YA 1H8ED 3ZYDA 3T27A 2SGEE 1YY3A 2BX4A 2ALPA 2O8UA 4RT1A 3A85A 5A0BA 4X2WA 1CHOG 2HOBA 3LJOA 1AKSB 1PPEE 4FU8A 3IWMA 6LPRA 1GJAB 1SLVB 2ZWLH 2BD2A 3SI4H 4BANB 2Y80A 1C5OH 2A2XH 3PROA 4NZQA 5GCHG 2FOBA 2FZZA 4OS6A 3VFEA 1ZRBA 3BTKE 2W6JD 1H9LB 1C1UH 1FAXA 1W8BH 2QXJA 3R0FA 4NGAH 2AEIH 3T25A 3P92A 1O2OA 3A7VA 5LPEA 1P2OA 4K1TA 4I32A 1AU8A 2XBYA 2ZTZA 4AN7A 3PMHB 3FANA 1OOKB 5B6OA 4BXSA 5EQSA 1BRAA 4YXWD 4AYYB 3UY9A 1AIXH 1LHFH 1V2ST 2QGRA 2OP9A 4K1SA 4GCHG 4KELA 1DWCH 2FPZA 4O9VA 5EOKA 1DY8A 3TITA 1GI9B 4WF8A 4DGJA 1TGNA 1GI7B 1ZPCA 1EOJA 1HIAA 3M37A 1Q2WA 1CGHA 2WINI 3LJJA 3KL6A 3DSGA 1ZMLA 2FS8A 1YC0A 5KGOA 3T62A 2RDEA 1W2KH 2D2DA 2FI3E 1PQAA 4MPUA 2AMPA 2QN5T 2ZDMA 1BZXE 3VEQB 1GDUA 1YPMH 2NU1E 1ZOMA 1GBLA 3I78A 4RN6A 1LPZB 2WPDD 1HXFH 1SQRA 1NN6A 1TB6H 3KN2A 3ZZAA 2ZFRH 1IAUA 3QGJA 4K60A 3ZZ5A 1GMCG 2BHGA 1DXWA 3TU7H 1O2YA 2BM2A 1NFYA 1C9TA 2BLQA 2TBSA 1C1TA 2WV4A 2J4IA 4INLA 5LPFA 1GJDB 3RXFA 1TGBA 1F0TA 2FXRA 1W14U 2J2UA 1OWJA 4HGCA 4IN1A 4B74A 2QXIA 3BV9B 1O2HA 2ZC9H 4TWWA 1E38B 2GTBA 1ZSJA 2W5EA 1UCYK 2V3MA 1CA8B 1O30A 3U98H 4F55A 1MKXH 1L2EA 3ENSB 1K1OA 3EA8A 5JDUB 2QXHA 3BIVH 4FVBA 4QT8C 1QJ1B 5DJ7A 1F2SE 3P6ZB 1GJCB 1GWAA 2ODQA 4FUJA 4WXVA 1UK3A 2RA0A 2J92A 1O2RA 4KGAA 5HYOA 2ZGCA 1XVMA 2CF9H 3A80A 1O3KA 4CHAC 3F9HA 3BSQA 3RMLH 1S85A 1TNHA 4CRDA 1B0FA 1KLJH 3PRBA 1T32A 4H6SB 1C5UA 5C17A 1AI8H 3T29A 1TNLA 2ODPA 5G4BA 3M61U 2Y7ZA 3FZZA 2A5AA 3K65B 4H6TA 2F3CE 4XD7D 1F5KU 4B6FA 1O32A 1CA0B 2XOKD 1DDJA 2FEQH 3PV2A 1Y3YA 4X2XA 3FZDA 2FOAA 2BLOA 1CU1A 4JCNA 1GHWH 4KTCA 3M36A 3GY5A 1GBBA 1ZLRA 3FKSD 2G51A 3ODFA 1RTLA 1MU6B 1Z6JH 4D7FA 2GV6A 1KXAA 1P02A 1BMNH 3VB4A 1O3BA 2OC7A 1WQVH 3SGAE 4B71A 2ANWA 4YESB 1TPAE 2DUCA 3EGKH 3RXUA 2G55A 2XTTB 1UCYH 1DUAA 4K2YA 3RXCA 1LVOA 1Y5UT 3LH3A 3RXAA 4K3JA 5LPRA 1QIXB 1UVOA 2YMSD 4VGCC 3Q00A 5JBAS 5CDFE 2Y81A 3GYMA 1O2VA 5C5NA 1XUJA 4A1XA 4CR9A 4X1RU 1ZHRA 2H5CA 1HJAB 2O8TA 3PB1E 4Y0YE 2KAIA 3RC5A 1TPSA 3WW7A 2ZCKP 3QTVH 3GISB 3LH1A 1BTHH 2KCYA 1XUHA 5FBEA 2ZU4A 5SGAE 1T8MA 5HM9A 3E6PH 1MTUA 1W13U 4R0IA 4YOGA 3PRDA 2EC9H 2NWNA 2Y82A 3FP8E 4Q7YA 4D9QA 1A1RA 4IW4E 5FBIA 3RXPA 1TRNA 2VB0A 1C2MA 1GHYH 1SGYE 1O2LA 7GCHF 4K5ZA 5FPSA 1H8IH 1LKBA 2HPQH 4MQAA 4ZMAH 2G00A 1O3FA 2YNBA 3K9XB 1MBQA 4B6EA 4BTUB 1DS2E 2K1QA 2AS9A 1D3QB 3ZIAD 2WPJS 3AW0A 2ZFTA 