1TNLA

Prediction of novel serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tnlA02
2ZU3A 4QT8C 3TJNA 4O9VA 3KQCA 2SGPE 4D76A 2P93A 1GBMA 1JIRA 2ANMH 2BX4A 3HKIB 1OWIA 3E90B 3SQHE 2LNCA 4ISNA 3EE0B 4ZH8A 3KIDU 2TIOA 3MMGA 3BV9B 4CH2B 4Z6AH 1FUJA 1RS0A 4SGBE 2OP9A 4UDWH 2HNTF 1O3DA 1F5RA 3MNSA 1YC0A 3Q77A 2RA0A 3T26A 2FYQA 3RXQA 1L4ZA 1O2OA 1TNHA 2Z9JA 3GYMA 3S9CA 2Z6BD 1DITH 1JMOH 1C2IA 1C5NH 1CA0C 1ZSJA 3VGCB 3TGJE 5K7RA 2EI6A 1NU7B 2ZCKP 3R0FA 1O3CA 1UVPA 4NWKA 2ZHDA 3RXEA 1MCVA 3ESTA 5CHAB 1DWDH 1LKAA 3RXHA 3T62A 1D6RA 1O2VA 1TPOA 1WTHD 2PWXA 1A4WH 2ZC9H 1DXWA 4ZKNU 3SV9A 1LPKB 1S0QA 1C5TA 2PSXA 2PV9B 1EAUA 1DWCH 1UK2A 1CSOE 4IGDA 2ZTYA 3ELAH 2VINA 1W7XH 1ABJH 3P92A 1C1WH 4XFQA 1QJ6B 4ABAA 3I78A 3RXMA 2OD3B 1OWJA 2AYWA 3KL6A 4NZQA 3PROA 4O03A 4K60A 4CBNA 2FTMA 1MKXH 3TLOA 4THNH 2ZDLA 1G3CA 1AUJA 2UUYA 5I25A 5A09A 1EATA 1HDTH 2BOHB 2H1UA 1TNIA 1MZDA 1K1PA 1ABIH 2AIQA 9LPRA 2PKSB 1NN6A 4FVBA 4H4FA 2BD3A 3ZYEA 2B7DH 2ZHFH 4BANB 1IQFA 1OWHA 4XBDA 2IPHA 2R2WU 1CHGA 3F9GA 4IC5A 5DK1A 1Y8TA 4Y7BA 5C2ZA 2BB4A 4X1NU 5TJXA 5JPMH 4X6NA 4ZROA 1GDUA 1QR3E 1WQVH 3UIRA 2B9LA 1P8VC 4I31A 1Z8IB 3GISB 2JKHA 4AG1A 5A2MH 1ELBA 3LGWA 3GY5A 1P2NA 1OWEA 4YZUA 4NA7A 1J14A 1RD3B 1NFXA 1J16A 1O37A 1SGDE 3V13A 1PYTD 3CS7A 5L6NH 2OQUA 2ZNKH 3S7HB 4X1QU 2Z9GA 2FI5E 3URDA 1D9IA 1EQ9A 2ODPA 1HB0B 3PLBA 1YPJH 5T6DA 1SFIA 1TMBH 2VWOA 2Z9LA 4YT6H 3RXOA 3S69A 4BOHA 2ODYB 1SBWA 2H6MA 3SJ9A 1ELFA 1NT1A 3SU3A 3P6ZB 1A1RA 4YOJA 4JYTA 4FUIA 3A84A 4X6PA 1EASA 1XX9A 1MU6B 2A7JA 4ABEA 2C3SA 1KTTB 2K1QA 5FCKA 2BQ6B 4KTUA 1F5KU 2OC0A 3VB6A 4OS6A 1EJNA 4ZXYH 3FP6E 1SLUB 1NRRH 2WUBA 3BTQE 1J9CH 3PLKA 3A8CA 2A4OA 1Z8RA 5C1YA 2XC0A 3SNEA 5A0CA 1BTWA 3T27A 1XVMA 2BM2A 1UVOA 4DURA 1MBMA 4CHAB 3OX7U 1TGCA 3DFJA 5JB9S 2ALPA 5EW2H 1GI3A 1CT0E 1SGCA 1SR5C 2EEKA 2FOHA 1GBCA 2ZFSA 4LZ1H 2ZGXH 1NRQH 1HJAB 2ZEBA 4OS7A 4B1TA 1DPOA 1QL7A 1FY5A 3RXVA 2VH6A 1C2GA 1L2EA 2F9BH 1NFYA 4K1EA 5GPIB 1C1QA 1QA0A 3SU5A 1YPLH 1TMTH 1ID5H 4DGJA 4XDEA 1W12U 8KME2 4J1YA 4U32A 1ESAA 1GI5A 5HM2A 4K3JA 3D62A 2B0FA 1FY1A 3P8OA 3ZZ7A 5JBBS 1GDQA 1O3GA 1HAZB 2UUKB 2EC9H 1GPZA 3SU2A 2BMGB 1KSNA 1ELEE 3OY5U 5A0BA 2TRMA 2ZFRH 3BEUA 3DUXH 2ZPQA 1YP9A 1H9LB 3BTDE 2OBQA 3O8CA 2GX4A 5ETXA 4NGAH 1SI5H 3U69H 1GBHA 1GBLA 4SGAE 3KGPA 3A80A 1G3DA 2CF8H 2J38A 2VIPA 4I8LA 2ZDKA 1V2QT 3RXJA 3EQ0H 5EXLA 1YPMH 2ANYA 2JH5D 5JBTA 3VXFH 3RM2H 1KLTA 4NA8A 2R2MB 1O2MA 1FAXA 4ZXXH 4Y0YE 4Q2KA 1TOMH 2BD7A 4X8UH 3RXFA 3TK5A 3TPIZ 4NWLA 2KAIB 1GI0A 2ZHEH 1EOLA 4NFFA 4JYVH 1RJXB 1HRTH 2IJOB 3SUEA 2ZFFH 4D7GA 2FX6A 1AKSA 1DLEA 1KXEA 2Y82A 4IS5A 4AYVB 1XKAC 5PTPA 1SGIB 2C90B 1EXFA 4ISHH 2GCHG 1ELVA 1BTPA 5GIBA 2ESTE 2QN5T 3NPSA 3UREA 3SO3A 3RP2A 1GI6A 1HPGA 3FP8E 1H8DH 2O8MA 4E7RG 2Y81A 2C4FH 3TH2H 3M3VA 1DWEH 1V2LT 4ZAEA 2JH0D 1MTWA 2BD2A 1SGFA 4GSOA 4OGXA 2G4UA 3SHCH 1EOJA 5C20A 1YCPK 1JOUB 5C5NA 1MTNB 1MD7A 3RXIA 4A92A 2VVUA 1IQGA 2UWOA 2C8ZB 4I33A 3FFGA 2AGIX 2FODA 2Z9KA 4E06H 1K1IA 2A4GA 4JZ1A 4INLA 1C4Y2 1YPEH 1ANEA 1TNJA 4IC6A 5FPTA 3P8NA 1O5DH 1OXGA 5ABWA 3TJVA 1TRNA 4AG2A 1C1RA 1K1JA 3K2UA 4CREA 2XTTB 1C1PA 1SGFG 1LVMA 1UO6A 4JK5A 4VGCC 4Q7YA 1O33A 4KTCA 4WJG2 1Q2WA 4KP0A 2ZWLH 1O38A 5DKMA 3A7WA 3SN8A 2FEQH 5FHTA 3UTUH 2QC2A 1P57B 4D9RA 1O2SA 2BDGA 1V2ST 1AFQC 1AVXA 1TQ7B 1AU8A 2H9HA 5F8ZA 4NA9H 2FM2A 2XCNA 4YO9A 1V2WT 1AO5A 1ELAA 3NXPA 2VIQA 3F9EA 3RXDA 1TYNA 2W5EA 1AQ7A 3A89A 4NZLA 1HFDA 2V6NA 8LPRA 2VH0A 1KY9A 1O2IA 2WINI 3UR9A 3URCA 5H4IB 2IN2A 1YLCA 1W7GH 3ZZ3A 3RXAA 3TVJB 1EAIA 3C27B 1EAXA 3D65E 2BY5X 3RXLA 2FPZA 1YGCH 3JZ2B 3HGNA 3HGPA 4DOQA 1SGYE 3RXUA 2BDBA 1RGQA 2FMJA 3SJIA 3QUMP 3QZRA 1AZZA 4RKOB 1AE8H 1N8OB 3A8BA 2XBYA 2HRVA 2J2UA 3GY7A 3MU8A 4CR5A 2SFAA 3A7TA 4I8KA 2VVVA 1NRNH 1S6FA 4WF8A 4GVUA 1HAVB 2TBSA 5EOKA 3U8RH 1HGTH 5ESTE 1FPCH 1CA8B 2PTCE 5DP7A 1GJ5H 4DW2U 1NFUA 3BTKE 5T6GA 2A4RA 4H6TA 5DGJA 3A82A 3WY8A 6CHAC 1GCTC 3GOVB 4IN1A 2P3FH 3RXRA 3PTNA 1SGPE 4U30A 1O39A 4I8GA 2Q6GA 1PQ8A 4IMQA 1TRYA 3VPKA 1DX5M 1ZMLA 4I8HA 2ZA5A 1A0HB 1YPHE 4Q7XA 1PYTC 2Z9IA 4X6MA 4MNXA 2GKVE 4FU9A 1GI1A 1THPB 2YNBA 4KTSA 5E2OA 3A83A 1T7CA 3I29A 3MWIU 3RXCA 1TX6A 4BXWA 1BRAA 4ISIH 1RTFB 2CJIA 5DP4A 1G9IE 2IOTA 1C5PA 1N6YA 1WU1A 2PUXB 4ISLA 1SGEE 1QQUA 4MNVA 3F9FA 2HVXA 1U6QA 1P0SH 5AHGH 3LONA 1OYTH 3EAJA 1O3BA 3LGUA 1TONA 1WSSH 2XBVA 5J4SA 1TA6A 1ELDE 3E0PB 3OY6U 2ZI2H 5IDKA 1EB1H 1UTKA 3GCNA 1F92A 1W13U 1BRCE 1LHCH 2TGAA 1PPCE 2ZPSA 4LK4A 3SW2B 3T2NA 5EQQA 4Y0ZE 1Y3WA 1UCYK 4F4OC 3PLPA 1FPHH 3VXEH 1C1UH 1ZTJA 4TY6A 3MO6A 1O2WA 1B5GH 3FVFB 1ARBA 2QGRA 1C2KA 2QY0B 5TCAA 1ANCA 1O3NA 3ZZ5A 3EGKH 1B0EA 3RUOA 4DJZB 1CBWC 3MTYA 2PLXA 2UUJB 3CP7A 3P17H 1AFEH 4JZFH 1GMDF 1VZQH 4K5ZA 2W7SA 2ZGHA 2BQWB 1AMHA 3U8OH 2QAAA 2FTLE 3GCTF 3ODFA 1O2ZA 1O5AB 3MYWA 4HI3A 1OKXA 2PHBA 1TAWA 4WXVA 4ISOA 1FNIA 3RU4D 1Y3VA 1BMAA 2GV6A 3UNSA 1L1GA 1YPHC 5FAHA 1N1LA 1C5RA 2NU2E 2Y7XA 3U8TH 3L33A 2C8YB 2RCEA 3VB5A 1A61H 2H9TH 1UTLM 1FIZA 1QBNA 1C2JA 1QTFA 1AN1E 5FBIA 1BMMH 1J8AA 1OOKB 2J9NA 1GGDC 