1TNMA

Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
91
structure length
91
Chain Sequence
RILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN MODULE M5
publication title Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Muscle protein
total genus 11
structure length 91
sequence length 91
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tnmA00
1KV3A 1A7BA 5ICXB 2OP4L 4XPBH 3MRNB 2MQ3A 2NYYD 2J6EH 3HMXA 4ZSOA 3MUHL 2VH5L 1OP5K 1J1XL 4IDLA 3FFDB 1UWGH 1P4LB 3X11A 5JO5B 3D9AH 3PXHA 3V4VH 4JQXC 2I9LA 2YC1A 4Z7OE 4PRIE 5FA3B 1J0ZA 2NTFB 5F3HB 5LG1A 4R0LB 1KENL 1F45A 1RUQH 5LBSH 1GZPB 2GSGA 4I0CC 1INQB 4QRSA 3WO3B 3FQRA 3UPRA 1FZKA 1XGPB 2G5BA 4KQ3L 4MZ3A 4NN6B 4EN3B 1F6AB 4L4VA 4U2YA 2AV1A 5I19L 2V9QA 3VXUB 2YRPA 3G5YB 3RL2B 3DO7B 3W9DA 1I4FB 1HYSD 1NEUA 3LOWA 5JOEA 1I8IB 1U95B 2Q7YB 2DQUH 2NNAA 3FFCE 1WAAE 2Q3AA 3V0VA 1IC7H 4QRPB 3DRQB 3R0MA 2CIKA 1PKOA 5IR1B 4PJ5A 4NWUH 4XNUH 1FRGH 3B5HA 1CDGA 4QXGH 4HUUB 4WV1B 3FQXB 2VZUA 3MYJA 4BQBA 3DTXB 4IOFC 3ZHDA 3PWJB 3VI3E 1CF8L 4B0MM 1KF9B 1EUTA 5IB4A 5MENA 4RGND 5HJ3B 2D0FA 3NAAH 4WEUD 1MNUH 5GRYA 4AZ8A 5I9QB 3GBNH 1WTLA 2R1XA 5D93B 4KV5F 5DVMA 5JQ6H 2UVFA 2D7PA 2Z31B 2XZCH 5HI5D 3QFJA 5B38A 1YN6B 2LAGB 4UQ3B 4APQC 4I0PD 2IF7A 1T03L 1F90H 1T83C 1IM9A 4J8RA 3IDUA 1T80A 4QF1B 3A6BL 5GHWL 4YNYA 4BQ6A 1YEFL 4PLKD 3DGCR 3W0WD 2BNUA 2LU3A 4ZUUB 3PHSA 1JN6A 4XX1G 3IGAB 2JIXB 3SY0B 4Q2ZA 1NBQA 1YZZA 2CR6A 2YBRA 2NY7L 4J6RL 1HWHB 2EIDA 2COQA 4ZTOH 4Z8FH 2BY2A 5EULV 1OM3L 1EAPA 2OQJA 5C08D 1KCSH 2YK1L 4NOBA 3CFIC 4D9RE 3UTTD 1A7QH 1SVCP 4GAGH 1FORH 1NGYA 2FX9L 2FHFA 1FLTX 5K9KA 2VLJE 2CKNA 5CGYC 4LLVB 3MLRL 4IJ3C 2XTJB 4MMXC 1MCHA 4W4OC 4ZNCD 2I9LB 4XVSL 4MAYC 5AYQA 4YHMH 4YDIH 4IHOA 3L1OL 5GS0C 1WV7T 4HT1H 2AJSL 2GY7B 1OTTD 