1TNLA

Prediction of novel serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA02
2CGAA 3RXOA 4OGXA 5AFZH 1A0HB 1M9UA 3ZVDA 1NO9H 2VIWA 1GBHA 4ABJA 3QN7A 1TOMH 1PQ8A 5BRRE 1OP2A 1OP0A 1SQTA 3SUDA 1AIXH 4IS5A 1HAOH 1FAXA 1GJ8B 3PLPA 1FJSA 2DE9A 5SGAE 2BQWB 1IHSH 5J4QA 7LPRA 2WPKS 4NFEA 1P03A 2CHAB 1NPMA 1AO5A 1C5TA 1DE7H 2ZPSA 4XFQA 2QN5T 1ACBE 1XM1A 2GX4A 1GMHG 1N6XA 2XCNA 3Q3KA 1FY8E 1BB0B 2VH0A 3HK6B 4U30A 3E8LA 3V13A 2FWWA 4IN2A 1O2YA 1O2MA 3QZRA 3M5LA 2AIPA 3EAJA 1LVBA 1P2KA 5LH8A 1TRMA 3UTUH 3PB1E 3MO3A 2I6QA 4MPXA 3A7TA 1OKXA 1GHYH 1LCYA 4PROA 1ZGIA 1MH0A 5EXMA 1J9CH 5AVDA 1BOQA 1UTMA 1YM0A 1B0EA 3P8NA 5F8XA 1WOFA 1XKAC 2QA9E 1UMAH 4MPWA 4JZDH 3DA9B 2CF8H 1AWHB 3BG4C 1C2EA 1PPGE 1JRTA 1QJ7B 1ZHMA 4KP0A 1TGSZ 2ZGBH 4XSKU 5HGGA 3A8AA 1UTQA 1XUJA 1OWEA 1TA6A 2BD4A 2A4OA 5PTPA 1C4Y2 3QGNB 1AB9B 2TIOA 3BG8A 4KTUA 1DY8A 4D9QA 1LQEA 2BDAA 1XUFA 4FU7A 4B2CA 1FN8A 3I78A 4BTIB 5DO4H 2R0KA 2ZA5A 4HI3A 4NG9H 1GGDC 1O37A 2C3SA 3TK9A 1SGIB 2G51A 8GCHG 1DWEH 1A61H 1UJ1A 1AVGH 1Z8GA 4LZ4B 1CGJE 1AFEH 2OC1A 1BBRK 2ZU5A 1SGTA 3UR6A 2XC4A 2HVXA 3VEQB 1O3FA 1C2IA 4DIIH 2OQ5A 2H9HA 3P95A 1MAYA 2GV6A 1GBTA 4JYTA 1RD3B 1SGFG 3V0XA 4X1PU 1LPGB 3TVJB 6LPRA 3CP7A 3RXGA 1C5MD 2IN2A 1G2LA 2DUCA 3R0FA 1UTNA 5C5OA 5LPRA 3I77A 3GCTG 1OX1A 1BTHH 1AZ8A 3IWMA 3UFAA 1ZYOA 4BAQB 4ISLA 2RA0A 3FAOA 4GVUA 1IOEA 3UY9A 3SJ8A 4B73A 4CRBA 2LPRA 1EAXA 4AOQA 1GMDF 1VCWA 2OC8A 1FY1A 4K60A 4E06H 1E37B 1TNKA 2ALPA 5J4SA 3DD2H 2FM2A 2PSXA 2BD8A 1FIWA 3MU4A 4Q7XA 4MNVA 2YOLA 1D4PB 3HKIB 2BVXH 1ZMLA 1ZSKA 1FZZA 1C5LH 1VITG 1VCQA 3BTHE 4ISIH 3MH5A 3U9AH 2FO9A 2HRVA 4ZKNU 1GJ9B 2BLVA 2ZTXA 3LT3A 4RN6A 2BB4A 2FOHA 1DWDH 1KLIH 3URDA 4MG3A 1PQ7A 3SI4H 1CQQA 3ZYDA 2P3TB 1DITH 1SFQB 3GCHC 3HGNA 4ZROA 1V2RT 1NU9A 1YYY1 2Z7FE 4OS5A 3SU5A 2ODYB 4J2YB 2ZDNA 3ZV8A 2BMGB 4AG1A 1RJXB 2A7JA 3T25A 2NU3E 1XUGA 4H4FA 5ABWA 1Z8RA 1RTLA 1FNIA 4CREA 1YPLH 2J38A 3RXCA 1N8OB 2VIVA 5F8TA 4K5ZA 1CGHA 1K22H 3GDUA 3PO1C 4AYYB 1GVLA 1O5CB 2ZTYA 1O3BA 2ZGHA 1EP5A 1DUAA 4INHA 5GCHG 2ANWA 2FDAA 2VIDA 2ZPRA 1UCYK 3UIRA 3LJJA 4DOQA 2OQUA 5DP9A 2P8OC 2VGCC 2Y5HA 2ZFTA 3LOXA 4OS1A 1EKBB 4X6OA 4O3UA 1P12E 1DM4B 3FANA 5FPSA 2ZU3A 5GXPA 1LVOA 1TBZH 2TGPZ 1WBGB 3GOVB 1BTPA 1DFPA 4MQAA 3M5MA 1C5PA 1Y5UT 1C1WH 2NU2E 1NZQH 5DKMA 1TBQH 1AHTH 1GI2A 1GJ7B 4WVPE 5DJ7A 1GDNA 4QT8C 2PV9B 6CHAB 2Y80A 2J92A 1QJ1B 2Q6DA 4IBLH 3F9EA 3OY5U 2HGTH 1C1VH 3NKKA 3T28A 1ELGA 1TX7A 4WMFA 3K65B 3E3TA 2O8LA 1BTXA 9ESTA 4D7GA 3BTFE 4K3JA 1YLDA 1L4ZA 1WSSH 1P9UA 3OSYA 1TIOA 2FX4A 1V2JT 3MWIU 3LGWA 3MTYA 1QFKH 4Q7ZA 3BF6H 1PPHE 2BD2A 4DVAU 2WPHS 3EYDA 4HTCH 3RC4A 1QRZA 3Q00A 1IQJA 3KEEA 5LPEA 3TLOA 2ZO3H 1K1JA 4I8JA 1WTHD 1A4WH 1BHXB 1LDTT 2ULLA 1AN1E 2C93B 4B74A 1EPTB 3TH3H 2ANMH 1O2OA 1J17T 1V2UT 1K9OE 5DP8A 4F4OC 1YGCH 1ZJDA 3GY7A 3F6UH 5BPEA 4B2BA 3ZZ5A 1MU8B 1GJDB 2BLWA 2FOCA 2HALA 1EB2A 1P3EA 4X8UH 3BTME 3GY3A 2BTCE 2BZAA 3GDVA 3S69A 3URCA 5DK1A 1W12U 4YOJA 3FFGA 3PWBA 4A5TS 2Y5FA 3VB6A 2F9PA 3VB5A 1BCUH 1QB9A 3B23B 2A5IA 3GCOA 4ZUHA 1C5UA 3L3TA 2G4UA 2QYIA 1QCPA 2GP9B 2FLRH 1CSOE 3TJUA 4NZLA 2ZDVH 2BDHA 4I32A 1L1JA 4YLUA 1CVWH 1IQEA 4IW4E 2VIQA 1LVYA 3FZDA 3P6ZB 1KDQB 1W11U 4X8TH 5HXFA 1F7ZA 5E0JA 2EEKA 1GPZA 1MKXH 1PPEE 3MO6A 2QC2A 3E90B 5EQRA 4A92A 1O2RA 1O2SA 1TNJA 1S83A 1MKWK 2ZDMA 1UK3A 1SHYA 1DDJA 1E36B 1MU6B 5DP4A 3MH4A 4H42U 4M7GA 1QA0A 1AUJA 3UUZA 3LC5A 4AGJA 3BN9A 1C1TA 1F0UA 1LKBA 1QQUA 5L6NH 4Y76A 2VIPA 1YPMH 1SGPE 1Q2WA 3T2NA 1PYTC 1ESAA 3ODDA 4AYVB 3P92A 6ESTA 3ZZ6A 4DT7B 1QL8A 2ZC9H 2XC5A 1P06A 2ZU2A 3QO6A 4DCDA 3LH1A 1HPGA 1J16A 3KQBA 2BDCA 1GBJA 5E0HA 1IHTH 2FP7B 2HWLB 1XKBC 4Y10E 2PFEA 3LJOA 4B75A 3HGPA 3BTTE 2B5TB 1O2XA 1DXWA 1ARBA 1AE8H 5EODA 1C2DA 3RU4D 1HIAA 1RS0A 1T8LA 4DG4A 3RXUA 1C2HA 2F91A 2O8TA 2PHBA 2Q1JA 5AFYH 4ABBA 2FZZA 4RKJB 2A0QB 1TX8A 1KYNA 1LHCH 2A4GA 2GZ7A 3M3SA 4AFSA 3D23A 3UOUA 1TNGA 4LK4A 1PPCE 4GSOA 4CBNA 2J94A 1HAIH 4A6LA 5DP3A 2VWLA 1OSSA 1D9IA 1EATA 4WF8A 5L30H 2Z9KA 1S85A 2AIQA 2TPIZ 3KN2A 2EI8A 2J9NA 5GJ4B 3ATWA 1LVMA 1CHOG 1OYTH 2BX3A 2ZFPH 4NCYA 4A1XA 2JH6D 4A1VA 1V2PT 1H9LB 3QLPH 1A2CH 1GVKB 1O3LA 2OTVA 2F9BH 3W95A 4NGAH 2BDIA 1G37A 1Q3XA 5A0CA 2IPHA 2Y5GA 1C1UH 3DFJA 1QB1A 3LONA 1XVMA 1V2TT 5EXLA 4AFUA 3T26A 1NM6A 3RXPA 1C2LA 3BTKE 3BIVH 2V3OH 1AY6H 1MBMA 6GCHF 1SOTA 3V12A 2R9PA 3MNXA 2BX4A 1L2EA 2ZKSA 1O2LA 2PKAA 3ATKA 1XUHA 4CBOA 1NFWA 1NY22 3U98H 1T8OA 1ANEA 1A5GH 2BQ7B 3TH4H 1B5GH 1W10U 2ODPA 2RG3A 2ZHFH 4JZEH 1BMNH 1MCVA 5IDKA 1XMNB 2Y82A 1YLCA 2H6MA 1CGIE 1ZTLA 1W3CA 5JBAS 4FVBA 4K8YA 3EA8A 4YT7H 1GCTC 1YBWA 2GMTC 2JETC 1EP6A 1EXFA 3BTEE 3RXRA 1BZXE 1AUTC 1IAUA 1DUEA 3VB3A 4FUGA 5TCAA 8ESTE 1TE0A 1AQ7A 4UD9H 1BA8B 1ELEE 7GCHF 3A7WA 3RC6A 2Q6FA 4X8SH 4GHTA 2STBE 1DT2A 1KXDA 1G32B 2XXLA 1EZQA 3RXHA 1PPBH 3SNAA 2RDLA 2I6SA 1TMUH 4CR5A 5EQQA 3DT0H 1O3DA 3SGQE 2CV3A 1IQMA 4UFDH 2PTNA 3S9AA 3MU0A 1LQDB 2ZGCA 1QNJA 2P93A 3LDXH 1C1MA 1K28D 1Y3YA 5JYIA 1XX9A 1GJCB 1UCYE 1C2KA 4I7YH 2O8WA 4CRAA 4H6SB 1SLWB 1XXDA 2WUCA 3VGCB 2NWNA 