1TNMA

Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
91
structure length
91
Chain Sequence
b'RILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN MODULE M5
molecule tags Muscle protein
source organism Homo sapiens
publication title Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set.
pubmed doi rcsb
total genus 11
structure length 91
sequence length 91
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tnmA00
4HUNB 2WP3O 4MQTB 3I2CH 5DUPH 3NTCH 1RIHH 2YN5A 1J1XL 1MFEL 2C4XA 1T5XB 3TBTA 4ACPA 1P4BL 2VL5A 1A0QH 3EO1A 4GW4B 2BOBA 1MI5E 2VDOL 4ZTOL 5IMOA 4F7TB 3KPRE 2D7TH 4OI7A 1JYWA 5E4EB 5H2BB 3GBNL 3VXOB 5JNYB 5TQ0H 4RA3A 5C09E 1DN2A 4KDWA 1GGBL 2W60A 4PS4H 4PRIB 2HT4C 2QQNH 4HLJA 5GRYA 5LBSL 3HI1A 3L3KB 3FOLB 2DQIL 1FNLA 2HG5A 5IOPB 2K9UA 4JN1H 3KPNA 3DETD 2AK1L 2R1YA 3K4ZA 4X7CC 2BVYA 1VSCA 5DUBB 4ZD3H 2OK0H 2EIZA 3GSXB 3KR3H 4XXDA 3UAJC 3ULUF 3GJFK 3WFBL 3LHPH 1KCSH 1O7SA 4JN1L 3LEVH 5E7FA 2WWMD 1HIMH 5KTEH 4R4NC 3WE6A 4N8CH 1E4JA 2UYLB 4M02A 2QQKH 1RD6A 4E41A 4WI5A 3DGCR 4TNVF 3NIGF 1FBIH 5D96B 5CZXD 1MH5B 3AROA 4L9LB 4YEFA 2CRIA 1QRNE 3KGRA 5GZND 3QDJB 5GZOC 1CGTA 2L7JA 3GSNB 4KPHH 2NY5H 1Q9LB 2XICA 4B41A 4L4TB 1YMME 3A6OA 4L4VE 3B2VL 5T1DH 1W8NA 1BGXH 4JRYD 1V8HA 3C60A 1KEML 2YOCA 4KDTC 2XNAA 3RWHA 4X7FC 2GSIB 1VGKB 1A3LH 3HUJF 1QSVA 4GG8B 1SVCP 1FJ1A 1E0OB 4NZTH 2EDHA 4YHIB 3QHZH 5DC4B 4QOKB 2C3XA 4HUUA 4ZSOA 3BJLA 1EMTL 3GMRA 3SJVB 3QUYC 5IIEB 5TDOB 3NN8B 1B90A 3BP6B 3C8DA 2N7AA 4OGZA 4BQ8A 1T80A 2BY3A 5ID0B 5GRVL 1UKTA 1KB5B 5IFAH 3W82A 4GRLC 5CIPH 4X4ZA 5D5MA 3L3HA 5GISL 1U95A 1ND0B 1HXMA 2FX7L 1ZLWH 2OBGA 1I3UA 3MRRA 4LLVB 3VI4F 1II4E 2E8ZA 4JJ5A 2GW5A 2ITCA 4HIEA 4BSWA 1H5BA 4I5BA 3BQUD 4HEME 5E94A 3H9YA 1S9KC 1NEZA 4DN4H 5I30H 4XC3H 3I6KB 5T5NF 2DL9A 3I6LE 2VC2L 4W6WB 4YXHH 1DUZA 3NTCL 5HHQA 1GZQB 1N4XH 3MRNA 2X89A 5I1HL 3FO2A 4XX1G 2X4OA 4JG0L 3A67H 4MXVE 3QEGL 1DBBH 5D6DA 1JGDB 4XNMB 1BAFH 1QSFB 3TCLB 5DZLA 2CMRL 4PJ8C 1S7VB 4XZUB 1AO7D 4A6YH 2BX5A 3KLAB 4HJGB 5HGBA 4HKZA 2D7OA 2WIIA 1KJ3L 5DEGB 2QQQA 3QRGL 2XZAL 1SM3L 5FO9B 3LQZA 1I7RA 2VDPH 1I9IH 3R0NA 1ZHKA 2ICWA 3QNYB 1TMCB 5DYOB 2HRLA 3Q48A 5DS8A 2A83A 1RZ7L 4JO2L 3MV7E 3FB5A 4NPYB 2FLBT 1BQHG 5L9DL 3H0TB 4NRYA 7FABL 1RZFH 3MRHB 3RNKB 5J1SC 2NXZD 4JZJA 1E28B 4O9HL 4PGZA 5E2UH 3AREC 3MTRA 4PJAF 2IQ9L 5JUEL 4OZIA 4HIIA 1QSEE 1W0VA 3WIHH 3BP4A 4WW2C 1BFOA 3B2UC 1UEYA 3KYMB 4XMLH 2ED9A 3QG6B 2B1HL 3GRWH 3A6BH 1MIEH 2KZWA 3QJFB 1L0YA 4Z7VB 2ENYA 2YWYA 4ZFOA 3NPSB 4FS0A 2EXYD 4XPFL 1EJOH 5CEXB 2H32B 4PREA 1QEWA 1QR4A 3V6OA 4NT6A 4ODSH 4CVZB 3QUYD 5EC2A 2ZKHL 5F70A 1JUFB 3B9EA 5EBLB 5EU5A 2Y07L 1M05A 5AWNL 4XVTH 2BNRA 5BRZD 1KJ2A 5FO8A 1X6LA 3FL7A 3HMXA 4DK6A 4M5ZL 2NY6D 4LCWA 3ZDXF 3IJSA 3WO4B 2Y36L 1P9MC 3F65A 1INEL 4JRXD 4FQ1L 3U4AA 1TETH 2D0GA 3WUWG 5FUCC 4HT1H 4LCCB 5IVXA 1I85C 4KJYB 4ZFGH 4QNPF 3VWJD 5BS0E 4L8SB 4EBQL 3OKKA 1QFHA 3FN0L 1RQ5A 5CUSH 4XAKE 1GSMA 3OWEA 5FEBA 5HDBE 3KPSE 2I24N 3JWDC 5K9JH 1F11A 3RL1A 3W0WB 2V9TA 5C8JB 4LSSH 3ET9F 5IJVA 5FYJH 5T1KA 4EN3D 4JFFE 3ARFC 3ZDZF 2XG5A 3ZKXC 1PVHA 4UBDD 5KSVB 5HGHB 3V7AE 2E8YA 4UU9A 4PJBB 1G0YR 2QSCL 4JPKL 35C8L 4H20L 4P9HH 1D5ZB 1HI6B 1HQ4B 3O41B 2WW8A 4LSPH 3GJFH 5IFHH 1YMMA 3C09C 2IGFL 3HN3A 1NCTA 5E5UB 4YDVB 5FGRA 5FYLH 4GKOA 5I0DA 1OM3H 4HUXA 5CEZH 1DUYB 1NGYA 4JY4B 3RFZC 1BVKB 1U8IA 3OF6D 2R2BB 1LNUA 2YA2A 2CDGA 1SYVB 4E9LA 1B0RA 2KPNA 2ZUXA 3SKMB 3CVIH 3U82B 2YN3A 1QFUH 5MP6H 3WD5L 5DUPL 1DBKL 2HTKC 4P2OD 2H2SC 3FRUB 1Q9WA 4N5ED 4MJ2A 1YMMB 5I71B 2OJEB 5F9DC 5C1MB 1OSPL 4ONHB 1PX4A 4FP8H 5EZOH 4IRZH 3BZDA 2O26U 1J5OL 3RHWK 4Z7OE 4CW1A 1PEWA 3D18A 1MCJA 2XY1A 2OP4H 3ZT7A 3VXRD 5JA8B 5JQ6L 1F11B 3BQUB 4N0YL 2NY1C 3P9LB 3DO7B 4ISVB 5D7JC 4X6FB 1G7IA 1N0XL 3QSKB 4H20H 4P9HL 2CXKA 3H9SA 4RWHA 1CVRA 5JOEA 4K7PY 4NC0B 4X6DA 4YAQB 1KC5H 1YJDL 2F58H 5EU6A 5D9SB 1GCFA 1G7QB 3TF7C 5BXFB 4GKSB 1C5CL 3LB6C 4QF1A 3MRPB 1IGCH 3TIEB 3PL6A 1MCOL 1QNZL 1FV1A 2OXGA 3VWJC 3LQAH 3O45B 5M7QA 2G60H 4J6RL 4PGDB 2OR9L 3BKJH 4KK5D 3O4OB 5IMMB 3I84A 3IAGC 1KN2L 2ARWA 1FLTX 3GSRB 2J4WH 1NCNA 3U0WL 3IB4A 4RDQG 1NUFA 3BIBX 1YYLL 3IU3B 2I60H 3OKOB 2XT1B 3MROA 1UM5L 3DPBA 2QADC 3SPVA 5IK3A 4EUPG 3CXDL 4UV4L 5AZEL 5DZNA 3BP4B 2J2ZA 4FG6C 5ESVA 5HBBA 4HIIB 1T20A 2DLGA 3QNZB 4OZIB 1WWBX 5MEOA 1YNLH 4MNGE 1GOGA 3FN3A 1PG7X 2D03H 1UFUA 2CKBH 5JHLH 1JNLH 4FABH 4DK3A 3CFEA 3PDOA 2A83B 3OZ9H 1MHPL 5DJDB 3T0DA 3MCKA 1NDGA 5KSUB 3BXNB 4E0RB 4PRNA 4PGJA 1I1YB 5D8JL 4AEIH 3BH8B 1B0WA 4KJPD 3ZYJA 4JFEE 4DGIL 2DOCA 2A6DA 4PRID 4KK6D 3VRJB 3WXVH 1OCWL 5CEZE 4EDXB 5JW4N 4JZNB 4OI9A 5GGRY 1A4KB 1QRND 1T1ZB 4LEOA 1BPVA 3PGDB 3WIHA 5J3HD 2Z9TA 2AJVL 1BFVL 3QO0A 1OB1B 3UTPD 3O2WL 1J11A 5ID1B 4MJ5A 3RPIB 5BV7B 4X5XB 3BKMH 4O2FA 4KY1H 1FYTA 2ATKB 2NY1D 2CK0L 2GQHA 3ZDYE 3SCMA 5HYJD 4G7YL 4M43H 5DK0A 1MCHA 1BD2A 2BOCA 3QQ4A 3TESA 4NHCL 5J7CC 3CSBA 4OQTH 5HI3C 5IG7A 1DEEA 3W39A 4GBXA 4JREC 4XPAL 4X7TA 4JHWL 2GITA 4Y19A 2J6EL 3WDJA 2VLJA 1G7HB 2P5EE 4Q7DA 1KBGL 1NCAL 1U92B 2IPKA 4G80A 1QRKA 4HS3A 4DEPB 3IRPX 1Z0MA 3BP6A 