3S9BA 3RUOA 1UHBA 2WUCA 1UO6A 4LZ1H 2PR3A 2B9LA 1FXYA 4WMDA 4I8KA 4X8UH 3SU0A 3BF6H 3L33A 5A0CA 1IQKA 2ZGHA 4ABBA 4UFDH 4XOJA 3RU4D 4A1TA 5GPIB 1ZTJA 3SNEA 4Y0ZE 4BOHA 4CRCA 1P12E 1P9UA 2A4QA 3GY3A 5C94A 3MTYA 2OXSA 1TNIA 4FXGH 1SGDE 3U1JB 2EA3A 4ZCNA 1A3BH 3LGUA 9LPRA 3ATIA 4MTBA 1QHRB 1LHCH 1G3CA 1KDQA 1TALA 5C1UA 1KIGH 2G52A 3NZIA 1JIRA 1L0ZA 1PQ8A 2RCEA 2TGDA 1QL9A 1AWFH 2GZ9A 2HVXA 3SQHE 4ZHMU 1G2LA 2ZDLA 3STIA 2D1JA 2QV1A 2ULLA 5KECA 3NXPA 3TNSA 2A5KA 3OY5U 1ZSLA 2G4TA 3SO3A 3AVZA 3DD2H 1H9HE 2H2ZA 1O2KA 2AH4X 1O3IA 2XBVA 3QTOH 4ABEA 1MD7A 5T6FA 3EA7A 1NFXA 3RXSA 3U69H 4ABIA 1BHXB 4ZKOU 1RIWC 3ZVBA 4BTTB 1S5SA 4HZHA 2ZPQA 1HCGA 2GT8A 1NU7B 3TIUA 3VB5A 2XCNA 2UWLA 5FX5A 4AGJA 2B8OH 3URDA 1TRYA 2Z9GA 1OWKA 1GBFA 1DANH 2FOCA 1WUNH 1LVMA 3MNSA 2OLGA 1AQ7A 1O5EH 3F9FA 2H6MA 3NK8A 1QA7A 3MI4A 1O39A 1G3EA 5HIZA 3F9EA 3E0NB 4B75A 1HBTH 1IQMA 3RLWH 2P3TB 2ZQ2A 2AGIX 1C5PA 2PWXA 3T28A 2ZPRA 1DLEA 3ZZ4A 3M7UA 1RD3B 2Q6FA 2QC2A 3N99A 2VINA 2SGQE 4ABHA 4NWKA 4I7YH 3GDSA 2V3OH 1FIWA 1BQYA 4Y7BA 4TSFD 1LKAA 4P00A 3Q3KA 2H9TH 4HTCH 1YBWA 2BLWA 2VGCB 1A0HB 4TY6A 3RDZA 3M3VA 1KLTA 1ZGVA 4Q7ZA 1C5ZB 3HGPA 5DKMA 2WSSD 1WBGB 3RC4A 7KMEH 3TGKE 2Y5FA 4Y8ZA 1CVWH 1SGEE 3RXRA 1MTNB 2ZHFH 3VG8A 1O2QA 5A0AE 5HGGA 5A8XA 3BTME 2KR7A 2AIPA 1NZQH 1ETSH 4U30A 5T6DA 1PPZA 3SJ8A 2J9NA 1UK2A 3PLBA 3VB3A 1C1WH 5DN6D 1GI5A 1V2KT 1ZHMA 1W10U 1FIZA 3LIWA 4CBOA 4XBBA 1INCA 1HJ9A 2Y6TA 1HJAC 3SHCH 1UTNA 4INKA 1O31A 1FNIA 2A0QB 2ANYA 1NC6A 1NFUA 1BBRK 1EUFA 4YOJA 5FPTA 1XM1A 4Z0KA 2VWNA 5EW1H 4NFFA 4D8NA 1PQ7A 1LPKB 1LPGB 3KIDU 4DURA 2PUQH 1O2WA 1XXFA 2W3KA 2P93A 3PO1B 1RJXB 1H9IE 1XKAC 2VIPA 1RRKA 1B0EA 4AFSA 1K21H 1XUIA 1DFPA 8KME2 5EW2H 3ZVAA 1GJ4H 2VJ1A 2VH6A 3UTUH 4Q63A 1JRSA 3LC3A 3PO1C 1K1PA 4UFEH 1EZUC 2VIQA 2P95A 2ZA5A 4YLQH 4ZKSU 3MOCA 3HKIB 2I6SA 3ZZCA 1AFEH 3RXJA 2JH6D 1HLTH 3LGVA 1MTWA 3FO8D 4X6NA 3UQOA 4UEHH 3K6ZA 3A8BA 7ESTE 1G36A 2V7QD 3B23B 1P3EA 4RKJB 1BTZA 3A8CA 1SR5C 3H5CB 4Y79A 1N8OC 5FPYA 1OKXA 3ZZ8A 4R8TB 1JIMA 3GY6A 3IG6B 1IQGA 3NCLA 3RP2A 3U8TH 2C3SA 3TNTA 3F68H 1DSTA 1QRZA 3A83A 3ATKA 3E90B 1NBME 2V6NA 3TVJB 1GG6C 1HPGA 1K1MA 5EJZA 4TT3D 1V2WT 1Z1JA 4MDSA 4UDWH 1SBWA 5BRRE 1GCTC 1CO7E 3A7WA 3GDVA 2GZ7A 1ZMJA 1BTYA 1SGFG 3ZV8A 4BAHB 4TY7A 3KHVA 2F9UA 4MNWA 4BTIB 1AUTC 3RXKA 1SFQB 3SN8A 4ABDA 