2ZGBH 1GI4A 1O2YA 4IBLH 2G4TA 1BJUA 1FLEE 3DA9B 3Q3YA 1JXPA 1Z71A 4D7FA 1EAWA 1AKSB 1HAGE 1Z8JB 3F68H 4AN7A 2H9EH 1WV7H 4FUGA 4K2YA 1GG6C 1Q31A 1YKTA 3AAVA 1Y3UA 5GWZA 2QA9E 3MI4A 2JH6D 5GJ4B 3SNCA 2HOBA 2NWNA 3E8LA 4ABDA 1SLWB 1O2PA 1O0DH 4UFEH 1K2I1 1TNKA 4GPGA 1G3EA 2ZQ1A 1O2KA 2PR3A 3LH3A 1A5IA 2FLRH 1JRSA 1XXFA 2OINA 4JK6A 3MNBA 3ZZ9A 3GDUA 2RA3A 1OWKA 2EI8A 5HMAA 5E0JA 4ZHLU 4WWYA 1NRSH 5AFYH 4DY7B 2Y5GA 1SC8U 1ACBE 1ZZZA 1BDAA 1KLIH 1QB1A 2WPKS 4I8JA 2OUAA 1V2NT 4HFPB 3NUMA 1AY6H 1LPGB 1P02A 2A5AA 2A0QB 1C2FA 1MZAA 2ZDMA 3F1SB 1TIOA 1K1MA 2BLVA 3W95A 1OS8A 1W0YH 2CXVA 4JMYA 1OWDA 1GBIA 2Q1JA 1GBJA 1GL0E 4GAWA 3GCHB 1XUJA 1C5LH 3LU9B 5DP3A 3RC4A 1HCGA 4AGKA 1TE0A 4UFFH 5DP6A 1ANBA 1L1NA 1QURH 2G5NA 4OS2A 4B73A 4ZKOU 4HTCH 2VIOA 4NIYA 4YOGA 2PW8H 1FDPA 3MH6A 1QGFA 1YPGH 1AB9B 1TGBA 2GP9B 1GMDG 1OYQA 4JCNA 3FP7E 2ZHWH 1NZQH 2BDYA 3GY3A 3VFEA 1TABE 1O30A 1GJDB 2ZGCA 3SJ8A 1O31A 1LCYA 2Q6FA 2HPPH 2GMTC 5A8XA 3SJOA 1MTUA 3GCTG 4AORA 1BQYA 1LKBA 1EJMA 2Z3EA 3SU6A 1O3AA 1UVSH 2BZ6H 3AW0A 4CRBA 1GI8B 2QXIA 3K6YA 5JYIA 4ABFA 1P9UA 2ZFPH 4WXIA 1HUTH 5GDSH 3A7ZA 1L1JA 3L6PA 1Z1JA 2BY9X 3QWCH 1Y5AT 2XC4A 1GJCB 2PGQB 1EPTC 3C1KA 1W3CA 1GHYH 1O3MA 1XM1A 1H8IH 3KF2A 1O5BB 2H5CA 5L30H 2ZZUH 2ASUB 3B8JA 3MU1A 3RXBA 4KELA 4YLQH 3E6PH 1TB6H 1UK4A 1SQOA 1CHOF 3S9AA 5HXFA 1UTMA 3U1JB 1V2PT 1M9UA 1W10U 3HPTB 2CV3A 4FXGH 5AVDA 1HAVA 1NESE 2A2XH 1T8MA 4I32A 1ZPZA 3OYPA 3UQOA 2YNAA 3RLYH 1YM0A 1P05A 1O2RA 1V2KT 4XBBA 1GJ7B 1O3HA 1ZSKA 3TK6A 2Z7FE 4MDSA 2Y80A 4H42U 3T28A 4A6LA 1X7AC 3BIUH 1V2JT 3VB7A 4AFZA 1UTPA 2FXRA 3GY6A 3GY2A 1VCQA 2WYGA 1SVPA 1BJVA 2SGFE 1D3DB 1FN6A 3BTWE 5LPRA 3P8FA 2BDCA 3KQBA 3MO3A 1V6DA 2VNTA 3RU4E 1BTUA 1FV9A 2GCHF 1GI7B 2SGQE 1WYKA 1ZTKA 2QCYA 3P70B 2DE9A 3TITA 4X1RU 4AB9A 4DT7B 5F03A 3TGKE 1SLVB 3SQEE 1E36B 1RIWC 2W3IA 1SB1H 1T4UH 2VGCC 2XWAA 1EZSC 2Z3CA 4ABHA 2P16A 4U2WA 1OP8A 2AGGX 3HKJB 3QTOH 1O2QA 3GICB 4AFSA 1TBRH 1CQQA 4CH8B 4INKA 3SGAE 1GHAF 1F0UA 4K8BA 3LGTA 1LVYA 4X2VA 1LPZB 1XUFA 2C8XB 1ZPCA 1JRTA 2WPJS 2ZGJA 3JZ1B 1THRH 1DE7H 6LPRA 2C8WB 1VCPA 5T3HA 2F83A 1Y3XA 1LTOA 1QY6A 3VB4A 1LHEH 4Y79A 5DG6A 3SV2H 4CRCA 2QF0A 1XMNB 1O5EH 1VJ9U 1BRBE 2TGPZ 1SFQB 3ZVAA 1NRPH 1D6WA 1SG8B 2ZDAH 3RMNH 1ZSLA 2ALVA 5E8EH 2J92A 2A5KA 1SSXA 1V2UT 1C2HA 1BZXE 1DY9A 1C2LA 1YCPH 5K0HA 3M7QA 1IQNA 5FXLA 4ABJA 1ZJKA 1MQ6A 4HZHA 1BIOA 1ZMJA 3QX5H 1GJ6A 4PROA 1ZHPA 4DG4A 1A7SA 1Z6EA 1UVTH 1BOQA 3MNXA 1GJ8B 2AERH 2V3OH 2GZ9A 2F9OA 1P10A 2WV5A 4Y8XA 3OU0A 1O3JA 4UFGH 3M5OA 1CHOG 3MNCA 1GCTB 4UD9H 3CS0A 5SGAE 1O2NA 3ZZBA 3BTFE 3BTEE 1S6HA 1VITF 2GZ7A 4KGAA 1S84A 3BN9A 2C93B 2P59A 1SMFE 3IWMA 3MHWU 3AASA 1TNGA 3RMOH 1SOTA 2BHGA 3F6UH 4NIWA 4Y10E 1NROH 3PMAB 1TRMA 1ESBA 1MUEB 2CGAA 3U98H 2R3YA 3STIA 1PQ5A 5E0GA 2QXGA 3T5FH 4CRFA 3LGIA 1DUEA 1ZOMA 2ZU5A 4X8VH 1ZRKA 3ZVFA 4HGCA 1KXDA 3VB3A 2BX3A 4ABGA 2G52A 3FAOA 1GMCG 1QJ1B 1K22H 3A86A 3SJKA 1MAXA 1O2GH 3LJOA 1A3EH 1SGQE 4NG9H 1IOEA 2TGDA 1O3OA 3TNTA 5DP8A 3SGBE 2XRCA 1ZHMA 3A85A 3MOCA 3ZZ6A 3SV6A 1E34B 4WMDA 3KHVA 5JB8S 1AD8H 3EA7A 3PMHB 2UWPA 3U1IB 1PPFE 1GHAG 1HAHH 4ZKSU 1TGNA 2AS9A 1GHXH 2YOLA 1C5XB 3LPRA 3SUFA 2XWBI 1YLDA 1QRWA 1C9PA 1EZXC 1KIGH 1GJAB 2ZP0H 4FUEA 1BBRH 3UR6A 1CBWB 1F0TA 1F2SE 3MH4A 3SNAA 2ZPRA 2D1JA 2AFQB 3D23A 3H7TA 1AVGH 3DD2H 5EXNA 5DP5A 3ZVEA 4KKDA 3SU1A 3RDZA 1NU9A 3TJUA 1O3FA 1UVUH 1LVOA 2XBXA 2J94A 3KQEA 5F8XA 4FUDA 2GT8A 4MNYA 1MKWK 1G32B 3FZDA 3ITIA 1LO6A 4BAQB 1LHDH 1G37A 3BTTE 3SOSA 2G81E 1BRUP 1Z1IA 1OPHB 1PPBH 2AH4X 2F9PA 2WPIS 4BAKB 1ELGA 1DSUA 1P2MA 1PJPA 1P11E 8ESTE 1KDQB 3G01A 1V2RT 2ZECA 5FPSA 1G36A 1O36A 3BEIB 1ELCA 2WYJA 1VITG 3ZZ8A 1GGDB 1J15A 5G4BA 4CHAC 1C5UA 2PFEA 3LIWA 5C67A 1C5OH 2Z94A 1LQEA 3ATKA 4X1SU 4YTAA 1HJ8A 2FOFA 3SGQE 1G3BA 1MMJN 1NFWA 4WH6A 1A5GH 2LPRA 5JBAS 1GG6B 3QDZB 3MH7A 4RSPA 3ZZAA 1PFXC 1SLXB 1HAOH 4X0WU 8GCHF 2BDHA 2O9QA 2BY6X 3Q3XA 4Y71A 1FY4A 1UMAH 3ZVDA 3M7TA 1NTPA 2BLWA 1GHVH 2ZIQH 1HIAB 2GVFA 1OP0A 1OSSA 1GI2A 1OP2A 5HGGA 1O32A 1C1OA 2I6QA 5FX5A 1UTOA 1B7XB 1KXBA 2BLOA 1T8LA 3A8AA 1AWHB 1FAKH 1LDTT 2QV1A 1XVOA 4B76A 2OQ5A 2GCTC 1P06A 3A81A 1GHBF 4BNRA 2A5IA 2PKAB 4A5TS 1DY8A 1A3BH 1P01A 1ORFA 1EP6A 1FONA 1O2HA 4ABIA 4IN2A 1TWXB 1CA0B 2OC7A 9ESTA 1EB2A 4A1VA 3BF6H 3M3TA 1FMGA 2STAE 1W2KH 1PQAA 4NCYA 4X8SH 1W11U 2J4IA 2WUCA 1O2TA 2QIQA 3BEFB 4Y11E 1QFKH 1SPJA 5F6MA 2FOAA 4MPWA 1DLKB 3V0XA 5EQRA 1DUAA 2P8OC 3TJOA 3DT0H 1F0SA 2VVCA 1Y5BT 4MPXA 2BTCE 2AMPA 5A8ZA 4I7YH 1AI8H 2G5VA 2HPQH 3LJJA 2FOBA 1XUKA 3ZV8A 1E0FD 3R3GB 3UY9A 2F9NA 1XKBC 1VR1H 3M7UA 3P95A 1QIXB 3NWUA 4FUFA 2HNTE 1KYNA 3F9HA 4BXSA 7GCHF 5FCRA 3SUDA 2VU8E 2QXJA 2UWLA 1H4WA 2BZAA 2F91A 1Q3XA 1JWTA 4OS5A 1P2IA 1TMUH 6GCHF 2O8WA 3RXGA 2PUQH 3MU5A 1Y59T 4OS1A 4O3TA 3Q00A 3E91A 2R0LA 1DSTA 1G2MA 2Y5HA 3T25A 2BVRH 5DP9A 3QGJA 3ZVBA 3ATMA 1T4VH 2G55A 3HK3B 8GCHG 5T6FA 1Y3YA 1SOZA 3I77A 2AIPA 4YT7H 2G00A 3K9XB 1VGCC 4FUHA 3UNQA 2F3CE 4WMEA 2VB0A 4XOJA 5LH8A 3NKKA 2OCVB 4BAHB 1SL3A 2XXLA 3S7KB 2BDAA 1HJ9A 3M5LA 4K8YA 