5HGGS 3EYSH 1A6ZB 1HK6A 3LN9A 1XH3B 2H45A 1V3JA 1YEFH 2W59A 2YD7A 4RGNE 1HNFA 1RIUL 4ZAKA 1MRFL 1FO0A 3BKYH 4NNXB 5ITBH 2CDEB 1ZLSH 1PG7H 1C16B 1TQBB 3GK8L 4X5LA 5ISZB 1YY8A 2EDYA 2VR4A 3M07A 1C7TA 5EN2A 3V79C 2I5YH 5GIRB 2AXGB 3SGDI 3B4NA 1N26A 3WUWA 5LGHL 3DBXA 1B4JH 2V5SA 5EG6C 2FHCA 4HGWB 5F96L 3QULB 1H3VA 4KJQC 3DX8A 4R2GC 5A40E 4ETQB 5J1AA 3D25B 2P7TB 5ICZB 1QTYT 4FQQB 5C0CE 1CICC 3QIUD 1XF5A 3AGVA 1J12A 2ZUWA 1Q9LA 1KLUA 1UCBH 1K8IA 5F6HJ 3HG1B 1LMKA 5GIRA 1T4KB 5BV7C 4I0CC 3MGOA 2AJXH 1KNOA 4E41B 3BKYL 5CFHA 3NGBB 3F5WA 2VZTA 4MA8L 4OCSL 2E9WA 2VLKD 4YHLL 4KJPC 2J6EH 2DQDH 3KPQA 3WYRA 2DQCL 1BFSA 3V4PL 3MRIB 4X6BB 4YC2B 3KPNB 5TF1H 1UJ3A 3OKEA 1J05B 5KS9F 2V6HA 4CRPA 5C6PB 1S5HA 2X4PA 4L8DA 3TN0C 4JFFB 4GBXB 1JTPA 3RZCA 1KELH 6FABL 2ID5A 3S4SA 5F97E 1DE4B 3IDJA 4IDJL 2ICWI 2VAAB 3WL9B 2VE6B 2Q76B 1CR9H 1KN4L 3EUUA 1X5YA 1M6OB 5CAYB 3T0AA 4KUCD 2F74A 4IIQB 2FHBA 4WIQA 3DXAD 1JWMB 1KTDA 3S37L 3OKMA 3K2MC 1HDMA 5E5RB 2W92A 3VWJA 4N0CD 3VXNA 1J88A 1ZA3B 2CRYA 3GSQA 1JNNL 3FB6B 3UTQB 1AQDB 4YDLC 1NFIA 1OTSD 1RZGB 4N1EA 1N4XL 3VA2C 1J0HA 3O8XC 2A6IB 5GJSL 5B3NA 3TFKD 5DTFB 2YBRA 2J8UB 1IGMH 1RIUH 4Q6IA 4ZODA 4LOUD 3V5HA 4G9DB 5JLZB 1GGIL 3VXSD 5JDSB 5HPMB 3BZ4B 2LQRA 4XP1H 3P40A 2I27N 3V0WL 5DLML 3GKWL 5C0BD 2YUVA 3WMSA 4OSUL 5DJXA 4LVNC 5IFAL 3P4MB 1NGPH 1WC7B 1NCDH 2GT9A 5I1IH 3QEGH 4OCWH 2NW2A 1CICD 2A9MH 2XTJC 3M8OL 4H8WH 2YPLA 1AO7A 1LEGA 3BDYH 5EU6E 2BNQE 4RSVA 1EAJA 2H9GA 2HLAB 2XWTA 1R0AH 4QYOA 4ZO8A 4LLWA 2NXYB 3AB0B 3AS1A 3CZJA 5DA0B 3O6MH 5F72S 2YEZB 3RU8H 3MRFA 4K2UL 4UQ2A 3ARUA 1X7QB 3VFTB 3HAEH 1LEIB 2QSVA 2GCYA 1AGEA 1IFHL 1M7IA 3BIAX 1R3IH 5CD5C 2A6KB 5D1XC 5GRZA 5GGRA 4BKLA 2XWJA 3QFDA 2YS4A 5DD5H 2Z4QA 2ZOKA 4FQHB 2FD6L 2NW3A 4JGUA 5FYKH 4QF1B 3MRKB 3UPRA 1KN4H 4NOFA 1A7OH 2X1WL 5I1CL 4URTB 1RAMA 4R6UA 4F8QA 1AIFA 2VLJE 3N06B 3IDNA 2G2RB 3VMOA 3JVGA 5JZ7C 3L5WB 4X6DB 1AHWC 2VR9A 5BJTA 4MJ6B 1FFRA 2PYFB 1T04B 2J5LB 4OD2B 4Y4FC 3IAPA 5MEND 2UWEA 1T2QH 4DN3H 2HFEB 4I2XE 2DICA 3EYVB 5C0JB 2Z31C 1DLHB 3E6FA 1C12A 2X6MA 4HH9B 1FO0H 4LPUA 4QOKD 1LK2B 4ODHL 2QEJA 3CK0H 4X4XA 1J0ZA 12E8L 4OBSA 1XF4A 2P5WA 1WWWX 3O8XD 2NX5B 3UYPA 1JGLH 3OHXB 3U9UA 3DMMD 1EHAA 3OQ3B 4X80H 3K1DA 2WUBL 2P8MA 4UT9L 4Z8FH 3UDWC 1LNUB 4OQTA 4Y2DA 4PJHF 1MCSA 2XFXB 4B5EA 4U1SB 1ZVSA 5KVDH 3HRZA 4CJ1A 4MGXA 2BHZA 3Q2CA 1MHHA 5EO9B 1QYGL 2FEDD 4UV7H 1RFDH 5DRZA 3O2DA 3UTTB 3C6LB 3BRFA 3NABH 1F5WA 4WFGD 3ARFA 3LV3B 3DVIA 2YPKB 4BQ6A 5MENB 4XNZC 3PHOB 2YRZA 3HI5L 4BZ1L 5JIHA 2VDML 3QAZB 2GJ6A 3EO9H 4LLMB 1MQKH 3LQAL 1VFUA 4PY7A 2JCCF 1TVHB 1CL7L 5FYLD 1R24B 1JPTH 1T5WA 1CU4H 3GO1H 4X6CB 4HXBH 2EE2A 1S9YB 3QFJE 4ZG1A 5IGXH 3HZVA 4GRWH 4I77L 2HP4A 1HHKB 1CL7H 4MD0B 1DQML 1KJ2H 4J3WA 1F2XK 5L8LB 3P2TA 1QLEH 4DVBB 4GKZA 4K94L 1L7TL 3ALXA 3K7UA 4G7VL 3VA6A 4X4YB 2BSED 2QV2A 1OW0C 4RMQA 3ZE0E 3MNVA 2R0ZL 2R4SL 1I7ZB 1KXTB 3IJSB 4QT5B 1T83A 2BVQA 3X3FL 4R8WH 5EIIA 1TNNA 4GSDH 5HYSB 4F7CB 5TDPA 4V1DE 4OZGB 4WU5A 1KIRA 2BNRB 5ERWB 1RHHB 2X70A 4U7KA 4PJAA 1J0JA 1Q0YH 5GS0D 3ECBB 2MHAA 4NT6B 3V5DA 3ZKQD 1ZHNA 3F12A 4I77H 1VEMA 2WUCL 4MYWB 4ZFZB 1MJUH 5EUKB 3ZTJG 3TWCL 2H32A 3GMMA 4F7EA 1FFNA 4Z7VA 4P46A 1W72B 1ZLUK 4NRXA 4WENB 3S7GA 1WFTA 3IAQA 3G6JF 1GAFL 5DJ8A 5F9OH 1AGCB 4PPTA 3TJEL 4BQCA 1CU4L 1X5JA 4JQIH 3OJDA 3L5WA 4YDJA 2FHFA 5EIVA 5DHVH 3ARDC 4WJ5B 5TFSL 4FTVD 4OLUH 4JPVL 2AJZB 1P84K 1HHIA 3S88L 1F3RB 2YR3A 4GRLA 3RNQB 1JHKL 2VXVL 4NCC1 2VQUA 2N1KA 2IBBA 2WUBH 4BQBA 4APQC 5DC9B 2E7LC 5SWQB 1R5IA 1FAIH 4F9LC 4PJDB 3HZYA 3CFKA 2DTSA 1XF3A 4OZGE 1UKSA 1EFQA 5KVMC 2I9LA 4X8JB 4HKZB 3MRFB 4WFHD 4GOSA 5EZLA 3ARBD 4JAMA 1YEJH 2XN9A 2R2CA 2VLRB 5ECJE 4OCRL 3BUYA 4QEGA 5C3TA 4JANA 2OYPA 4Q6YA 3BI9X 3HI6H 5BO1L 2F5BH 1U2HA 3AU1A 3J7HA 2AV1B 1G1YA 3LSOB 4HKXB 5C0CD 1MOEA 4QRUB 1WIUA 4DKFL 1NAKH 2XZCL 1MHCA 4C57C 5DHYB 2EC9U 4XVUC 4S1DD 4Y16C 4PTUA 1OSZB 3VE0B 1SM3H 4ZXBD 3S6CA 5JPMA 4YBQC 4HUWA 5D2NC 4MQ7B 4V2CB 2MHAB 4S1SH 3BKJL 1AJ7L 1BZ9A 3HB3C 4LEXH 1N59A 4HS8L 4KKBD 5JDSA 5ERWA 5C0GA 4HUKB 4OZHA 3DX7A 3ZSSA 3CFIC 2ICWJ 4H1LH 5C0IB 1D5BA 4XAWH 4LCIH 1NGPL 2OM5A 3QHTC 1CGVA 3QDHA 3DGGA 4JB9L 3QEUA 2DLTA 3N1PC 2A2QT 1EFXB 2PTTB 1MQ8A 4X4YA 1XEDA 2ZCLH 1EO8H 4DVBA 1F6AA 1NLDL 4KWUA 1CLCA 2F19H 1S7XB 2JJSA 3UTTD 1H0DA 3RWHB 2ICES 1CF8L 3PP4H 5C0AD 2XNAB 1T21B 3P77A 1OPGL 1WEJH 4JKPL 2FX7H 1YPZB 2WQRA 4D0DA 3NIFE 1F6FB 4M6OH 2CQVA 5SWZD 2F5AH 2PXYB 3PHSA 1KT2B 4HJJL 4YPGA 5E8NA 1T5WB 4RIRB 4Z9KB 1TVHA 3F7RA 2HWZH 3MLSL 4RQQA 2DIBA 3QWQB 2X40A 3BDXA 3GHBH 1NUGA 5H94A 4NHCH 1S5IH 5D7JA 3PHOA 1U8KB 4M1DH 5F7LB 4KI1A 5IFJB 4WTZG 3S3PA 5BRZE 3RWEA 3KPQB 3WUZA 2E9BA 5HTSA 4WI4A 3EYUL 3JTSB 5IF0B 2J8OA 3KDMB 4KI5D 1JGEB 1FNSL 2OTWA 2IAMD 3SO3B 3REWA 5B22A 1GHFH 4U1SA 5IOPA 2XY2A 4D9QD 3FOLA 4HAFA 4KXZH 1K8IB 3V4PH 2MCPL 1FN4A 3HNSH 3QHFL 2F5AL 4RQQB 2ZNXA 3GRWL 3QDJE 3RKPA 4JFDB 1W0WB 3D9AH 1BREA 1SJHB 1RZ7H 2A9NH 5GS2H 1RJLB 1BJ8A 3UTSD 2ZUVA 1RZ8A 2Q86A 4GXUM 2XN9D 4HBQA 2QSCH 3W5NA 1FG9C 4WNQA 3RVXD 3DBXB 3PP3K 2H26B 1A0QL 3S97C 3LS4L 4OV5A 1T5XA 1K3IA 