1TGCA 2FOMB 1J9CH 1YPHE 1ANDA 3NWUA 4ISOA 1TLDA 4UFFH 5L2ZH 1IQFA 1O5AB 1GBMA 3UNQA 1OWHA 5EQRA 1W0YH 3F2GA 5FCKA 2J34A 2YOLA 2SNVA 2Z6BD 4WXIA 3S7HB 4Z6AH 1TX6A 2XXLA 2BY9X 3M5MA 5HMAA 5EGMA 3MYWA 1LHEH 3PMJA 1SGTA 4ASUD 3CNRA 3T26A 4YOIA 4Y71A 5FHTA 1QR3E 1SGQE 5C1YA 1N1LA 3DFLA 1E0FD 1GJ6A 1WYKA 2STBE 5JB9S 1BMAA 3KCGH 1ETTH 1SQAA 1LMWB 3O8CA 3A7ZA 5EXMA 1Z1IA 5DK1A 1O3HA 3PM3A 5DP4A 4BAKB 1AB9B 1CSOE 5E2OA 1NM6A 4AB9A 1PYTD 3PV5A 4JZEH 1T8NA 4X0WU 4MLFB 2FLRH 1KXDA 4FUEA 1V2TT 3BTHE 2WYJA 2VVUA 3RXBA 3ZZBA 2FYQA 3H09A 5DP7A 2A5IA 2KAIB 4NSVA 2BQWB 1JRTA 2WHXA 2Y5GA 1UTQA 4O3UA 2BB4A 1A46H 2JKHA 2JDID 3GYLB 4IGDA 3ZZ6A 2BD8A 1Z8IB 4IBLH 2GDEH 1AHTH 4E7RG 2C93B 3SI3H 3PLPA 2FESH 4J1YA 3QZQA 1MZDA 3E1XB 2FO9A 1FY8E 4FUDA 1S6LA 5C5OA 3GCNA 1O3JA 3MH7A 2FWWA 1V2JT 2R3UA 1OP0A 3LPRA 4KP0A 1ZSKA 1ACBE 1DICA 3LONA 3UOPA 1TA6A 1HFDA 5K7RA 1TWXB 1UTOA 2OC0A 1TIOA 1DPOA 2Z9LA 3LGWA 1P2IA 1QZ8A 5A09A 2QAAA 4YTAA 3JZ1B 1GHVH 1FY1A 5LH8A 1GVZA 1O2SA 3O8RA 3A8DA 1O36A 2GV7A 1C2FA 4GPGA 3M7TA 1ZGIA 4DIIH 1WTGH 1BRBE 2EI8A 2ZZUH 1P10A 4DJZB 1DE7H 1C1PA 1OS8A 4X1NU 1FY3A 5ESBA 4E06H 1O2GH 3HK6B 1V2OT 1IOEA 3SNAA 1C9PA 6GCHF 4M7GA 3O8DA 1TYNA 2PTCE 1CA0C 4FETA 1PPHE 3OYPA 2GCHF 1D6WA 1CGIE 5C67A 2A7CA 1ID5H 2F91A 4A92A 1QBOA 2XW9A 1L1GA 2B0FA 1NS3A 1ETRH 1ZTLA 1C1OA 2SNWA 1KXEA 4NIXA 2P8OC 1UTMA 4U32A 1O2IA 1H8DH 3WWFA 4JZ1A 1A5GH 1AY6H 3TK9A 2LNCA 2GX4A 2OD3B 1AE8H 2P8OB 1O5BB 1BA8B 1P0SH 2ZKSA 1O3LA 2EQNA 3KQBA 1A7SA 1D3PB 2YMSC 2A4RA 2HRVA 1YKTA 3F6UH 2ZU1A 3MMGA 2W7SA 1QQ4A 4UE7H 1UK4A 1CE5A 1W3CA 1GG6B 2UWOA 3VB7A 2AMQA 4X1SU 1CGJE 4CREA 2GZ8A 2QF3A 1AFQC 1O3MA 3RU4E 1ARBA 1EZXC 1ABJH 2PUXB 3AK5A 4I8LA 1CT4E 5ABWA 4ZH8A 1P2KA 3TJVA 4K8BA 1SPJA 1J16A 1C4U2 4X2VA 3MNCA 1AFQB 4XFQA 1TQ7B 1BMMH 1C2IA 4MG3A 3GCTG 1ZPBA 1MKXK 2PKSC 3UOUA 2L74A 3PWBA 1NRPH 2C90B 2ASUB 2SGAA 1GVKB 2GT7A 2HVYB 1C5SA 1EAUA 1F0RA 1KXBA 1QBNA 1NFWA 4XSKU 1QNJA 3RXOA 1BCUH 3BTQE 2Q1JA 1G30B 1UVTH 3LDXH 5GJ4B 4FUFA 4ZXXH 1TFXA 1UHBB 1NPMA 1ZR0A 3D49H 4XRNA 3MU0A 3QZRA 1P2JA 5HIYA 1QB9A 4KKDA 3RXVA 4E05H 1SKYE 1FONA 2ZECA 1LCYA 3LOXA 4FU9A 4UFGH 5AFZH 3RLYH 5L2YH 1C4V2 1KTSB 1VR1H 2ZHEH 1YCPK 2GMTB 3F1SB 2HNTC 2A45B 4Y6DA 2ZDAH 3A89A 1J15A 1AB9C 1GI3A 3S7KB 1SGIB 3S9AA 1A5HA 4ESTE 3A81A 3MU8A 1MD8A 1AKSA 1VGCB 2K0QA 2F83A 