2PSYA 2PUXB 2HNTE 1P8VC 5LPFA 2FIRH 1GI0A 1UVSH 2OINA 1LHEH 1UK4A 3AVZA 2M5TA 1THPB 1C5XB 1CA0C 2OC7A 4K1SA 4TY6A 1SGCA 2J95A 3RM2H 4CRGA 1THRH 1LHDH 1O3JA 1NRPH 4FUFA 8LPRA 1HJ8A 3RXDA 1GBAA 2BDYA 2A5KA 3KIDU 3A7ZA 3IITA 3SU2A 5HYOA 1WQSA 2OC0A 2AH4X 2VINA 3SNDA 1C5RA 1CE5A 3T5FH 3RXVA 4NA8A 1BMMH 1TQ7B 1GJ6A 4TPIZ 1AKSA 4LZ1H 3SV7A 1XUIA 1EQ9A 1ARCA 1C1RA 2JH5D 1XUKA 8GCHF 1C1OA 2ZHWH 2ZP0H 3U8OH 1L4DA 5C20A 1SGYE 3ZVAA 3SUEA 1Z8JB 4FUCA 4LOYH 5FPYA 3SJOA 3D62A 1BTWA 1K1OA 2A1DB 1CHGA 4X6PA 3STIA 3RMOH 4AG2A 1QY6A 1ZHRA 5GCHF 3QTOH 1WQVH 2PGQB 1HAXB 4MNYA 1P9SA 3P8FA 4AFZA 1O2KA 2FOFA 3RU4T 2BVSH 2FS8A 1BRAA 1HAGE 1AKSB 2FTMA 5C1YA 1BRBE 2R0LA 1HUTH 1PPZA 4INLA 2BD7A 4YZUA 1ID5H 2W3KA 1O5FH 3SHAH 4UFFH 2XC0A 1UO6A 1H9HE 4WWYA 5EU8A 1H4WA 2PW8H 4E05H 9LPRA 1UVPA 3MYWA 3VPKA 4YTAA 3TH2H 1BBRE 5I25A 1GMCG 1C9PA 1C5SA 3SNEA 4WMEA 2ILNA 4ZKRU 1HB0B 3E16B 1BTZA 1AI8H 1ZR0A 4Y8YA 2UUFB 3LPRA 2JKHA 2TGTA 3GCNA 4XOJA 4YOGA 1GHXH 1D6WA 4ZMAH 1QIXB 2H9EH 4D8NA 3UOPA 1VJ9U 1AU8A 4ZH8A 3VGCC 1NFUA 2VGCB 4NIXA 3TJOA 1ETTH 3ZZ8A 1O3IA 2BD9A 1E35B 2ZCLP 3RUOA 2ZDKA 3QK1A 4ASHA 1MZDA 4GHQA 4ISNA 2QV1A 5C3NA 1SPJA 3SQEE 3ZZ9A 3FP7E 1RRKA 2ZWLH 2ZFRH 4FU8A 3T27A 1C1PA 1SLXB 4UFGH 3TK5A 1BBRH 1T7CA 2NU0E 2G5NA 1EOJA 1GI1A 1YCPH 1ORFA 1P0SH 1ZGVA 1P2MA 2STAE 3KNXA 5GWZA 1W14U 3ENSB 1OWJA 2RA3A 2BY6X 5E8EH 4FUBA 1QBOA 1AB9C 1WV7H 2F9UA 1AZZA 1GI8B 5DGJA 1C5NH 4UDWH 1O36A 1H1BA 1VITH 4VGCC 2J34A 1G30B 2FMJA 3ZZ7A 2VH6A 1B0FA 3MMGA 4WMDA 2IJOB 4B2AA 3RLYH 1FUJA 5H4IB 2GVFA 3EE0B 2CXVA 3AAUA 1EOLA 2NU4E 1Y3VA 2AMQA 5JDUB 2G81E 4YOIA 2BLQA 2VVUA 3AW0A 1LKAA 3U1IB 1C1NA 3U8TH 1EJMA 3U1JB 1W0YH 2GGVB 1LHFH 4NIYA 4GLYA 2C4FH 2WV4A 1O3NA 2WINI 1ZRBA 3TGKE 2A31A 1NFXA 2FXRA 1P01A 1O3HA 2AMDA 1BTYA 3A87A 1GI7B 3GY4A 3ATMA 1Z1IA 1TX6A 1AWFH 2BXTH 5JBTA 3ZZDA 3ODFA 1JIMA 1DOJA 2OBQA 3ZVCA 1A3BH 4RKOB 2QGRA 7GCHG 3SV2H 2Y81A 3A7XA 4UFEH 1ZOMA 2XYAA 1LPZB 1IQIA 4ISHH 1YPEH 2QIQA 1YPGH 4Q2KA 1O2QA 1UTLM 1QBVH 5LGOA 1ABJH 3KQDA 5A8XA 1EZXC 1AE5A 3F1SB 3SNCA 1UTOA 1NN6A 1PPFE 1C1QA 1GHBF 5EOKA 3SNBA 2THFB 1EZUC 1H8DH 4GUXA 1FPHH 2C8YB 2O8UA 5TCCA 1TNIA 4HZHA 3MHWU 1V2KT 3QTVH 1NROH 3N7OA 2R3UA 5EPNA 1GI9B 3KL6A 4BAKB 4FUIA 4NIVA 4O97A 4VGCB 3GYLB 1W2KH 1NRRH 1HNEE 1IQHA 2OCVB 1W0ZU 3P17H 3L33A 1GBDA 5FBIA 1THSH 2AGIX 1UCYH 5E0GA 1BUIA 5AHGH 1EJAA 1A5HA 3BV9B 2BYAX 1QQ4A 1B7XB 2W7SA 2G52A 1C4V2 1FAKH 1KIGH 1K1IA 1SR5C 4IMQA 3MOCA 2Q6GA 2ZI2H 3F9HA 1Y8TA 6CHAC 2KAIB 5A8YA 3B9FH 1GJBB 2BY9X 2UUJB 1TOCB 2FEQH 1NESE 1TMBH 1D3PB 1C4U2 3DFLA 2Z3CA 5CMXH 1PFXC 3O8CA 1C9TA 4ISOA 4ABDA 3BTWE 3BSQA 5F03A 1TGCA 1YPKH 3A84A 5B6OA 2BZ6H 3BG4B 1K1NA 1G2MA 1SG8B 2FOBA 4ABHA 1AVXA 2QXIA 1A5IA 2ZGXH 5GPIB 1WAYB 1ZRKA 4JK6A 1ELDE 5FAHA 4I31A 4DURA 4MNWA 3SU1A 3LIWA 1MZAA 4ZKOU 4D9RA 4ZAEA 3SU0A 2BHGA 1FDPA 1O2VA 1K2I1 1Y3WA 1JMOH 4BOHA 2UWLA 3SBKA 1GBKA 1FY3A 1RGQA 2OLGA 4X8VH 2PR3A 3LGUA 4BAMB 2ANYA 3KGPA 3H5CB 4AZ2B 1DLKB 1L1NA 1YPHE 2OUAA 2FS9A 2GCTC 1P2JA 4B71A 4FUDA 5EW2H 1IQLA 3B8JA 2ZGJA 4X6NA 1O3GA 1D6RA 1A0LA 4GAWA 2CN0H 1G3EA 1SLVB 8KME2 1TPAE 4AX9H 2ASUB 1EPTA 2WPIS 1E0FD 1ANDA 1SC8U 2XRCA 3K9XB 4AB9A 4B76A 1GWAA 1OWHA 1FQ3A 2GZ9A 4IC6A 2OXSA 2HPPH 1C2GA 1Q31A 1GG6B 3S9BA 1HBTH 3OU0A 1OWDA 2A32A 5ESTE 4X1RU 1AGJA 1O31A 4CH8B 1TGBA 1DSTA 1SGNE 1UHBB 1S84A 3K6ZA 3BTQE 4ZXYH 2WPJS 3UNSA 4BANB 1HAVA 1HXEH 2EC9H 3LGYA 3STJA 2PLXA 1O3CA 1P10A 1EAUA 3O8BA 3NPSA 3S7HB 1GI6A 2FYRA 4INKA 1HLTH 7KMEH 1OP8A 4YLQH 4AB8A 3ZZAA 1TQ0B 1OYQA 3VXEH 1GMDG 1BDAA 2JETB 1IQGA 2C8ZB 3TK6A 3EGKH 1F5RA 2AS9A 3M5OA 1BMLA 3MU1A 1ETSH 1YP9A 5A0AE 2ZCHP 4MLFB 1QHRB 2WPMS 1EJNA 4X6MA 4XBBA 1KSNA 1TA2A 3A7VA 2SNWA 1SVPA 5T6GA 3MFJA 1AD8H 1LMWB 3M7QA 4Z6AH 4XE4A 2WUBA 1MKWH 1O2HA 3VFEA 2ZG0H 1O5GH 1TALA 1QL9A 2PWXA 4NA9H 3SHCH 1JOUB 2H2ZA 3TGIE 3QDZB 1NTPA 4Y11E 1BRCE 5JBBS 5A8ZA 1EX3A 2QXJA 5CE1A 1S0RA 1CT2E 1GHZA 4O03A 5TJXA 2VB0A 2ZZUH 1EZSC 1ZLRA 2VWNA 1Z6JH 3FVFB 3P8OA 1TNHA 3ITIA 1QR3E 2XBXA 3RLWH 5JBCS 5F6MA 4TWWA 2GD4B 4WY3A 3A81A 1MQ5A 1SI5H 4YO9A 4CHAB 5FX5A 4MPUA 2OP9A 2SGDE 2GMTB 1KXBA 1RTKA 1GGDB 1HV7A 2GDDA 2XBWA 2Z9JA 3LC3A 3A89A 3PLKA 3RXAA 3TGJE 3RXLA 3ZVFA 1TFXA 2F83A 2C90B 1U6QA 1SGRE 1O3AA 5FCRA 4D7FA 2SGQE 3A8CA 2GT7A 3M3TA 1GMCF 4MNXA 3ZVBA 2AERH 4YESB 3KCGH 1Y59T 3GY5A 1V2VT 3VB4A 4E7RG 2ZCKP 1MUEB 1GHWH 1YC0A 4X2VA 1FY4A 1DLEA 2H5CA 3LKWA 1P57B 5DG6A 2G8TA 1GJAB 1O5AB 2H9TH 1QTFA 3RMMH 2Z3DA 3QWCH 4IGDA 3Q77A 1BHXF 1A0JA 3GDSA 2IOTA 4X2XA 5L2YH 2R3YA 3C27B 1G36A 1GHBG 2SGAA 4K2YA 2BOKA 2UWOA 1W8BH 1WYKA 1TMTH 2A5AA 1K1LA 1QB6A 1ZPZA 2QY0B 1S5SA 1SOZA 1O2WA 1SL3A 3UQVA 2GCHG 1SSXA 1MTVA 4JZ1A 1EAIA 1AFQC 1PQ5A 2W7UA 1S81A 5FX6A 3NCLA 5DP7A 5JB8S 3PO1B 4BNRA 4CHAC 4MVNA 1ABIH 3NZIA 4OS6A 3SV8A 3VB7A 1MCTA 3PTBA 3V7TA 1DX5M 4UEHH 5JPMH 2A4QA 4U32A 2G5VA 1ETRH 4ZKSU 2PUQH 5T6DA 4BXSA 1O3MA 2F9VA 3Q76A 5FXLA 1ZMJA 3P70B 3UNRA 1O2UA 4KTCA 2D2DA 1GMHF 3EA7A 4K1TA 1LTOA 4Y0ZE 4CRFA 3GISB 3TPIZ 1OWKA 5C2ZA 1VR1H 1GDQA 3BEFB 5EXNA 2BD5A 