3O2WH 1P53A 4MLIA 3VFNA 4KKBC 2RQ8A 1BD2E 4DUXA 5DK2A 2XZZA 2PYEB 1A7PL 1DLHA 3E6FB 2PW2A 4OJFL 1TJIL 2GKIA 1D5MA 4QHKJ 4YHPA 1UZ8A 5CHNB 2EDEA 5LBSH 1VFOA 2JK5A 3QUZB 3DUHA 4HS3B 6FABH 3BE1H 1N59B 3QHFH 1BZQK 4LP5A 4ELMF 3MGTB 3F7YB 4YJZL 3QIUB 4NKIL 4F58L 1UQSA 2DQCH 2NCMA 3TO4A 1GGIH 4POZC 1P7QD 5T33L 4JM4L 5JPMB 3X13B 4ZQKB 2BJML 2Z4QB 2ZOKB 3E2HC 3QIBD 5DK0B 5ILTH 4M7KL 4AEHH 3VFRA 2FB4L 1AGBA 1A6UL 2ESVB 3SDYL 1EZVY 1MNUH 4YQXH 4KU1A 1DQJB 3RWGB 4WFED 2VKWA 4ENED 3RVVD 4CADB 4LLAA 1R3KB 1TCRB 3BUYB 4UQ2B 4P0DA 1AY1H 4D0CA 1OAZL 2XA8H 5DJ6A 3ILQC 3D87B 5HD8D 3QDME 5KVEL 4AM0A 5D1ZD 3CSYB 3LQAC 2ZUYA 1UH4A 4PJIF 1ZK9A 5IVNA 3CFKB 4HMEA 1CGYA 3BH8A 3ARVA 2K7PA 1M71B 4H26B 3P0GB 3S3SA 4E0RA 1QOKA 5CGMA 1S5IL 1IVLA 1QA9B 4LRIA 1LO2H 5CP3A 1WC7A 5TE6L 4L1DA 3HR6A 5C0BE 2AJZA 4XC3L 3ARBC 3F7QA 2J5LC 2DQDL 4KTEH 5IVOA 1RURL 3EGSA 2F8VA 2ORBH 2VZ3A 1NQBA 4PJEB 4DCQB 4Z77A 2LAAA 1CN4A 2YA1A 4XHJC 4JVPA 1PSKH 2VXSH 2DQFA 4R9HA 4WRLA 1MJ7L 4XP5L 3R4DA 2J88L 5A1AA 2GJ6D 3E1F1 4L4TE 2DI9A 4F7EB 3L7FB 5J12B 2PW2B 4U1IA 4HUMB 4BH7A 4L3EA 5D1QD 1INDH 1W72A 4ZFZA 2NYYD 2D7NA 3OV6A 1AQDA 3GMMB 3MLXH 2F54D 3H9SD 3QEQE 3VWJB 4G8IA 1HDMB 1LDPH 2BDNL 5JR1L 1HKLH 3RP1A 4M48L 2F58L 1FV1B 3GSNH 1UM6H 1RY7B 5SWSA 4KH2A 4IOIB 5D7IF 1QRNA 1W0WA 4HKBA 5FK9B 1FE8H 3TN0A 3FT2B 5FF6A 5GJTH 4N90D 2X9XA 3RY6A 3QNXB 5CEZD 2QHLA 5D2LF 3IDYC 3DXAA 5ICYA 3RJDA 1KJ2L 1CE1L 4O51B 2D03L 1JGVH 3REWB 1CQYA 1UXWA 1EVTC 4XCNB 2OTWB 3RVVC 3DVNA 1YEKH 4JPWL 2D9CA 4ZS6C 4IMLB 1JHKH 3GKZA 1B0GA 1OQXA 1VADA 1IQWH 5ISZD 4LPXA 1U8KA 2YPLE 4NN6B 1QFUL 1T0NA 3SBWA 5MP6L 2ARJQ 5L88L 3WFBH 2LU7A 3P4OB 5CIPB 4QO1A 1Z6JT 1KIQB 3E8UH 5AEAA 2FBJH 5MENA 4ONHA 3FB8A 1MIMH 3OG6B 1LO3L 5D7LA 4M5ZH 1H9VA 1T1YB 2YC1B 1KLUB 3FRUA 1JYVA 4Q9QH 1DQTA 1VB9A 1YPZA 5DVNA 5IMKA 4EDWL 4F7PB 4PUBL 4DUVA 1T21A 4ODBD 3TWCH 4G8GE 5LJYH 3ARSA 3V5KA 1D9KB 4NWTL 1MI5B 4M61B 3CMOL 15C8L 4M62L 1YY8B 4OQTL 1XF1A 2ICEB 2MJWA 3UJIH 2DRUA 3GHEH 3QEUB 3QPXL 4HK3N 1KC5L 5C2BL 4HUXB 2VLME 4YZFE 5L6YL 3RRQA 5FYJL 4HKBB 1L0QA 3L3GB 4OUOA 2P49B 3KJ6L 4OZHB 4TOYH 3UYOD 2DQHL 3GO1L 3B5HA 4UU9B 4H0GA 1IARB 2HKFL 3GB7A 4ODVL 4PJGF 4X4XB 4AJ0A 3GBLA 2PO6D 4X7TB 4QRPB 3IDMA 3SDDD 4PJ8D 3RWFA 3W39B 4EN3C 5LVEA 3EYVA 3F7PC 1E6JL 3MUGA 4TPRL 3IDYB 2BSRB 5DRNA 3RWIA 1QFWL 3CD4A 3WHE1 3O2DH 3WN5C 2V7HA 3B83A 4MSWB 4XNUL 1YN7B 3E2HB 1K6QH 4JFQA 4PJGE 4NO2B 3NACH 3BZFA 1NCCH 3WHE0 4IOFC 5I15L 4M93C 5I75B 2DQEL 4OZHE 3QIUC 1YMHB 1KJMA 3IDNB 3ZT6A 4LDEB 5DEFA 3H3PH 4UZGA 4M5YH 3U7YL 3ARXA 4ZUWB 2EYRA 3IVKA 5GGRB 3WXWH 3T2QA 2DIAA 3HZYB 15C8H 4JFXB 4YIQA 1SJEB 1A21A 5JQHC 4UUJB 4UTBL 1M05B 5KSUA 2R0KL 1M71A 2MQ3A 2JJUA 5DJDA 1QFPA 3D3VD 1X7QA 3KPRA 4PRBA 4P9ML 5IJKA 4WO4B 2VTFA 5I9QC 1X6NA 1MCCA 4P5TC 3L5HA 3MXWL 5E00A 3TN0D 3KYMA 4FQJH 3HE7A 5L7XL 1W0VB 1G6RL 1FDLH 5L8KB 1JTTA 2YSSA 1J5OH 3S98A 3Q6FA 3D0VA 4P48A 3WSQH 5DDHB 1J0KA 4PJCE 1A2YB 5FV1L 1A02N 2IAND 4JQXA 5DJXB 3P73B 4U3XA 5T5FL 3TT1H 3L3DB 4PJCB 5FUOL 3DJ9A 1DCLA 1JJUA 3P4MA 9CGTA 4C59B 4NQUA 1J8KA 4BZYA 5DJYB 5HPMA 1UJTA 3F7YA 4M03A 1KIRB 1XIWD 2DWEA 2P43B 4F2MB 5TDPB 4UT6L 1T7XA 4I0PC 4XBEL 3BPNC 3O9WD 3NZHH 1Y0LB 2EYRB 3IVKB 3DYPA 1TPXC 2FATH 1FVEA 3IDIA 1RZGA 5L2KA 1JYNA 4R8WL 3Q5TA 5CLWA 3SDXE 1I9IL 3C6SA 4Y4KA 5A2LH 3K0WA 4HBCH 1C7SA 5KTEL 2A73A 1KTDB 2DQHH 5TH2B 1FNEA 3PGCA 4BH8B 3C60C 3BH9A 1GZQA 5KS9E 1IGTA 4LAQH 4OCMC 4MD0A 5JOPE 1XR8B 3U30C 4PP2A 4LNVA 3GJEA 1RZ8B 2Q86B 1XAUA 2NTFA 4Q0XH 4OCWL 4H8WC 4YHYB 4D0BB 3GMNB 2YPVL 3I6GB 3X11A 4JFFA 1BM3H 3IDMB 4UQ3B 2X4PB 3D18B 1BX2A 4CW1B 1DE4A 3FKUS 1FLRH 3RZCB 3A6BL 3GB7B 5HHMB 3G9AB 3KG5A 4PRPE 5D5MB 1S5HB 5TQ0L 2MPAH 1SMOA 4YDIL 5ID0A 1SEBA 3MJ7A 5HHXH 1C08B 1UB5A 3TV3L 2VLJD 4HT1L 2OI9B 3P0YL 5KSBF 1JGEA 4DGVH 4MJIE 5C0BB 5IF0A 4I9WE 3EOTH 5CSGA 3MFFB 1EPFA 3HHRB 4ZDHA 1YQVH 3LVEA 2P8LB 1T22A 3RIAF 1XGPA 4N9GA 2YWZA 1D6EB 5H37H 1JPSH 1OAXH 3WJJA 1FYTD 1WT5A 3MJ6A 4BFIA 2EYSA 4EI6A 2CDFB 5SWSE 4U3CA 4F57L 1IM9A 4V1DB 2K1MA 3BD3A 3HR5B 1KYOJ 4U2YA 3U9UB 5C07B 1RJYB 3GI8H 3G6DL 3VFWA 1X5GA 5AD0B 5BW7C 5M95B 1T1YA 1TZIA 2AJSL 3WUWB 3ZKND 3RX5A 4V1DA 5FIEA 3EYOA 3I6LD 4J12A 4XP5H 5CIPA 1KF9B 1HCVA 2X89D 1MNUL 1A6WL 3CZFA 2WQ8A 3NCFB 2XZCH 1C5BL 4X9GA 1BZ7B 3WE6B 5CZVH 5FOJA 3RL1B 1JIBA 5GISH 4JHBA 2R29H 1JFQH 1DBJH 2HFEA 1EEQA 5HYIA 2E9JA 3WNKA 1T04A 5AUMA 4K2UH 2M2DA 4F9PC 4TUKL 2MMXA 4GG6E 3PP4L 3EZ8A 1A7RL 4NKDB 4CN1A 1R3JA 4LHUA 3ZE2F 2F9BT 2GITB 3AM8C 4UQ3A 3VE0A 5F9AC 2OSLB 2XWJB 3QFDB 5F7FA 1FL3A 4U6XB 4E41D 4Q97A 3VW3H 1G9NH 2PF6A 5H2BA 3PXHA 2Z8WC 3O3EA 3QQ9C 4DOHE 1FGNH 4M3JA 2NY0C 1U0QA 1M7IB 1EIBA 2XQBL 2MWCA 3FQUB 4M1CC 2IFFL 4M7LL 1NCDL 2Y06H 1IGTB 5EUOE 3C08L 1MWAA 1U3ZA 3V95A 4OLVL 4LEOB 5C07D 3EDKA 2Q8AH 2EICA 4CVZA 3QDGD 2D7MA 1DANT 1OP5K 4GRWE 5BZWB 3AXLB 1NSNL 2AEQL 2DDQH 3JTTA 5IBUG 4F7MA 4ZNEA 3EOTL 4ZFOB 1RUML 4OLVH 4RAVA 5J9PB 4PGEA 1E6OL 4I3SL 4M6ML 5FXCH 4JRYE 1X5FA 2DLHA 4HZAA 2RAMA 1C5BH 4Z7UA 1WFUA 2W65A 1R3LB 1VPOL 4XWOC 5DJYA 4XAKD 1QPPA 1MCDA 1E28A 3MJ9A 4K94C 1I9RL 