1HAOH 1Z8JB 1OP2A 1NRRH 3VPKA 1EB1H 1K1LA 5CHAC 1YGCH 1THRH 2BDAA 1ZJKA 2Z7FE 2XBWA 1J8AA 1YPKH 3BIUH 3EA9A 3VXEH 3MH5A 3GY7A 3PMAB 4I86A 2ZDVH 2ZGBH 1S0RA 2IPQX 3P8FA 5F53A 2B5TB 2HLCA 3DSOA 3RXEA 3A86A 2H9HA 1GBHA 1FY5A 1D9IA 5AFYH 3GCOA 1E1QD 4X8SH 4U2WA 4JYVH 1GJ7B 5FX6A 4AC9A 4B1TA 1KSNA 4IC5A 1V2LT 4X1PU 3UNRA 1TE0A 1KLIH 1AVXA 1P11E 3TJNA 1NBMD 1TA2A 1WV7H 2NU2E 4CH2B 4Y76A 1EJNA 1GI6A 4ZUHA 1IQLA 2ZP0H 1TMTH 4OS5A 3ZVEA 2BD5A 3M5OA 3RMOH 1A3EH 1O3NA 3ATWA 1NO9H 3UB0A 2BLVA 4ABGA 4NFEA 3EYDA 3PYHA 1C1MA 1MTNC 3WWBA 2WPIS 2TGTA 1L4ZA 2KCOA 4H4FA 5GNDA 1MKWK 3ZV9A 1HAXB 3SU1A 1IQEA 2WZQA 3HGNA 3BN9A 1GBEA 3DUXH 2CGAA 1TNJA 3P8GA 5EXNA 1RXPA 3M3SA 1UW7A 4O03A 3SORA 1NRSH 2BOKA 4HG6A 2FMJA 3ATMA 2GVFA 1O35A 3RXDA 4NIVA 3SNDA 1CHOF 3RXIA 1O38A 2ZF0H 3K6YA 2RG3A 4DVAU 2OC8A 3SU4A 2DE9A 1XMNB 2C8YB 1FAKH 2QY0B 3R3GB 3T2NA 1BTWA 3ZZ9A 1PJPA 4E7NA 3ESTA 1DXPA 2OCVB 2G81E 3BEIB 3F0OA 2YMSB 3MH4A 3VGCC 1D6RA 1FPCH 4FVDA 4ABJA 1U6QA 2J97A 4SGAE 2VWMA 4UD9H 5DP3A 1UTLM 5I46H 1HAGE 1A4WH 2KCAA 1GGDC 2XC5A 1TX7A 1HAVA 1OX1A 4FUCA 3NUMA 2CHAB 1FMGA 2TIOA 5I25A 3D23A 1EKBB 1F92A 2GCTC 2CK3D 5F8ZA 2ZCHP 2RDLA 3N7DA 4OGYA 1NRNH 3DSPA 1BT7A 2ANMH 2FLBH 1Z8RA 3BTDE 2XYAA 5TJXA 3URCA 2GP9B 1EPTC 8GCHF 2IPHA 1W7GH 1PPFE 6CHAB 4D76A 2O9QA 2BZAA 1Y3WA 3P8OA 1P3CA 3HK3B 1HAPH 1NU9A 5CE1A 2XNIA 1N6XA 3FP7E 1DUEA 1GCDA 1OWIA 2KZ4A 2F4LA 1YPEH 1SSXA 4Q4LA 2JETC 5AHGH 4TYDA 1K1JA 1JXPA 2LP6A 2BD7A 3SJOA 3K2UA 3MO9A 2VBCA 1MBMA 3U9AH 3U28C 1KMHB 1HNEE 2GJGA 1CT0E 3H7OA 3NPSA 5B6LA 2VIVA 3F2FA 3QUMP 4K1EA 2OTVA 1NROH 3QLPH 2OINA 5DPAA 4WMFA 1ZMNA 5JPMH 5C0TA 2O8LA 4ZHAA 2J38A 3KGPA 4GHTA 1GI1A 3KYFA 1O2ZA 2IJOB 2RFKC 1ZZZA 3QO6A 1YPGH 1MUEB 1VCWA 2ZFQH 3SU3A 1O3DA 1H1BA 1ORFA 1GMDF 2F9PA 1T4VH 1GGDB 5E0JA 1SOTA 1GI8B 2Z9JA 2QXGA 4WY3A 4J2YB 2V3HH 4OS1A 3SV9A 2V0BA 3BTTE 2ZFPH 5A8ZA 1C2EA 1VJ9U 2TRMA 1YPJH 4Q2KA 3LGIA 1SGFA 1LVYA 4ZAEA 1AGJA 2D26C 4GAWA 1BBRE 1TNKA 1WQSA 3N7OA 4GVUA 1UJ1A 5C3NA 1BBRH 1C2KA 5A2MH 6GCHG 1ARCA 3PLKA 1K9OE 1THSH 3C27B 1AZ8A 1EJMA 1P03A 1SMFE 3RXGA 1C2DA 1C5VA 4X2YA 1DT2A 1MAXA 4DT4A 3GOVB 3SUFA 1AVGH 1GBKA 4GHQA 1C5LH 1D3DB 2J95A 1DX5M 1TOCB 2VWOA 3ZYEA 4ISIH 2L6OA 2GD4B 3GICB 1ABIH 3RXTA 1V2RT 2Y7XA 2PP6A 4BAOB 1MCTA 3EE7A 3W94A 3QX5H 1GI0A 2AGGX 4AORA 4AZ2B 3SU5A 4ZHLU 4LZ4B 