2FOMB 1QA7A 4AZ2B 4ZMAH 3ODDA 5FPYA 4X2XA 1EKBB 5GCHF 5L2ZH 1F7ZA 1NC6A 3LKWA 3EDXB 3B23B 1QJ7B 1GHBG 3ZVGA 1NS3A 1KLJH 3SV7A 4K1TA 4NSYA 4U01A 4Y76A 1MQ5A 2NU4E 3KCGH 1DM4B 4TPYA 2M5TA 1P3CA 1S0RA 4O3UA 1O2JA 3M35A 2VGCB 4E05H 1A46H 4MTBA 1BTHH 4MPVA 1JBUH 1N8OC 1KXCA 1C5SA 1AHTH 3OSYA 2VWNA 1GCDA 1N6XA 3UWIA 1ANDA 3M5MA 1JIMA 1VITH 2O8TA 2FX4A 1ETSH 1HAYB 1T31A 3W94A 3GCOA 2ZO3H 1CT2E 1TNLA 4ASHA 4JZEH 2HNTC 1C5ZB 4YOIA 3IITA 1MD8A 1P12E 2A45B 2ULLA 3LC3A 3MO9A 1TGSZ 2EA3A 2GDDA 3GY4A 1YPKH 1KTSB 1BHXB 2CHAC 1AIXH 2P3UB 3M5NA 1FI8A 3P8GA 3TK9A 4AYYB 5AFZH 1L0ZA 2XCFA 2NU0E 3RXSA 3AW1A 4UONA 1K1OA 2CMYA 1WTGH 1EUFA 4FU7A 1AWFH 4OGYA 1GDNA 4DVAU 4LZ4B 1P09A 3V3MA 2BY8X 7GCHG 2QXHA 2BOKA 1DXPA 1O5FH 4WVPE 2BY7X 2DE8A 1WAYB 2BVXH 3BTHE 3LDXH 1DANH 1IHSH 2OBOA 5ESBA 1ZHRA 5EXMA 3TIUA 6GCHG 2FO9A 1ZR0A 1TQ0B 1ZJDA 1YBWA 1FN8A 2A7HA 1A0JA 1HXEH 1IQMA 1QCPA 3STJA 1GBKA 1ZTLA 4B74A 2Q6DA 2FZZA 1FJSA 1V2VT 2OC1A 1C9TA 1IQHA 4Z0KA 5IYTA 1XUHA 3ZYDA 3EA9A 3K6ZA 2Y6TA 2ZU4A 1KDQA 4Y6DA 1O3LA 1FQ3A 5GXPA 1QB9A 2FDAA 4X1PU 1QL9A 4TY7A 1QNJA 1OX1A 5B6OA 1LQDB 1E37B 3K65B 5GCHG 2CN0H 3LT3A 1PPZA 1GBFA 3PO1C 4OS4A 2CF9H 3UOUA 2ZFTA 1FXYA 2SNWA 2STBE 1P04A 1AZ8A 3PTBA 3ZVCA 4ESTE 1DOJA 1BCUH 1ZGVA 3CENA 2ZU2A 2BQ7B 2F9VA 4MNWA 1Y5UT 2WPLS 5CMXH 1C5WB 2VIDA 1NY22 2R9PA 3A87A 1GL1A 3E3TA 3ATIA 2BD8A 5C1XA 1HIAA 1QB6A 4E7NA 3RLWH 4X2YA 2ZQ2A 4AB8A 2AEIH 4AFUA 1C4U2 1UTJA 3RC6A 1IQLA 1QL8A 1SQTA 2FI3E 3RXPA 3HK6B 4RN6A 2DUCA 3E0NB 5EPYA 2B8OH 5C3NA 1CGIE 2SGAA 2PKAA 1C5VA 1GBAA 3RXKA 1P2QA 2Z3DA 3UNRA 4Y8ZA 2WPHS 3FZZA 1O5CB 4VGCB 1GMCF 1P3EA 2FP7B 3BG4C 2JETC 4BAOB 1S83A 3B9FH 4B71A 2Y5FA 2A32A 3LC5A 1BUIA 5LPFA 4GCHF 1T32A 1QRXA 1W8BH 5TCCA 1THSH 4M7GA 1AFQB 1HAIH 7LPRA 2QF3A 2NU3E 4NSVA 3EYDA 3MU4A 2F9UA 4K69A 1SGNE 1MH0A 1AVWA 3PWCA 1MKXK 4O97A 1C1VH 1DWBH 1SGRE 1GVKB 3UQVA 2OTVA 3TH3H 2A1DB 2AMQA 2D26C 3UOPA 3V7TA 1P2OA 1O3PB 1L4DA 1C5MD 1WUNH 4BTUB 1K1NA 1GHZA 4FVDA 5C1UA 5F8TA 1IQEA 2ZFQH 2ZCHP 4Q80A 2FI4E 1HAXB 2D2DA 2H2ZA 3HATH 2UUFB 3E1XB 2GTBA 1RFNA 4UEHH 2ODQA 2P94A 1QHRB 4MVNA 4YESB 2R3UA 2THFB 2W3KA 2FESH 4ZHMU 3KN2A 2FS8A 1EPTA 1GBEA 4NIVA 1BHXF 2J34A 4TPIZ 3VGCC 1BB0B 3KEEA 3SHAH 1LMWB 2ZDVH 3GCHC 2ZTXA 3GYLB 1F5LA 1K1LA 5J4QA 1GJBB 5CHAC 3U9AH 1BTXA 1UTQA 4BTTB 2A31A 4ZHAA 2GT7A 3UUZA 5EW1H 2ZDNA 1GMHF 1ZGIA 3VEQB 3QN7A 1C1MA 6CHAB 3O8BA 2HLCA 3ATLA 1AB9C 5BPEA 3FANA 1E38B 1V3XA 2BD4A 2GGVB 5DPAA 4FU8A 3QO6A 2ZG0H 5JBCS 6ESTA 3LGVA 3RC5A 4AGJA 1AGJA 3N7OA 4WH8A 4AX9H 2ZKSA 3A7VA 4Y8YA 2GCTB 2AMDA 2VJ1A 1MTSA 5E2PA 1ESTA 5DJ7A 4WMFA 1MU8B 2PTNA 1EJAA 3LH1A 1K21H 4F49A 1MKWH 1CVWH 3O8DA 1TFXA 3QTVH 3MH5A 3L3TA 1ZLRA 3ZZDA 4DIHH 1C2MA 1UHBA 2XBWA 3RMLH 2A4QA 3BTME 2PKSC 2TGTA 1A2CH 3A7YA 2GD4B 1PPGE 1QRZA 2ZTZA 4K1SA 1W14U 1HNEE 4XSKU 1NO9H 3GDVA 1CU1A 1XUGA 4TWYA 1RXPA 2PGBB 4RKJB 3E16B 1RRKA 1NPMA 4GCHG 3PV4A 5HYOA 1CT4E 1RTLA 2FOCA 2P8OB 1S85A 2GZ8A 2O8UA 7ESTE 2HGTH 1O35A 4D8NA 4CRAA 2OLGA 1EP5A 1H9IE 1TPAE 1QQ4A 1Z7KA 1ZRBA 2FIRH 5CE1A 1MAYA 3M61U 3AVZA 1GJ4H 2EI7A 4D9QA 2BVSH 1Z6JH 2J95A 4UE7H 1CO7E 3BSQA 1GBTA 1MTVA 2BXTH 2ZU1A 2GV7A 2VWMA 2OC8A 1NM6A 2BD9A 1MBQA 1GBDA 2FOEA 4NFEA 1TX8A 1AE5A 1LHGH 3Q3KA 3PWBA 3LGYA 1WBGB 1IQKA 1K9OE 5A8YA 2BYAX 2FWWA 5DO4H 1SGTA 1V2MT 3RMMH 2PSYA 1CE5A 2VIWA 1BTYA 3SI3H 1EZUC 2ZF0H 3ATWA 3A7XA 4B75A 2RDLA 1UTNA 5JDUB 3TU7H 4FUJA 1CGJE 5E0HA 1WCZA 1VGCB 3RXTA 2ANKH 2ZCLP 4GUXA 3TGIE 1GMHG 2O8LA 5I46H 4GHQA 4R0IA 2A2QH 3PMJA 1EX3A 4X6OA 1HXFH 1XUIA 4LOYH 2A7CA 3ZZ4A 2V35A 1ZPBA 2NU1E 2BD5A 1ETRH 1HAPH 1B0FA 1O5GH 3SUGA 4AOQA 3QZQA 2HWLB 1C4V2 1D3PB 2D8WA 3D49H 2P95A 4MG3A 3BG8A 2V0BA 1IAUA 2ANWA 3OTJE 1QBVH 1PQ7A 3BTGE 5EQSA 5EPNA 4BTIB 1HJAC 1UCYH 3S9BA 3A8DA 1C1NA 2GDEH 1V2TT 2FOGA 2W7UA 2XYAA 2P3TB 1BMNH 2RG3A 4FUCA 4UFDH 1T8NA 2XC5A 1KXAA 3SI4H 2XW9A 3M36A 3SU4A 3QK1A 3T29A 3LOXA 3RM0H 1D4PB 2Y7ZA 1DICA 3GY8A 4WY3A 2SGDE 3Q76A 1O3KA 4GLYA 3UFAA 3NK8A 1S82A 1W0ZU 5FX6A 4CRDA 1K28D 2WPMS 1FZZA 2SGEE 4JZDH 4Q7ZA 5BRRE 3MU0A 1BBRK 1C1TA 1FY3A 4AFQA 5A0AE 3SV8A 1TBQH 1FIWA 4YM9A 3QGNB 4XE4A 2B5TB 4GHTA 1PPHE 1C2DA 4R8TB 2CHAB 4ABBA 3IG6B 5LPEA 1TGTA 1EZQA 4INHA 1P2KA 1UJ1A 1FY8E 3DFLA 3PB1E 3RU4T 1F0RA 1TLDA 4TWWA 4X2WA 3QLPH 1IHTH 3S0NA 3ENSB 1GWAA 1T8OA 1YYY1 7KMEH 3MFJA 1TA2A 1TBZH 1ELTA 5FBEA 4CRGA 3H7OA 1O2XA 3UWJH 4Y7AA 2ILNA 3SU0A 1BBRE 1P03A 3AAUA 1O3EA 1WQSA 4JYUH 3V12A 1C5QA 1TALA 1TPSA 1SQAA 5AF9H 2R0KA 4X8TH 1Z8GA 1C2EA 2VWLA 1YCPM 1VJAU 2GMTB 1BITA 3M37A 4B2BA 2ZHQH 3SNDA 1GBBA 3DHKH 1ARCA 4ZUHA 1V2OT 4B2AA 1BA8B 1S81A 1TPPA 4MQAA 3BIVH 3KNXA 1GVLA 5EGMA 4A1TA 1DT2A 1VCWA 3EA8A 1MTNC 3A88A 5HM9A 1WOFA 2I6SA 4FUBA 3O8RA 1HYLA 1H9HE 4DCDA 4CBOA 1BTZA 4ZKRU 3UPEA 2AGEX 2FS9A 3NZIA 3SZNA 1EPTB 3SNBA 3M3SA 1O2UA 1CGHA 1YF4A 4B2CA 2BXUH 1SHHB 1H1BA 4IMZA 3GDSA 3ZV9A 1P9SA 3PO1B 4XBCA 4NIXA 4BAMB 2OXSA 4YLUA 3ZZCA 1RTKA 4JZIA 3KQDA 1D3QB 1G2LA 5LGOA 1INCA 2HALA 1O34A 5EU8A 2V3HH 2G51A 1IQJA 1AUTC 2FYRA 3TH4H 1BT7A 1GI9B 1G30B 2W26A 1UCYE 1DS2E 1PPEE 5C5OA 3PYHA 3SORA 1DFPA 1GJ9B 2FLBH 1TX7A 1MCTA 1P2JA 1DDJA 3PM3A 2BLQA 4MLFB 1A0LA 3PMBB 1HV7A 1GHWH 4A1XA 2XNIA 1UK3A 3NCLA 4A7IB 1UHBB 2WV4A 2G8TA 1D3TB 1E35B 1ETTH 1S5SA 1TOCB 1GVZA 1SHYA 5EG4A 1O2LA 1BMLA 2VIVA 4TYDA 1A5HA 1KXFA 4DIIH 1O3IA 3BG4B 2JETB 1C5YB 1RIWB 4IW4E 1HBTH 1LVBA 5EODA 4CR9A 4H6SB 2H5DA 3SBKA 5L2YH 2SNVA 1XXDA 1C1SA 3TNSA 2KAIA 1DVAH 1J17T 1ZMNA 2QYIA 4J2YB 4LXBH 1ZYOA 2TPIZ 1HLTH 1IQIA 3H5CB 1LHFH 1QBOA 4MPUA 2BDIA