1HKLL 2ZCHL 5DMGC 1X4ZA 1S9VB 2V2WA 4MHHI 4AEFA 3W2DH 5FM5O 4C56A 4NBZB 4MXQD 4QRPE 1QA9A 2VXQH 2HAZA 3GIVA 4JRXE 4Y2DC 1V7NH 2W65B 2RIKA 1U6AL 5GGQH 3UDWA 4RAVB 5J9PA 4CKVX 5ILTL 1AGCA 5DJ8B 1IGIH 5HI5C 5GSVB 1F8TL 5DTFA 2WIIB 1HQRB 3TC9A 3SPVB 5L2KE 2GEEA 1S7VA 4XZUA 5DJ6B 5F7UA 2OR9H 3MROB 1YC7A 4WO4A 3GSRA 2DMKA 2NY4B 3MLUH 3V4UH 3VXNB 1AXTH 3V5DB 4HIJB 1JWMA 1I8KB 3V4VH 2X05A 5IB4A 2OL3H 3RTQD 1WJ3A 1B6UA 2F74B 1RIHL 5TGBA 1N7MH 3QXTA 3FQUA 3S36L 4OZGA 1FL3B 4WFFE 1BIHA 2O5YL 3AS0A 5HYSA 1J0IA 4XMPL 2JKXA 4N5UA 3VMNA 3WFEL 4GAGL 4EXPX 3PF2A 3X3GL 3MRMA 2ITCB 4HHAA 4WW2B 5D1QB 4JJ5B 4MVBD 4TVPD 2EDJA 2ZCKH 3L7EA 3V52L 1ND0A 1YMHA 4NHUB 2RJMA 5JW3L 3CFCH 4JFDD 2RCSH 4ZOEA 3MYJB 3MV8A 2HVKB 4XMKH 4YHZL 4ETYA 4PJAE 3D6GA 4WW1B 5KVDL 3RVUC 3BQUA 1A7NH 2BSRA 2RR3A 3P9LA 3MV7A 4M1CD 1MFNA 5EO0B 5F8QC 3WFDL 3SDYH 1EAPA 5J0BA 1G9EA 2AABH 4XCFL 4FFYL 1NFDB 1NAKL 4KVNH 4P3WA 1VGKA 2ITDA 3HRPA 1TZIB 2CGRL 2QQKL 4PJHE 2WAHA 3L3JA 1CTNA 4DVRH 4LRIC 1NC4A 1Q72L 5E9DA 4YPJA 3ARZA 3HNTH 3VFWB 4EEEA 5ICZA 5ADOH 3RY6C 2X4TA 2YXFA 4HAGA 2N4IA 3UTTA 4HGWA 4M5YL 3V7AG 3KYKL 1XR9B 3SO5A 2PUQT 4BFIB 2VXVH 3BPLB 1G6RH 1WV7T 2DM2A 4QRRD 2CLRB 5F93C 3LRSA 1FORH 1BVKA 1MI5A 4M61A 5FYLL 1WVZA 1N8ZA 1HCFX 4NWUH 4AT6A 1NGYB 1D6EA 1OAUL 5CEZL 2R8SL 3CDGA 1TTFA 4J3TA 2P8LA 3WLWC 4BQ9A 3NAAL 2V9RA 3RZCC 5FUCE 4NQDA 4R4ND 1A3LL 1L6XA 4JPVH 4Z76B 5E9DB 4FQLH 2BMKA 1ZANH 3HLAA 3FQXA 1P4BH 5HGHA 2YC1A 3K8KA 1HQ4A 2JLLA 1JHTB 1NANI 4IRSC 1D5ZA 5D5ME 2UY6A 1KT2A 1JNHB 4I8DA 1IQWL 1F3JB 1FNGB 1P7KA 1DEEB 1U3HA 2C3WA 4L9DA 5I18H 1CDHA 1BM3L 2WSKA 2NTFB 3GMNA 3I6GA 1B0GB 3SCMB 3VGAB 5GZOD 5GZNC 5HYJE 1XR8A 4O2FB 2YD2A 4X9HA 4Y5XB 1MJUL 3OL2A 2NZIA 4BH8A 1WZMA 4DTGH 1KENH 4LSUL 5E8EA 3EO1B 4Q9QL 1IC5H 3O3DB 5IHLB 1QSZA 3A0OA 4KJYA 3GFUA 4LVOC 5IVXB 3DSFL 3ULUC 1EFXA 1XIWB 2R0LL 5FF6B 5IBTH 1SJXA 4K3JL 3S37X 4RISH 1OF2A 2J4WL 5LWYH 1FVEB 4X8XA 3OMZA 1F4XH 1BOGB 1FORL 1TJHH 1Y0LA 5EZOL 3HZKB 3RL2A 3JWDH 4QLRA 5CBAA 1AGEB 4C55A 5EC2B 5FYKU 4HIJA 2BNQB 5C0AE 1Q8MA 4G8IB 1EGJH 4OFPA 1F3DH 4HUWB 2YRPA 1QFWH 3C6LD 1NBYB 4OKVA 2IFGA 3D48R 1FPTL 3K4DA 4LGRB 1SYSB 4ZSOE 4RGNC 5TF0A 4KDTA 1EUTA 3SDCD 4X6EA 3ARGA 5C86A 2XACC 1CZ8H 1INQB 2J7LA 4FQ2L 4JHAH 4M9OA 5EC1B 1M4KA 2VXTH 5C08B 2A77L 3TVMC 3U7YH 5CD5D 1H3PL 4M62H 2YPLB 3MLTA 4MX7A 4TPRH 3D2UB 3MRHA 4JQVA 2VLRA 4N0RA 4N0YH 3CU1A 4AH2A 1O5DT 1HWHB 4NPYA 4NQDD 1U2CA 3EDDA 3OJMB 3HE7C 4PUBH 3MCLH 5DYOA 1LP9B 4QTHB 4Z95H 3MCG1 2OCFD 1XGRB 2NY3B 1EUUA 4UUJA 5D2LE 4NC2B 4TUJB 1ZHKB 2ICWB 3ARRA 1ACZA 3ROLA 5JIPA 4OCYL 3TA3C 3U7AA 3LMJL 3O45A 4HPYL 4G9DA 1FP5A 1U3HD 3WCYA 4ZUWA 5GRUH 4LRNH 4X9FA 2A9ML 1YY9C 3QPXH 5C2BH 3T2OA 1SQ2N 4LDLB 3IU4L 2OS7A 1XIWA 4RX4A 3VRLF 1OAYL 5FGCB 3IDUA 3GSQB 3UTQA 3QIWC 1MWAB 2IPTL 3TBVB 2F54E 5L9DH 2X4RB 4LPWA 1T03L 3VFGH 4M6NL 4LARL 5DRNB 4X6FA 3RKDD 4NRXB 1SMAA 3O3EB 4JKWA 2V7HB 2IQ9H 1AGBB 2APWA 1FYTE 3MUGB 4QXTB 1V3MA 5KSBA 3WL9A 5HXMA 3QJHB 1HXMB 1ZHNB 5HDBF 1H5BB 4LASH 1UWEH 4GMSL 4YXLH 1OAQL 4OFYA 5GPRA 1IBGH 2V17L 2X70B 4R26H 5FFLA 1NAML 1KPRB 2YK1H 2X09A 3OGOE 4LF3B 4OIAA 4X6BA 3ZO0A 1K4DB 1S7TB 2FR4B 4DEPC 3MBEB 3MRIA 1A7OL 2W38A 1UYWL 4BFBD 2P1YA 4ZOCA 5DQ9A 4PJ7E 4PJIE 3KPPB 2ZSVB 4G6JL 5E5MA 4JPKH 3DYOA 5B3JE 2WBJC 5FGBA 1I3VA 3CDGB 4FNLH 4HUUB 2MQCA 1P6FA 4GKZB 2ICEA 2IJ0C 4MAYA 2V5TA 1ROWA 3MV9D 2NY2C 3D39E 1ZV5A 5K9JL 4Z7WA 5I66A 2CLRA 3MJGX 1D9KA 5HHVH 4JY4A 1INEH 3C60B 3CLEL 3WLBA 5AD0A 1XR9A 5GGSA 1FO0L 3MR9B 5DT1H 1DEDA 4XHJD 1VFMA 3LKOA 4QGYA 4JFDA 1KCUL 1JCKA 1S8DA 4HXAL 5AWNH 5DHXB 3VGGA 1FN4B 2X9WA 2GJ6B 1MCWM 4LLMA 5GS2D 5CINL 4H8WL 4Q0XL 2ITDB 4L9LA 2VZOA 3DXAE 1YZZA 2CK0H 3K8MA 5ISZA 3BRGC 4JY5L 5SV3A 5ESQA 3TZVC 1KPVA 4YR6A 1UXWB 1A6ZA 5KVEH 1C08A 1UB5B 2UZIL 4ODSL 1YJDC 3DVNB 3DXAB 2AK1H 2EYTB 2IPUG 2HG5B 2VITB 5D7JB 4YXHL 4OF6A 4M6MH 1NKOA 5H94B 3MLVH 1D3CA 3L7EB 1CFBA 2P8MB 5I1HH 1N6UA 3FT2A 1H3TA 1NBVH 3EFFB 4RIRA 3S5LA 4YPGB 5E8NB 4PRIE 4RMRA 2GJZA 3WJLC 4IOIA 1ZLSL 1NMCC 3TP4A 5F1OB 1GH7A 3QIBA 1HEZA 2WLYA 3CFCL 5SWSB 4S10A 1WFOA 2M26A 5EBLA 5FKAB 1YEEL 1UXSB 4PYHA 1EDQA 2MPAL 3C5ZC 3GUTA 1S7XA 1XCTB 1RULH 2VL5B 4MXWH 5I74B 2Y72A 2IH3B 1VFAA 2UZIH 4Q9BA 1MFAL 3B5TA 3BYYA 1U8MA 4GKNB 5KSBE 3RWCB 3DVGB 3QRFM 3QJFA 4OF5A 3MACH 1CYGA 3ZHLA 3O11A 3V6FA 3MRJA 3Q6GL 1NFKA 5GGVL 4D8PA 1MLCB 1OAQH 4NJ9H 2VO5A 2FB4H 3EGSB 1BZ9B 5B8CB 3MACL 2NY2D 5EU3A 1DLFH 2IAMC 2YMXL 1QBML 2FH8A 4DCQA 4Z77B 1GRWA 3QB7C 1CFQA 3UPRB 4F80A 3EYQD 1S9VA 2V2WB 4FQHA 4RGND 1VCAA 3D39D 3FONB 3U7WL 2DQUH 2GHWB 4C54A 3GSWA 4MAUH 4AIZB 3Q6FB 2EE6A 1FNFA 5E8DH 5HHOE 1T20B 3QNZA 1JNNH 5ESVB 2EO1A 1UH3A 4QGTA 3QCTL 4L29A 3O6KL 4HFUL 1T83C 3LZFL 3KXFE 3WBDA 2Z91A 4AL8H 4JANB 4OJFH 2QQLH 4JO1L 3FAXA 3K81A 4M1GL 5SWSD 1EVUA 4F7MB 3NIFF 2QJDA 2XN9B 5TQ2L 1TCMA 4JAMB 5BZWA 4U0RC 2EDBA 3MOQA 1OVZA 4QTIL 2AJSH 2NX5D 3MBXH 4FQCL 3HB3D 1F4AA 1R3HB 4M7JH 2F54A 1DBBL 4L29B 1MJ8L 4HQQH 1QFWI 5ALCL 5JORB 2HT2C 4D9LL 1DUZB 1MAJA 2CRMA 4JE4B 1V7MH 4PGDA 4JFXA 3ULUE 3GSWB 4AIZA 1OLLA 4OLYH 4POYA 5IT2L 1RZJH 