4FU7A 4MNYA 3SV8A 2AMDA 2BQ6B 4OGXA 4GUXA 2QIQA 1C1SA 3UREA 3CP7A 5CMXH 4JMYA 3EQ0H 4NWLA 4P02A 3MWIU 1EATA 2ZHDA 1QRXA 1ZRKA 2PKAB 5GXPA 3WY8A 1MCVA 1UMAH 1C4Y2 1CQQA 1HAIH 1VCPA 1LHDH 4NZLA 5ETXA 4JZIA 3OTJE 3SUGA 3TH3H 2IJD1 2KX4A 4JYTA 5L30H 2HALA 1K28D 1EZQA 3RU4T 3STJA 1SC8U 3KQDA 1B5GH 3E3TA 3GY4A 1GI2A 1YLDA 5EPNA 4RKOB 3RXQA 1MAYA 3QK1A 4DIHH 2BMGB 1COWD 1P05A 2ODYB 3AAVA 4ISHH 5DP5A 1IQJA 4I8HA 6CHAC 1GBIA 3SZEA 3PV4A 1QQUA 1T8LA 3OY6U 4YZUA 2BX3A 4AG1A 3SZNA 3ATLA 2OBOA 5DP6A 3CS7A 4YT6H 4A1VA 5DP9A 5K0HA 1HAZB 3MNBA 1QJ7B 3VB6A 4RSPA 2FOHA 1THPB 1IQNA 1W0JD 3FVFB 2JJ1D 3BG4B 5TCAA 2VIDA 2QYIA 3V3MA 1FUJA 1JWTA 4FUIA 3LU9B 4AFUA 4WH6A 1V2QT 3FAOA 4ABAA 4F48B 4NA8A 1TRMA 3U8RH 4ZXYH 4DG4A 2F43B 2ZU2A 2STAE 1NRQH 4NIWA 1UVUH 1P04A 1T31A 2YNAA 1D4PB 3KNXA 1FN6A 1W12U 3GY8A 1TBQH 1GMCF 2ZFFH 1Y59T 3SV7A 1RS0A 5T3HA 4H42U 2P94A 2P3FH 2VH0A 3QGNB 3BTGE 2AHME 5J4SA 1EASA 1H8HD 5DO4H 1OWEA 3TH4H 1SOZA 5JBTA 2UUJB 1A2CH 4ZROA 1EX3A 2A31A 3BTWE 1E1RD 1LTOA 2BXUH 4XDEA 5E2PA 1VZQH 1HAHH 2FODA 1TGTA 1BRCE 3E16B 8LPRA 2W7UA 4X6PA 1DY9A 1ELBA 1C2GA 1ZJDA 5E0GA 4FUGA 2PV9B 1GDQA 5C2ZA 2GKVE 3U8OH 4OS2A 2TGAA 1Y5AT 3OEHD 2AYWA 4GLYA 5F6MA 2ZGXH 1EB2A 3ZZ3A 1O37A 1E79D 1BRUP 1RTFB 1EQ9A 3PWCA 3OSYA 3HKJB 2R9PA 1GMHF 2WUBA 2FX4A 1SLXB 1TX8A 4B2BA 1SLUB 1GHXH 2KM0A 2Z9KA 1DM4B 1O2XA 1QRWA 5AVDA 2H9EH 3SQEE 2Z9IA 3EE0B
chains in the Genus database with same CATH topology
3LKWA 4GSOA 2CN0H 3RMMH 1Z6EA 1F5LA 2SGPE 4NIYA 2ZQ1A 3RM0H 1EP6A 1EPTA 1TQ0B 1WAYB 3KQEA 2NU4E 1O33A 3A87A 1MTVA 2BY6X 3GCHB 3P95A 1GJ5H 5BPEA 5C1XA 1O2JA 2ZFSA 3OU0A 3P8NA 1Z71A 2SGFE 2VVVA 1O2PA 3LGTA 1CBWC 2VWLA 1HV7A 1ELGA 3RMNH 1AN1E 3Q76A 1ELCA 3TK6A 2WPKS 4NCYA 2GGVB 3A88A 2FS9A 3TPIZ 2P59A 1FJSA 3GCTF 1BTUA 3PTBA 1UVSH 4FUHA 1SGRE 2CMYA 3GDUA 4B2CA 3UUZA 2XWAA 2A4GA 4ASHA 1TGSZ 1A61H 3SV6A 1QFKH 3SV2H 1M9UA 3EDXB 2IN2A 2FOGA 4AX9H 3MFJA 2FX6A 4DCDA 2CXVA 3SHAH 1WSSH 1HRTH 2PSXA 1P57B 1P01A 2GCTB 4WH8A 3M5LA 5EODA 4NG9H 1O5DH 1NY22 4D9RA 4UONA 1MQ6A 1XX9A 4K8YA 4MPWA 2FI5E 1S6HA 2ESTE 1HYLA 2CJIA 2G5VA 1HXEH 2FOEA 1O2TA 1Y3VA 3KEEA 2Y5HA 2BVXH 1TBZH 3P17H 3TGIE 3O8BA 3Q3YA 1OYQA 5EQQA 2QCYA 3A84A 1T4UH 1HDTH 1EAIA 5GCHF 1G3DA 4B2AA 2Z3EA 1G3BA 1MU8B 1LQDB 5JBCS 3TK5A 2ZPSA 2EEKA 2FTLE 4NA7A 1F7ZA 2M5TA 2XCFA 2ZU3A 