chains in the Genus database with same CATH superfamily
2ZU3A 4QT8C 3TJNA 4O9VA 3KQCA 2SGPE 4D76A 2P93A 1GBMA 1JIRA 2ANMH 2BX4A 3HKIB 1OWIA 3E90B 3SQHE 2LNCA 4ISNA 3EE0B 4ZH8A 3KIDU 2TIOA 3MMGA 2QF5A 3BV9B 4CH2B 4Z6AH 1FUJA 1RS0A 4SGBE 2OP9A 4UDWH 2HNTF 1O3DA 1F5RA 3MNSA 1YC0A 3Q77A 2RA0A 3T26A 2FYQA 3RXQA 1L4ZA 1O2OA 1TNHA 2Z9JA 3GYMA 3S9CA 2Z6BD 1DITH 1JMOH 4XRNA 1C2IA 5IK2D 1C5NH 1CA0C 1ZSJA 3VGCB 3TGJE 5K7RA 2EI6A 1NU7B 1WXRA 2ZCKP 3R0FA 1O3CA 1UVPA 4NWKA 2ZHDA 3RXEA 1MCVA 3ESTA 5CHAB 1DWDH 3SZEA 1LKAA 3RXHA 3T62A 1D6RA 1O2VA 1TPOA 1WTHD 2PWXA 1A4WH 2ZC9H 1DXWA 4ZKNU 3SV9A 1LPKB 1S0QA 1C5TA 2PSXA 2PV9B 1EAUA 5CHBA 1DWCH 1UK2A 1CSOE 4IGDA 2ZTYA 3ELAH 2VINA 1W7XH 1ABJH 3P92A 1C1WH 4XFQA 1QJ6B 4ABAA 3I78A 3RXMA 2OD3B 1OWJA 2AYWA 3KL6A 4NZQA 3PROA 4O03A 4K60A 4CBNA 2FTMA 1MKXH 3TLOA 4THNH 2ZDLA 1G3CA 1AUJA 2UUYA 5I25A 5A09A 1EATA 1HDTH 2BOHB 2H1UA 1TNIA 1MZDA 1K1PA 1ABIH 2AIQA 9LPRA 2PKSB 1NN6A 4FVBA 4H4FA 2BD3A 3ZYEA 2B7DH 2ZHFH 4BANB 1IQFA 1OWHA 4XBDA 2IPHA 2R2WU 1CHGA 3F9GA 4IC5A 5DK1A 1Y8TA 4Y7BA 5C2ZA 2BB4A 4X1NU 5TJXA 3WWFA 5EJ1A 4X6NA 4ZROA 5JPMH 1GDUA 1QR3E 1WQVH 3UIRA 2B9LA 1P8VC 4I31A 1Z8IB 3GISB 2JKHA 4AG1A 5A2MH 1ELBA 3LGWA 3GY5A 1P2NA 1OWEA 2JDID 4YZUA 4NA7A 1J14A 1RD3B 1NFXA 1J16A 1O37A 1SGDE 3V13A 1PYTD 3CS7A 5L6NH 2OQUA 2ZNKH 5T1VA 3OTPA 3S7HB 2RFKC 4X1QU 2Z9GA 2FI5E 3WWBA 3URDA 1D9IA 1EQ9A 2ODPA 1HB0B 3PLBA 1YPJH 5T6DA 4P02A 1SFIA 1TMBH 2VWOA 2Z9LA 4YT6H 3RXOA 3S69A 4BOHA 2ODYB 1SBWA 2H6MA 3SJ9A 1ELFA 1NT1A 3SU3A 3P6ZB 1A1RA 4YOJA 4JYTA 4FUIA 3A84A 4X6PA 1EASA 1XX9A 1MU6B 2A7JA 5C0UA 4ABEA 2C3SA 1KTTB 2K1QA 5FCKA 2BQ6B 4KTUA 1F5KU 2OC0A 3VB6A 4OS6A 1EJNA 4ZXYH 3FP6E 1SLUB 1NRRH 2WUBA 3BTQE 1J9CH 3PLKA 3A8CA 2A4OA 1Z8RA 5C1YA 2XC0A 3SNEA 5A0CA 1BTWA 3T27A 1XVMA 4FOUC 2BM2A 1UVOA 4ZCNA 4DURA 1MBMA 4CHAB 3OX7U 1TGCA 3DFJA 5JB9S 2ALPA 5EW2H 1GI3A 1CT0E 1SGCA 1SR5C 2EEKA 2FOHA 1GBCA 2ZFSA 4LZ1H 2ZGXH 1NRQH 1HJAB 2ZEBA 4OS7A 4B1TA 1DPOA 1QL7A 1FY5A 3RXVA 2VH6A 1C2GA 1L2EA 2F9BH 1NFYA 4K1EA 5GPIB 1C1QA 1QA0A 3SU5A 1YPLH 1TMTH 1ID5H 4DGJA 4XDEA 1W12U 8KME2 4J1YA 4U32A 1ESAA 1GI5A 5HM2A 4K3JA 3D62A 2B0FA 1FY1A 3P8OA 3ZZ7A 5JBBS 1GDQA 1O3GA 1HAZB 2UUKB 2EC9H 1GPZA 3SU2A 2BMGB 1KSNA 1ELEE 3OY5U 5A0BA 2TRMA 2ZFRH 3BEUA 3DUXH 2ZPQA 1YP9A 1H9LB 3BTDE 2OBQA 5CDFE 3O8CA 2GX4A 5ETXA 4NGAH 1SI5H 3U69H 1GBHA 1GBLA 4SGAE 2HVYB 3KGPA 3A80A 1G3DA 2CF8H 2J38A 2VIPA 4I8LA 2ZDKA 1V2QT 3RXJA 3EQ0H 5EXLA 1YPMH 2ANYA 2JH5D 5JBTA 3VXFH 3RM2H 1KLTA 4NA8A 2R2MB 1O2MA 1FAXA 4ZXXH 4Y0YE 4Q2KA 1TOMH 2BD7A 4X8UH 3RXFA 3TK5A 3TPIZ 4NWLA 2KAIB 1GI0A 2ZHEH 1EOLA 4NFFA 4JYVH 1RJXB 1HRTH 2IJOB 3SUEA 2ZFFH 4D7GA 2FX6A 1AKSA 1DLEA 1KXEA 2Y82A 4IS5A 4AYVB 1XKAC 5PTPA 1SGIB 2C90B 1EXFA 4ISHH 2GCHG 1ELVA 1BTPA 5GIBA 2ESTE 2QN5T 3NPSA 3UREA 3SO3A 3RP2A 1GI6A 1HPGA 3FP8E 1H8DH 2O8MA 4E7RG 2Y81A 2C4FH 3TH2H 3M3VA 1DWEH 1V2LT 4ZAEA 2JH0D 1MTWA 2BD2A 1SGFA 4GSOA 4OGXA 2G4UA 3SHCH 1EOJA 5C20A 1YCPK 5DN6D 1JOUB 5C5NA 1MTNB 1MD7A 3RXIA 4A92A 2VVUA 1IQGA 2UWOA 2C8ZB 4I33A 3FFGA 2FODA 2AGIX 2Z9KA 4E06H 1K1IA 2A4GA 4JZ1A 4INLA 1C4Y2 1YPEH 1ANEA 1TNJA 2QF4A 4IC6A 5FPTA 3P8NA 1O5DH 1OXGA 5ABWA 3TJVA 1TRNA 4AG2A 1C1RA 1FX0B 1K1JA 3K2UA 4CREA 2XTTB 3DSPA 2KFWA 1C1PA 1SGFG 1LVMA 1UO6A 4JK5A 4VGCC 4Q7YA 1O33A 4KTCA 4WJG2 1Q2WA 2L74A 4KP0A 2ZWLH 1O38A 5DKMA 3A7WA 3SN8A 2FEQH 5FHTA 3UTUH 2QC2A 1P57B 4D9RA 1O2SA 1COWD 2BDGA 1V2ST 1AFQC 1AVXA 3DCLA 1TQ7B 1AU8A 2H9HA 5F8ZA 4NA9H 2FM2A 2XCNA 4YO9A 1V2WT 1AO5A 1ELAA 3NXPA 2VIQA 3F9EA 3RXDA 1TYNA 2W5EA 1AQ7A 3A89A 4NZLA 1HFDA 2V6NA 8LPRA 2VH0A 1KY9A 1O2IA 2WINI 3UR9A 3URCA 5H4IB 3UAIC 2IN2A 1YLCA 1W7GH 3ZZ3A 3RXAA 3TVJB 1EAIA 3C27B 1EAXA 3D65E 2BY5X 3RXLA 2FPZA 1YGCH 3JZ2B 3HGNA 3HGPA 4DOQA 1SGYE 3RXUA 2BDBA 1RGQA 2FMJA 3SJIA 3QUMP 3QZRA 1AZZA 4RKOB 1AE8H 1N8OB 3A8BA 2XBYA 2HRVA 2J2UA 3GY7A 3MU8A 4CR5A 2SFAA 3A7TA 2WV9A 4I8KA 2VVVA 3PV2A 1YY3A 1NRNH 1S6FA 4WF8A 4GVUA 1HAVB 2TBSA 5EOKA 3U8RH 1HGTH 5ESTE 1FPCH 1CA8B 2PTCE 5DP7A 1GJ5H 4DW2U 1NFUA 3BTKE 5T6GA 2A4RA 4H6TA 5DGJA 3A82A 3WY8A 6CHAC 1GCTC 3GOVB 3KQ5A 4IN1A 2P3FH 3RXRA 3PTNA 1SGPE 4U30A 1O39A 3PV5A 4B6FA 4I8GA 2Q6GA 1PQ8A 4IMQA 1TRYA 3VPKA 1DX5M 1ZMLA 4I8HA 2ZA5A 1A0HB 1YPHE 4Q7XA 5KGOA 1PYTC 2Z9IA 4X6MA 4MNXA 2GKVE 4FU9A 1GI1A 1THPB 2YNBA 4KTSA 5E2OA 3A83A 1T7CA 3I29A 3MWIU 3RXCA 1TX6A 4BXWA 1BRAA 5KECA 4ISIH 1RTFB 2CJIA 4HG6A 5DP4A 1G9IE 2IOTA 1C5PA 1N6YA 1WU1A 2PUXB 5B6LA 4ISLA 1SGEE 1QQUA 4MNVA 3F9FA 2HVXA 1U6QA 1P0SH 5AHGH 3LONA 1OYTH 3EAJA 1O3BA 3LGUA 1TONA 1WSSH 2XBVA 5J4SA 