3C60B 1DFBH 2HRLA 2GSGB 1KTLB 1LO3H 4QRSB 1XGTB 3WNLA 1DBJL 4NUJB 4JCMA 3UPRB 4DQOH 2UWEE 3IDYC 5K9OA 1YEIL 3FHAA 1NKRA 4JFQA 3VFPB 3VFMA 3W9DB 5KVFH 1ZHBA 2VXUH 2BNRA 2NNAB 4TSBL 5F1NB 1RIVH 1GCFA 4IRSA 3V0VB 1V7NL 1A4JA 3VXTA 1T21A 2CIKB 4JFOA 2AGJH 4Y4KA 4POYA 4P2YA 4LFHG 2BVPB 5HYJE 2VDLH 3DWTA 3OL2A 4X6CE 3KLAA 4MNQD 4R97C 4LRNH 3ZDYE 3MYJB 2VDNL 2XWJB 3B2UC 2A77H 3RWHB 2RBLA 5GS0L 3MNVB 1XEDA 1CFVH 1Q9LA 3NABH 3D39B 3O6MH 5CS7A 4LHUD 5IMLA 3TPKA 1LILA 5I1AA 1QEWA 5ABDE 3RIAF 4U1GC 5DMGC 4X8JA 1DN0B 3TV3H 2FEEI 3CXDL 4XNZC 2BY1A 3DX9B 3T0WA 3QFJB 2QSCL 1VDGA 1YY9D 2W38A 3VXRE 4QOKE 4CKVX 3LS5H 4J8RB 2UY7A 1A7NL 5HVGB 3EDEA 1T1ZB 4M43L 1AXSA 1U91A 1FVEA 5E24E 3WJJA 4LAQH 1JN6B 3SOBL 2QL1A 1JTPA 1TIUA 5IVZB 4Q2ZB 2FB4L 1CLOL 2HVKB 4NO5B 4X7FC 2EECA 4AG4H 2O5YH 1QG3A 3BEVB 3TGXA 1G7IB 1KLGA 3MBEC 3PE9A 4X6BA 4GW5B 4GXUN 4I0PA 1C16B 4J3TA 5CP3H 2X4TA 5D2NC 3I75A 4DKFL 4QYOA 4QRTB 1HNFA 2CLRA 2FGZA 4PJ8C 3GKZA 2MFNA 1HCFX 25C8L 4H0IA 3OQ3B 4XC3H 1OW0C 1HH6B 3NCYS 5EZJB 2R9HD 4X98A 4PV9B 1S3KL 1EAJA 1CIDA 1NLBH 3BWAB 5C08A 3MGOB 2VXSH 5HHNA 1BEYH 3EOYG 4XPAH 4NQTA 5K9OB 3UTTA 2Z92B 4DGIL 3DX8A 5DZOA 1U3YA 3THML 4LCCC 3BKJH 4U1KA 5B3NA 3VFMB 3MOAH 5IT2H 2XY2A 3TFKC 2WBJA 1PBYA 3PF2A 1A7PL 5HYEA 1FBIL 4CNIA 2EKSB 4PY8J 3VXTB 1T21B 4MA7L 1B3JA 2XI9A 4JFOB 5BOPA 1A6UL 3R4DA 4GKSB 3O2DH 1DL7L 1F00I 2X1XR 4U1LA 4PGEA 1MUJA 5FFLA 3TIEA 5KW9L 4LEXH 1LO0H 1NAKL 3F7VA 3KLAB 4KMLB 3VFSA 3PGCB 3QH3A 1NAML 5IMKB 4YDJA 2ATKA 2B2XL 3VG0H 2D3VA 5TDPB 3UJJL 1GZQA 5E8NA 2AP2A 3MRCA 3OG4B 1JV5A 1FIEA 1U93A 3ULSA 1R0AH 1W72L 5CILH 2EIBA 5IJKA 2A1WL 3VD7A 2G75B 5CJOL 2Q8AH 1C5DA 2OJZH 4YBLB 1PY9A 2IBGA 5IBLC 3HC3L 3ARYA 5M7QA 1RAMA 5INDB 5FYJD 5INCA 4IS6A 1XR8B 1AXSB 1U91B 1FVEB 4LEOB 4JHWL 