3RXLA 2UUKB 1IHSH 1C2JA 1XUGA 1KXFA 1T7CA 2TGPZ 2OBQA 4AFZA 1GBAA 2BDHA 2GMTC 3E91A 2F9VA 1BJUA 1S84A 4F49A 2VNTA 1P09A 1A0LA 8ESTE 3CENA 3NKKA 1ZYOA 1GDNA 1HAYB 3D65E 3LT3A 1RFNA 1SHHB 4XBCA 1GBJA 1HB0B 2G8TA 1L1JA 1QCPA 2BZ6H 2C4FH 3UR6A 4JK5A 3SJ9A 2QA9E 1A0JA 1B7XB 1W0ZU 5FXLA 1TONA 1CHGA 4TPYA 2Z3DA 3A7TA 2W3IA 4YM9A 3MO3A 2G5NA 1AE5A 2Z3CA 4INHA 5IYTA 1C1RA 4MNVA 1EP5A 2P3UB 1SG8B 2O8WA 1TAWA 1KXCA 5HXFA 1SQOA 1C1QA 2FIRH 4Y7AA 4A7IB 2R2WU 1S0QA 2OQ5A 5FCRA 4IS5A 3KQCA 3S9CA 1EXFA 1V2NT 2AFQB 1HGTH 4DT7B 1PFXC 1WU1A 1ESTA 2PLXA 4IMZA 4DY7B 1GHAF 1OYTH 5LGOA 2P16A 1TPOA 2XC4A 4Q7XA 1SLWB 1VITH 4WWYA 1ANBA 4B76A 1OXGA 1XKBC 4Y10E 5F03A 2DE8A 4CRAA 3D62A 3SNBA 3UIRA 4MPVA 2VGCC 1LO6A 1V2PT 3BG4C 1MMJN 1GBTA 1GMDG 3SUDA 4BAQB 4F4OC 3GCHC 1GHBF 1EPTB 1Z7KA 4K69A 3QDZB 3M5NA 3UQVA 1KTTB 5J4QA 5DP8A 1V2VT 1MTSA 1O3CA 1LDTT 1O3GA 1C5WB 2Q6DA 3ZVCA 1GL0E 3E8LA 4AB8A 1ELFA 1Y3XA 2H5DA 3I29A 1SGPE 1RGQA 4JK6A 3PTNA 1C5NH 5DGJA 2FOFA 1DITH 4CH8B 1O34A 1ESAA 1C5QA 2B7DH 3Q3XA 3MH6A 3BTFE 1L4DA 1K1NA 1V3XA 1TOMH 1C5YB 1GHZA 3MU4A 1J17T 1O2NA 3SU2A 1GL1A 3T5FH 3QN7A 3LGYA 1WOFA 7LPRA 4IMQA 1QTFA 2A1DB 2ZU5A 2THFB 1DSUA 4ISLA 1OP8A 1FN8A 2HPPH 1Q3XA 1MKWH 1QA0A 2V35A 4CBNA 4MVNA 3ODDA 1O2MA 3A7XA 1H4WA 4AGKA 4CHAB 5H4IB 1MH0A 1ESBA 1P8VC 5FAHA 4D7GA 3PMBB 2NU3E 1SGNE 2C8XB 2PFEA 3HPTB 2GDDA 4WMEA 4AFQA 3BEFB 3B9FH 1V2MT 1TPPA 1EOLA 1SHYA 1MZAA 1AMHA 5GDSH 2BYAX 1YPHC 1BTXA 1VITG 1YPLH 4ZKRU 2WPLS 1G32B 3ZVGA 1BDAA 1PPBH 4AG2A 3RXMA 2BD3A 1PQ5A 3SGBE 5TCCA 5DG6A 1EAWA 1F5RA 1G2MA 2R2MB 2PGBB 3ZVFA 4LXBH 1ELEE 1SFIA 4Y8XA 2ZTXA 1HJ8A 1QBVH 1UTKA 1LHGH 4ABFA 4I8GA 2BTCE 3ITIA 4LOYH 1Q31A 4LK4A 1WTHD 3V12A 1S83A 3TLOA 1C1NA 1S81A 1DWBH 2FP7B 3E0PB 1EJAA 2HNTF 5ESTE 2BOHB 4TPIZ 1FV9A 1GPZA 1QB1A 1T8OA 2XC0A 1A5IA 1NTPA 1YYY1 5E0HA 1VJAU 2QF0A 1DVAH 5HM2A 2VIOA 2BDGA 1VGCC 2ZDNA 1JBUH 1PPCE 2BVSH 1ZTKA 1XXDA 2CF8H 1XUFA 1P2MA 2ZG0H 1GMHG 2OUAA 3S69A 4ISNA 2HWLB 1YCPH 4BXWA 1G9IE 2XRCA 4NA9H 1IQHA 1BIOA 2JH0D 3MNXA 1N8OB 5EXLA 2A7HA 3JZ2B 1QL8A 3V13A 1FQ3A 1W7XH 1IQIA 5JYIA 1MQ5A 4XE4A 3S0NA 4Y8YA 3SGQE 1BTPA 3EAJA 1O5FH 2VVCA 3V0XA 9ESTA 1ZPZA 2ZTYA 4XBDA 3U1IB 1QL7A 1VCQA 3DT0H 2ILNA 1P9SA 1JOUB 1TMUH 1TMBH 2BD9A 2VU8E 3HATH 5C20A 3FFGA 2F9OA 2G4UA 4MPXA 4SGBE 1C1VH 3DA9B 1C5RA 1P06A 2ALVA 5IDKA 