1TA6A 1ELDE 2XNDD 3E0PB 3OY6U 2ZI2H 5IDKA 1EB1H 1UTKA 3GCNA 1F92A 1W13U 1BRCE 1LHCH 2TGAA 1PPCE 2ZPSA 4LK4A 3SW2B 3T2NA 5EQQA 4Y0ZE 1Y3WA 1UCYK 4F4OC 1KMHB 3PLPA 1FPHH 3VXEH 1C1UH 1ZTJA 4TY6A 3MO6A 1O2WA 3U28C 1B5GH 3FVFB 1ARBA 2QGRA 1C2KA 2QY0B 5TCAA 1ANCA 2YMSC 1O3NA 3ZZ5A 3EGKH 1B0EA 3RUOA 4DJZB 1CBWC 3MTYA 1H8HD 2PLXA 2UUJB 3CP7A 3P17H 1AFEH 1YLNA 4JZFH 1GMDF 1VZQH 4K5ZA 2K8IA 2W7SA 2ZGHA 2BQWB 1AMHA 3U8OH 2QAAA 2FTLE 3GCTF 3ODFA 1O2ZA 1O5AB 3MYWA 4HI3A 1OKXA 3GS9A 2PHBA 1TAWA 4WXVA 4ISOA 1FNIA 3RU4D 1Y3VA 1BMAA 2GV6A 3UNSA 1L1GA 1YPHC 5FAHA 1N1LA 1C5RA 2NU2E 2Y7XA 3U8TH 3L33A 2C8YB 2RCEA 3VB5A 1A61H 2H9TH 1UTLM 1FIZA 1QBNA 1C2JA 1QTFA 1AN1E 5FBIA 1BMMH 1J8AA 1OOKB 2J9NA 1GGDC 2ZGBH 1GI4A 2AHME 1O2YA 4IBLH 2G4TA 1BJUA 1FLEE 3DA9B 3Q3YA 1JXPA 1Z71A 4D7FA 1EAWA 1AKSB 1HAGE 1Z8JB 3F68H 4AN7A 2H9EH 1WV7H 4FUGA 4K2YA 1GG6C 1Q31A 4TT3D 1YKTA 3AAVA 1Y3UA 5GWZA 2QA9E 3MI4A 2JH6D 5GJ4B 3SNCA 2HOBA 2NWNA 3E8LA 2J98B 4ABDA 1SLWB 1O2PA 1O0DH 2EQNA 1K2I1 4UFEH 1TNKA 4GPGA 1G3EA 2ZQ1A 1O2KA 2PR3A 3LH3A 1A5IA 2FLRH 1JRSA 1XXFA 3UB0A 2OINA 4JK6A 3MNBA 4Q4LA 3ZZ9A 3GDUA 2RA3A 1OWKA 2EI8A 5HMAA 5E0JA 4ZHLU 4WWYA 1NRSH 5AFYH 4DY7B 2Y5GA 1SC8U 1ACBE 1ZZZA 2W6ID 1BDAA 1KLIH 1QB1A 2WPKS 4I8JA 2OUAA 1V2NT 4HFPB 3NUMA 1AY6H 1LPGB 1P02A 2A5AA 2A0QB 1C2FA 1MZAA 2ZDMA 3F1SB 1TIOA 1K1MA 2BLVA 3W95A 1OS8A 1W0YH 2CXVA 4JMYA 1OWDA 1GBIA 2Q1JA 1GBJA 4RT0A 1GL0E 4GAWA 3GCHB 1XUJA 1C5LH 4AC9A 3LU9B 5DP3A 3RC4A 1HCGA 4AGKA 1TE0A 4UFFH 5DP6A 1ANBA 4XD7D 1L1NA 1QURH 2G5NA 4OS2A 4B73A 4ZKOU 4HTCH 2VIOA 4NIYA 4YOGA 2PW8H 1FDPA 3MH6A 1QGFA 1YPGH 1AB9B 1TGBA 2GP9B 1GMDG 1OYQA 4JCNA 3FP7E 2ZHWH 4Q63A 1NZQH 2BDYA 3GY3A 3VFEA 1TABE 1O30A 1GJDB 2W6JD 2ZGCA 3SJ8A 1O31A 1LCYA 2Q6FA 2HPPH 2GMTC 5A8XA 3SJOA 1MTUA 3GCTG 4AORA 1BQYA 1LKBA 1EJMA 2Z3EA 3SU6A 3MQKC 1O3AA 1UVSH 2BZ6H 3AW0A 4CRBA 1GI8B 2QXIA 3K6YA 5JYIA 4ABFA 1P9UA 2ZFPH 4WXIA 1HUTH 5GDSH 3A7ZA 5HIYA 1L1JA 3L6PA 1Z1JA 2BY9X 3QWCH 1Y5AT 2XC4A 1GJCB 2PGQB 1EPTC 3C1KA 1W3CA 2K0QA 1GHYH 1O3MA 1XM1A 1H8IH 3KF2A 1O5BB 2H5CA 5L30H 2ZZUH 2ASUB 3B8JA 3MU1A 3RXBA 4KELA 4YLQH 3E6PH 1TB6H 1UK4A 1SQOA 1CHOF 3S9AA 5HXFA 1UTMA 3U1JB 1V2PT 1M9UA 1W10U 3HPTB 2CV3A 4FXGH 5AVDA 1HAVA 1NESE 2A2XH 1T8MA 4I32A 1ZPZA 3OYPA 3UQOA 2YNAA 3RLYH 1YM0A 1P05A 1O2RA 1V2KT 4XBBA 1GJ7B 1O3HA 1ZSKA 3F2FA 3TK6A 2Z7FE 4MDSA 2Y80A 4H42U 3T28A 4A6LA 1X7AC 3BIUH 1V2JT 3VB7A 4AFZA 1UTPA 2FXRA 3GY6A 3GY2A 1VCQA 2WYGA 1SVPA 1BJVA 2SGFE 1D3DB 1FN6A 3BTWE 5LPRA 3P8FA 2BDCA 3KQBA 3MO3A 5EJLA 1V6DA 2VNTA 3RU4E 1BTUA 1FV9A 2GCHF 1GI7B 2SGQE 5EIYA 1WYKA 1ZTKA 2QCYA 3P70B 2DE9A 3TITA 4X1RU 4AB9A 4DT7B 5F03A 3TGKE 1SLVB 3SQEE 1E36B 1RIWC 2W3IA 1SB1H 2KM0A 1T4UH 2VGCC 2XWAA 1EZSC 2Z3CA 4ABHA 1EFRD 1OHHD 2P16A 4U2WA 1OP8A 2AGGX 3HKJB 3QTOH 1O2QA 3GICB 4AFSA 1TBRH 1CQQA 4CH8B 4INKA 2LP6A 3SGAE 1GHAF 1F0UA 4K8BA 3LGTA 3AK5A 1LVYA 4X2VA 1LPZB 4F55A 1XUFA 2C8XB 1ZPCA 1JRTA 2WPJS 2ZGJA 3JZ1B 1THRH 1DE7H 6LPRA 2YMSD 5C94A 2C8WB 3DSGA 1VCPA 5T3HA 2F83A 4I86A 1Y3XA 1LTOA 1QY6A 3VB4A 1LHEH 4Y79A 5DG6A 3SV2H 4CRCA 2QF0A 1XMNB 1O5EH 1VJ9U 1BRBE 2TGPZ 1SFQB 3ZVAA 1NRPH 1D6WA 1SG8B 2ZDAH 3RMNH 1ZSLA 2ALVA 5E8EH 2J92A 2A5KA 1SSXA 1V2UT 1C2HA 1BZXE 1DY9A 1C2LA 1YCPH 5C17A 2LELA 5K0HA 3M7QA 1IQNA 5FXLA 4ABJA 1ZJKA 1MQ6A 4HZHA 1BIOA 3FO8D 1ZMJA 3QX5H 1GJ6A 4PROA 1ZHPA 4DG4A 1A7SA 1Z6EA 1UVTH 1BOQA 3MNXA 1GJ8B 2AERH 2F4LA 2V3OH 2GZ9A 2F9OA 1P10A 2WV5A 4Y8XA 3OU0A 1O3JA 4UFGH 3M5OA 1CHOG 3MNCA 1E79D 1GCTB 4UD9H 3CS0A 5SGAE 1O2NA 3ZZBA 3BTFE 3BTEE 1S6HA 1VITF 2GZ7A 4KGAA 1S84A 2CK3D 3BN9A 2C93B 2P59A 1SMFE 3IWMA 3MHWU 3AASA 1TNGA 3RMOH 1SOTA 2BHGA 3F6UH 4NIWA 4Y10E 1NROH 3PMAB 1TRMA 2KR7A 1ESBA 1MUEB 2CGAA 3U98H 2R3YA 2J5UA 3STIA 1PQ5A 5E0GA 2QXGA 3T5FH 2IJD1 3LGIA 4CRFA 1DUEA 1ZOMA 2ZU5A 4X8VH 1ZRKA 3ZVFA 4HGCA 1KXDA 3VB3A 2BX3A 4ABGA 2J98A 2G52A 2GJGA 3FAOA 1GMCG 1QJ1B 1K22H 3A86A 3SJKA 1MAXA 1O2GH 3LJOA 1A3EH 1SGQE 4NG9H 1IOEA 2TGDA 1O3OA 3TNTA 5DP8A 3SGBE 2XRCA 1ZHMA 4B6EA 3A85A 3MOCA 3ZZ6A 3SV6A 1E34B 2WSSD 4WMDA 3KHVA 4OM9A 5JB8S 1AD8H 3EA7A 3PMHB 2UWPA 3U1IB 1PPFE 1GHAG 1HAHH 4ZKSU 1TGNA 2AS9A 1GHXH 2YOLA 1C5XB 3LPRA 3SUFA 2XWBI 5F53A 1YLDA 2KCOA 1QRWA 1C9PA 1EZXC 1KIGH 1GJAB 2ZP0H 4FUEA 2YMSB 1BBRH 4DT4A 3UR6A 1CBWB 1F0TA 1F2SE 3MH4A 3SNAA 2ZPRA 2D1JA 2AFQB 3D23A 4ACBA 3H7TA 1AVGH 3DD2H 5EXNA 5DP5A 3ZVEA 4KKDA 3SU1A 3RDZA 1NU9A 3TJUA 1O3FA 1UVUH 1LVOA 2XBXA 2J94A 3KQEA 5F8XA 4FUDA 2GT8A 4MNYA 1MKWK 1G32B 3FZDA 3ITIA 1LO6A 4BAQB 1LHDH 1G37A 3BTTE 3SOSA 2G81E 1BRUP 1UW7A 1Z1IA 1OPHB 1PPBH 2AH4X 2F9PA 2WPIS 4BAKB 1ELGA 1H8ED 1DSUA 1P2MA 1PJPA 1P11E 8ESTE 1KDQB 3G01A 1V2RT 2ZECA 5FPSA 1G36A 1O36A 3BEIB 1ELCA 2WYJA 1VITG 3ZZ8A 1GGDB 1J15A 5G4BA 4CHAC 1C5UA 2PFEA 3LIWA 5C67A 1C5OH 2Z94A 1LQEA 3ATKA 4X1SU 4YTAA 1HJ8A 2FOFA 3SGQE 1G3BA 1MMJN 1NFWA 4WH6A 1A5GH 1W0JD 2LPRA 1GG6B 5JBAS 3QDZB 3MH7A 4RSPA 3ZZAA 1PFXC 1SLXB 1HAOH 4X0WU 8GCHF 1MABB 2BDHA 2BY6X 2O9QA 3F0PA 3Q3XA 4Y71A 1FY4A 1UMAH 3ZVDA 3M7TA 1NTPA 2BLWA 1GHVH 2ZIQH 1HIAB 