4LHUA 4NRXA 4RGNB 3MRGB 2F5AL 3IDGB 2K9UA 3OR6B 4P3DA 3GMQB 3NIDE 5GRJH 3BP4B 1CU4H 4PGCA 2K7QA 1Z3GL 2P46B 4J3VA 2GTZA 5GGQL 2FR4A 3CFBA 4KUZH 2XXCB 3U1SL 3KYOA 1AQKL 3QJFB 2DWEA 2DL9A 5JW4R 4RIRB 2A6JA 3QRGH 4KKNA 3VW3H 2WBKA 1KNOA 2CLRB 4JY5L 4M1GH 3W0WB 3N9GH 5IQ7L 3VWJA 5AD0B 3ZTJH 4UTAH 3PP3H 2HKHH 3K4ZA 3U48A 3MFGB 3P77B 1MJJA 3DSFH 3VXQB 3NPZB 2VDOL 4MA3B 5C08B 1KB9J 4OAWA 2PN5A 4FFZH 4MJ5A 5HHNB 5DRNB 4GRMA 1B0RA 4ZS6C 5J1AB 1GGYA 3UTTB 2DTML 3PL6D 1KTRL 4X83A 5D1XD 1U2CA 4HWEH 4FNLH 1DEDA 1EHAA 1KFAL 2FLBT 2IQAA 3PGFH 1O7VA 3N0PB 3U30B 3ARBC 3T04D 5F72S 3V52H 4UZGA 1MIEL 4Y5XA 4GO6B 4OCSH 1IFHH 3O6FD 5I1CH 3MACL 5JHDD 3T3PF 3L3IB 4Q9BA 1OF2B 3T0XA 4R26L 4EUPG 4RFEB 4ETQA 3NCMA 1JPSL 5EZOL 1JV5B 4LU5L 4GW4A 1SEBB 3DMMA 1VFAA 2FWOA 4XNMA 1NCAH 4L3CB 2OK0L 3RVXD 1EMTH 4PFEA 2NZ9C 1P5UA 1RVFL 1DQDH 2GK0B 3RHWK 5ACZB 4ODHL 2CLVA 1C5DB 4F3FA 4ZDHA 1T3FA 5HVHB 5JUEH 5L88H 4JFHD 4MXVE 4NCDA 1PKQA 4LQ1A 3LD8C 1QNZH 4PYGA 2LU4A 3I02A 3TLRA 1QSED 4MNQB 5EIVA 2NW2A 4IS6B 4AJ0A 3D3VE 5KSBE 5DUPL 3U7WH 1HEZB 1WZ1L 1N64L 4WWKD 1DP0A 1F4XL 4U6XA 3LKNB 3MUY1 3RU8L 4AIXA 1EGJH 5JW4Q 1OT1A 3WHE0 1M4KA 3RGVD 4TRPH 1DQJB 4JRYD 2IEPA 5GGVY 1TCMA 3CFBB 4FQIL 4JZJC 1U8IB 2YPLD 1YPZA 2DWEB 1MWAH 3WIHL 4LVNB 3Q3GB 4HC1H 4R96A 4Z95H 1ZA3A 4JO3H 3T77B 3DO3A 3ZDXE 1IGTA 5IOPB 2ZCHL 2PYEB 2I27N 3V2AR 4XHQA 4EDWH 3HE6C 3FT4A 2CGRH 1A64A 1ZWIB 4LLWA 1X5ZA 1MJJB 3I3EA 3MLSL 3P11L 1J0YA 4MAUH 5TPWL 4CL7A 5D96B 3GMNB 4LCWD 4MJ5B 3X12A 4AIZA 4XC1H 2HTKD 1IGIL 1UM4L 2X4SA 1UKSA 5EH1A 3LB6D 1IKFL 1MFAL 2BVYA 4LKCB 3GSNB 3IF1B 4Y4FD 2FNBA 1GOFA 1A2YA 1I9IL 2IQAB 3DXAB 3GSQA 2YZ8A 4CVXA 4F7MA 1YEGL 3GSRA 1RFDH 3GSNH 4Y5XB 2PCPB 4Q6IB 3GI9H 3MX0A 5FOBB 3SCMC 3NACL 3ZKSD 3R06A 4B41A 3NGBB 3A6OA 2BOCA 5D2NE 