2APFA 1AGFA 1YEGH 4M7KH 5EBWA 3VFVB 3BWUC 4KROC 3MRBA 4IDLA 3VD3A 4HIXH 2R69L 2CIKB 2JB6B 4U6VH 1HHJA 3RUGA 4MJID 4NKDA 3LEXB 2QSTA 2BC4A 4Y19E 4WJ5A 4TNWF 1ACYL 3THMH 1VEPA 3QIUA 4JEGB 4J4PA 4RRPG 5DVMA 5E1AB 4XNQA 3QDGA 5T1MA 4NO2A 4G43A 4D8PB 5CHNA 4MB5A 1OP9A 3MRJB 3U9PH 5TDOA 2VSDA 4PRDA 1AQKH 4ISVA 4LNRB 4KRPC 4ZSOB 1MRCL 3SKNB 1D5MB 3QI9D 1H3WM 2ZSWA 1AP2A 1FZKB 1BZ7A 2YUWA 3FB6A 4WEBL 4YHKH 1MFDH 4LFHD 3S8WA 3GNML 5E7BA 1HIML 2IFFH 3AREB 4WNQB 4TVSa 1XT5A 1N5YL 1FG2A 4IIQA 5KANI 1YEIL 5DC0A 1RJLA 3ALWA 3E3QE 1JZ4A 4OM0H 4MXWL 2DLFL 5IHBA 1Q9WB 2YD6A 4KI5C 1RUAL 3S88H 1CZ8L 2WBJD 3FHAA 4L8DB 1E6OH 4I3SH 4HLZH 1NAMB 4UDTA 4HX1A 2CDFA 3OKEB 4OT1L 3OBAA 3LD8C 1QBAA 1DQMH 3V5KB 4TSAL 3EJZC 4PJFF 5DD1L 3BQUC 2EYTA 2VDQH 3MA7B 4B50A 3O9WC 1L7IL 4YR6B 3LS5H 5FCSH 3HNVL 3RWEB 2FX9H 5ESQB 5DUBA 4BUGA 3V6OC 1VENA 3BP7A 5J6GB 3QDAA 4ZPTA 1R24A 1JN6B 3VXTB 5E08L 5JTWA 5F1IA 4P4KC 3T2NH 4EVNA 4R2GD 2DI7A 2AXHA 2BRQA 5HHOD 4D3CH 4QHLB 1EO7A 1S8DB 3X11B 5T3XL 3GNMH 3GHBL 3VMPA 4QOKE 2BCKA 4FG6D 2WM0A 4D0DB 5BV7H 4XCNA 1L6ZA 4UAOB 2EDLA 3HUJE 5CEYA 3BH9B 3MOBH 2EDNA 4IEFB 2EH7H 4MA3A 2QLVB 3BW9A 4MWFA 1TITA 3GDBA 5JXEA 3ZHDA 3C6SB 4Y4KB 2CDEA 5DWUH 4QRSA 3QA3B 4M43L 1SY6A 4JDVB 4PRHB 2X44D 3DGGB 3TN0B 4I18A 3CC5A 3ESUF 4J1UA 3LEYH 4OLUL 4XP9L 2Q3ZA 2ZCLL 3NH7L 1AFVH 1KCVH 1SHMA 3TO2B 5L2JB 3MBEA 1S7TA 5FO8B 3BJ91 1KACB 3U46B 3CX5J 5C7XL 2NLJB 4NZRH 5C0GB 4MQ7A 4CVXA 4Y19B 4GO6B 4PB0L 2DF3A 3O2DL 1RFDL 4JM2F 5DURD 1K6QL 2FIKB 2Q8BL 2A1WH 3QXAB 1OGAE 4HH9A 2FWOB 5I15H 1JZ5A 5DMIL 5I16B 1LE9A 4U1IB 4BH7B 3WKML 3JWOH 3L7FA 3WS3A 3CU7A 1FC1A 3AU1B 3MV9B 3QO0B 1B2WL 3H42H 1XCQA 2PYFA 5JQ6H 2VZUA 2Z35A 5IB2B 2ZG3A 2XKNA 5FYJE 4Z5RB 4OCLC 3GMLB 4K71B 2A77H 1ERNA 4HWBL 1S78C 3EYQC 5IWLC 3DURB 4XI5D 2V9QA 3FO9A 2GY5A 3I02A 1IC5L 5FHAL 3KPRB 2EDKA 4QWWD 1TENA 2EIEA 4D9RE 3CXHK 2FGWH 5D70L 4JZOA 4PJDA 3ROLB 1I7RB 4HG4J 4HUVB 1KLFA 5SWQA 5F3HB 3I02B 5DEGA 3G6AB 4L4TD 5ACMA 3RGVC 2VDRH 4F37F 3EFDH 4ZNEE 4Z5RA 2H2PC 3MRGB 1KJMB 4GS7C 2FGZA 2XN9E 1BQHA 1IC7L 4LLWB 4JQXC 3MLTB 4MX7B 1EXUB 1KIPB 4KKLD 4N9OB 4P59L 3TBYB 1LO4H 3Q1SL 4XPHL 4YDJB 3OJDB 5HHME 3RWGA 5C08A 4ZS7L 1MI5D 1SVZA 5I1IL 1INQA 4LIQE 2ESVA 4KTDH 4L9LC 3JV0A 3QZWG 3ARGB 1A9EA 4NKMA 5I16A 2XKUA 2ARJB 4WWKC 5E94B 1CXLA 5FDYA 5FOBA 3VG9C 4PLJD 1TQCC 5GSRA 3QXAA 4UILL 2IPUK 1VPOH 4QRPA 1ZMYA 3NCJL 3AMLA 3NACL 3BMVA 3O3UN 3TA3B 4U31A 4F33B 2AQ1A 4WU5B 2NY7H 3BZ4A 4F7CA 1OP3H 4NN7B 1PQZA 2BHYA 4LGPB 5EU4B 5EIIB 4N5EC 4IHOB 4KHXH 3MRPA 2B4CC 4KRPB 4WU7B 1J7VR 2BVQB 3PWVB 3VI3F 4M48H 3OB0H 4GKSA 1CXHA 1TJHL 2ZG1A 3G5VA 1NFIB 2IH1B 4MWFB 1LO5A 5D9SA 4HWNA 3OAZK 1ZA3A 5D7KD 3T0BA 3RVWC 1CGSH 4GG6F 4GQPH 1HHKA 2X2YA 1LP9E 1BF2A 1Z3GL 2W9EH 4Y5XA 5FCUL 1GL4B 4Y2DD 1WZ1H 1SJHA 3LCYA 5F9JA 2AXJA 4OB5L 3SDXB 2VAAA 1MFAH 1HSBA 1M1SA 5ICXA 4XI5C 1U3HB 5C92A 1BIIB 3GSNA 5T1LD 2HKHL 1DVFC 4HK3J 3C09B 4G8FB 4S1RL 1IAOA 4QWWC 1P4LB 2HMID 4AEEA 3EJZD 4F15C 2EDWA 3T3ME 3FQXB 4NQCD 4BELD 5LXGL 2YXMA 5DMJB 3C6LA 1Q0XL 1VADB 2I9TA 3LV3A 5C3LD 1QBMH 3ARFB 3KDMA 5DMKA 4L3AA 4RGOL 3JV4A 1EO8L 4NQDB 3RY4A 1XIWC 1LO3H 4LIQH 4PY8I 1KJ3H 4RNRB 1SYVA 4CU7A 3ZL4L 4R4BA 4ZO9A 1PKOA 1LK3L 1KNOB 5ICYB 2XZAH 1JNJA 2R2EB 2FCBA 1KXVC 3MGOB 2B4CL 1IGFH 2EKSB 3LQMA 4OLYL 1T4KA 3OR6B 4NJ9L 3MLYH 1WCQA 3A67L 2QADD 3QDJD 4P2RA 3WNNA 1UM4L 1ZTXL 3IDGA 1XFPA 4IRZL 3RVUD 4AL8L 3OHXA 1T66D 5CJXC 2XZQH 4HWEH 2ZCHH 3ARPA 4B7LA 3DX8B 4UNUA 2ED7A 1M7DA 2NXYD 5IMOB 3VD4A 1EHLL 1CFTA 2R29L 32C2B 5L6YH 4ZNCD 4JFZL 3DROB 4YHLH 1E4KA 4NNPL 3BRDA 1KB9J 3K4AA 4JO4H 4P57A 4U1GC 4DGVL 1AP2B 3TNMB 1ITBB 4KGJA 1C12B 4RFNC 1MCPH 5GGSY 5FGSA 2AI0H 4O02L 4LCWE 1U8HB 1ZSDA 3DX7B 4JFDE 3MLZL 2ZKHH 4P3CL 3SGJA 1I9EA 3WNLA 4DFHA 1OOAA 5FA3A 2BC4B 4MJ6A 3T0EC 3CVHB 2XQYG 2VLJB 1FFPA 1LQSR 1CR9L 4PJEA 3MLRL 5HGDA 5T3ZL 3H9ZA 1WLHA 4MA7L 3WDHA 3EYUH 5CGTA 4NM8H 1Y6NR 5E4EC 1IAMA 1DTUA 4YX2L 1Z3GH 5KJRL 3VXUE 1IC4H 4PTUB 1E4WL 4LCWB 3CMGA 4TULL 3MRKA 4NP4H 1GGUA 1J8HD 2KUTA 4GRWB 2FD6H 5DK3A 2EO9A 4FN0A 5TPWL 2XA8L 3QT2A 1CBVH 1MHCB 5ENWB 2GCYB 2Y7QA 1BAFL 3O6FB 5TGBB 3LD8B 4IM8A 5IUSA 2A6KA 2D4DA 4K9EH 3HMXL 4RBPK 3PGDA 2N56A 5IB3A 2YEZA 3LPWA 5BS0D 4MAUL 3TBSA 4PREB 1R3IL 1A6UH 1ZLVH 4P2RE 3TEUA 1ZVHA 5GQBA 4IRSD 2E27H 3IFNH 3HMXH 3QG7L 4XGZB 4PD4J 2MCG1 5HYFA 1HYSC 3TYGL 5FO7A 2I9LB 5IV2B 2H9GB 4KDVA 4FTVA 4WCYL 4NO0B 2HMIC 1R3KA 1AO7B 4F58H 3P11L 1EBPA 1ED3B 1B4RA 2XWTB 3CVHH 4PJ9A 2NW2B 2ORBL 2OTUA 2ESVE 4NP4L 1NDGB 5CJ5A 1D6VH 1TJGH 3LKNB 3FQNA 2YD1A 3X14B 1ZLWK 2DYPA 4YHOL 3VFRB 3RNKA 3BUTA 5JR1H 5IROC 5F6IC 4C56B 3VXSB 4XVTL 4ZQKA 3FB5B 4EI5A 5HGAB 5KW9H 1O0VA 1GOFA 3C2AH 5INDB 1G7JB 1ZGLB 5B8CA 3O8XB 5BMFH 4FQIH 3Q0HA 4YUEL 1R3LA 1EJOL 3DSFH 2OZ4A 4TVPH 3MO1B 4UB0L 4RFOL 5E56A 1YYLH 3V5HB 2DJSA 2JJVA 3KLAA 2WBJB 4HJGA 5AYQA 5HGBB 4GKNA 4Q6IB 4JM2D 2V5YA 2VIRB 2VB5A 3JTTB 2DM7A 3OKOA 3IU3A 5DO2D 1QSFA 2PYEA 4ONGH 5DK2B 1U8JB 4NM4L 2XPGB 2IH3A 3QCTH 3W9EA 4XBEH 3H7BA 3VFNB 5FKAA 3DRTB 4WO4D 5EFIA 3WFCH 1J1OL 4GAYA 3VXRE 3WEXB 4HSQA 1OAKH 