2ZCLP 1D3TB 4OS7A 2PSYA 2UUYA 4WJG2 4YLUA 1DWDH 1QURH 1DWEH 1SQTA 3DHKH 4CR5A 2ZGJA 3L6PA 1E35B 1UVPA 2FYRA 4HI3A 5AF9H 1AVWA 3AAUA 2BY7X 3SJIA 2BVRH 2PHBA 1SVPA 2AIQA 2LPRA 1AO5A 1P2NA 2WV5A 3UWJH 2BY8X 5CHAB 5E8EH 3W95A 4GCHF 3AW1A 2UWPA 1Y5BT 1YLCA 1Y8TA 2ZIQH 1ANCA 1EAXA 1V2UT 3SUEA 4O3TA 2PTNA 1LVBA 2HNTE 3SW2B 1NT1A 1BMLA 2FM2A 4O97A 2WPHS 1RTKA 1QGFA 3C1KA 5PTPA 4B73A 1DOJA 5EG4A 3V7TA 2WYGA 4I33A 4JYUH 1KDQB 1O0DH 2O8MA 2BDIA 2FDAA 1EZSC 4JZDH 1BJVA 1O5GH 1ZHPA 1K2I1 1HIAB 1GBDA 3A82A 3TH2H 2FTMA 4TWYA 2CHAC 3ZZDA 1BOQA 4A5TS 4CRFA 1AUJA 4Q80A 1O3OA 5EU8A 1AZZA 1XVOA 1O5CB 4PROA 1G37A 2XWBI 1O3PB 1BB0B 2XBXA 1UTPA 2JH5D 1LQEA 3SU6A 3MU5A 1UTJA 4X8VH 1F0SA 2PW8H 1VITF 2IOTA 3M35A 2EI7A 2R3YA 1RIWB 2ZO3H 3ZVDA 5GWZA 2JETB 3B8JA 4X1QU 1FI8A 1AD8H 3MHWU 2VIWA 1FDPA 5F8XA 4OS4A 1GVLA 2BY5X 3UNSA 2WPMS 1GBCA 1GJ9B 3F9GA 3A8AA 5L6NH 1XUKA 3TJOA 2ZDKA 2C8WB 3VGCB 3ZZ7A 6ESTA 1GI4A 1ELVA 1Y3UA 3I77A 5GIBA 2ZI2H 3RM2H 4JZFH 2ANKH 1ELTA 3TGJE 1X7AC 2A32A 2SGDE 1OWDA 4X6MA 1FLEE 1K22H 4DOQA 1YP9A 2ZNKH 1IHTH 2A4OA 4I8JA 1HAVB 1GHAG 2ZHQH 1L1NA 4AYVB 1KYNA 2UUFB 2BD4A 1SL3A 2A2QH 1W11U 2RA3A 4I31A 1JMOH 1CBWB 3LC5A 1GJ8B 4FUBA 4THNH 3FP6E 3BTEE 2R0LA 2R0KA 7GCHG 2GCHG 2ZHWH 4YT7H 3UFAA 1S6FA 1C5MD 1SI5H 3BG8A 3UR9A 1BHXF 1TBRH 1P2QA 2NU0E 3UPEA 2PKSB 2OC1A 1GJBB 4ZKNU 1BITA 1O3AA 2I6QA 4NSYA 4BAMB 1S82A 1CT2E 2AERH 2BDYA 1O3EA 4DW2U 1WCZA 3VXFH 4CRBA 2A7JA 2BQ7B 2CV3A 1GHBG 1K1IA 2EI6A 2Q6GA 3RXHA 1OPHB 2FI4E 3AASA 1TNGA 4MNXA 3UWIA 1E36B 2BDBA 1QB6A 2PKAA 1Z8GA 3ELAH 2BXTH 1NESE 5EPYA 5T6GA 4X6OA 1PPGE 3G01A 4IC6A 1C5XB 4WVPE 3GY2A 5F8TA 1FY4A 1QJ6B 4X8TH 2BDCA 2H1UA 1C2LA 3MO6A 3SJKA 3DFJA 1ANEA 1C2HA 1FPHH 1HUTH 2W26A 1BUIA 3KF2A 1YM0A 1SGCA 5JBBS 3M3TA 3P70B 2Z94A 1E34B 2J94A 2SFAA 1C5TA 3Q77A 4YO9A 1UCYE 4CRGA 3SBKA 3IITA 1DLKB 4Y11E 1O2UA 2ZEBA 1QY6A 3MU1A 3SOSA 1TABE 1ELAA 8GCHG 1FZZA 4KTSA 2F9NA 3TJUA 1J14A 1E37B 4BNRA 1YF4A 3H7TA 1GCTB 2AGEX 4HFPB 2F9BH 3L3TA 2HGTH 4IN2A 4KTUA 5JB8S 4A6LA 1OSSA 3RC6A 3QWCH 3M7QA 2D8WA 3BEUA 3OX7U 1ELDE 2C8ZB 3CS0A 1SB1H 4VGCB 5A8YA 1F0UA 3A7YA 4U01A 2TPIZ 1V6DA 1AWHB 1KY9A 2PGQB 4AOQA 2OQUA 3SNCA 1PYTC 1YCPM 1N6YA 3ZYDA 3T27A 2SGEE 2BX4A 2ALPA 2O8UA 3A85A 5A0BA 4X2WA 1CHOG 2HOBA 3LJOA 1AKSB 1PPEE 4FU8A 3IWMA 6LPRA 1GJAB 1SLVB 2ZWLH 2BD2A 3SI4H 