3GJEA 2WIIB 4LLUA 3VGFA 4LHQB 5DRXB 3W11C 1GGUA 4K8RD 3PL6A 3PWUA 1YMMD 5DJYA 2WM0A 3QQ9C 1N3NA 4YJZL 5D1XA 1A1MA 5D7IE 3TZVB 4U1NB 4O51A 3FO9A 2GJZB 4X5WB 3UZVB 1Q72H 3T0DA 1VFAB 5IHUH 4XNMB 4NNXB 5SWQB 2IALA 1JE6A 4XWOC 2IG2H 3V7AE 1UJTA 5C0NC 3P4NB 4NN7B 4G6AD 2CLVB 4F3FB 3N1PC 1T3FB 3LDBC 4X7TA 4MA1C 1WITA 3O6FA 1RQ5A 1Z9SA 3HNVH 5JHDA 1ZEAH 3SGJC 2MCPL 3I02B 4EQ3A 4OFVA 3LKQA 2NW2B 3BE1L 4LSDA 4LPVA 1KJMA 2DAVA 4U6XB 1Y0LA 3H9HA 4HV8A 2WUCH 3VFTB 1C1EL 2AVGA 2AJXH 5DC9B 2EDYA 4XXCA 3ILPA 3TIDB 1ZANL 4BKLA 3KJ6H 3ZKXC 3T2QA 1AD9A 4YDVB 3BEWA 2AQ1A 4GKOA 5FHBH 1NCTA 1TJHH 3HE7B 3ZE1E 1FG2B 4LP5A 5E2JA 3OV6A 1KT2A 5DURD 3BZFA 2MCG1 1QSEA 3KPPB 4RGMC 4NQXA 1RSFA 2H6PB 1ZA3B 1GIGL 3WKML 2AI0L 1N0LA 4PJ7E 4KJWD 4UDTB 2DICA 3T2NL 5FYJH 4RMQA 3I2CH 3I6GB 3T0EC 4ODVL 1G9MH 1YPZF 3EO9H 3H7BA 2A6IA 3MFFA 2YPLA 3X14A 4AIZB 1RIHL 2X4SB 5CSBA 1HK6A 3DOSA 4HUMB 1IC5H 4I2XB 1UQSA 4X5XB 1JWMA 1MCKA 3RWIA 2R1YB 4CVXB 4F7MB 4JY4B 5C09D 3GSRB 4U6YB 1P84J 2MHAA 5C0AD 4YHLH 5IBTH 4FQQA 1WWWX 5E5RB 4UB0H 4U1JB 3R06B 1DQLL 4Y5YB 3GKWH 1UH4A 3GJEB 4LCWA 1DLHB 5EWIH 3MCKA 4KAQH 1LO4H 4Y5VB 1UXSA 2YA2A 3DJ9A 3LZFH 3MV9D 5DJYB 3S5LB 3R1GL 4OZIB 5D1XB 4WUKH 4Y4FA 1AGFB 1T5WA 1DLFL 1QFHA 4UTBH 3DUSB 2E8ZA 5C6WH 3T4YB 5CGMA 2FZ3A 2VIRB 3O6FB 4Y1AE 4HSQA 3WV0A 5KAQG 4I9WE 4PJIE 4M6OH 2NMSA 3SE8L 4BFIA 1KJMB 1RV6X 3QPXH 1RZFL 2F19H 4HV8B 4HIXL 2V5YA 1G7LB 2DQHL 1AC0A 3KYNA 3ILPB 4BKLB 5T1KB 3U0TA 5I30H 1OTSC 3T1FA 4F57H 2QTEA 3TA3D 3PWPE 3U9UB 4L8SB 3UC0L 4PJBB 1Q38A 3MGTA 2ED9A 2Y07L 1XF2B 3QNYB 3IFLH 3V0WL 4AEIL 4F9LC 3BZFB 1QSEB 4K71B 4NSKA 3WD5H 3MODH 3DETC 4NQXB 5ISZB 5D7SH 4WWKB 1YA5A 1WZKA 2VLLB 5DVNA 1HKLH 4OZ4A 1TLKA 5MEOB 3QNZB 5C7XL 4WW1B 1KPVB 2C4FU 2VDMH 2W60B 3RGVB 3PUCA 4JRYB 1OLZA 1G7JB 