2HNTC 2C8WB 1CT4E 5FHTA 1TBRH 1V2LT 3A83A 1FI8A 1BMAA 4ABIA 3Q3XA 1GI5A 3LH3A 1QL7A 2JH0D 2P16A 3H7TA 1D3TB 1N8OC 3S9CA 2W26A 4ESTE 1KXCA 2GKVE 1TB6H 4A1TA 3P8GA 3SORA 1O34A 3SI3H 2EI7A 3D49H 1TPOA 1GJ4H 4Y71A 4BXWA 2SNVA 2P8OB 3RM0H 3SV9A 2ZQ1A 1UVUH 2SFAA 1F0SA 4Y0YE 1J14A 1GBBA 4A7IB 5HMAA 3SUGA 2A2XH 2Z9IA 2GZ8A 2XNIA 1G3CA 3O8RA 1CA0B 4Y79A 1F92A 1RTFB 4Y7AA 1EASA 3TU7H 1JRSA 1BJUA 5IYTA 1KY9A 4OGYA 1ZHPA 1O30A 1QBNA 2EA3A 1FN6A 3MH6A 3RXFA 1Y3XA 4XBCA 3AW1A 1ESBA 1ZTJA 2XWAA 2VNTA 3M61U 1HGTH 1RXPA 1ZZZA 2HOBA 1Z6EA 1UVTH 3ZYEA 1NRNH 1O33A 1WU1A 3UWJH 5A09A 5HM2A 2P3FH 1V3XA 1YKTA 4Y8XA 4K8BA 1DY9A 2BLOA 1A46H 1SLUB 1O3EA 3UREA 2VWMA 2ZTZA 4X1QU 5G4BA 4H6TA 1H8IH 3ESTA 4FUHA 3C1KA 1ZSLA 2FPZA 3ZZCA 2V0BA 4JMYA 1N6YA 2R2WU 2ZIQH 2A45B 1GI4A 2ZU4A 1RIWC 2WPLS 2UWPA 1TRYA 3LGIA 2O8MA 2BDBA 1ZTKA 1MD8A 3I29A 1UTJA 3ZZ4A 1S6FA 4XBDA 4TPYA 2WYGA 1S0QA 1V2OT 2FESH 1KXAA 5EQSA 1ZMNA 2CHAC 4GCHG 2AFQB 1KTSB 1WCZA 1F0RA 4Z0KA 1UTPA 3M7UA 3PV4A 1E34B 3ZZ3A 2Z94A 1YCPM 5DPAA 1D3QB 1FPCH 4X2YA 3BIUH 2ZNKH 3PMHB 1OOKB 5EGMA 4BTTB 1EB1H 5C1UA 3SW2B 3A80A 1C5QA 1EAWA 1Z1JA 3DHKH 1SGFA 2PKSB 4BAOB 1C5WB 1GG6C 3KQCA 1TLDA 1KXFA 2FOAA 1DVAH 4IC5A 1ZPCA 3KF2A 5E2OA 1CBWB 2XBYA 1OPHB 1VGCB 3NUMA 4MDSA 3S0NA 1SB1H 2FTLE 1P05A 6GCHG 2Y6TA 5FCKA 1NFYA 4IN1A 1DWCH 1JIRA 1TAWA 1O5DH 3RXBA 1OXGA 1TGTA 3Q3YA 1TGNA 1GBIA 3ZVGA 1ELCA 1P09A 1O2ZA 3FP6E 5F8ZA 1F5KU 2B0FA 1HXFH 1BITA 1K1PA 3SU6A 1HAVB 2FOEA 3SO3A 1V2ST 3HK3B 3RMLH 2BQ6B 3MNBA 1WTGH 1HCGA 1SGQE 3A88A 2V3HH 2DE8A 4JZIA 1O2IA 4LXBH 3RXJA 1G9IE 1SBWA 3TNSA 3A86A 1GCTB 3ELAH 3EQ0H 4DGJA 3SGAE 1ELFA 2TBSA 3PM3A 1WUNH 1O2JA 3TITA 1Z8IB 4I8KA 4CRCA 4FXGH 1FY5A 3ZZBA 3HKJB 1RFNA 3LGVA 1MTNC 1Z71A 2ZQ2A 3PYHA 1JBUH 4CH2B 4NWLA 3RXEA 4K69A 2SGEE 1FMGA 2LNCA 5T3HA 1BJVA 3RXSA 3TJVA 4JYUH 1TPSA 4Y6DA 1F5LA 3G01A 2O9QA 1TWXB 3EA9A 4O3TA 1F2SE 2CMYA 3GY8A 1C5YB 2F9OA 2QAAA 1L1GA 3O8DA 1GVZA 2BY5X 4WH8A 3FP8E 1GBEA 3SJ9A 2VVCA 2VWOA 3RC5A 3SN8A 1YPJH 4O9VA 4CRDA 1HAZB 3MU5A 3MNSA 3S7KB 4ABAA 2GDEH 1D3DB 1QGFA 3L6PA 1C1SA 2XCFA 1MTUA 1QURH 5L2ZH 4UE7H 1VCPA 1MMJN 3SU3A 3QGJA 1P02A 1S82A 1CO7E 1BQYA 1ELVA 4IMZA 4F49A 3CENA 1CU1A 4WJG2 5K0HA 1VITF 1C2FA 1CT0E 2Z9GA 5CHAC 1V2NT 3M35A 1GL0E 1LHGH 1HAPH 3MNCA 3SV6A 3UWIA 4RSPA 2TGDA 1SHHB 4X2WA 2VVVA 2RCEA 2FI4E 5I46H 4DIHH 1GBFA 1BT7A 1YF4A 3FZZA 1A3EH 4THNH 3UR9A 1SQOA 4DJZB 3E0NB 3M36A 3HATH 1Z7KA 2BOHB 4U01A 1UHBA 1C2JA 5A0BA 1L0ZA 3TNTA 1P2IA 1S6HA 1MTNB 4XDEA 2F3CE 3CS0A 1O38A 2ANKH 4TY7A 3PROA 1DICA 5HM9A 4YM9A 1X7AC 5GDSH 3GY6A 5K7RA 2ZPQA 3R3GB 1DSUA 4MPVA 1YCPK 1ELAA 3M3VA 1ZJKA 1BRUP 3SUFA 2AMPA 4DW2U 1C5ZB 3E1XB 2P59A 4AN7A 1IQFA 1UK2A 3UNQA 3BEIB 5ESBA 3AAVA 1UTKA 4JCNA 2AEIH 1O3KA 1K21H 4AGKA 1J8AA 3BEUA 2H1UA 4OS2A 1JXPA 1Y5AT 2OBOA 1FXYA 2KAIA 1GBMA 1KLJH 1T32A 3ATIA 2QF3A 3SGBE 4ZHLU 1O2PA 5C1XA 2ZHEH 1GHVH 2R2MB 1PJPA 1BIOA 3RXQA 3A8BA 4NIWA 1CBWC 2BXUH 3QZQA 2XBVA 4D76A 3MO9A 2TGAA 3F9GA 2QXGA 3VXFH 2PKSC 2Z6BD 1KXEA 1TONA 1DS2E 3ZVEA 4ZXXH 2P95A 2VU8E 2FOMB 1ELBA 4ABFA 3WY8A 1O5BB 3KHVA 2BVRH 2GV7A 4GCHF 3UQOA 1INCA 2ZHQH 4FUJA 1NS3A 3PWCA 3GCTF 1KLTA 1MKXK 2G4TA 2FI5E 3K2UA 3H7OA 1HDTH 1V2MT 3KQEA 1MTSA 1HFDA 3SJKA 1E38B 4OS4A 2K1QA 1SMFE 4E7NA 1HYLA 4HGCA 1SFIA 3U69H 2QXHA 4FVDA 3RDZA 1C5OH 2F9NA 2HNTF 2A4RA 1PYTD 1MAXA 1VJAU 1DPOA 2FLBH 4GPGA 4NFFA 4JZFH 4R0IA 1AMHA 4I8HA 4TYDA 2ZECA 2V35A 2XWBI 2ZHDA 4NWKA 2PKAB 4SGAE 2ODQA 1O3OA 2W5EA 1IQKA 1NU7B 1HIAB 4CR9A 3HPTB 4KELA 5CHAB 4TWYA 2QCYA 2B7DH 4KGAA 1YPHC 1W7XH 2CJIA 2BM2A 4WH6A 3OTJE 5EPYA 1ZPBA 4X1SU 4KTSA 1W13U 3PMJA 3SOSA 1T4VH 4BAHB 1TRNA 4K1EA 5AF9H 3A85A 1AVWA 2OD3B 2ZDAH 2FYQA 3CS7A 3RXIA 1MD7A 3V3MA 1W7GH 2ZDLA 1HAYB 1IQNA 3E0PB 1G3BA 5T6FA 4Q80A 1Y5BT 5JB9S 3AASA 1T8MA 1J15A 3ATLA 2EI6A 1QA7A 2A2QH 4JYVH 3RU4E 1N1LA 1UVOA 4MTBA 2PGBB 2XTTB 1HJAC 4AFQA 2J2UA 2G55A 2C8XB 2YNBA 3K6YA 3IG6B 4Y7BA 3JZ1B 2VJ1A 2D8WA 2A7HA 3RXTA 3RXMA 2H5DA 2P3UB 1GBCA 5FPTA 1O0DH 1GJ5H 2B9LA 3A8DA 3PLBA 2ALVA 1TNLA 1GI3A 3LGTA 3MH7A 1GHAG 1GHAF 4R8TB 1O2NA 3SZNA 3JZ2B 1ESTA 2ESTE 2CF9H 2G00A 1TPPA 2PTCE 3EDXB 5C5NA 3SQHE 3GCHB 1GDUA 4I33A 1FIZA 5ETXA 1T4UH 1A7SA 1P2OA 3RMNH 5GIBA 3QUMP 2VIOA 1K1MA 1NT1A 3U8RH 1DANH 1SGDE 2HLCA 2ZFQH 4AORA 5C67A 2GTBA 2BD3A 1P3CA 4NSVA 1ELTA 1T31A 1ANCA 1P11E 2ZF0H 2GT8A 1RIWB 1ZSJA 3ZV9A 5A2MH 1HJ9A 3W94A 4J1YA 1NRSH 3NWUA 5DP5A 2BDGA 3UPEA 3PTNA 4SGBE 4NSYA 1OS8A 2B8OH 2J4IA 2A7CA 2FX6A 3T29A 2ZFFH 3A82A 3M37A 5EW1H 4DY7B 1HJAB 3RXKA 1O32A 2YNAA 2UUKB 3OYPA 1O2TA 3M5NA 4ABGA 1EUFA 3NK8A 1O5EH 3BTGE 3DUXH 4FUEA 4B1TA 3D65E 3PMBB 2SGFE 3F68H 3LU9B 2GCTB 4KKDA 3SJIA 1FONA 1C2MA 1LPKB 1XVOA 2V6NA 2D1JA 1DWBH 1BTUA 2GCHF 3GICB 4BTUB 4I8LA 1QJ6B 2HPQH 2AGGX 4FU9A 2BY7X 4X0WU 1QRXA 1HRTH 1KTTB 2W3IA 1G3DA 3OY6U 3E91A 4ABEA 1DXPA 1CHOF 1VZQH 1KDQA 1P2NA 2Z3EA 3M7TA 1F0TA 1T8NA 4WXIA 1NRQH 1P2QA 1CA8B 2WV5A 1VGCC 2FI3E 1GCDA 2AGEX 4ZHMU 2Y7XA 1FLEE 1MQ6A 2Z9LA 1FV9A 4UONA 1V2QT 2P94A 1AFQB 1SGEE 2XW9A 3GYMA 2FOGA 5E2PA 1PQAA 7ESTE 3MI4A 3RP2A 5DP6A 3SU4A 1O2GH 1GBLA 3A7YA 4NZQA 3E6PH 5EG4A 4WXVA 1V2WT 5FBEA 1H9IE 4NA7A 4I8GA 3GY2A 4HFPB 2Y7ZA 1A1RA 1O39A 2NU1E 3TIUA 2D26C 2TRMA 1ANBA 1LO6A 4X1NU 1XXFA 4Y8ZA 2SGPE 2ZFSA 3TJNA 1TABE 4YT6H 3F9FA 1O35A 3MU8A 3QX5H 3T62A 1Y3UA 1MTWA 4U2WA 1V6DA 1SQAA 1HAHH 1MBQA 2QF0A 4OS7A 4Q7YA 4ZHAA 1EPTC 3BTDE 2WYJA 1JWTA 2AYWA 1TYNA 3NXPA 2ZU1A 1GL1A 1OWIA 1P04A 3OX7U 1C5VA 1QRWA 3PMAB 2ZEBA 2UUYA 1O3PB 1NC6A 4JK5A 2BY8X 2FODA