4BANB 2Y80A 1C5OH 2A2XH 3PROA 4NZQA 5GCHG 2FOBA 2FZZA 4OS6A 3VFEA 1ZRBA 3BTKE 1H9LB 1C1UH 1FAXA 1W8BH 2QXJA 3R0FA 4NGAH 2AEIH 3T25A 3P92A 1O2OA 3A7VA 5LPEA 1P2OA 4K1TA 4I32A 1AU8A 2XBYA 2ZTZA 4AN7A 3PMHB 3FANA 1OOKB 5B6OA 4BXSA 5EQSA 1BRAA 4AYYB 3UY9A 1AIXH 1LHFH 1V2ST 2QGRA 2OP9A 4K1SA 4GCHG 4KELA 1DWCH 2FPZA 4O9VA 5EOKA 1DY8A 3TITA 1GI9B 4WF8A 4DGJA 1TGNA 1GI7B 1ZPCA 1EOJA 1HIAA 3M37A 1Q2WA 1CGHA 2WINI 3LJJA 3KL6A 1ZMLA 2FS8A 1YC0A 3T62A 1W2KH 2D2DA 2FI3E 1PQAA 4MPUA 2AMPA 2QN5T 2ZDMA 1BZXE 3VEQB 1GDUA 1YPMH 2NU1E 1ZOMA 1GBLA 3I78A 4RN6A 1LPZB 1HXFH 1TB6H 1NN6A 3KN2A 3ZZAA 2ZFRH 1IAUA 3QGJA 4K60A 3ZZ5A 1GMCG 2BHGA 1DXWA 3TU7H 1O2YA 2BM2A 1NFYA 1C9TA 2BLQA 2TBSA 1C1TA 2WV4A 2J4IA 4INLA 5LPFA 1GJDB 3RXFA 1TGBA 1F0TA 2FXRA 1W14U 2J2UA 1OWJA 4HGCA 4IN1A 4B74A 2QXIA 3BV9B 1O2HA 2ZC9H 4TWWA 1E38B 2GTBA 1ZSJA 2W5EA 1UCYK 1CA8B 1O30A 3U98H 1MKXH 1L2EA 3ENSB 1K1OA 3EA8A 5JDUB 2QXHA 3BIVH 4FVBA 4QT8C 1QJ1B 5DJ7A 1F2SE 3P6ZB 1GJCB 1GWAA 2ODQA 4FUJA 4WXVA 1UK3A 2RA0A 2J92A 1O2RA 4KGAA 5HYOA 2ZGCA 1XVMA 2CF9H 3A80A 1O3KA 4CHAC 3F9HA 3BSQA 3RMLH 1S85A 1TNHA 4CRDA 1B0FA 1KLJH 1T32A 4H6SB 1C5UA 1AI8H 3T29A 1TNLA 2ODPA 5G4BA 3M61U 2Y7ZA 3FZZA 2A5AA 3K65B 4H6TA 2F3CE 1F5KU 1O32A 1CA0B 1DDJA 2FEQH 1Y3YA 4X2XA 3FZDA 2FOAA 2BLOA 1CU1A 4JCNA 1GHWH 4KTCA 3M36A 3GY5A 1GBBA 1ZLRA 3ODFA 2G51A 1RTLA 1MU6B 1Z6JH 4D7FA 2GV6A 1KXAA 1P02A 1BMNH 3VB4A 1O3BA 2OC7A 1WQVH 3SGAE 4B71A 2ANWA 4YESB 1TPAE 2DUCA 3EGKH 3RXUA 2G55A 2XTTB 1UCYH 1DUAA 4K2YA 3RXCA 1LVOA 1Y5UT 3LH3A 3RXAA 4K3JA 5LPRA 1QIXB 1UVOA 4VGCC 3Q00A 5JBAS 2Y81A 3GYMA 1O2VA 5C5NA 1XUJA 4A1XA 4CR9A 4X1RU 1ZHRA 2H5CA 1HJAB 2O8TA 3PB1E 4Y0YE 2KAIA 3RC5A 1TPSA 2ZCKP 3QTVH 3GISB 3LH1A 1BTHH 1XUHA 5FBEA 2ZU4A 5SGAE 1T8MA 5HM9A 3E6PH 1MTUA 1W13U 4R0IA 4YOGA 2EC9H 2NWNA 2Y82A 3FP8E 4Q7YA 4D9QA 1A1RA 4IW4E 5FBIA 3RXPA 1TRNA 2VB0A 1C2MA 1GHYH 1SGYE 1O2LA 7GCHF 4K5ZA 5FPSA 1H8IH 1LKBA 2HPQH 4MQAA 4ZMAH 2G00A 1O3FA 2YNBA 3K9XB 1MBQA 4BTUB 1DS2E 2K1QA 2AS9A 1D3QB 2WPJS 3AW0A 2ZFTA 3S9BA 3RUOA 1UHBA 2WUCA 1UO6A 4LZ1H 2PR3A 2B9LA 1FXYA 4WMDA 4I8KA 4X8UH 3SU0A 3BF6H 3L33A 5A0CA 1IQKA 2ZGHA 4ABBA 4UFDH 4XOJA 3RU4D 4A1TA 5GPIB 1ZTJA 3SNEA 4Y0ZE 4BOHA 4CRCA 1P12E 1P9UA 2A4QA 3GY3A 3MTYA 2OXSA 1TNIA 4FXGH 1SGDE 3U1JB 2EA3A 1A3BH 3LGUA 9LPRA 3ATIA 4MTBA 1QHRB 1LHCH 1G3CA