2QSTA 4K55A 1T89A 4LPWA 4L9LA 4XHJD 2DQTH 4PJCE 2CH8A 1XF1A 3X14B 4X4XB 4H88H 4NZUL 3MPCA 1IGFH 3V6FB 1PD6A 1XAUA 3OB8A 1RUMH 5D72L 1C5BH 2H3NB 1NANH 2RGSA 3BDBA 3SDXE 3RDTC 3QIBD 1BIHA 4XCCH 3HG1E 4MSWA 4MQXD 15C8H 5FKAB 4BELD 5I1JL 2MHAB 4LGPB 2OR9H 4FQQB 5IQ9B 5H8DA 1ETZB 4U7MA 3SQOH 3RHWF 1ZHLA 3IFOA 1IQDA 5E94B 4OI9A 3BRDA 3FO2B 4HZLB 1O5DT 3FQWB 2HYMA 4YX2L 5TDNB 1D5IH 4P2OA 5EORH 4N0UA 1KPUA 3IDIA 2HLAA 1LHZA 1OAZL 1TZGH 3IU4H 1T66C 3RPIB 2FJHA 2EDNA 2VZVA 4NYLA 5E1AB 1P9MA 1CQYA 1FFPB 3EOTL 2CJUH 4ONGL 5D2LE 5C09A 1TENA 2VITA 2FEEL 2XRAH 5C0AA 1JMZA 3FAWA 3HMXL 2RCSH 3ARFA 1JTTA 3JV6A 4LARL 4Z7VB 3SJVE 2IPUK 3OAZK 3I6LE 5EOTB 3CDGB 3LQAC 1CE1H 4BFIB 5BQ7A 5LQBH 1YMMB 2PW1B 1KB5A 4W70A 1L0YA 1OQOA 2FGWL 4R4NC 4WJ5B 3KYNB 4K8RH 3IETB 4DW2H 4RAUA 4PJFE 4NHCH 4FTVA 4F8TA 4YGAB 3T1FB 5IB2B 2ZCLH 5T1DL 5TE4H 3BQUB 1DQQB 3JWDH 4TYUA 4OZFG 1TJGL 2DLFL 1F4HA 1HI6A 3MNZA 3LIZL 4NM4L 1M71A 1CXIA 4M6MH 4URTB 5MI0B 1X9QA 4WNQB 4QRRD 4OLXL 2DI8A 5CP7A 3ARDA 5J9PB 4H5SB 1QPXA 3E6FA 2HN7A 4OZ4B 3HAEA 3LSOA 5A2KH 1N0XH 2AJZA 1QKZH 3LQAL 1E4XH 1KB9K 4QHNA 1J0KA 5KZCB 2Q3ZA 1FE8L 5JXAH 4XCFH 3UTQB 3PWLB 1R5WA 3EO1A 1MJUL 3BX7C 3UYRL 4XXDA 5FO9B 3LPWA 5HI3C 1KULA 1D5ZA 1HSBA 3GSUB 3FCTA 4LPUA 4HS6B 3CDYA 4MLIA 4PRBA 1A02N 2P8MA 4MSWB 4KI5D 1A7RL 4YPJA 5E08L 1J1PL 4U3XA 3UBXG 2R0ZH 3B8YA 4G7YL 4R90L 4NKDA 4PRPE 5FUZL 1QHPA 1T7ZA 1A0QL 1ZHLB 3HZYB 4Z7UB 1A5FH 1F4YH 3NIGF 5JW3H 5HHXH 2HFTA 2IAMB 4NFBA 4U33A 4HKBB 3FB6B 3CVIL 1AGEB 4N0UB 3WYRA 2RHEA 1KPUB 2HLAB 1MSPA 3UP1A 2NYYC 3T0EE 2FJHB 3VXSD 1MFCL 3QIBA 5T33H 2IPUG 4RAVA 3MBXH 3QG6B 2VITB 1BJMA 7FABH 1LQSR 4IRSC 4O2EA 3U6RA 2F5BL 4YHZL 4Y4KC 4DGYH 4JFXA 2ZP0T 4JVUA 1A6WL 3MRKB 1B2WH 4HIJB 3CSYA 5DFVD 3MV9B 3BUYA 5D8JH 5BQ7B 1QFUL 3UTSD 