chains in the Genus database with same CATH superfamily
2CGAA 3RXOA 4OGXA 2VBCA 5AFZH 1A0HB 1M9UA 3ZVDA 1NO9H 2VIWA 1GBHA 4ABJA 3QN7A 1TOMH 1YY3A 1W0JD 1PQ8A 5BRRE 1OP2A 1OP0A 1SQTA 3PV5A 1AIXH 3SUDA 4IS5A 5C0UA 1FAXA 1HAOH 1GJ8B 3PLPA 1FJSA 2DE9A 5SGAE 2BQWB 1IHSH 5J4QA 7LPRA 2WPKS 4NFEA 1P03A 2CHAB 1NPMA 1AO5A 1C5TA 1DE7H 2ZPSA 4XFQA 2QN5T 2V3MA 1ACBE 1XM1A 2GX4A 1GMHG 1N6XA 2XCNA 3KYFA 1FY8E 3Q3KA 1BB0B 2VH0A 2XOKD 3HK6B 4U30A 3E8LA 3V13A 2FWWA 4IN2A 1O2YA 1O2MA 3QZRA 3M5LA 2AIPA 3EAJA 1LVBA 1P2KA 5LH8A 1TRMA 3UTUH 3PB1E 3MO3A 2I6QA 3CNRA 4MPXA 3A7TA 1OKXA 1GHYH 1LCYA 4PROA 2GJGA 1ZGIA 3F2FA 1MH0A 5EXMA 1J9CH 5AVDA 1BOQA 1UTMA 1YM0A 1B0EA 3P8NA 5F8XA 1WOFA 1XKAC 2QA9E 1UMAH 4MPWA 4JZDH 3DA9B 2CF8H 3F2HA 1AWHB 3BG4C 1C2EA 1PPGE 1JRTA 1QJ7B 1ZHMA 4KP0A 1TGSZ 2ZGBH 4XSKU 2J98A 5HGGA 3A8AA 1UTQA 1XUJA 1OWEA 1TA6A 2BD4A 2A4OA 5PTPA 1C4Y2 3QGNB 1AB9B 2TIOA 3BG8A 4KTUA 2F43B 1DY8A 4D9QA 3H09A 1LQEA 2BDAA 1XUFA 4FU7A 4B2CA 1FN8A 3I78A 4BTIB 5DO4H 1QZ8A 2R0KA 2ZA5A 4HI3A 4NG9H 1GGDC 1O37A 2C3SA 3TK9A 1SGIB 2G51A 8GCHG 1DWEH 1A61H 1UJ1A 1AVGH 1Z8GA 4LZ4B 4Z1MD 1CGJE 1AFEH 1H8HD 2OC1A 1BBRK 2ZU5A 1SGTA 3UR6A 2XC4A 2HVXA 3VEQB 1O3FA 1C2IA 4DIIH 2OQ5A 2H9HA 3P95A 1MAYA 2GV6A 1GBTA 1FX0B 4JYTA 1RD3B 1SGFG 3V0XA 4X1PU 1LPGB 3TVJB 6LPRA 3CP7A 3RXGA 1C5MD 2IN2A 1G2LA 2DUCA 3R0FA 1UTNA 5C5OA 5LPRA 2QF5A 3I77A 3GCTG 3F0OA 1OX1A 1BTHH 1AZ8A 3IWMA 3UFAA 1ZYOA 4BAQB 4ISLA 2RA0A 2J97A 3FAOA 4GVUA 1IOEA 3UY9A 3SJ8A 4B73A 4CRBA 2LPRA 5IK2D 1EAXA 4AOQA 1GMDF 1VCWA 2JDID 2OC8A 1FY1A 4K60A 4E06H 1E37B 1TNKA 2ALPA 5J4SA 3DD2H 2FM2A 2PSXA 2BD8A 1FIWA 3MU4A 4Q7XA 4MNVA 2YOLA 1D4PB 3HKIB 2BVXH 1ZMLA 1ZSKA 1FZZA 1C5LH 1VITG 1VCQA 3BTHE 4ISIH 3MH5A 3U9AH 2FO9A 2F4LA 2HRVA 4ZKNU 1GJ9B 2BLVA 2ZTXA 3LT3A 4TT3D 4RN6A 2BB4A 2FOHA 1DWDH 1KLIH 3URDA 4MG3A 1PQ7A 3SI4H 1CQQA 3ZYDA 2P3TB 1DITH 1SFQB 3GCHC 3HGNA 4ZROA 1V2RT 5DSFA 1NU9A 1YYY1 3FOAA 2Z7FE 4OS5A 3SU5A 2ODYB 4J2YB 2ZDNA 3ZV8A 2BMGB 4AG1A 3U28C 1RJXB 2A7JA 3T25A 2NU3E 1XUGA 4H4FA 5ABWA 1Z8RA 1RTLA 1FNIA 4CREA 1YPLH 2J38A 3RXCA 1N8OB 2VIVA 5F8TA 4K5ZA 1CGHA 1K22H 3GDUA 3PO1C 4AYYB 1GVLA 1O5CB 2ZTYA 1O3BA 2ZGHA 1EP5A 1DUAA 4INHA 2EQNA 5GCHG 2ANWA 2FDAA 2VIDA 2ZPRA 1UCYK 3UIRA 3LJJA 4DOQA 2OQUA 5DP9A 2EY4C 2P8OC 2VGCC 2Y5HA 2ZFTA 3LOXA 4OS1A 1EKBB 4X6OA 4O3UA 1P12E 1DM4B 3FANA 5FPSA 2ZU3A 5GXPA 4B6EA 1LVOA 1TBZH 2TGPZ 1WBGB 3GOVB 1BTPA 1DFPA 4MQAA 3M5MA 1C5PA 1Y5UT 1C1WH 2NU2E 1NZQH 5DKMA 1TBQH 1AHTH 1GI2A 1GJ7B 1MABB 4WVPE 5DJ7A 1GDNA 2YMSC 2PV9B 4QT8C 6CHAB 2Y80A 2J92A 1QJ1B 2Q6DA 4IBLH 3FKSD 4F48B 3F9EA 3OY5U 2HGTH 5CDFE 1C1VH 3NKKA 3T28A 1ELGA 1TX7A 4WMFA 3K65B 2LELA 5C0TA 3E3TA 4ACAA 2O8LA 1BTXA 9ESTA 4D7GA 3BTFE 4K3JA 1YLDA 1L4ZA 1WSSH 1P9UA 3OSYA 1TIOA 2FX4A 1V2JT 3MWIU 3LGWA 3MTYA 1QFKH 4Q7ZA 3BF6H 1PPHE 2BD2A 4DVAU 2WPHS 3EYDA 4HTCH 3KYGA 3RC4A 1QRZA 3Q00A 1IQJA 3KEEA 5LPEA 3TLOA 2ZO3H 1K1JA 4I8JA 3EE7A 1WTHD 1A4WH 1BHXB 1LDTT 2ULLA 1AN1E 2C93B 4B74A 1EPTB 3TH3H 2ANMH 1O2OA 1J17T 1V2UT 1K9OE 5DP8A 1H8ED 4F4OC 1YGCH 1ZJDA 3GY7A 3F6UH 5BPEA 4B2BA 3ZZ5A 1MU8B 1GJDB 2BLWA 2FOCA 2HALA 1EB2A 2KCAA 1P3EA 4X8UH 3BTME 5EJZA 3GY3A 2BTCE 2BZAA 3GDVA 3S69A 3URCA 5DK1A 1W12U 4YOJA 3FFGA 3PWBA 3OTPA 4A5TS 2Y5FA 3VB6A 2F9PA 3VB5A 1BCUH 1QB9A 3B23B 2A5IA 3GCOA 4ZUHA 1C5UA 3L3TA 2G4UA 2QYIA 1QCPA 2GP9B 2FLRH 1CSOE 3TJUA 4NZLA 2ZDVH 2BDHA 4I32A 1L1JA 4YLUA 1CVWH 1IQEA 4IW4E 2VIQA 1LVYA 3FZDA 3PRDA 3P6ZB 1KDQB 1W11U 4X8TH 5HXFA 1F7ZA 5E0JA 2EEKA 1GPZA 1MKXH 1PPEE 3MO6A 2QC2A 3E90B 5EQRA 4A92A 1O2RA 1O2SA 1TNJA 1S83A 1MKWK 2ZDMA 1UK3A 1SHYA 1DDJA 1E36B 1MU6B 5DP4A 3MH4A 4H42U 4M7GA 1QA0A 1AUJA 3UUZA 3LC5A 4AGJA 3BN9A 1C1TA 1F0UA 1LKBA 1QQUA 5L6NH 4Y76A 2VIPA 1YPMH 1SGPE 1Q2WA 5HIYA 3T2NA 1PYTC 1ESAA 3ODDA 4AYVB 3P92A 6ESTA 3ZZ6A 4DT7B 1QL8A 2ZC9H 2XC5A 1P06A 2ZU2A 3QO6A 4DCDA 3LH1A 1HPGA 1J16A 3KQBA 2BDCA 1GBJA 5E0HA 1IHTH 2FP7B 2HWLB 1XKBC 4Y10E 2PFEA 3LJOA 4B75A 3HGPA 3BTTE 2B5TB 5C17A 1O2XA 1DXWA 1ARBA 1AE8H 5EODA 1C2DA 3RU4D 1HIAA 1RS0A 1T8LA 4DG4A 3RXUA 1OHHD 1C2HA 2F91A 2O8TA 2PHBA 2Q1JA 5AFYH 2OK5A 4ABBA 2FZZA 4RKJB 2A0QB 1TX8A 1KYNA 1LHCH 2A4GA 2GZ7A 3M3SA 4AFSA 3D23A 3UOUA 1TNGA 4LK4A 1PPCE 4GSOA 4CBNA 2J94A 1HAIH 4A6LA 5DP3A 2VWLA 1OSSA 1D9IA 1EATA 4WF8A 5L30H 2Z9KA 1S85A 2AIQA 2TPIZ 3KN2A 2EI8A 2J9NA 5GJ4B 3ATWA 1LVMA 1CHOG 1OYTH 2BX3A 2ZFPH 4NCYA 4A1XA 2JH6D 4A1VA 1V2PT 4RT0A 1H9LB 3QLPH 1A2CH 1GVKB 1O3LA 2OTVA 5T1VA 2F9BH 4RT1A 4NGAH 3W95A 2IPQX 2BDIA 1G37A 1Q3XA 5A0CA 2IPHA 2Y5GA 1C1UH 3DCLA 3DFJA 1QB1A 3LONA 1XVMA 