3F2GA 2GVFA 1OP0A 1S6LA 1OSSA 1GI2A 1OP2A 5HGGA 1O32A 1C1OA 2I6QA 5FX5A 1UTOA 1B7XB 1KXBA 2BLOA 1T8LA 3A8AA 1AWHB 2HLDD 1FAKH 1K0HA 1LDTT 2QV1A 1XVOA 4B76A 2OQ5A 2GCTC 1P06A 3A81A 1GHBF 4BNRA 2A5IA 2PKAB 4A5TS 1DY8A 1A3BH 1P01A 1ORFA 1EP6A 1FONA 1O2HA 4ABIA 4IN2A 1TWXB 1CA0B 2OC7A 9ESTA 1EB2A 4A1VA 3BF6H 2KCPA 3M3TA 1FMGA 2STAE 1W2KH 2IPQX 1PQAA 4NCYA 2QE7D 4X8SH 1W11U 2J4IA 2WUCA 1O2TA 2QIQA 3BEFB 4Y11E 1QFKH 1SPJA 5F6MA 2FOAA 4MPWA 1DLKB 3V0XA 5EQRA 1DUAA 2P8OC 3TJOA 3F2HA 3DT0H 1F0SA 2VVCA 1Y5BT 4MPXA 2BTCE 2M2AA 2AMPA 5A8ZA 4I7YH 1AI8H 2G5VA 2HPQH 3LJJA 2FOBA 1XUKA 3ZV8A 1E0FD 3R3GB 3UY9A 2F9NA 1XKBC 1VR1H 3M7UA 3P95A 1QIXB 3NWUA 4FUFA 2HNTE 1KYNA 3F9HA 4BXSA 1E1QD 7GCHF 5FCRA 3SUDA 3FKSD 2VU8E 2QXJA 2UWLA 1H4WA 2BZAA 2F91A 1Q3XA 1JWTA 4OS5A 1P2IA 1TMUH 6GCHF 2O8WA 3RXGA 2PUQH 3MU5A 3KYFA 1Y59T 3OFND 4OS1A 4O3TA 3Q00A 3E91A 5C0TA 2R0LA 1DSTA 1G2MA 2Y5HA 3T25A 2BVRH 5DP9A 3QGJA 3ZVBA 3ATMA 1T4VH 2G55A 3HK3B 3CNRA 5T6FA 1Y3YA 8GCHG 1SOZA 3I77A 2AIPA 4YT7H 2VBCA 3W1EA 2G00A 3K9XB 1VGCC 4FUHA 3UNQA 2F3CE 4WMEA 2VB0A 4XOJA 5LH8A 3NKKA 2OCVB 4BAHB 1SL3A 2XXLA 3S7KB 2BDAA 1HJ9A 3M5LA 4K8YA 2FOMB 1QA7A 4AZ2B 4ZMAH 3ODDA 3SYJA 5FPYA 4X2XA 1EKBB 5GCHF 5L2ZH 1F7ZA 1NC6A 3LKWA 3EDXB 3B23B 1QJ7B 1GHBG 3ZVGA 1NS3A 1KLJH 3SV7A 4K1TA 4NSYA 4U01A 4Y76A 1MQ5A 2NU4E 3KCGH 1DM4B 4TPYA 2JJ1D 1P3CA 2M5TA 1S0RA 4O3UA 1O2JA 3M35A 2VGCB 4E05H 1A46H 4MTBA 1BTHH 4MPVA 1JBUH 1N8OC 1KXCA 4ASUD 1C5SA 5DSFA 1AHTH 3OSYA 2VWNA 1GCDA 1N6XA 3UWIA 1ANDA 3M5MA 1JIMA 1VITH 2FX4A 2O8TA 1ETSH 1HAYB 1T31A 3W94A 3GCOA 2ZO3H 1CT2E 1TNLA 4ASHA 4JZEH 2HNTC 1C5ZB 2WPDD 4YOIA 3IITA 1MD8A 1P12E 2A45B 2ULLA 3LC3A 3MO9A 1TGSZ 2EA3A 2GDDA 3GY4A 1YPKH 1KTSB 1BHXB 2CHAC 1AIXH 3WW7A 2P3UB 3H09A 3M5NA 1FI8A 3P8GA 3TK9A 4AYYB 5AFZH 2KX4A 1L0ZA 4Z1MD 2XCFA 2NU0E 3RXSA 3AW1A 4UONA 1K1OA 2CMYA 1WTGH 1EUFA 4FU7A 1AWFH 4OGYA 1GDNA 4DVAU 4LZ4B 1P09A 3V3MA 2BY8X 7GCHG 2QXHA 2BOKA 2F43B 1DXPA 1O5FH 4RI0A 4WVPE 2BY7X 2DE8A 1WAYB 2BVXH 3BTHE 5KEDA 3LDXH 1DANH 1IHSH 2OBOA 5ESBA 1ZHRA 5EXMA 3TIUA 6GCHG 2FO9A 1ZR0A 4TSFD 1TQ0B 1ZJDA 4YXWD 1YBWA 1FN8A 1E1RD 2A7HA 1A0JA 1HXEH 1IQMA 1QCPA 3STJA 1GBKA 1ZTLA 4B74A 2Q6DA 2FZZA 1FJSA 1V2VT 2OC1A 1C9TA 1IQHA 4Z0KA 5IYTA 1XUHA 3ZYDA 3EA9A 3K6ZA 2Y6TA 2ZU4A 1KDQA 4Y6DA 3ZIAD 1O3LA 3OEHD 1FQ3A 5GXPA 1QB9A 2FDAA 4X1PU 1QL9A 4TY7A 1QNJA 1OX1A 5B6OA 1LQDB 1E37B 3K65B 5GCHG 2CN0H 3LT3A 1PPZA 1GBFA 3PO1C 4OS4A 2CF9H 3UOUA 2ZFTA 1FXYA 2SNWA 2STBE 1P04A 1AZ8A 3PTBA 3ZVCA 4ESTE 1DOJA 1BCUH 1ZGVA 3CENA 2ZU2A 2BQ7B 2F9VA 4MNWA 1Y5UT 2WPLS 5CMXH 1C5WB 2VIDA 1NY22 2R9PA 3A87A 1GL1A 3E3TA 3ATIA 2BD8A 5C1XA 1HIAA 1QB6A 4E7NA 3RLWH 4X2YA 2ZQ2A 4AB8A 2AEIH 4AFUA 1C4U2 1UTJA 3RC6A 1IQLA 1QL8A 1SQTA 2FI3E 3RXPA 3HK6B 4RN6A 2DUCA 3E0NB 5EPYA 2B8OH 5C3NA 1CGIE 2SGAA 3DSOA 2PKAA 1C5VA 1GBAA 3RXKA 1P2QA 2Z3DA 3UNRA 4Y8ZA 1WDIA 2WPHS 2WZQA 3FZZA 1O5CB 4VGCB 1GMCF 1P3EA 2FP7B 5GNDA 3BG4C 2JETC 4BAOB 1S83A 3B9FH 4B71A 2Y5FA 1NBME 2A32A 3LC5A 1BUIA 5LPFA 4GCHF 1T32A 1QRXA 1W8BH 5TCCA 1THSH 4M7GA 1AFQB 1HAIH 2V3MA 7LPRA 2QF3A 2NU3E 4NSVA 3EYDA 3MU4A 2F9UA 4K69A 1SGNE 1MH0A 1AVWA 3PWCA 1MKXK 4O97A 1C1VH 1DWBH 1SGRE 1GVKB 3UQVA 2OTVA 3TH3H 2A1DB 2AMQA 2D26C 3UOPA 3V7TA 1W0KD 1P2OA 1O3PB 1L4DA 1C5MD 1WUNH 4BTUB 1K1NA 1GHZA 4FVDA 5C1UA 4F48B 5F8TA 1IQEA 2ZFQH 2ZCHP 4Q80A 2FI4E 1HAXB 2D2DA 2H2ZA 3HATH 2UUFB 3E1XB 2J97A 2GTBA 1RFNA 4UEHH 2ODQA 4P00A 2XOKD 2P94A 1QHRB 4MVNA 4YESB 2R3UA 2THFB 2W3KA 2FESH 4ZHMU 3KN2A 2FS8A 1EPTA 1GBEA 4NIVA 1BHXF 2J34A 4TPIZ 3VGCC 1BB0B 3KEEA 3SHAH 1LMWB 2ZDVH 3GCHC 2ZTXA 3GYLB 1F5LA 1K1LA 5J4QA 3F0OA 1GJBB 5CHAC 3U9AH 1BTXA 1UTQA 4BTTB 2A31A 4ZHAA 2GT7A 3UUZA 5EW1H 2ZDNA 1GMHF 1ZGIA 5EJZA 3VEQB 3QN7A 1C1MA 6CHAB 3O8BA 2HLCA 3ATLA 1AB9C 5BPEA 3FANA 1E38B 1V3XA 2BD4A 2GGVB 5DPAA 4FU8A 3QO6A 2ZG0H 5JBCS 6ESTA 3LGVA 3RC5A 4AGJA 1AGJA 3N7OA 4WH8A 4AX9H 2WHXA 2ZKSA 3A7VA 2KCAA 2GCTB 4Y8YA 2AMDA 2VJ1A 1MTSA 5E2PA 1ESTA 5DJ7A 4WMFA 1MU8B 2PTNA 1EJAA 3LH1A 1K21H 4F49A 1MKWH 1CVWH 3O8DA 1TFXA 3QTVH 3MH5A 3L3TA 1ZLRA 3ZZDA 4DIHH 1YWUA 1C2MA 1UHBA 2OK5A 2XBWA 3RMLH 2A4QA 3BTME 3F3BA 3FN8A 2PKSC 2TGTA 1A2CH 3A7YA 5HIZA 2GD4B 2PP6A 1PPGE 1QRZA 2ZTZA 4K1SA 1W14U 1HNEE 4XSKU 1NO9H 3GDVA 1CU1A 1XUGA 4TWYA 1RXPA 2PGBB 2KCYA 4RKJB 3E16B 3FOAA 1RRKA 1NPMA 4GCHG 3PV4A 5HYOA 1CT4E 1RTLA 2FOCA 2P8OB 1S85A 2GZ8A 2L6OA 2O8UA 7ESTE 2HGTH 1O35A 4D8NA 4CRAA 2OLGA 1EP5A 1H9IE 1TPAE 1QQ4A 1Z7KA 1ZRBA 2FIRH 5CE1A 1MAYA 3M61U 3AVZA 1GJ4H 2EI7A 2JIZD 4D9QA 2BVSH 1Z6JH 2EY4C 2J95A 4UE7H 1CO7E 3BSQA 1GBTA 1MTVA 2BXTH 2ZU1A 2GV7A 5FL7D 2VWMA 3KYGA 2OC8A 3OE7D 1NM6A 2BD9A 1MBQA 1GBDA 2FOEA 4NFEA 1TX8A 1AE5A 1LHGH 3Q3KA 3PWBA 3LGYA 1WBGB 1IQKA 1K9OE 5A8YA 2BYAX 2FWWA 5DO4H 1SGTA 1V2MT 3RMMH 3OEED 2PSYA 1CE5A 2VIWA 1BTYA 3SI3H 1EZUC 2ZF0H 3ATWA 3A7XA 4B75A 2RDLA 1UTNA 5JDUB 3TU7H 4FUJA 1CGJE 5E0HA 1WCZA 4FETA 1VGCB 3RXTA 2ANKH 2ZCLP 4GUXA 3TGIE 1GMHG 2O8LA 5I46H 4GHQA 4R0IA 2A2QH 3PMJA 1EX3A 4X6OA 1HXFH 1XUIA 4LOYH 2A7CA 3ZZ4A 2V35A 1ZPBA 