1G7PB 4K07A 3QEHB 4UT9H 2XG4A 3FN0H 3G9VA 4NZRH 5EDXA 3B3IA 2NXZC 3TT1L 1RZ7L 5E8EB 1HYSC 5ALCH 5H37H 3SKUD 5C0JB 2MKWA 2AXGA 3QR2A 3MROB 5HGDB 1UYWH 2QEJA 4FRWA 1UXWA 1PZUB 3TVMD 1JP5A 2NY4C 1I3GH 2EH7L 2MTPA 4D9QD 3BMWA 2JCCB 1RY7B 3K2MC 1GSMA 4YXKL 1I8MA 2VAAB 1Z6JT 3WJJC 4F7EA 4X4MA 4QRPE 2VXVH 4H25A 5HDOA 1KXQE 2AXHA 2Z8SA 4RGNC 1FSKC 4QHNB 5E99H 4JFFA 2ICWB 1QR1B 4OIBA 1MCRA 4OD1H 3TA3B 5JW5B 1CGSH 1A7OL 1R5WB 2AJ3B 5D4QA 4GKNA 4P59L 4KV5E 1EK3A 1I75A 4S0SD 3MLPA 4TUKH 5HI5C 4IMKA 3H9SE 4I0PC 5I1IL 2H26B 4QRRA 3WIIH 4PLJD 1ZHKA 3FRPG 1UACL 3BIKA 3TNMB 4PLKC 1NLDL 5SWZD 4DEPB 1SYVA 2DOCA 1EO8H 3DYPA 1CFNA 3KJ4B 3FO0L 4ODTH 1JI2A 2GITA 3SE9H 3S3JA 2A83A 1J0JA 4J1UA 3UTZA 3MRHA 4CN4A 1P7QD 5IV2A 4XCEA 3ILQD 5EOQL 1F97A 1H8SA 3AAZB 2IBZX 2DMBA 1CFBA 2V9TA 5BO1L 2WBJC 1R3KA 3LRSA 4O9HH 5HHVH 3CVHB 5F7YC 5JA9A 3WUWA 3U6RB 4DK3A 4PREB 4OCXL 1D6VL 6FABL 2Z8RA 3QUXA 2XACC 4JFDD 4DVRH 4XB7A 5ANMB 4ZSOE 2AJUL 1OTTC 5L2KD 3CVHH 1E4JA 3CSYB 5IVXA 4LPCA 5CJQL 5L7XH 2WUBH 1H15A 4NKOB 2ZPKH 4A6YA 1AO7D 4HHAA 3AB0C 1B4JL 1PG7X 3V5HB 5M94B 2ZSWA 4HLJA 2C1PA 3JTTB 1V7ML 2DBLH 1F4WH 1U8OA 5IJKC 3CLEL 1QLEH 2VAJA 3K1KC 4YEEA 1EHLH 1CGTA 3B9AA 4L4VE 3KLHD 1J18A 1OAUH 5BVPL 4YDLB 1ZXQA 3OKEA 3F65A 2RFXA 3UTSA 1MCJA 3DBXB 3PJSA 2ITCA 3L5WA 1FNHA 2JELL 3CCHA 4XNQA 4R3SA 5TH2B 3U9PL 2IJ0C 4G6JH 4UIMB 3AU1B 2EDJA 4H25B 1RUPL 3OX8B 2A73A 1WUNT 2MKLC 4PJ5E 5J13C 4JFPA 4U3HA 3SHSA 4HPYL 3OTTA 2ADGA 1HINH 3TVMA 4MWFA 4FXGB 4UV4H 1SQ2N 5GIRB 5F3BA 3H6JA 2JKXA 2R0KL 5DSCA 4JKKA 4PB0L 5FYJU 3VRIB 1MCWW 4QTIH 1P84K 5MENE 1FP5A 1TZIA 4YAQB 4P5TD 2QBWA 1JHKL 3BIKB 1LP9A 4TNWF 1YMHB 1FFOA 4DCQA 4NJAL 1SYVB 4OLZH 3N1FC 3VWJC 4DVBA 1CFNB 2KDGA 4C54A 4OFKA 5CBEA 1NEZA 4CUCA 3QFJE 3RWDA 4YPGA 1BM3L 2GITB 