1V2TT 5EXLA 4AFUA 3T26A 1NM6A 3RXPA 1C2LA 3BTKE 3BIVH 2V3OH 5DN6D 1AY6H 1MBMA 2KCYA 1SOTA 6GCHF 3V12A 2R9PA 3MNXA 2BX4A 1L2EA 2ZKSA 1O2LA 2PKAA 3ATKA 1XUHA 4CBOA 1NFWA 1NY22 3U98H 1T8OA 1ANEA 1A5GH 2BQ7B 3TH4H 1B5GH 1W10U 2ODPA 2RG3A 2ZHFH 4JZEH 1BMNH 1MCVA 5IDKA 1XMNB 2Y82A 1YLCA 2H6MA 1CGIE 1ZTLA 2K0QA 1W3CA 5JBAS 4FVBA 4K8YA 3EA8A 4YT7H 1GCTC 1YBWA 2GMTC 2JETC 1EP6A 1EXFA 3BTEE 3RXRA 1BZXE 1AUTC 5KEDA 1IAUA 1DUEA 3VB3A 4FUGA 5TCAA 8ESTE 1TE0A 1AQ7A 4UD9H 1BA8B 4B6FA 1ELEE 7GCHF 3A7WA 3RC6A 2Q6FA 4X8SH 4GHTA 2STBE 1DT2A 3OFND 1KXDA 1G32B 2XXLA 1EZQA 3RXHA 1PPBH 3SNAA 2RDLA 2I6SA 1TMUH 4CR5A 5EQQA 3DT0H 1O3DA 3SGQE 2CV3A 1IQMA 4UFDH 2PTNA 3S9AA 3MU0A 1LQDB 2ZGCA 1QNJA 2P93A 3LDXH 1C1MA 1K28D 1Y3YA 5JYIA 1XX9A 1GJCB 1UCYE 2M2AA 2KCPA 1C2KA 4I7YH 2O8WA 4CRAA 4H6SB 1SLWB 1XXDA 2WUCA 1VKYA 3VGCB 2NWNA 2PSYA 2PUXB 2HNTE 1P8VC 5LPFA 2FIRH 1GI0A 1UVSH 2OINA 1LHEH 1UK4A 3AVZA 2M5TA 1THPB 3F2GA 1C5XB 1NBMD 1CA0C 2OC7A 4K1SA 2J5UA 4TY6A 4ACBA 1SGCA 2J95A 3RM2H 4CRGA 1THRH 1LHDH 1O3JA 1NRPH 4FUFA 8LPRA 3AK5A 1HJ8A 3RXDA 1GBAA 2BDYA 2A5KA 3KIDU 3A7ZA 3IITA 3SU2A 5HYOA 1WQSA 2OC0A 4ASUD 2AH4X 2VINA 3SNDA 1C5RA 1CE5A 3T5FH 3RXVA 4NA8A 1BMMH 1TQ7B 1GJ6A 4TPIZ 1AKSA 4LZ1H 3SV7A 1XUIA 1EQ9A 1ARCA 1C1RA 2JH5D 1XUKA 3ZIAD 8GCHF 1C1OA 2ZHWH 2ZP0H 3U8OH 1L4DA 5C20A 1SGYE 3ZVAA 3SUEA 1Z8JB 4FUCA 4LOYH 5FPYA 3SJOA 3D62A 1BTWA 1K1OA 2A1DB 1CHGA 4X6PA 3STIA 3RMOH 4AG2A 1QY6A 1ZHRA 5GCHF 3QTOH 1WQVH 2PGQB 1HAXB 4MNYA 1P9SA 3P8FA 4AFZA 1O2KA 2FOFA 3RU4T 2BVSH 2FS8A 1BRAA 1HAGE 1AKSB 2FTMA 5C1YA 1BRBE 2R0LA 1HUTH 1PPZA 4INLA 2BD7A 4YZUA 1ID5H 2W3KA 1O5FH 3SHAH 4UFFH 2XC0A 1UO6A 1H9HE 4WWYA 5EU8A 5GNDA 1H4WA 2PW8H 4E05H 9LPRA 1UVPA 3MYWA 3VPKA 4YTAA 3TH2H 1BBRE 5I25A 1GMCG 1C9PA 3NRLA 1C5SA 3SNEA 4WMEA 2ILNA 4ZKRU 1HB0B 3E16B 1BTZA 1AI8H 3WWFA 1ZR0A 4Y8YA 2UUFB 3LPRA 2JKHA 2TGTA 4FOUC 3GCNA 4XOJA 4YOGA 1GHXH 1D6WA 4ZMAH 5B6LA 1QIXB 2H9EH 4D8NA 3UOPA 1VJ9U 1AU8A 4ZH8A 3VGCC 1NFUA 2L74A 2VGCB 4NIXA 3TJOA 1ETTH 3ZZ8A 1O3IA 2BD9A 1E35B 2ZCLP 3RUOA 2ZDKA 3QK1A 4ASHA 1MZDA 2XNDD 4GHQA 4ISNA 2QV1A 5C3NA 1SPJA 3SQEE 3ZZ9A 3FP7E 1RRKA 2ZWLH 2ZFRH 4FU8A 3T27A 1C1PA 1SLXB 4UFGH 3TK5A 1BBRH 1T7CA 2NU0E 2G5NA 1EOJA 1GI1A 1YCPH 1ORFA 1P0SH 1ZGVA 1P2MA 2STAE 3KNXA 5GWZA 1W14U 3ENSB 1OWJA 2RA3A 2BY6X 5E8EH 4FUBA 1QBOA 1AB9C 1WV7H 2F9UA 1AZZA 1GI8B 5DGJA 1C5NH 4UDWH 1O36A 1H1BA 1VITH 5CHBA 4VGCC 2J34A 1G30B 2FMJA 3ZZ7A 2VH6A 1B0FA 3MMGA 1K0HA 4WMDA 2IJOB 4B2AA 3RLYH 1FUJA 5H4IB 2GVFA 3EE0B 3F3BA 2CXVA 3AAUA 1EOLA 2NU4E 1Y3VA 2AMQA 5JDUB 2G81E 4YOIA 2BLQA 2VVUA 3AW0A 1LKAA 2WZQA 3U1IB 1C1NA 3U8TH 1EJMA 3U1JB 1W0YH 2GGVB 1LHFH 4NIYA 4GLYA 2C4FH 2WV4A 1O3NA 3N99A 2WINI 1ZRBA 3TGKE 5EJ1A 2A31A 1NFXA 2FXRA 1P01A 3W1EA 1O3HA 2AMDA 1BTYA 3A87A 1GI7B 3GY4A 3ATMA 1Z1IA 1TX6A 1AWFH 2BXTH 5JBTA 3ZZDA 3ODFA 1JIMA 1DOJA 2OBQA 3ZVCA 1A3BH 4RKOB 5C94A 2QGRA 7GCHG 3SV2H 2Y81A 3A7XA 4UFEH 1ZOMA 2XYAA 1LPZB 1IQIA 4ISHH 1YPEH 2QIQA 3DSPA 1YPGH 4Q2KA 3GS9A 1O2QA 1UTLM 1QBVH 5LGOA 1ABJH 3KQDA 5A8XA 1EZXC 2IJD1 1AE5A 3F1SB 3SNCA 1UTOA 1NN6A 1PPFE 1C1QA 1GHBF 5EOKA 4YXWD 3SNBA 2THFB 1EZUC 1H8DH 4GUXA 1FPHH 2C8YB 2O8UA 5TCCA 1TNIA 4HZHA 3MHWU 1V2KT 3QTVH 1NROH 4I86A 3N7OA 2R3UA 5EPNA 1GI9B 3KL6A 5FL7D 4BAKB 4FUIA 4NIVA 4O97A 4VGCB 3GYLB 1W2KH 1BMFD 1NRRH 1HNEE 1IQHA 2OCVB 1W0ZU 3P17H 3L33A 1GBDA 5FBIA 1THSH 2AGIX 1UCYH 5E0GA 1BUIA 5AHGH 1EJAA 1A5HA 3BV9B 4ZCNA 2BYAX 1QQ4A 1B7XB 2W7SA 2G52A 1C4V2 1FAKH 1KIGH 1K1IA 1SR5C 4IMQA 3MOCA 2Q6GA 2ZI2H 3F9HA 1Y8TA 2YMSB 6CHAC 2KAIB 5A8YA 3B9FH 1GJBB 4Q63A 2BY9X 2UUJB 1TOCB 2FEQH 1NESE 1TMBH 1D3PB 1C4U2 3DFLA 2Z3CA 5CMXH 1PFXC 3O8CA 1C9TA 4ISOA 4ABDA 3BTWE 3BSQA 5F03A 1TGCA 1YPKH 3A84A 5B6OA 3UAIC 2BZ6H 2YMSD 3BG4B 1K1NA 1G2MA 1SG8B 2FOBA 4ABHA 1AVXA 2QXIA 1A5IA 2ZGXH 5GPIB 1WAYB 1ZRKA 4JK6A 1ELDE 5FAHA 4I31A 4DURA 4MNWA 3SU1A 3LIWA 1MZAA 4ZKOU 4D9RA 4ZAEA 3SU0A 2BHGA 1FDPA 1O2VA 1K2I1 1Y3WA 1JMOH 4BOHA 2UWLA 3SBKA 1GBKA 1FY3A 1RGQA 2OLGA 4X8VH 2PR3A 3LGUA 4BAMB 2ANYA 3KGPA 3H5CB 4AZ2B 1DLKB 1L1NA 1YPHE 2OUAA 2FS9A 2GCTC 1P2JA 4B71A 4FUDA 5EW2H 1IQLA 3B8JA 2ZGJA 4X6NA 1O3GA 1D6RA 1A0LA 4GAWA 5EIYA 2CN0H 1G3EA 1SLVB 8KME2 1TPAE 4AX9H 2ASUB 1EPTA 2WPIS 1E0FD 1ANDA 1SC8U 2XRCA 3K9XB 4AB9A 4B76A 1GWAA 1OWHA 1FQ3A 2GZ9A 2L6OA 4IC6A 2OXSA 2HPPH 1C2GA 1Q31A 1GG6B 3S9BA 1HBTH 3OU0A 1OWDA 2A32A 5ESTE 4X1RU 1AGJA 1O31A 4CH8B 1TGBA 1DSTA 1SGNE 1UHBB 1S84A 3K6ZA 3BTQE 4ZXYH 2WPJS 3UNSA 4BANB 1HAVA 1HXEH 2EC9H 3LGYA 3STJA 2PLXA 1O3CA 1P10A 1EAUA 3O8BA 3NPSA 3S7HB 1GI6A 2FYRA 4INKA 1HLTH 7KMEH 1OP8A 4RI0A 4YLQH 4AB8A 3ZZAA 1TQ0B 1OYQA 3VXEH 1GMDG 1BDAA 2JETB 1IQGA 2C8ZB 3TK6A 3EGKH 1F5RA 2AS9A 3M5OA 1BMLA 3MU1A 1ETSH 1YP9A 5A0AE 2ZCHP 4MLFB 1QHRB 2WPMS 1EJNA 4X6MA 4XBBA 1KSNA 1TA2A 3A7VA 2SNWA 1SVPA 2QE7D 5T6GA 3MFJA 1AD8H 1LMWB 3M7QA 4Z6AH 4XE4A 2WUBA 1MKWH 1O2HA 3VFEA 2ZG0H 1O5GH 1TALA 1QL9A 2PWXA 4NA9H 3SHCH 1JOUB 2H2ZA 3TGIE 3QDZB 1NTPA 4Y11E 1BRCE 5JBBS 5A8ZA 1EX3A 1WXRA 2QXJA 5CE1A 1S0RA 1CT2E 1GHZA 4O03A 5TJXA 