2NU1E 2BD5A 1ETRH 1HAPH 1B0FA 1O5GH 3SUGA 4AOQA 3QZQA 2HWLB 1C4V2 1D3PB 2V7QD 2D8WA 3D49H 2P95A 4MG3A 3BG8A 2V0BA 1IAUA 2ANWA 3OTJE 1QBVH 1PQ7A 3BTGE 5EQSA 5EPNA 4BTIB 1HJAC 1UCYH 3S9BA 3A8DA 2JJ2D 1C1NA 2GDEH 1V2TT 2FOGA 2W7UA 3PRDA 2XYAA 2P3TB 1BMNH 2RG3A 4FUCA 4UFDH 1T8NA 2XC5A 1KXAA 3NRLA 3SI4H 2XW9A 3M36A 3SU4A 3QK1A 3T29A 3LOXA 3RM0H 1D4PB 2Y7ZA 1DICA 3GY8A 4WY3A 2SGDE 3Q76A 3PRBA 1O3KA 4GLYA 3UFAA 3NK8A 1S82A 1W0ZU 5FX6A 4CRDA 1K28D 2WPMS 3N99A 1FZZA 2SGEE 4JZDH 4Q7ZA 5BRRE 3MU0A 1BBRK 1C1TA 1FY3A 4AFQA 5A0AE 3SV8A 1TBQH 1FIWA 4YM9A 3QGNB 4XE4A 2B5TB 4GHTA 1PPHE 1C2DA 4R8TB 4ACAA 2CHAB 4M9FA 4ABBA 3IG6B 5LPEA 1TGTA 1EZQA 4INHA 1P2KA 1UJ1A 1FY8E 3DFLA 3N7EA 3PB1E 3RU4T 1F0RA 1TLDA 4TWWA 4X2WA 3QLPH 1IHTH 3S0NA 3ENSB 1GWAA 1T8OA 1YYY1 7KMEH 3MFJA 1TA2A 1TBZH 1ELTA 5FBEA 4CRGA 2RDEA 3H7OA 1O2XA 3UWJH 5HKKD 4Y7AA 2ILNA 3SU0A 1BBRE 1P03A 3AAUA 1O3EA 1WQSA 4JYUH 3V12A 1C5QA 1TALA 1TPSA 1SQAA 4RT1A 5AF9H 2R0KA 4X8TH 1SKYE 1Z8GA 1C2EA 2VWLA 1YCPM 1VJAU 2GMTB 1BITA 3M37A 4B2BA 2ZHQH 3SNDA 1GBBA 3DHKH 1BMFD 1ARCA 4ZUHA 1V2OT 4B2AA 1BA8B 1S81A 1TPPA 4MQAA 3BIVH 3KNXA 1GVLA 5EGMA 4A1TA 1DT2A 1VCWA 3EA8A 1MTNC 3EE7A 1SQRA 3A88A 5HM9A 1WOFA 2I6SA 4FUBA 3O8RA 1HYLA 1H9HE 4DCDA 4CBOA 1BTZA 4ZKRU 3UPEA 2AGEX 2FS9A 3NZIA 2KZ4A 3SZNA 1EPTB 3SNBA 3M3SA 1O2UA 1CGHA 1YF4A 4B2CA 2BXUH 1SHHB 1H1BA 4IMZA 1QZ8A 3GDSA 3ZV9A 1P9SA 3PO1B 4XBCA 4NIXA 4BAMB 2OXSA 4YLUA 3ZZCA 1RTKA 4JZIA 3KQDA 1D3QB 1G2LA 3OAAD 1INCA 2HALA 1O34A 5LGOA 5EU8A 2V3HH 2G51A 1IQJA 1AUTC 2FYRA 3TH4H 1BT7A 1GI9B 1G30B 2W26A 1UCYE 1DS2E 1NBMD 1PPEE 5C5OA 3PYHA 3SORA 1DFPA 1GJ9B 2FLBH 1TX7A 3N7DA 1MCTA 1P2JA 1DDJA 3PM3A 2BLQA 4MLFB 1A0LA 3PMBB 1HV7A 1GHWH 4A1XA 2XNIA 1UK3A 3NCLA 4A7IB 3VG8A 1UHBB 2WV4A 2G8TA 1D3TB 1E35B 1ETTH 1S5SA 1TOCB 1GVZA 1SHYA 5EG4A 1O2LA 1BMLA 2VIVA 4TYDA 1A5HA 1KXFA 4DIIH 1O3IA 3BG4B 2JETB 1C5YB 1RIWB 4IW4E 1HBTH 1LVBA 5EODA 4CR9A 4H6SB 2H5DA 3SBKA 5L2YH 2SNVA 1XXDA 1C1SA 3TNSA 1VKYA 2KAIA 1DVAH 1J17T 1ZMNA 2QYIA 4J2YB 4LXBH 1ZYOA 2TPIZ 1HLTH 1IQIA 3H5CB 1LHFH 1QBOA 4MPUA 2BDIA
chains in the Genus database with same CATH topology
2ZU3A 4QT8C 3TJNA 4O9VA 3KQCA 2SGPE 4D76A 2P93A 1GBMA 1JIRA 2ANMH 2BX4A 3HKIB 1OWIA 3E90B 3SQHE 2LNCA 4ISNA 3EE0B 4ZH8A 3KIDU 2TIOA 3MMGA 3BV9B 4CH2B 4Z6AH 1FUJA 1RS0A 4SGBE 2OP9A 4UDWH 2HNTF 1O3DA 1F5RA 3MNSA 1YC0A 3Q77A 2RA0A 3T26A 2FYQA 3RXQA 1L4ZA 1O2OA 1TNHA 2Z9JA 3GYMA 3S9CA 2Z6BD 1DITH 1JMOH 1C2IA 1C5NH 1CA0C 1ZSJA 3VGCB 3TGJE 5K7RA 2EI6A 1NU7B 2ZCKP 3R0FA 1O3CA 1UVPA 4NWKA 2ZHDA 3RXEA 1MCVA 3ESTA 5CHAB 1DWDH 1LKAA 3RXHA 3T62A 1D6RA 1O2VA 1TPOA 1WTHD 2PWXA 1A4WH 2ZC9H 1DXWA 4ZKNU 3SV9A 1LPKB 1S0QA 1C5TA 2PSXA 2PV9B 1EAUA 1DWCH 1UK2A 1CSOE 4IGDA 2ZTYA 3ELAH 2VINA 1W7XH 1ABJH 3P92A 1C1WH 4XFQA 1QJ6B 4ABAA 3I78A 3RXMA 2OD3B 1OWJA 2AYWA 3KL6A 4NZQA 3PROA 4O03A 4K60A 4CBNA 2FTMA 1MKXH 3TLOA 4THNH 2ZDLA 1G3CA 1AUJA 2UUYA 5I25A 5A09A 1EATA 1HDTH 2BOHB 2H1UA 1TNIA 1MZDA 1K1PA 1ABIH 2AIQA 9LPRA 2PKSB 1NN6A 4FVBA 4H4FA 2BD3A 3ZYEA 2B7DH 2ZHFH 4BANB 1IQFA 1OWHA 4XBDA 2IPHA 2R2WU 1CHGA 3F9GA 4IC5A 5DK1A 1Y8TA 4Y7BA 5C2ZA 2BB4A 4X1NU 5TJXA 5JPMH 4X6NA 4ZROA 1GDUA 1QR3E 1WQVH 3UIRA 2B9LA 1P8VC 4I31A 1Z8IB 3GISB 2JKHA 4AG1A 5A2MH 1ELBA 3LGWA 3GY5A 1P2NA 1OWEA 4YZUA 4NA7A 1J14A 1RD3B 1NFXA 1J16A 1O37A 1SGDE 3V13A 1PYTD 3CS7A 5L6NH 2OQUA 2ZNKH 3S7HB 4X1QU 2Z9GA 2FI5E 3URDA 1D9IA 1EQ9A 2ODPA 1HB0B 3PLBA 1YPJH 5T6DA 1SFIA 1TMBH 2VWOA 2Z9LA 4YT6H 3RXOA 3S69A 4BOHA 2ODYB 1SBWA 2H6MA 3SJ9A 1ELFA 1NT1A 3SU3A 3P6ZB 1A1RA 4YOJA 4JYTA 4FUIA 3A84A 4X6PA 1EASA 1XX9A 1MU6B 2A7JA 4ABEA 2C3SA 1KTTB 2K1QA 5FCKA 2BQ6B 4KTUA 1F5KU 2OC0A 3VB6A 4OS6A 1EJNA 4ZXYH 3FP6E 1SLUB 1NRRH 2WUBA 3BTQE 1J9CH 3PLKA 3A8CA 2A4OA 1Z8RA 5C1YA 2XC0A 3SNEA 5A0CA 1BTWA 3T27A 1XVMA 2BM2A 1UVOA 4DURA 1MBMA 4CHAB 3OX7U 1TGCA 3DFJA 5JB9S 2ALPA 5EW2H 1GI3A 1CT0E 1SGCA 1SR5C 2EEKA 2FOHA 1GBCA 2ZFSA 4LZ1H 2ZGXH 1NRQH 1HJAB 2ZEBA 4OS7A 4B1TA 1DPOA 1QL7A 1FY5A 3RXVA 2VH6A 1C2GA 1L2EA 2F9BH 1NFYA 4K1EA 5GPIB 1C1QA 1QA0A 3SU5A 1YPLH 1TMTH 1ID5H 4DGJA 4XDEA 1W12U 8KME2 4J1YA 4U32A 1ESAA 1GI5A 5HM2A 4K3JA 3D62A 2B0FA 1FY1A 3P8OA 3ZZ7A 5JBBS 1GDQA 1O3GA 1HAZB 2UUKB 2EC9H 1GPZA 3SU2A 2BMGB 1KSNA 1ELEE 3OY5U 5A0BA 2TRMA 2ZFRH 3BEUA 3DUXH 2ZPQA 1YP9A 1H9LB 3BTDE 2OBQA 3O8CA 2GX4A 5ETXA 4NGAH 1SI5H 3U69H 1GBHA 1GBLA 4SGAE 3KGPA 3A80A 1G3DA 2CF8H 2J38A 2VIPA 4I8LA 2ZDKA 1V2QT 3RXJA 3EQ0H 5EXLA 1YPMH 2ANYA 2JH5D 5JBTA 3VXFH 3RM2H 1KLTA 4NA8A 2R2MB 1O2MA 1FAXA 4ZXXH 4Y0YE 4Q2KA 1TOMH 2BD7A 4X8UH 3RXFA 3TK5A 3TPIZ 4NWLA 2KAIB 1GI0A 2ZHEH 1EOLA 4NFFA 4JYVH 1RJXB 1HRTH 2IJOB 3SUEA 2ZFFH 4D7GA 2FX6A 1AKSA 1DLEA 1KXEA 2Y82A 4IS5A 4AYVB 1XKAC 5PTPA 1SGIB 2C90B 1EXFA 4ISHH 2GCHG 1ELVA 1BTPA 5GIBA 2ESTE 2QN5T 3NPSA 3UREA 3SO3A 3RP2A 1GI6A 1HPGA 3FP8E 1H8DH 2O8MA 4E7RG 2Y81A 2C4FH 3TH2H 3M3VA 1DWEH 1V2LT 4ZAEA 2JH0D 1MTWA 2BD2A 1SGFA 4GSOA 4OGXA 2G4UA 3SHCH 1EOJA 5C20A 1YCPK 1JOUB 5C5NA 1MTNB 1MD7A 3RXIA 4A92A 2VVUA 1IQGA 2UWOA 2C8ZB 4I33A 3FFGA 2AGIX 2FODA 