1W72L 2VE6A 4D94A 3QUMH 3OAYH 1OT2A 5FYKD 3TIEA 5E2TH 2DLIA 2XV6B 4U6XA 1QKZL 4I9WD 4ZUTB 3MOAH 4JFEB 4OLWH 5DRWB 3S5LB 1QACA 4OD1L 1NCWL 2DBLL 1NEZG 3ALPA 4GXVH 4JCMA 3RI5K 3TBWA 3UO1L 5JIIA 3OKNB 1CT8A 3ARYA 3RVTD 4Z7UE 1A4JA 4WUUD 1NCBL 4PRPD 3BKCL 5GGUB 5T3XE 4KGLA 2O5XH 3EO0B 4KVCL 4OLZH 4F37K 4Y5YB 2DM3A 4KPHL 1CK0H 4ODTL 2F53D 4MD4B 1MCRA 2IAMB 4LAQL 3BEWA 1FJ1B 1BQSA 7CGTA 4LSDA 4E41E 4LLYB 3D85A 2E7HA 5IB5B 4LK4A 4TOYL 1FZJB 3CDYA 4V1DD 1Q94A 3ME0A 1JV5B 5A2IH 2OJEA 3QR2A 4MLSA 1A3RH 1WZLA 4C58B 4PRPB 5HVHC 1XF5B 3LOWA 3QWRA 2P7TA 4LOUC 1RJYA 2DQGH 5C07A 2YA0A 3TT1L 1WFNA 5DRZB 1IGCL 2I07B 5IW1B 1JGUH 3ULUH 3BEVA 4ZO7A 2BRRL 1BVZA 2DJ4A 3MXVL 2VDQL 2Y9RT 3QULA 1UKQA 1MH5A 4QRRB 4Z7WB 1FQ9C 3OPZH 4EI6B 1IAII 1UADC 1QR1A 1F6AB 1FL5A 2WWKT 5CILH 1U8IB 1W0YT 3GZKA 4MVBC 4HPYH 4PLOB 5C0DB 3SKOB 3MV7D 5TE7L 1PZUB 4W4OC 2PTTA 1XH3A 4NCC2 2IALB 3MFFA 1I1FA 5HHPB 1DQDL 1X5AA 3IRZA 5CWSB 3ZE1E 4PLKC 3ARBB 1JZ8A 1G6RB 2FECL 1DQLL 3MJ7B 1K4DA 1DFBL 2P5WB 4XP4L 2NXYC 4BZ2L 5IP4A 1G1CA 2EE9A 3UJIL 2B2XH 4PJBA 3L3KA 3MBED 4RMWA 5IEKA 3TJEH 5I1EL 4K8RD 4LSTH 1HH9A 3ZKMD 3ZTNH 1YEDB 3QJHA 1KENL 3D1MC 5E6ID 1EBAA 2CKNA 5T1KB 3UZVB 2BOCB 3HC4H 1OSZA 2QBWA 3QQ4B 1N6QH 2GAZA 4NZRL 3W0WA 4D0BA 2EIDA 2ATKA 2B2XL 4MMXC 2R1XA 4NQSB 1NBQA 4X5XA 1BD2B 3RPIA 3GJEB 3E3QC 3KPTA 5I19H 2QKIB 1NDMB 5J13C 3LSOA 4HKXA 3MXWH 2CGRH 5E99L 1OB1A 5C0RH 1MCOH 3SKJH 1CD0A 2L7UA 4XPHH 5F7KC 1A6AA 1FZOB 1FCCA 4MXQC 3IDIB 5CJQL 5F7EL 3MOBL 5L2KB 1A1MA 5DZOA 4XCYA 3IDXL 2OJZL 3QCUH 4BKLB 3IFPB 1KN2H 1U41A 3ULSB 1MFBL 5FYKE 1QLEL 2XRAH 2A1WL 3G04A 4U1JA 1I1YA 3DX9B 2CKBB 4S1SL 1LEIA 4X4ME 5JOPD 1JUFA 3MCKB 1DQDH 5IHZB 1LP9A 1Q9KB 3QIBC 4PJ7F 3RNQA 4HS6B 25C8H 2QHRL 1JWUA 1HHIB 2NTSP 3PV7A 4IMKC 3S4SG 3PDDA 4KQ4H 4PB0H 4AYFA 4RDQF 5DD5L 3R8BB 4YBLC 1YNLL 2NXZC 4NQVB 4QYOB 3HE6D 1G0DA 3GSOB 3EDFA 2EH7L 3HPLA 2YSSB 1JNLL 1LEGB 5HDLA 5IK3B 4MA1C 1X5HA 3V9FA 2HA1A 3O3BB 3O4OC 4K7PL 4X7DC 2WWKO 4XP6H 3TT3L 4YC2C 4X6EB 1RMFH 4LP4A 4YQXL 4P46B 2JJSC 4MZ2A 5ADPL 1FL6B 4JZJB 1A3RL 1S7WA 1UC6A 5BRZA 5LGJA 1SYSA 5BW7A 3H0TA 2D0FA 1H15B 5EUKA 1A7QH 4GLRI 4K3DL 1GIGL 4DWHA 1PLGH 4OCXH 5I1JH 3ECBA 2VWEC 1Y18B 1S9WA 3MXVH 4XTRD 5DJCA 5GRJH 4MCZA 4DW2H 1RHHA 3GI9H 4JDZB 5D7LD 1LO0L 5JLZA 1BECA 2GSGA 3PL6B 4QXUH 4W70A 4YIQB 2AQ2A 5BVPH 2NY6B 5CCKL 3VDAA 1PSKL 4PLKD 3ARGD 1HHGA 2IGFH 2Y5TA 5EWIH 5BO1H 3MNVB 4L4VA 3F6LA 5IHUH 3KXFD 3ETBF 4LSRH 4YAQA 4NBXB 2F53E 5EU6D 2B1AL 1G9NC 1NFDE 5DVLA 3LAFA 4TNWK 5B38G 1N5AB 5BVJB 2OR8A 3EOAA 4RGMC 4BUHA 4JFQB 4FZEH 1MVFA 1EA9C 5I1EH 3HC3H 3JBG7 3EYFB 4JM4H 3RWIB 4KZEL 1IJ9A 2D7QA 4HGMA 3DO7A 1XGQB 4FQCH 2DBJA 2DDQL 3TVMD 1MELA 4I5BB 4UT7L 4CNIA 4X6CA 4HIEB 3VFUA 1F3JA 1FNGA 4LU5L 3QQNA 1JNHA 4KC3B 4JO3L 1F6LL 3MRRB 4LLVA 4PY7B 5FYLE 3VXME 2CXGA 3L3IB 5D2NE 3SGDH 3U0TA 2VUYA 3X3GH 3C5ZA 3VXMB 1WAAF 4ZUSB 3QAZC 1QG3A 2BY1A 2VLRE 2VLMD 3HFML 1CFVL 3RJQB 4MNGA 3OTTA 1UA6H 4NKOA 4QOKA 3S35X 1CE6B 3NIDF 4X5WA 3LRSB 4I0PA 4B53A 4Y5YC 3HG1A 4QXWA 2H1PL 2R2BA 4JVWA 1OD7A 1VHPA 4WHTA 4HJJH 2R69H 4YDVA 1A5FL 5A16A 4F7PA 5IMKB 3B2UD 3D25A 3TCXA 4ETQA 1I1CA 4PFEA 4PRAA 4QCIA 2NX5A 1F2QA 3W11D 4DKEL 3O41A 3ARDD 4OM1H 4YE4L 4L1HA 1AH1A 1XF4B 3M8OH 4WGWB 4KRPD 3N85H 1NFDA 4ZMAT 4RFOH 3ILQD 1UM6L 1DQQA 2Y06L 4HG4K 1DBAL 4OUUA 3S5LG 2LTQB 3BAEL 4MNQE 4QHMA 4R7DA 5IB1B 3T4AA 4LSSL 3QXWA 5IJVB 5IT2H 5C8JA 3SE9L 3ILPB 3E8UL 2YD5A 4JRWA 5C0JA 4HC1L 2DQTH 3FJTA 4B7IA 4IMLA 3D69A 4NDMA 3L9RB 4F8TA 3OSKA 3WO4C 1V3LA 1PBYA 3E6HA 4OD2A 1PW3A 1BEYL 5I8CB 2YUXA 1ZT4A 43C9A 5AG8A 4DN4L 5I30L 1IGJA 2PCPB 2G2RA 1JFQL 4Y1AA 1I7UA 3HI1B 1YEHH 5ESAB 1RUQH 4PJBF 5E4IA 3U36B 5L2KD 4HJ0D 1FE8L 3FFDB 5FK9A 3BGFC 1KJ2B 4EIZC 4KRNA 2E9IA 4WVRA 4KTEL 5EUOF 2UZXB 4MJ5B 7FABH 2FZ3A 1I8KA 1GC1H 4PV9A 2HT4D 2AGJH 2P48B 4NZDA 3RA7H 3MJ9H 3VFOB 5AAWA 1YMMD 4YWGH 2C3GA 3VCLB 2CR3A 1HN1A 2BRRH 1HQRA 4U1GB 4WI8A 4L3EB 5BZDA 5CJ8A 3UPCA 2AEPL 5F89B 1S7SA 4Y4KD 4XNXL 3ZL4H 3OAUH 1MWAH 3IKKA 2B4CH 4PRNB 4DFIA 3BXNA 3RTQA 4I18C 2PR4L 1YECL 1BFVH 2BJMH 5GGTL 3C87A 3SE3A 1GZPB 2HTLD 5LXGH 3O2VL 1LD9A 2GT9B 5SWZA 1G7PB 4QHUB 3WIHL 3MLZH 4P3CH 1OAKL 1W72H 3RIFK 2X4SA 5DS8B 4RGOH 3UTSA 2FDBP 2EDFA 3O6FC 5MEOB 3D3VA 3R0MA 2EDTA 2H41A 4P2OC 4FXLA 3WNOA 4OCRH 4KK5C 1GJIA 4M8QB 4MAYC 1U93A 4PG9B 3S35H 1E27B 1U8NB 4P23D 5DI8B 2J8UA 2DQJH 2VISB 3AXLA 4XBGB 4WI2A 2PW1A 4ORGB 3SDDC 4LKCB 3K3QA 4GMTL 5DFVC 1TTUA 1JGDA 4XNMA 3IXTA 4CU6A 1TCRA 1WF5A 5HHQB 3ESVF 3OKMB 4HCRA 4OFYD 2IBZY 5D7JD 5L8JB 1DQJA 1CFNB 1FSKB 4ZFOL 4BYHA 1RUQL 3OR7A 3HG1D 4QXGL 3T0XA 1M6OA 2OSLA 2Q76A 1T7ZA 4PJ9D 4K3JH 3LH2L 4CVWA 4MNQD 3S4SB 4LHUB 1R3JB 2AI0L 3L3HB 1MFCH 4WUUB 5KVGH 3ELAT 5C0CA 1J05A 4JR9H 4L4JA 4LRNL 3WNPA 2R0KH 1ETZA 3O2VH 2CUIA 5AUMB 4XB8A 3H9SB 4MNHB 4UDUB 2QHRH 4WFHE 2JB5L 5IIEA 3QUZA 3NZ8B 1G7IB 2JK5B 1OAYH 2Q20A 3GMRB 2R15A 1UZ8B 4QRPD 5MERA 2EDDA 4OZIF 3HA0A 5D7KE 5SWZE 3OJ2C 4JKLA 4XCEA 1MLBA 4TSCL 4NN7C 2EIBA 4XPBH 1Q38A 3G08A 4NYLA 5L7XH 3CZFB 5EOTB 4PYGA 2HT3C 5JMRA 4CGTA 1ZT1A 4WI9A 1WTGT 1YJDH 