2VB0A 2ZZUH 1EZSC 3VG8A 1ZLRA 2VWNA 1Z6JH 3FVFB 3P8OA 1TNHA 3ITIA 1QR3E 2XBXA 3RLWH 5JBCS 5F6MA 4TWWA 2GD4B 4WY3A 3A81A 1MQ5A 1SI5H 4YO9A 4CHAB 5FX5A 4MPUA 2CK3D 2OP9A 2SGDE 2GMTB 1KXBA 1RTKA 1GGDB 1HV7A 2GDDA 2XBWA 2Z9JA 3LC3A 3A89A 3PLKA 3RXAA 3TGJE 3RXLA 3ZVFA 1TFXA 2F83A 2C90B 1U6QA 1SGRE 1O3AA 5FCRA 4D7FA 2SGQE 3A8CA 2V7QD 2GT7A 3M3TA 1GMCF 4MNXA 3ZVBA 2AERH 4YESB 3KCGH 1Y59T 3GY5A 1V2VT 3VB4A 4E7RG 2ZCKP 3DSOA 1MUEB 1GHWH 1YC0A 4X2VA 1FY4A 1DLEA 2H5CA 3LKWA 1P57B 5DG6A 2G8TA 1GJAB 1O5AB 2H9TH 1QTFA 3RMMH 2Z3DA 3QWCH 4IGDA 3Q77A 1BHXF 1A0JA 3GDSA 2IOTA 4X2XA 2RFKC 5L2YH 2R3YA 3C27B 1G36A 1E1RD 1GHBG 2SGAA 4K2YA 2BOKA 2UWOA 1W8BH 1WYKA 5HIZA 1TMTH 2A5AA 1K1LA 1QB6A 1ZPZA 2QY0B 1S5SA 1SOZA 1O2WA 1SL3A 3UQVA 2GCHG 1SSXA 1MTVA 4JZ1A 1EAIA 1UW7A 1AFQC 1PQ5A 2W7UA 1S81A 5FX6A 3NCLA 5DP7A 5JB8S 3PO1B 4BNRA 4CHAC 4MVNA 2LP6A 1ABIH 3NZIA 4OS6A 3SV8A 3VB7A 1MCTA 3PTBA 3V7TA 1DX5M 4UEHH 5JPMH 2A4QA 4U32A 2G5VA 2W6ID 1ETRH 4ZKSU 2PUQH 5T6DA 4BXSA 1O3MA 2F9VA 3Q76A 5FXLA 1ZMJA 3P70B 3UNRA 1O2UA 4KTCA 2D2DA 1GMHF 3EA7A 2JJ1D 1LTOA 4K1TA 4Y0ZE 3GISB 3TPIZ 4CRFA 1OWKA 5C2ZA 1VR1H 1GDQA 3BEFB 5EXNA 2BD5A 2HNTC 2C8WB 1CT4E 5FHTA 1TBRH 1V2LT 3A83A 1FI8A 1BMAA 4ABIA 3N7EA 3Q3XA 1GI5A 3FN8A 3LH3A 1QL7A 2JH0D 2P16A 3H7TA 1D3TB 1N8OC 3S9CA 2W26A 4XRNA 4ESTE 1KXCA 2GKVE 4FETA 3WW7A 1TB6H 4A1TA 3P8GA 3SORA 1O34A 3SI3H 2EI7A 3D49H 1TPOA 1GJ4H 4Y71A 4BXWA 2SNVA 2P8OB 3RM0H 3SV9A 2ZQ1A 1WDIA 1UVUH 2SFAA 1F0SA 4Y0YE 1J14A 1GBBA 4A7IB 5HMAA 3SUGA 2A2XH 1KMHB 2Z9IA 2GZ8A 2XNIA 1G3CA 3O8RA 1CA0B 4Y79A 1F92A 1RTFB 3UB0A 4Y7AA 1EASA 3TU7H 1JRSA 1BJUA 5IYTA 1KY9A 4OGYA 1ZHPA 1O30A 1QBNA 5F53A 2EA3A 1FN6A 3MH6A 3RXFA 1Y3XA 4XBCA 3AW1A 1ESBA 1ZTJA 2XWAA 2VNTA 3M61U 1HGTH 1RXPA 1ZZZA 2HOBA 1Z6EA 1UVTH 3ZYEA 1NRNH 1O33A 1WU1A 3UWJH 5A09A 5HM2A 2P3FH 1V3XA 1YKTA 4Y8XA 4K8BA 1DY9A 2BLOA 1A46H 1SLUB 1O3EA 3UREA 2VWMA 2ZTZA 4X1QU 5G4BA 4H6TA 1H8IH 3ESTA 4FUHA 3C1KA 1ZSLA 2FPZA 3ZZCA 2V0BA 4JMYA 1N6YA 2R2WU 2ZIQH 2A45B 1GI4A 2ZU4A 3DSGA 1RIWC 2WPLS 2UWPA 1TRYA 3LGIA 2O8MA 2BDBA 1ZTKA 1MD8A 3I29A 1UTJA 3ZZ4A 1S6FA 4XBDA 4TPYA 2WYGA 1S0QA 1V2OT 2FESH 1KXAA 2KR7A 5EQSA 1ZMNA 2CHAC 4GCHG 2AFQB 1KTSB 1WCZA 3OE7D 1F0RA 4Z0KA 1UTPA 3M7UA 3PV4A 1E34B 3ZZ3A 2Z94A 1YCPM 5DPAA 1D3QB 1FPCH 4X2YA 3BIUH 2ZNKH 3PMHB 1OOKB 5EGMA 4BTTB 1EB1H 5C1UA 3SW2B 3A80A 5KGOA 1C5QA 1EAWA 1Z1JA 3DHKH 1SGFA 2PKSB 4BAOB 1C5WB 1GG6C 3KQCA 1EFRD 1TLDA 1KXFA 2FOAA 1DVAH 4IC5A 1ZPCA 3KF2A 5E2OA 1CBWB 2XBYA 1OPHB 1VGCB 3NUMA 4MDSA 3S0NA 1SB1H 2FTLE 1P05A 6GCHG 2Y6TA 5FCKA 1NFYA 4IN1A 1DWCH 1JIRA 3F0PA 1TAWA 1O5DH 3RXBA 1OXGA 1TGTA 3Q3YA 1TGNA 1GBIA 3ZVGA 1ELCA 1P09A 1O2ZA 3FP6E 5F8ZA 1F5KU 2B0FA 1HXFH 1BITA 1K1PA 3SU6A 1HAVB 2FOEA 3SO3A 1V2ST 3HK3B 3RMLH 2BQ6B 2KM0A 3MNBA 1WTGH 1HCGA 5EJLA 1SGQE 5HKKD 1S6LA 3A88A 2WV9A 4TSFD 2V3HH 2DE8A 1YWUA 4JZIA 1O2IA 4LXBH 3RXJA 2KFWA 1G9IE 1SBWA 3TNSA 3A86A 1GCTB 2W6JD 3ELAH 3EQ0H 2HVYB 4DGJA 3SGAE 1ELFA 2TBSA 2K8IA 3PM3A 1WUNH 1O2JA 3TITA 1Z8IB 4I8KA 4CRCA 4FXGH 1FY5A 2WSSD 3ZZBA 3HKJB 1RFNA 3LGVA 1MTNC 1Z71A 2ZQ2A 3PYHA 1JBUH 4CH2B 4NWLA 3RXEA 4K69A 2SGEE 1FMGA 2LNCA 5T3HA 1BJVA 3RXSA 3TJVA 4JYUH 1TPSA 4Y6DA 1F5LA 3G01A 2O9QA 3N7DA 1TWXB 3EA9A 4O3TA 1F2SE 2CMYA 3GY8A 1C5YB 2F9OA 2QAAA 1L1GA 3O8DA 1GVZA 2BY5X 4WH8A 3FP8E 1GBEA 3SJ9A 2VVCA 2VWOA 3RC5A 3SN8A 1YPJH 4O9VA 4CRDA 1HAZB 2RDEA 4Q4LA 3MU5A 3MNSA 4AC9A 4XD7D 3S7KB 4ABAA 2GDEH 1D3DB 1QGFA 5KECA 3L6PA 1C1SA 3OAAD 2XCFA 1MTUA 1QURH 5L2ZH 4UE7H 1VCPA 1MMJN 3SU3A 3QGJA 1P02A 1S82A 1CO7E 1BQYA 1ELVA 4IMZA 4F49A 3CENA 1CU1A 4WJG2 5K0HA 1VITF 1C2FA 1CT0E 2Z9GA 5CHAC 1V2NT 3M35A 1GL0E 1LHGH 1HAPH 3MNCA 3SV6A 3UWIA 4RSPA 2TGDA 1SHHB 4X2WA 2VVVA 2RCEA 2AHME 2FI4E 5I46H 1E79D 1GBFA 4DIHH 1BT7A 1YF4A 3FZZA 1A3EH 4M9FA 4THNH 3UR9A 1SQOA 4DJZB 3E0NB 3M36A 3HATH 1Z7KA 2BOHB 4U01A 1UHBA 1C2JA 5A0BA 1L0ZA 3TNTA 1P2IA 1S6HA 1MTNB 4XDEA 2F3CE 3SZEA 3CS0A 1O38A 2ANKH 4TY7A 3PROA 1DICA 5HM9A 4YM9A 1X7AC 5GDSH 3GY6A 5K7RA 2ZPQA 3R3GB 1DSUA 4MPVA 1YCPK 3KQ5A 1ELAA 1COWD 3M3VA 1ZJKA 3OEHD 1BRUP 3SUFA 2AMPA 4DW2U 1C5ZB 3E1XB 2P59A 4AN7A 1IQFA 1UK2A 3UNQA 3BEIB 5ESBA 3AAVA 1UTKA 4JCNA 2WPDD 2AEIH 1O3KA 1K21H 4AGKA 1J8AA 3BEUA 2H1UA 4OS2A 1JXPA 1Y5AT 2OBOA 4F55A 1FXYA 2KAIA 1GBMA 1KLJH 1T32A 3ATIA 2QF3A 3SGBE 4ZHLU 1O2PA 5C1XA 2ZHEH 1GHVH 2R2MB 1PJPA 1BIOA 1SKYE 3A8BA 3RXQA 4NIWA 1CBWC 2BXUH 3QZQA 2XBVA 4D76A 3MO9A 2TGAA 3F9GA 2QXGA 3VXFH 2JIZD 2PKSC 2Z6BD 1KXEA 1TONA 1DS2E 4DT4A 3ZVEA 4ZXXH 2P95A 2VU8E 2FOMB 1ELBA 4ABFA 3WY8A 1O5BB 3MQKC 3KHVA 2BVRH 2GV7A 4GCHF 3UQOA 1INCA 2ZHQH 4FUJA 1NS3A 3PWCA 3GCTF 1KLTA 1MKXK 2G4TA 2FI5E 2PP6A 3H7OA 1HDTH 1V2MT 3K2UA 3KQEA 1MTSA 1HFDA 3SJKA 1E38B 4OS4A 2K1QA 1SMFE 4E7NA 1HYLA 4HGCA 1SFIA 3U69H 2QXHA 4FVDA 3RDZA 1C5OH 2F9NA 2HNTF 2A4RA 3FO8D 1PYTD 1MAXA 1VJAU 1DPOA 2FLBH 4GPGA 4NFFA 4JZFH 4R0IA 1AMHA 4I8HA 4TYDA 2ZECA 2V35A 2XWBI 2ZHDA 4NWKA 2PKAB 4SGAE 2ODQA 1O3OA 4OM9A 2W5EA 1IQKA 1NU7B 1HIAB 4CR9A 3HPTB 2KCOA 4KELA 5CHAB 4TWYA 2QCYA 4P00A 