1N5AB 5J1SC 3R8BB 4MB4A 2ATPA 2R0LL 2A83B 1CFSA 4J1UB 1DANU 3SDDA 5LKNA 2NY1C 12E8L 5CZVH 5I1HH 2FEDC 2KBGA 2HT2D 4G6FD 5BS0A 4IRJD 3SE4A 5ITFB 2F53A 3K81A 2B1HL 1FPTH 1SJXA 4Z95L 3P4LA 1BVLB 4E0RB 4K3DL 4BZ2H 4ENED 3WUWB 1J5OL 1IGMH 1YECH 4Y5XC 3QCTH 1Q9OA 5DD6B 3HNTL 1AI1L 4NKMB 3T65A 1MFNA 3HZKB 1PYWB 4ZAKD 1CR9H 3HC0A 1E4WL 1MIML 1X5JA 2CSPA 1A6ZB 1PZ5A 2DLTA 1VADB 4GMTL 2FX7L 4KUCF 4KI5F 3RWJA 3QO0B 1MJ7H 4TOYH 1OAKH 4TSAH 4HHAB 3VXSB 2W9DL 4TQEH 4UUJA 1J12A 4FQHB 1LEKA 5IFAH 1DE4A 3DMMC 2GUOA 2YUWA 5T5NF 1LE5A 2YUZA 1U8OB 2OSLA 5I75B 2ESVB 3WFHB 4NN7C 5IVXF 1K3ZA 1UM6H 1D9KD 4KKLD 4YHPB 4JFDA 5IMOB 5L2KA 2W91A 5GRZA 4P9HC 4JFZH 4OD2A 1OSPL 2BNRE 3L5WB 3CCHB 5KJRL 1AO7A 3QEQA 5ILTL 5T3ZH 5FGCE 4MHHI 3S88H 2DQIH 4BZ1L 5MP6H 4XNYL 3KPNA 3U7YH 1RK1A 4HWUA 3ZTJG 1MCCA 1FYHB 4GBXD 5CEXB 3TVMB 3MRPA 4HDIB 1W8NA 3BXNB 2CKBH 5CJ8A 1YN7A 3EO0A 3HFML 1VCAA 4X6DB 3VFVA 5C6PB 5HYQB 1UM5L 1FFOB 4PUBH 3NCJL 4M7LL 3KPMA 1J8HD 3C6LD 2QKIB 2JE8A 2VQ1A 4AK1A 4DVBB 1YYLL 4P9HL 1NEZB 1IAMA 2Y4SA 3RWDB 2H45A 4YPGB 4BSVA 1A9EB 4XZUB 5H94B 4X0KA 4XI5C 3N85H 4HJGB 2AAVA 1LP9F 2DWDA 2C9AA 4MJ6A 5EZIH 3L3GA 4NJ9H 2C7UA 4GH7B 1ITBB 1I8LA 4LVEA 1EERB 1Z2KA 2ICWJ 1IC1A 1NCDL 4RGNE 5DT1H 3BESR 1I1AD 3GJFK 2UUDK 5SWZB 3T4AA 5ID1A 1OPGL 2PXYD 1UCTA 3O0RH 3WXVH 5A16A 4ZXBD 1P53A 4UDUB 3I2CL 4WGVB 3T65B 3I3DA 4LDOB 4DOHB 3W2DL 5C0EB 4L5FL 4QHMA 1PZ5B 4OQTH 4XVTH 2LVCA 1P7QB 2VB5A 2V5MA 5DA0B 4AH2B 3ORJA 5DK2B 4HFUL 1E27B 4OUUB 1S9VA 3PL6C 1CFQB 2EDBA 4YUEL 3WSQL 1LEKB 4UUJB 1R3IH 5D1XC 4BFBD 4KC3B 3QEGL 3EFDL 1HOCB 1LE5B 1FL6A 3QA3A 4UV7H 3IDXH 2A0LC 3C8KA 4J3SA 5HGHA 4GXVL 5C08E 4ZAKA 5E00A 4JFDB 1T22A 3O6FC 2YMXL 3MV8D 3UTTE 3AGVA 1U8PB 3FT3A 3MNWA 4YHNA 4G80B 1CL7H 1TZHA 3T3PE 4XH2A 5FUOH 4BFEA 5A3ID 