3OKYA 4H1LB 5J56B 1KTLA 5CBEB 1JZ6A 4X7SL 5C0EA 4OZIE 3MPCA 3AVEA 4R97C 3SKJL 4H25A 4PP1C 5HDQL 1GPOH 4PLJC 1CLOH 2ADJB 4R3SA 1OARL 5J1AB 4ZTPL 3PL6C 1IM9B 4KHTL 5AYUL 2AQ3A 2Z31B 3TPUA 4NUGL 4HS8H 2EYSB 4LMQE 4J6RH 5J89A 1XMWA 4QHKI 3B2VH 2CLZA 4DZBB 3VXRB 1CDCA 4GH7B 5IM7A 4M3KB 3I9GH 4ZDHB 4DKDC 1P2CA 2FNBA 2QTEA 4EUPA 4MAYD 3HMWH 2P8PA 3JTSA 1FBIL 4XXDB 1RHFA 2PXYC 4HWBH 1U9KA 2AJXL 4Z7OF 2R1WA 1HI6A 5IQ9B 1MF2H 2IWGA 2KBGA 2EIZB 3GSXA 3C5ZD 4UNTA 4DVRL 3BVNB 3CUPB 4XNUH 1G7HA 3IFLH 1KCSL 4LCIL 1QO3B 4OZFG 3FCTB 1NCCL 4PRIA 3TPKA 2V7NA 1BX2B 4NNYB 1DDHB 1XGTB 2PXYA 3G5ZB 2QQNL 5IG7B 2PYEE 1T3FA 3DTXA 3T0WA 2ILLA 2P44B 3VXOA 5JNYA 1IEBB 1WCBB 1NL0H 5I1KH 1OGAB 4F7TA 4RISL 4L8SA 5LWYL 4LLUA 1FNEB 5D1XA 3PQYE 3QFJD 4PLNC 1UG9A 1DN0A 4WWKB 4YHML 4R97B 3AFLA 1U58B 4O00A 5DJZB 4FQXB 4Z78B 1U8QB 4XMLL 1NMAL 4MZ3A 3T77B 1A4KA 1T1ZA 4G7YH 1I8MB 5EB9A 4JZNA 4GQ9L 4M4PA 3IXAB 3ZHKA 4MDJB 2A6DB 4NWTH 1J1XH 3WFHA 4PIRF 5EWIL 1D5BB 1KTRL 3DHMA 4P3DA 5ETUB 1A7QL 3FTGB 4K8RH 3OXSA 4LEXL 5D7SH 5EOCL 1AXSB 1UENA 1VGEH 5AZEH 5HJ3B 4J8RA 3ARFD 4OLZL 3L3DA 1QZ1A 4I1NB 4OIIL 4U05A 4FQLL 3STLA 3UTSE 5HDQH 5BVPL 4OQ1A 1YDPA 1A2YA 2R0WL 4YFDB 3GK8H 1D5XA 4N1CA 1KYOK 3D0VB 3QG6A 1NBZA 3RGVA 1MJJA 4QRUA 4HBCL 2AVGA 3T2NL 2AV1A 1CCZA 2CR6A 1C1EL 3L6FA 1EEYA 3ULVC 1DSFL 3VGDA 1V7NL 1Q9OA 4JFPB 4PJBE 3RUGF 3MLWH 4NRZB 4G6MH 1RVFH 1AI1H 1F58L 3VFMA 1K8DA 4FQ2H 1YUHA 5ACZA 1DL7H 3KYOA 2R23B 3QUYB 4WGVB 4X8JA 4U2ZA 1NMBL 3SDDB 2AKRA 1XF3B 2VXUH 5IMMA 1RVFL 1TZHB 3LQZB 4EKXA 1FPTH 4D9RD 4ZOBA 1R5IB 3V4UL 4JG1L 1E4XL 2V2TB 2KH2B 3EHBD 1JK8B 2APTA 4KUZH 3VGBA 1ZGLP 4Q2ZB 2HFTA 2PXYD 2VZ1A 3WKMH 5EORL 4I0KA 3O9WB 3P3YA 5DEFB 3VD5A 4FXKA 2EEBA 3WN5A 3H7LA 5BXFA 1DFBH 5DFVD 2X4OB 5EU6B 1T1XA 5AZ2H 1KULA 5ADPH 3NFPB 5E2JA 4N8VB 3GMQA 2AJUH 2W9DL 4PBVC 2Q8BH 2A38A 5J11C 1ONQA 2BVPA 5I1CH 1I3GH 2HVJB 4GQ9H 5GS1A 4LLQB 1FFNB 1KB5L 3RWFB 3JUZA 5HI5D 5KSAB 1EGJA 3OKDA 2VLLA 4X98A 4LVHC 2NMSA 1BGXL 3RTQC 2QR0B 4I48A 2FL5A 3WFEH 3TFKC 3H9HB 2F15A 4Z8FL 2G5BB 2IG2H 1KB5A 1F58H 3T2PA 3S96A 4MDIB 3PJSA 3QISA 3LKSB 1TETL 4GRMA 1HILB 4ELME 3MSPA 3SJVA 4PJXA 1RURH 2AV7B 4PGBA 4QT5A 4ZFGL 2AJYH 2I26N 1YQ2A 4PJIA 1QSFE 3QUMA 3CLFH 3I75B 4YHIA 5LAXA 12E8H 3N9GL 4MS8D 2Q3AA 5JW5A 3SKMA 4NSKA 4TVPL 5ANMA 5TE4L 1VA9A 4G8GA 4HWZB 1P7HL 3HKFA 3WDIA 3EAKA 3P9MB 1IC1A 2ZNWA 2SEBB 1TVDA 3ZYZA 3KJ4C 4TRPL 5D6DC 2WZPD 4LPTA 4GJTB 3NCBB 4Z0XB 3ZSTA 1CDBA 2QQLL 4JO1H 2LU3A 5KW9L 1YYMH 5E8OB 5A3IC 5J1TC 4NFDA 1OTUD 1QP1A 1KCKA 4ZYKB 2VN7A 4HXBL 4OGXH 3QIWA 3QWRD 1OHQA 1QLRB 1QNZH 5D7LB 3V0VB 4TTGA 4M7JL 1FIGH 1UWGH 2Q6WA 3LS5L 1FVDB 5KSVA 3P4OA 3O4LB 1D5IH 1KUMA 2EEAA 1T0NB 1SJVA 2EH8H 3KPLB 5I8KH 4X6DF 2UYLA 4HKJA 4X7EC 3DUUA 1RZKH 3EHBC 5JXED 5GJTL 3PNWB 3OG4B 4PBWD 2D7PA 3DMMC 1A6WH 4U6VL 3RX7A 3VW3L 5JW3H 1MHHB 3QG7H 5EO9A 1YEIH 3PWJB 1GGTA 4O51A 3MBXL 1NJ9B 3JWOC 2J8HA 4J4PD 3FQWB 4WEMB 2XXMB 3BD5A 2PETA 3HRZB 4KVCH 3VXUD 4HWEL 3QXDA 3MRDA 3QNXA 4XMKL 4YHZH 1AXIB 4LCCA 2KL6A 3CNKA 3F7VB 4L8SC 5B39B 4H5SB 1R5WB 5C9JB 5CSZB 4OGXL 3B9KC 3PWPE 4NO0D 1MRCH 3O4LD 2B0SH 4KKCD 5FB8B 4NM8L 4Z0BH 1S7RB 4OSUH 4FXGA 3VXQB 1PD6A 1PG7W 1G84A 1FGVH 1OGAD 5ANME 2J6EA 2MFNA 1D9KC 4AMKL 4IMKA 4PJFE 1EV2E 3PV6B 1CI5A 1NGZB 3RDTA 1J1OH 1ZEAH 2MKWA 1S3KL 5FKPB 1FSKC 1JPGA 3DECA 3HG1E 2AK4E 1QEWB 2PNDA 4OF0A 5KOMC 3HC0B 1I1AA 5DLMH 3I50L 3FO1A 3ZDYF 3QDMB 4JO2H 3FT4A 2CK2A 2ERJC 2UWEB 1CL7I 3KS0J 1YEHL 1CDGA 2HKHH 3EIFA 4JDTL 3NPSC 1ES0A 4WTZA 1G7MB 2HFFB 3MUHL 5T1LA 3M17B 4LPCA 2X4QA 5E0QA 5BJTB 2P24A 5SX4H 3FAWA 3QBTB 2ADIB 4JR9L 3KHOA 5MHSD 4TSBH 3NA9H 3RWJB 3FRPA 4F9LA 2XZQL 2DLFH 4CU8A 1K9TA 4HF5L 4NRYB 5ISZE 5E03A 3FQTA 3IETB 3MV11 1GC1L 3IYLW 5IESL 3QCVH 4X6CF 5IR1B 1JPFB 4BK4A 4KJQD 1P7QB 1IAIL 3RGHA 3WS6C 4Y4HA 4XPBL 3MREB 4ZPVB 2ZG2A 1OGTB 1B3JA 3MZGB 1MRDL 1BBDL 1CGWA 5GS0C 3FRPG 1T7WA 3FN9A 1GVIA 3BDBA 3CH1A 3CSYA 1KG0B 3P11H 3MNZA 4NFCA 3CXDH 4EBQH 4GG6A 4P2CG 4U33A 1MEXL 1WITA 2NNAB 2VDKL 4G5ZH 5C70A 4D0CB 1QD0A 5D8JH 5F3BA 1GPOL 4GS7B 4U1NA 3S35L 4WV1A 3V7MA 2ATPB 4XPTH 2OL3A 4XVJH 3FO2B 3RIFF 2WUCH 1KCRL 3GMPA 3KWWA 2VDKH 1Z9MA 3CDCA 4UOJA 5KJRH 3ULVF 5MI0B 2X1OA 3SHSA 1NEZB 4YUEH 3QUXB 4NIKB 3P9MA 2IANE 4UIKH 2ESVD 3P30H 1AD9B 3TO4B 4ZUVA 3MUY1 3SY0A 5I17B 5DJ2B 4NO5A 3JZ7A 1UQSB 2VLKB 2GTZB 4R0LC 2B7DT 3DARA 3MGTA 4RFNB 3ARDA 4JHZA 1VFBA 3BD4A 4PJXB 1I9RH 1F4YH 4PB9H 3MLRH 5T3ZH 4G7VH 4XCCH 3WKNA 5HYSG 1RJCA 3KYNA 2MKLC 2GJJA 2FRGP 4BJLA 4HK0B 4OCNC 1P5VA 1K4CA 3FFCD 4XRCB 1DBMH 2D7TL 4PTTB 4GG8A 4FFVC 4CUCA 4OV5B 5EIQA 4U1MB 2GSIA 1YQVL 4ODVH 3PIQA 1BOYA 1T0MA 4Z7UF 2BVPB 1EEZB 4G6ML 1HSAA 1U8LA 1DBML 3EO9L 4IRSA 5F44A 3PUCA 1RK1B 1S3KH 3KXFA 5FUOH 2UV3A 4DKAA 4WV1C 1I4FA 4N8PA 2F19L 3T0VA 3MODL 5HYEA 5DGRA 2E6PA 1V05A 3GM8A 3QDJA 4P2RD 2BFVH 1QVOA 3TH4T 5DRXB 2BHUA 3ULUD 4WI3A 4YNYB 4JLRB 4HXAH 3BT2L 2ZUTA 4KKAC 2VDLL 3HZMB 1XGUA 1TQCB 4NQED 2V2TA 3SBWC 3TA3D 1HOCB 1CG9A 4XTRC 3ARGC 4BK5A 2R0LH 1A22B 3SDDA 2GUOA 3FB7B 2IEPA 5IFJA 3F5WB 2Y5EA 3CLEH 5GRJL 3VJ6B 1F42A 2A74B 2R1YB 