2B7DH 4KGAA 1YPHC 1W7XH 2CJIA 2BM2A 4WH6A 3OTJE 5EPYA 1ZPBA 4X1SU 4KTSA 1W13U 3PMJA 3SOSA 1T4VH 4BAHB 1TRNA 4K1EA 5AF9H 3PV2A 1YLNA 3A85A 1AVWA 2OD3B 2ZDAH 2FYQA 3CS7A 3RXIA 4P02A 1MD7A 3V3MA 1W7GH 2ZDLA 1HAYB 1IQNA 1E1QD 3E0PB 1G3BA 4HG6A 5T6FA 4Q80A 1Y5BT 5JB9S 3AASA 1T8MA 1J15A 3ATLA 2EI6A 1QA7A 2A2QH 4JYVH 3RU4E 1N1LA 1UVOA 4MTBA 2PGBB 2XTTB 1HJAC 4AFQA 2J2UA 2G55A 2C8XB 2YNBA 3K6YA 3IG6B 4Y7BA 3JZ1B 2VJ1A 2D8WA 2A7HA 3RXTA 3RXMA 2H5DA 2P3UB 1GBCA 5FPTA 1O0DH 1GJ5H 2B9LA 3A8DA 3PLBA 2ALVA 1TNLA 1GI3A 3LGTA 3MH7A 1GHAG 1GHAF 4R8TB 1O2NA 3SZNA 3JZ2B 1ESTA 2HLDD 2ESTE 2J98B 2CF9H 2G00A 3WWBA 1TPPA 2PTCE 3EDXB 5C5NA 3SQHE 3GCHB 1GDUA 4I33A 1FIZA 5ETXA 1T4UH 1A7SA 1P2OA 3RMNH 5GIBA 1NBME 3QUMP 2VIOA 1K1MA 1NT1A 3U8RH 1DANH 1SGDE 2HLCA 2ZFQH 2QF4A 4AORA 5C67A 2GTBA 2BD3A 1P3CA 4NSVA 1ELTA 1T31A 1ANCA 1P11E 2ZF0H 2GT8A 1RIWB 1ZSJA 3ZV9A 5A2MH 1HJ9A 3W94A 4J1YA 1NRSH 3NWUA 5DP5A 2BDGA 3UPEA 3PTNA 4SGBE 4NSYA 1OS8A 2B8OH 2J4IA 2A7CA 2FX6A 3T29A 2ZFFH 3A82A 3M37A 5EW1H 4DY7B 1HJAB 3RXKA 1O32A 2YNAA 2UUKB 3OYPA 1O2TA 3M5NA 4ABGA 1EUFA 3NK8A 1O5EH 3BTGE 3DUXH 4FUEA 4B1TA 3D65E 3PMBB 2KZ4A 2SGFE 3F68H 3LU9B 1SQRA 2GCTB 4KKDA 3SJIA 2KX4A 1FONA 1C2MA 1LPKB 1XVOA 2D1JA 2V6NA 1DWBH 1BTUA 2GCHF 2JJ2D 3GICB 4BTUB 4I8LA 1QJ6B 2HPQH 2AGGX 4FU9A 2BY7X 4X0WU 1QRXA 1HRTH 1KTTB 2W3IA 1G3DA 3OY6U 3E91A 4ABEA 1DXPA 1CHOF 1VZQH 1KDQA 1P2NA 2Z3EA 3M7TA 1F0TA 1T8NA 4WXIA 1NRQH 1P2QA 1CA8B 1VGCC 2WV5A 2FI3E 3SYJA 1GCDA 2AGEX 4ZHMU 2Y7XA 1FLEE 1MQ6A 2Z9LA 3PRBA 1FV9A 4UONA 1V2QT 2P94A 1AFQB 1SGEE 2XW9A 3GYMA 2FOGA 5E2PA 1PQAA 7ESTE 3MI4A 3RP2A 5DP6A 3SU4A 1O2GH 1GBLA 3A7YA 4NZQA 3E6PH 5EG4A 4WXVA 1V2WT 5FBEA 1H9IE 4NA7A 4I8GA 3GY2A 4HFPB 2Y7ZA 1A1RA 1O39A 1W0KD 2NU1E 3TIUA 2D26C 3OEED 2TRMA 1ANBA 1LO6A 4X1NU 1XXFA 4Y8ZA 2SGPE 2ZFSA 3TJNA 1TABE 4YT6H 3F9FA 1O35A 3MU8A 3QX5H 3T62A 1Y3UA 1MTWA 4U2WA 1V6DA 1SQAA 1HAHH 1MBQA 2QF0A 4OS7A 4Q7YA 4ZHAA 1EPTC 3BTDE 2WYJA 1JWTA 2AYWA 1TYNA 3NXPA 2ZU1A 2WHXA 1GL1A 1OWIA 1P04A 3OX7U 1C5VA 1QRWA 3PMAB 2ZEBA 2UUYA 1O3PB 1NC6A 4JK5A 2BY8X 2FODA
chains in the Genus database with same CATH topology
2CGAA 3RXOA 4OGXA 5AFZH 1A0HB 1M9UA 3ZVDA 1NO9H 2VIWA 1GBHA 4ABJA 3QN7A 1TOMH 1PQ8A 5BRRE 1OP2A 1OP0A 1SQTA 3SUDA 1AIXH 4IS5A 1HAOH 1FAXA 1GJ8B 3PLPA 1FJSA 2DE9A 5SGAE 2BQWB 1IHSH 5J4QA 7LPRA 2WPKS 4NFEA 1P03A 2CHAB 1NPMA 1AO5A 1C5TA 1DE7H 2ZPSA 4XFQA 2QN5T 1ACBE 1XM1A 2GX4A 1GMHG 1N6XA 2XCNA 3Q3KA 1FY8E 1BB0B 2VH0A 3HK6B 4U30A 3E8LA 3V13A 2FWWA 4IN2A 1O2YA 1O2MA 3QZRA 3M5LA 2AIPA 3EAJA 1LVBA 1P2KA 5LH8A 1TRMA 3UTUH 3PB1E 3MO3A 2I6QA 4MPXA 3A7TA 1OKXA 1GHYH 1LCYA 4PROA 1ZGIA 1MH0A 5EXMA 1J9CH 5AVDA 1BOQA 1UTMA 1YM0A 1B0EA 3P8NA 5F8XA 1WOFA 1XKAC 2QA9E 1UMAH 4MPWA 4JZDH 3DA9B 2CF8H 1AWHB 3BG4C 1C2EA 1PPGE 1JRTA 1QJ7B 1ZHMA 4KP0A 1TGSZ 2ZGBH 4XSKU 5HGGA 3A8AA 1UTQA 1XUJA 1OWEA 1TA6A 2BD4A 2A4OA 5PTPA 1C4Y2 3QGNB 1AB9B 2TIOA 3BG8A 4KTUA 1DY8A 4D9QA 1LQEA 2BDAA 1XUFA 4FU7A 4B2CA 1FN8A 3I78A 4BTIB 5DO4H 2R0KA 2ZA5A 4HI3A 4NG9H 1GGDC 1O37A 2C3SA 3TK9A 1SGIB 2G51A 8GCHG 1DWEH 1A61H 1UJ1A 1AVGH 1Z8GA 4LZ4B 1CGJE 1AFEH 2OC1A 1BBRK 2ZU5A 1SGTA 3UR6A 2XC4A 2HVXA 3VEQB 1O3FA 1C2IA 4DIIH 2OQ5A 2H9HA 3P95A 1MAYA 2GV6A 1GBTA 4JYTA 1RD3B 1SGFG 3V0XA 4X1PU 1LPGB 3TVJB 6LPRA 3CP7A 3RXGA 1C5MD 2IN2A 1G2LA 2DUCA 3R0FA 1UTNA 5C5OA 5LPRA 3I77A 3GCTG 1OX1A 1BTHH 1AZ8A 3IWMA 3UFAA 1ZYOA 4BAQB 4ISLA 2RA0A 3FAOA 4GVUA 1IOEA 3UY9A 3SJ8A 4B73A 4CRBA 2LPRA 1EAXA 4AOQA 1GMDF 1VCWA 2OC8A 1FY1A 4K60A 4E06H 1E37B 1TNKA 2ALPA 5J4SA 3DD2H 2FM2A 2PSXA 2BD8A 1FIWA 3MU4A 4Q7XA 4MNVA 2YOLA 1D4PB 3HKIB 2BVXH 1ZMLA 1ZSKA 1FZZA 1C5LH 1VITG 1VCQA 3BTHE 4ISIH 3MH5A 3U9AH 2FO9A 2HRVA 4ZKNU 1GJ9B 2BLVA 2ZTXA 3LT3A 4RN6A 2BB4A 2FOHA 1DWDH 1KLIH 3URDA 4MG3A 1PQ7A 3SI4H 1CQQA 3ZYDA 2P3TB 1DITH 1SFQB 3GCHC 3HGNA 4ZROA 1V2RT 1NU9A 1YYY1 2Z7FE 4OS5A 3SU5A 2ODYB 4J2YB 2ZDNA 3ZV8A 2BMGB 4AG1A 1RJXB 2A7JA 3T25A 2NU3E 1XUGA 4H4FA 5ABWA 1Z8RA 1RTLA 1FNIA 4CREA 1YPLH 2J38A 3RXCA 1N8OB 2VIVA 5F8TA 4K5ZA 1CGHA 1K22H 3GDUA 3PO1C 4AYYB 1GVLA 1O5CB 2ZTYA 1O3BA 2ZGHA 1EP5A 1DUAA 4INHA 5GCHG 2ANWA 2FDAA 2VIDA 2ZPRA 1UCYK 3UIRA 3LJJA 4DOQA 2OQUA 5DP9A 2P8OC 2VGCC 2Y5HA 2ZFTA 3LOXA 4OS1A 1EKBB 4X6OA 4O3UA 1P12E 1DM4B 3FANA 5FPSA 2ZU3A 5GXPA 1LVOA 1TBZH 2TGPZ 1WBGB 3GOVB 1BTPA 1DFPA 4MQAA 3M5MA 1C5PA 1Y5UT 1C1WH 2NU2E 1NZQH 5DKMA 1TBQH 1AHTH 1GI2A 1GJ7B 4WVPE 5DJ7A 1GDNA 4QT8C 2PV9B 6CHAB 2Y80A 2J92A 1QJ1B 2Q6DA 4IBLH 3F9EA 3OY5U 2HGTH 1C1VH 3NKKA 3T28A 1ELGA 1TX7A 4WMFA 3K65B 3E3TA 2O8LA 1BTXA 9ESTA 4D7GA 3BTFE 4K3JA 1YLDA 1L4ZA 1WSSH 1P9UA 3OSYA 1TIOA 2FX4A 1V2JT 3MWIU 3LGWA 3MTYA 1QFKH 4Q7ZA 3BF6H 1PPHE 2BD2A 4DVAU 2WPHS 3EYDA 4HTCH 3RC4A 1QRZA 3Q00A 1IQJA 3KEEA 5LPEA 3TLOA 2ZO3H 1K1JA 4I8JA 1WTHD 1A4WH 1BHXB 1LDTT 2ULLA 1AN1E 2C93B 4B74A 1EPTB 3TH3H 2ANMH 1O2OA 1J17T 1V2UT 1K9OE 5DP8A 4F4OC 1YGCH 1ZJDA 3GY7A 3F6UH 5BPEA 4B2BA 3ZZ5A 1MU8B 1GJDB 2BLWA 2FOCA 2HALA 1EB2A 1P3EA 4X8UH 3BTME 3GY3A 2BTCE 2BZAA 3GDVA 3S69A 3URCA 5DK1A 1W12U 4YOJA 3FFGA 