2Z9KA 4E06H 1K1IA 2A4GA 4JZ1A 4INLA 1C4Y2 1YPEH 1ANEA 1TNJA 4IC6A 5FPTA 3P8NA 1O5DH 1OXGA 5ABWA 3TJVA 1TRNA 4AG2A 1C1RA 1K1JA 3K2UA 4CREA 2XTTB 1C1PA 1SGFG 1LVMA 1UO6A 4JK5A 4VGCC 4Q7YA 1O33A 4KTCA 4WJG2 1Q2WA 4KP0A 2ZWLH 1O38A 5DKMA 3A7WA 3SN8A 2FEQH 5FHTA 3UTUH 2QC2A 1P57B 4D9RA 1O2SA 2BDGA 1V2ST 1AFQC 1AVXA 1TQ7B 1AU8A 2H9HA 5F8ZA 4NA9H 2FM2A 2XCNA 4YO9A 1V2WT 1AO5A 1ELAA 3NXPA 2VIQA 3F9EA 3RXDA 1TYNA 2W5EA 1AQ7A 3A89A 4NZLA 1HFDA 2V6NA 8LPRA 2VH0A 1KY9A 1O2IA 2WINI 3UR9A 3URCA 5H4IB 2IN2A 1YLCA 1W7GH 3ZZ3A 3RXAA 3TVJB 1EAIA 3C27B 1EAXA 3D65E 2BY5X 3RXLA 2FPZA 1YGCH 3JZ2B 3HGNA 3HGPA 4DOQA 1SGYE 3RXUA 2BDBA 1RGQA 2FMJA 3SJIA 3QUMP 3QZRA 1AZZA 4RKOB 1AE8H 1N8OB 3A8BA 2XBYA 2HRVA 2J2UA 3GY7A 3MU8A 4CR5A 2SFAA 3A7TA 4I8KA 2VVVA 1NRNH 1S6FA 4WF8A 4GVUA 1HAVB 2TBSA 5EOKA 3U8RH 1HGTH 5ESTE 1FPCH 1CA8B 2PTCE 5DP7A 1GJ5H 4DW2U 1NFUA 3BTKE 5T6GA 2A4RA 4H6TA 5DGJA 3A82A 3WY8A 6CHAC 1GCTC 3GOVB 4IN1A 2P3FH 3RXRA 3PTNA 1SGPE 4U30A 1O39A 4I8GA 2Q6GA 1PQ8A 4IMQA 1TRYA 3VPKA 1DX5M 1ZMLA 4I8HA 2ZA5A 1A0HB 1YPHE 4Q7XA 1PYTC 2Z9IA 4X6MA 4MNXA 2GKVE 4FU9A 1GI1A 1THPB 2YNBA 4KTSA 5E2OA 3A83A 1T7CA 3I29A 3MWIU 3RXCA 1TX6A 4BXWA 1BRAA 4ISIH 1RTFB 2CJIA 5DP4A 1G9IE 2IOTA 1C5PA 1N6YA 1WU1A 2PUXB 4ISLA 1SGEE 1QQUA 4MNVA 3F9FA 2HVXA 1U6QA 1P0SH 5AHGH 3LONA 1OYTH 3EAJA 1O3BA 3LGUA 1TONA 1WSSH 2XBVA 5J4SA 1TA6A 1ELDE 3E0PB 3OY6U 2ZI2H 5IDKA 1EB1H 1UTKA 3GCNA 1F92A 1W13U 1BRCE 1LHCH 2TGAA 1PPCE 2ZPSA 4LK4A 3SW2B 3T2NA 5EQQA 4Y0ZE 1Y3WA 1UCYK 4F4OC 3PLPA 1FPHH 3VXEH 1C1UH 1ZTJA 4TY6A 3MO6A 1O2WA 1B5GH 3FVFB 1ARBA 2QGRA 1C2KA 2QY0B 5TCAA 1ANCA 1O3NA 3ZZ5A 3EGKH 1B0EA 3RUOA 4DJZB 1CBWC 3MTYA 2PLXA 2UUJB 3CP7A 3P17H 1AFEH 4JZFH 1GMDF 1VZQH 4K5ZA 2W7SA 2ZGHA 2BQWB 1AMHA 3U8OH 2QAAA 2FTLE 3GCTF 3ODFA 1O2ZA 1O5AB 3MYWA 4HI3A 1OKXA 2PHBA 1TAWA 4WXVA 4ISOA 1FNIA 3RU4D 1Y3VA 1BMAA 2GV6A 3UNSA 1L1GA 1YPHC 5FAHA 1N1LA 1C5RA 2NU2E 2Y7XA 3U8TH 3L33A 2C8YB 2RCEA 3VB5A 1A61H 2H9TH 1UTLM 1FIZA 1QBNA 1C2JA 1QTFA 1AN1E 5FBIA 1BMMH 1J8AA 1OOKB 2J9NA 1GGDC 2ZGBH 1GI4A 1O2YA 4IBLH 2G4TA 1BJUA 1FLEE 3DA9B 3Q3YA 1JXPA 1Z71A 4D7FA 1EAWA 1AKSB 1HAGE 1Z8JB 3F68H 4AN7A 2H9EH 1WV7H 4FUGA 4K2YA 1GG6C 1Q31A 1YKTA 3AAVA 1Y3UA 5GWZA 2QA9E 3MI4A 2JH6D 5GJ4B 3SNCA 2HOBA 2NWNA 3E8LA 4ABDA 1SLWB 1O2PA 1O0DH 4UFEH 1K2I1 1TNKA 4GPGA 1G3EA 2ZQ1A 1O2KA 2PR3A 3LH3A 1A5IA 2FLRH 1JRSA 1XXFA 2OINA 4JK6A 3MNBA 3ZZ9A 3GDUA 2RA3A 1OWKA 2EI8A 5HMAA 5E0JA 4ZHLU 4WWYA 1NRSH 5AFYH 4DY7B 2Y5GA 1SC8U 1ACBE 1ZZZA 1BDAA 1KLIH 1QB1A 2WPKS 4I8JA 2OUAA 1V2NT 4HFPB 3NUMA 1AY6H 1LPGB 1P02A 2A5AA 2A0QB 1C2FA 1MZAA 2ZDMA 3F1SB 1TIOA 1K1MA 2BLVA 3W95A 1OS8A 1W0YH 2CXVA 4JMYA 1OWDA 1GBIA 2Q1JA 1GBJA 1GL0E 4GAWA 3GCHB 1XUJA 1C5LH 3LU9B 5DP3A 3RC4A 1HCGA 4AGKA 1TE0A 4UFFH 5DP6A 1ANBA 1L1NA 1QURH 2G5NA 4OS2A 4B73A 4ZKOU 4HTCH 2VIOA 4NIYA 4YOGA 2PW8H 1FDPA 3MH6A 1QGFA 1YPGH 1AB9B 1TGBA 2GP9B 1GMDG 1OYQA 4JCNA 3FP7E 2ZHWH 1NZQH 2BDYA 3GY3A 3VFEA 1TABE 1O30A 1GJDB 2ZGCA 3SJ8A 1O31A 1LCYA 2Q6FA 2HPPH 2GMTC 5A8XA 3SJOA 1MTUA 3GCTG 4AORA 1BQYA 1LKBA 1EJMA 2Z3EA 3SU6A 1O3AA 1UVSH 2BZ6H 3AW0A 4CRBA 1GI8B 2QXIA 3K6YA 5JYIA 4ABFA 1P9UA 2ZFPH 4WXIA 1HUTH 5GDSH 3A7ZA 1L1JA 3L6PA 1Z1JA 2BY9X 3QWCH 1Y5AT 2XC4A 1GJCB 2PGQB 1EPTC 3C1KA 1W3CA 1GHYH 1O3MA 1XM1A 1H8IH 3KF2A 1O5BB 2H5CA 5L30H 2ZZUH 2ASUB 3B8JA 3MU1A 3RXBA 4KELA 4YLQH 3E6PH 1TB6H 1UK4A 1SQOA 1CHOF 3S9AA 5HXFA 1UTMA 3U1JB 1V2PT 1M9UA 1W10U 3HPTB 2CV3A 4FXGH 5AVDA 1HAVA 1NESE 2A2XH 1T8MA 4I32A 1ZPZA 3OYPA 3UQOA 2YNAA 3RLYH 1YM0A 1P05A 1O2RA 1V2KT 4XBBA 1GJ7B 1O3HA 1ZSKA 3TK6A 2Z7FE 4MDSA 2Y80A 4H42U 3T28A 4A6LA 1X7AC 3BIUH 1V2JT 3VB7A 4AFZA 1UTPA 2FXRA 3GY6A 3GY2A 1VCQA 2WYGA 1SVPA 1BJVA 2SGFE 1D3DB 1FN6A 3BTWE 5LPRA 3P8FA 2BDCA 3KQBA 3MO3A 1V6DA 2VNTA 3RU4E 1BTUA 1FV9A 2GCHF 1GI7B 2SGQE 1WYKA 1ZTKA 2QCYA 3P70B 2DE9A 3TITA 4X1RU 4AB9A 4DT7B 5F03A 3TGKE 1SLVB 3SQEE 1E36B 1RIWC 2W3IA 1SB1H 1T4UH 2VGCC 2XWAA 1EZSC 2Z3CA 4ABHA 2P16A 4U2WA 1OP8A 2AGGX 3HKJB 3QTOH 1O2QA 3GICB 4AFSA 1TBRH 1CQQA 4CH8B 4INKA 3SGAE 1GHAF 1F0UA 4K8BA 3LGTA 1LVYA 4X2VA 1LPZB 1XUFA 2C8XB 1ZPCA 1JRTA 2WPJS 2ZGJA 3JZ1B 1THRH 1DE7H 6LPRA 2C8WB 1VCPA 5T3HA 2F83A 1Y3XA 1LTOA 1QY6A 3VB4A 1LHEH 4Y79A 5DG6A 3SV2H 4CRCA 2QF0A 1XMNB 1O5EH 1VJ9U 1BRBE 2TGPZ 1SFQB 3ZVAA 1NRPH 1D6WA 1SG8B 2ZDAH 3RMNH 1ZSLA 2ALVA 5E8EH 2J92A 2A5KA 1SSXA 1V2UT 1C2HA 1BZXE 1DY9A 1C2LA 1YCPH 5K0HA 3M7QA 1IQNA 5FXLA 4ABJA 1ZJKA 1MQ6A 4HZHA 1BIOA 1ZMJA 3QX5H 1GJ6A 4PROA 1ZHPA 4DG4A 1A7SA 1Z6EA 1UVTH 1BOQA 3MNXA 1GJ8B 2AERH 2V3OH 2GZ9A 2F9OA 1P10A 2WV5A 4Y8XA 3OU0A 1O3JA 4UFGH 3M5OA 1CHOG 3MNCA 1GCTB 4UD9H 3CS0A 5SGAE 1O2NA 3ZZBA 3BTFE 3BTEE 1S6HA 1VITF 2GZ7A 4KGAA 1S84A 3BN9A 2C93B 2P59A 1SMFE 3IWMA 3MHWU 3AASA 1TNGA 3RMOH 1SOTA 2BHGA 3F6UH 4NIWA 4Y10E 1NROH 3PMAB 1TRMA 1ESBA 1MUEB 2CGAA 3U98H 2R3YA 3STIA 1PQ5A 5E0GA 2QXGA 3T5FH 4CRFA 3LGIA 1DUEA 1ZOMA 2ZU5A 4X8VH 1ZRKA 3ZVFA 4HGCA 1KXDA 3VB3A 2BX3A 4ABGA 2G52A 3FAOA 1GMCG 1QJ1B 1K22H 3A86A 3SJKA 1MAXA 1O2GH 3LJOA 1A3EH 1SGQE 4NG9H 1IOEA