4WTXA 4NQCA 1LEKB 3TIDB 5JXAL 3DIFA 4UTBH 3KVQA 1E4XI 1JF1B 3UEZA 2NY0B 3OGCB 5DO2C 3MFGB 3OJVC 3U48A 4ELMA 5I1LA 4FNLL 4JY6A 2FATL 2GJ6E 1AE6H 5GRUL 3P4LA 1H8SA 1MUJB 1JBJA 3VXPB 4FQQA 1MJJB 3UX9B 3QO1B 4E5XB 5FDWB 3I9GL 4Y16D 3AAZB 1TJIH 1H0DB 4K3DH 3VWKB 2BOBB 4M7LT 4L5FH 4IS6A 1K2DA 3HUJA 3STBA 4J3SA 5C0AB 4RMSA 1UYWH 5ELIA 5K9QI 3B9VA 1HKFA 1F97A 2O61B 4KHTH 5AYUH 3WXVL 5JOFB 4RGMB 1RK0B 4HDIA 2X4NB 1VACA 3N9GH 5TFSH 1BJ1J 1YPZF 3PWPB 4GUPA 5B38A 4M9PA 3U6RB 2PO6A 4PRHE 4NUJB 5IQ7H 3IXAA 1U92A 2IPKB 4G80B 1URLA 1MHPH 4DQOL 4EZMA 4OGAD 2X1XR 4UT6H 3HUJB 4G42A 2HN7B 5CD3B 5CZXC 4U6YB 5DT1L 1L0XA 1J8HB 4LSQL 1X5KA 4K8RL 2H32H 1PZ5A 4JQIL 1MCIA 2OQJA 5C0RL 4LHUG 4FFVD 5DHYA 2C1OB 3VXUB 1RUPL 4HCRL 1F00I 1JI2A 4CMMB 1FYTB 3DTXB 3BPCA 3RKDC 4L4VD 2DKUA 4QNPE 1BLNB 3PGFL 3SGKC 3LRGA 5ID1A 2VKXA 3K2UL 1MFEH 3IDXH 1AE6L 1XZ0A 3DV4A 3QCUL 1YNTA 1AGDA 1JZ2A 3BFOA 5C08D 1KJVB 4JFOA 5B39G 3EJJX 5IBTL 4Y4HC 3OGCA 1JF1A 1LO4L 2YKLL 3Q1SH 5JUEH 3MV8D 5I76B 4JRYB 3LKRA 5EZLB 2YD9A 1SY6H 1LDSA 1GGCL 3V6ZB 4F9PA 5DQJA 5I73B 2JJTC 1M7XA 2WWMC 4IJ3C 2ZP0T 3FFCB 4G8GD 3CFBB 4LKXB 3VGFA 5E6IB 3HS0B 4EUPB 1QUNA 2ADFL 2FJHA 3VFSA 4M8VA 4YNYA 5DMIH 3CFDB 3HC4L 5EZJA 2DB8A 2NY7L 4ZTOH 5EO1B 4GRLB 2C26A 5E95B 4R7NA 4G8EA 5FA4B 3X17A 4POZD 4JHAL 2VN4A 1ORSA 2O5YH 2UY7A 5FECB 1RMFL 2VAJA 2CSPA 3TO4C 3OKLA 1EGJL 1P6AB 4Y5VC 2P4AB 4NN6C 1ZWIA 3VG0H 5D2NB 3IU4H 5FHBH 4ODHH 4P23B 1LDPL 1JGVL 4KK6C 2UWEE 3JVGC 4G6AD 2DWDA 5GS0H 1A64A 4U1KA 4ODWB 4JFHD 1OM3L 3AY4C 3F12B 4NQXB 5CJOL 3TZVA 2PR4H 3T1FB 4AG4H 4PJAB 5J3HC 3DUSA 1KV3A 3WLWD 1NC2B 5MERB 1KEGH 4EUPH 4TUOA 2R2HB 1U91B 1X5LA 3NZ8A 2O5ZH 5BQ7A 4MNHA 4UDUA 4XB7A 4Y4KC 3SOBH 3PHQA 3AY4A 4Z7VF 2A6JB 5HYQB 3PXJA 4P5TA 2NY1B 3EDJA 2Z93A 4ZUVB 5DHVB 3UTTE 5C09B 3U2SA 3GJFB 1KB9K 4YEEA 5D6CA 3KLHC 5L0QC 5CLTA 2R56H 4K23H 4GXUN 4ERSL 4DZ8B 1DVFA 2ZUQB 3CMOH 4HULB 1FYHB 1MEXH 4G5ZL 3SGEI 2FECI 5JO5B 3AMKA 1J10A 5EUOA 5GGVY 1T6VN 4P4KB 4MCYB 4U1NB 3IXTB 2NPLX 3NAAH 3WFCL 4KK9D 1NC4D 5F88B 1QYGH 4UV7L 3NCYP 3BE1L 3TNNB 5DA4A 5ALCH 3T0EA 2XWBA 2K3TA 5EBMB 4MD5A 1F3DJ 3IJYA 2AERT 4PJEF 1WBZA 4AK1A 2YPKA 4PG9A 5IKCA 1U8OB 1S9XB 2Y36H 1OP3K 2BP3A 4WTWA 5KAQF 1TTGA 3UO1H 3BYTA 1P1ZB 3G6JE 2IANB 2KQMA 4V2BA 4MJIA 4MQXD 4BM7A 2VABB 4RMVA 1MSPA 1ZVSB 4ELKB 1KCRH 2XFXA 3QUML 4CMHC 1YEKL 4JPWH 4Y2DB 4W81A 3RWJA 1CD9B 1X4XA 2NY3D 3VD9A 2VWEE 3C8KB 4AQOA 4DKEH 2ADIA 4K3HA 1GC1C 4YHOH 1DUYA 5IBLC 1JMXA 3U4BH 4EN3B 4CAGA 4LVOB 1NSNH 3LN5A 3TO4D 3MNWB 4OFKA 5D7IB 4YZFF 3AC0A 3BKCH 5I6XB 2C3VB 3K80A 3DMMB 5D1QC 2H3NB 1FRGL 1LK2A 4IBLT 5GS3A 1G9NL 3Q6GH 4L8CA 3UBXB 3RDTB 3WHXA 3WIIH 5D2LB 1JRHL 1LO2L 3B8YA 5J6HB 2XTJE 2GK2A 3GKWH 2Q8AL 3RI5F 4YX2H 2RGSA 1IGFL 1BWWA 3OKKB 3FFDA 4PP1D 3L95A 2JCCA 1WBYA 4XNZB 2AJ3B 5E8DL 5K59F 1AIFB 3PWUA 2W0FA 1I1RA 4AEIL 3MRDB 4NN5B 3VXMD 3EOBA 1PKQB 4PGCA 3V8CA 5BOZG 2R4RH 4NFBA 1QKZH 2FYYA 1T1WB 3BO8B 1U3YA 2LV4A 4RMUA 3LN4B 3MLUL 1DLFL 1ITCA 1Z5LA 2J12B 2YMXH 4NDMB 4L3CA 2H2SD 4S0SD 3TH2T 2RFXB 5JHLL 3ILPA 3D39A 3VFTA 5JW4R 2D4FA 5EU5B 2FJGA 1O7VA 4FRWA 5EH1A 5I8KL 1A6VH 3FFCE 1FNHA 2ICCA 2DM4A 3IFOB 4APQA 3MRLA 2E7LA 4XNYH 2Z92B 1A8JH 2BVTA 4P2OB 2H6PA 1OL0A 4UT9H 3QIWB 3VI4E 2C5DC 1A6VL 3LN5B 3DV6A 1BJMA 4EN3A 2ZCKL 4M1GH 1BFOB 4EI5D 4XNYL 1IM9D 1PX3A 4OZHF 4WHTB 1ORQA 1DBAH 4MXVF 3SDAB 4FQIL 2MQ0A 4JN2B 3UJTH 3QEQB 4XX1E 4IRJB 5EPMB 4PJGB 2BERA 3KLDA 2G60L 3BP5A 3PWLA 4HPOH 1P4IL 5ANMB 2L0DA 4JPIB 1NH6A 5I8OL 1X3DA 2AK4A 1X5XA 5IBLD 3FOMA 1UVQA 4XP6L 1WZKA 3CSGA 3QNYA 1LE5A 1IQDB 4U1HB 1D6VL 5HHNA 5KVFL 5FUZH 1QSFD 3K74B 4JRXA 3RDTD 4MNGB 3O3AA 4YFLI 1A6TA 4LDOB 5FO9A 4RX4D 4YO0B 3VXMA 4Y1AE 5FM4A 1WBZB 5BOPA 4WFGE 4OKDA 1A6PA 1A1NB 4MA1B 4PJEE 2A6IA 3T0EB 3MMEB 4PB9L 5F1SA 4OTXH 3REVB 4I13B 2BSTB 1ZHBB 4KTDL 1BBDH 1MCQA 4GW1A 4MCYA 4AY0A 3L5XH 4H88H 4XMPH 3SCMD 5HYJA 1CDJA 1NMCB 4X9BA 3RA7L 3AM8A 3TYFB 1WWCA 4YXLL 5L0QB 3MRCA 2NY5C 3Q3GB 2BVOA 1S7QA 4KKLC 4ZXBA 4HZLB 3I6KA 1SY6L 3DI3B 4P4RA 1N5AA 1N2RB 4IOFD 5F7EH 3IDJB 5KN5A 3ULVL 3QH3A 5DF0A 5IMLB 5K9OA 2LFGA 1F4HA 2MSPA 1DBKH 1OPGH 4P5MB 5T1DL 5JPNA 3R06A 1UJ3B 1KSRA 5DD3H 1EHNA 3QPQC 1YC8A 4F3FB 5BS0A 1I85A 4EJ1C 3EKCA 3NN8A 5DURB 5I1AA 3OZ9L 3HAEB 5DJCB 4Y16B 1NMBH 1NGQL 3BZEA 5DUMH 2AK4B 2VDNH 3GI8L 4J23A 1WZ1L 3BP5B 4OCYH 1AR1D 5E1HB 4PJGA 4AENA 4IRJA 3R1GH 5KZCD 4XP4H 4K55A 1GGBH 2IC2A 1UWXH 3IKCA 3O3BA 5D96C 5MEQB 5CINH 5AG9A 2VR5A 2WLZA 3HPLB 4UTAL 2DQIH 2VDRL 1EX0A 2NY2B 4L4TA 5TE7H 5CGYD 1QQDB 1BBJB 4XXCA 1MCEA 2AXGA 1CD1A 3TLRA 4DKFH 3HCVB 4D2NA 3GGWB 1CIUA 2ZJSL 2VXTL 1WEJL 4JKPH 3GBNH 5EN2B 3L5JA 3CPLA 4PR5B 3QUKA 3U0PA 1C16A 1XF2A 5DVKA 3C08H 1FO0B 4NNXA 3F6IA 4ZAKB 4HJ0C 5F9WC 2X9YA 2YPVH 3MJ8A 5I73C 1I9JH 2CKBA 4OAWB 3C5JA 3KPSB 2VQTA 4HFWB 1NMAH 3U4EA 3OF6A 3UC0L 4EOWL 3O6LL 1AJ7H 1TNMA 1HHHB 2CD0A 4ZD3L 2OK0L 2MOVA 4XCYB 1R5VB 1VERA 4FFWC 2X7LA 3MRQA 3QDGE 2JJTA 4XAWL 1TPXB 4XH2A 3L1OH 4FQXA 1QFOA 4KK8D 3BX7C 3GEWB 2AJ3A 4MS8C 3C9NA 3L5IA 4YHNB 3IGAB 3WIFB 4OB5H 1BLNA 4ODUA 4L5FL 3WJJC 3KPRD 2DQEH 5DSCA </