3PWBA 4A5TS 2Y5FA 3VB6A 2F9PA 3VB5A 1BCUH 1QB9A 3B23B 2A5IA 3GCOA 4ZUHA 1C5UA 3L3TA 2G4UA 2QYIA 1QCPA 2GP9B 2FLRH 1CSOE 3TJUA 4NZLA 2ZDVH 2BDHA 4I32A 1L1JA 4YLUA 1CVWH 1IQEA 4IW4E 2VIQA 1LVYA 3FZDA 3P6ZB 1KDQB 1W11U 4X8TH 5HXFA 1F7ZA 5E0JA 2EEKA 1GPZA 1MKXH 1PPEE 3MO6A 2QC2A 3E90B 5EQRA 4A92A 1O2RA 1O2SA 1TNJA 1S83A 1MKWK 2ZDMA 1UK3A 1SHYA 1DDJA 1E36B 1MU6B 5DP4A 3MH4A 4H42U 4M7GA 1QA0A 1AUJA 3UUZA 3LC5A 4AGJA 3BN9A 1C1TA 1F0UA 1LKBA 1QQUA 5L6NH 4Y76A 2VIPA 1YPMH 1SGPE 1Q2WA 3T2NA 1PYTC 1ESAA 3ODDA 4AYVB 3P92A 6ESTA 3ZZ6A 4DT7B 1QL8A 2ZC9H 2XC5A 1P06A 2ZU2A 3QO6A 4DCDA 3LH1A 1HPGA 1J16A 3KQBA 2BDCA 1GBJA 5E0HA 1IHTH 2FP7B 2HWLB 1XKBC 4Y10E 2PFEA 3LJOA 4B75A 3HGPA 3BTTE 2B5TB 1O2XA 1DXWA 1ARBA 1AE8H 5EODA 1C2DA 3RU4D 1HIAA 1RS0A 1T8LA 4DG4A 3RXUA 1C2HA 2F91A 2O8TA 2PHBA 2Q1JA 5AFYH 4ABBA 2FZZA 4RKJB 2A0QB 1TX8A 1KYNA 1LHCH 2A4GA 2GZ7A 3M3SA 4AFSA 3D23A 3UOUA 1TNGA 4LK4A 1PPCE 4GSOA 4CBNA 2J94A 1HAIH 4A6LA 5DP3A 2VWLA 1OSSA 1D9IA 1EATA 4WF8A 5L30H 2Z9KA 1S85A 2AIQA 2TPIZ 3KN2A 2EI8A 2J9NA 5GJ4B 3ATWA 1LVMA 1CHOG 1OYTH 2BX3A 2ZFPH 4NCYA 4A1XA 2JH6D 4A1VA 1V2PT 1H9LB 3QLPH 1A2CH 1GVKB 1O3LA 2OTVA 2F9BH 3W95A 4NGAH 2BDIA 1G37A 1Q3XA 5A0CA 2IPHA 2Y5GA 1C1UH 3DFJA 1QB1A 3LONA 1XVMA 1V2TT 5EXLA 4AFUA 3T26A 1NM6A 3RXPA 1C2LA 3BTKE 3BIVH 2V3OH 1AY6H 1MBMA 6GCHF 1SOTA 3V12A 2R9PA 3MNXA 2BX4A 1L2EA 2ZKSA 1O2LA 2PKAA 3ATKA 1XUHA 4CBOA 1NFWA 1NY22 3U98H 1T8OA 1ANEA 1A5GH 2BQ7B 3TH4H 1B5GH 1W10U 2ODPA 2RG3A 2ZHFH 4JZEH 1BMNH 1MCVA 5IDKA 1XMNB 2Y82A 1YLCA 2H6MA 1CGIE 1ZTLA 1W3CA 5JBAS 4FVBA 4K8YA 3EA8A 4YT7H 1GCTC 1YBWA 2GMTC 2JETC 1EP6A 1EXFA 3BTEE 3RXRA 1BZXE 1AUTC 1IAUA 1DUEA 3VB3A 4FUGA 5TCAA 8ESTE 1TE0A 1AQ7A 4UD9H 1BA8B 1ELEE 7GCHF 3A7WA 3RC6A 2Q6FA 4X8SH 4GHTA 2STBE 1DT2A 1KXDA 1G32B 2XXLA 1EZQA 3RXHA 1PPBH 3SNAA 2RDLA 2I6SA 1TMUH 4CR5A 5EQQA 3DT0H 1O3DA 3SGQE 2CV3A 1IQMA 4UFDH 2PTNA 3S9AA 3MU0A 1LQDB 2ZGCA 1QNJA 2P93A 3LDXH 1C1MA 1K28D 1Y3YA 5JYIA 1XX9A 1GJCB 1UCYE 1C2KA 4I7YH 2O8WA 4CRAA 4H6SB 1SLWB 1XXDA 2WUCA 3VGCB 2NWNA 2PSYA 2PUXB 2HNTE 1P8VC 5LPFA 2FIRH 1GI0A 1UVSH 2OINA 1LHEH 1UK4A 3AVZA 2M5TA 1THPB 1C5XB 1CA0C 2OC7A 4K1SA 4TY6A 1SGCA 2J95A 3RM2H 4CRGA 1THRH 1LHDH 1O3JA 1NRPH 4FUFA 8LPRA 1HJ8A 3RXDA 1GBAA 2BDYA 2A5KA 3KIDU 3A7ZA 3IITA 3SU2A 5HYOA 1WQSA 2OC0A 2AH4X 2VINA 3SNDA 1C5RA 1CE5A 3T5FH 3RXVA 4NA8A 1BMMH 1TQ7B 1GJ6A 4TPIZ 1AKSA 4LZ1H 3SV7A 1XUIA 1EQ9A 1ARCA 1C1RA 2JH5D 1XUKA 8GCHF 1C1OA 2ZHWH 2ZP0H 3U8OH 1L4DA 5C20A 1SGYE 3ZVAA 3SUEA 1Z8JB 4FUCA 4LOYH 5FPYA 3SJOA 3D62A 1BTWA 1K1OA 2A1DB 1CHGA 4X6PA 3STIA 3RMOH 4AG2A 1QY6A 1ZHRA 5GCHF 3QTOH 1WQVH 2PGQB 1HAXB 4MNYA 1P9SA 3P8FA 4AFZA 1O2KA 2FOFA 3RU4T 2BVSH 2FS8A 1BRAA 1HAGE 1AKSB 2FTMA 5C1YA 1BRBE 2R0LA 1HUTH 1PPZA 4INLA 2BD7A 4YZUA 1ID5H 2W3KA 1O5FH 3SHAH 4UFFH 2XC0A 1UO6A 1H9HE 4WWYA 5EU8A 1H4WA 2PW8H 4E05H 9LPRA 1UVPA 3MYWA 3VPKA 4YTAA 3TH2H 1BBRE 5I25A 1GMCG 1C9PA 1C5SA 3SNEA 4WMEA 2ILNA 4ZKRU 1HB0B 3E16B 1BTZA 1AI8H 1ZR0A 4Y8YA 2UUFB 3LPRA 2JKHA 2TGTA 3GCNA 4XOJA 4YOGA 1GHXH 1D6WA 4ZMAH 1QIXB 2H9EH 4D8NA 3UOPA 1VJ9U 1AU8A 4ZH8A 3VGCC 1NFUA 2VGCB 4NIXA 3TJOA 1ETTH 3ZZ8A 1O3IA 2BD9A 1E35B 2ZCLP 3RUOA 2ZDKA 3QK1A 4ASHA 1MZDA 4GHQA 4ISNA 2QV1A 5C3NA 1SPJA 3SQEE 3ZZ9A 3FP7E 1RRKA 2ZWLH 2ZFRH 4FU8A 3T27A 1C1PA 1SLXB 4UFGH 3TK5A 1BBRH 1T7CA 2NU0E 2G5NA 1EOJA 1GI1A 1YCPH 1ORFA 1P0SH 1ZGVA 1P2MA 2STAE 3KNXA 5GWZA 1W14U 3ENSB 1OWJA 2RA3A 2BY6X 5E8EH 4FUBA 1QBOA 1AB9C 1WV7H 2F9UA 1AZZA 1GI8B 5DGJA 1C5NH 4UDWH 1O36A 1H1BA 1VITH 4VGCC 2J34A 1G30B 2FMJA 3ZZ7A 2VH6A 1B0FA 3MMGA 4WMDA 2IJOB 4B2AA 3RLYH 1FUJA 5H4IB 2GVFA 3EE0B 2CXVA 3AAUA 1EOLA 2NU4E 1Y3VA 2AMQA 5JDUB 2G81E 4YOIA 2BLQA 2VVUA 3AW0A 1LKAA 3U1IB 1C1NA 3U8TH 1EJMA 3U1JB 1W0YH 2GGVB 1LHFH 4NIYA 4GLYA 2C4FH 2WV4A 1O3NA 2WINI 1ZRBA 3TGKE 2A31A 1NFXA 2FXRA 1P01A 1O3HA 2AMDA 1BTYA 3A87A 1GI7B 3GY4A 3ATMA 1Z1IA 1TX6A 1AWFH 2BXTH 5JBTA 3ZZDA 3ODFA 1JIMA 1DOJA 2OBQA 3ZVCA 1A3BH 4RKOB 2QGRA 7GCHG 3SV2H 2Y81A 3A7XA 4UFEH 1ZOMA 2XYAA 1LPZB 1IQIA 4ISHH 1YPEH 2QIQA 1YPGH 4Q2KA 1O2QA 1UTLM 1QBVH 5LGOA 1ABJH 3KQDA 5A8XA 1EZXC 1AE5A 3F1SB 3SNCA 1UTOA 1NN6A 1PPFE 1C1QA 1GHBF 5EOKA 3SNBA 2THFB 1EZUC 1H8DH 4GUXA 1FPHH 2C8YB 2O8UA 5TCCA 1TNIA 4HZHA 3MHWU 1V2KT 3QTVH 1NROH 3N7OA 2R3UA 5EPNA 1GI9B 3KL6A 4BAKB 4FUIA 4NIVA 4O97A 4VGCB 3GYLB 1W2KH 1NRRH 1HNEE 1IQHA 2OCVB 1W0ZU 3P17H 3L33A 1GBDA 5FBIA 1THSH 2AGIX 1UCYH 5E0GA 1BUIA 5AHGH 1EJAA 1A5HA 3BV9B 2BYAX 1QQ4A 1B7XB 2W7SA 2G52A 1C4V2 1FAKH 1KIGH 1K1IA 1SR5C 4IMQA 3MOCA 2Q6GA 2ZI2H 3F9HA 1Y8TA 6CHAC 2KAIB 5A8YA 3B9FH 1GJBB 2BY9X 2UUJB 1TOCB 2FEQH 1NESE 1TMBH 1D3PB 1C4U2 3DFLA 2Z3CA 5CMXH 1PFXC 3O8CA 1C9TA 4ISOA 4ABDA 3BTWE 3BSQA 5F03A 1TGCA 1YPKH 3A84A 5B6OA 2BZ6H 3BG4B 1K1NA 1G2MA 1SG8B 2FOBA 4ABHA 1AVXA 2QXIA 1A5IA 2ZGXH 5GPIB 1WAYB 1ZRKA 4JK6A 1ELDE 5FAHA 4I31A 4DURA 4MNWA 3SU1A 3LIWA 1MZAA 4ZKOU 4D9RA 4ZAEA 3SU0A 2BHGA 1FDPA 1O2VA 1K2I1 1Y3WA 1JMOH 4BOHA 2UWLA 3SBKA 1GBKA 1FY3A 1RGQA 2OLGA 4X8VH 2PR3A 3LGUA 4BAMB 2ANYA 3KGPA 3H5CB 4AZ2B