2DD8H 1AO7B 5I76B 1WIUA 1BHGA 4IIQA 2D31B 4ESKA 1JYNA 2ERJC 1MHEA 5IWLA 1RK1B 3NTCL 4XXCC 3V8CA 4YGVA 3RVXC 5LXGL 4CVWA 4KPHL 4GMSH 4QHUA 1NCUA 1GL4B 1JTOA 1D9KA 1MI5A 3P73A 4JLRB 1R3LA 1G9NH 4LPTA 5AG8A 5C6TL 1CTNA 4UMGA 2WW8A 1U41A 5CGTA 4U1MA 3MA9L 5BXFB 1EVTC 1YN7B 3TYFB 1QBML 4PBVC 3C2AH 3BH9A 5FM8A 4D3CH 5IKCB 5HHMD 1RUAH 3ARVA 2DQDL 2IH3A 3UEZA 1LD9B 5DLMH 1YYMH 2VQ1B 1CT8A 1EA9C 4LBEB 1MCFA 1MREH 2YN3A 5IROA 5I1EH 1JYVA 2QHRH 5I66A 4JKLA 2IQ9L 4GBXA 5HHPB 4F57L 1BF8A 4P4KA 5EFIA 3DUUB 4C59B 3OAYK 2DWDB 8FABA 2FYYA 1YEDA 4MJ6B 3OAUH 3EJYC 3MREA 1AGCA 2C3WA 5AAMA 1QSFD 3IB4A 4YBQD 5BZDB 1BZ9B 4P5TB 4RFNC 5D9SB 4Q9RL 4QRUB 4QLRA 2DQEL 5ID1B 4YFDB 1J8HA 3KPSD 4M7ZC 1NFIA 5A16B 5D5MB 4CJ0A 3QG7L 1U8QA 35C8L 4HCRH 4QHMB 4AEHH 4OD3H 1N7MH 5I6XC 4IRZL 3BP6A 1KN4H 3L95A 4M7KH 3IFNH 2HTKC 4OCWL 5H35B 4HS3B 3ARWA 4ZUWB 3E2HB 4IRJB 1FFNB 1WC7B 1F11A 3LB6C 1RMFL 3PP4H 4OM1H 1I1AA 4Y4FC 3TNNB 4ZYKA 1S9YB 1FVDB 1S7UB 1FL6B 3EDDA 2HJFA 4M9OA 4ZXBA 4GG8A 5HGHB 4JM2D 5CD3A 1X5AA 2CDEA 3DX6A 4YHIA 4NCC1 1JF6A 1Z5LA 1S7RA 1AHWB 5E00B 4EXKA 3U46A 5E9DA 1VEMA 4JHAH 2DM7A 3OB0K 4KXZI 4C55A 2O5XH 3SKOA 2DI9A 5E6IC 5F9OH 5I1GH 1IQWL 4O2FA 1R3JA 2IFFH 2AEIT 2GEEA 3QUKA 1MFDH 3N1MC 1MHEB 4W68A 1X5GA 5I16B 4YGVB 1LEGA 4JEGB 4XP5H 2V17L 4ODBD 5EO0B 3GJFA 3BKCL 5GISH 1MF2L 2AW2A 3P73B 3QUYB 1R3LB 3CLFH 3IDNA 3NZHH 2ICES 3BN9D 4HJ0C 1U8MB 5KVDL 3MV8A 4POUB 4U1MB 3QRFM 5C2BL 2R4RH 5MI0C 4S1RL 2H8PB 1FC1A 2Z8VC 3LN9A 3BH9B 4JN2A 1HIML 5CBAA 3DHMA 3ES6B 4RRPA 1CE1L 3MCLH 3NCEB 4PTUA 1BJ1H 1DBBL 3EYOB 1SBBA 4RMTA 1HZHH 4LLQB 4KTDH 1QOKA 3SQBA 2UZIL 1N59B 3QUZD 1LVEA 1PKQE 5DO2C 1T89C 5I66B 1N6UA 4L9LC 1KCRH 3FB5B 4GBXB 3BRFA 1XCTA 3UO1H 8FABB 3PQYD 1HE7A 4NDMB 4XBGA 1NJ9A 4B7IA 3MREB 5FHAL 2R4SL 2DLGA 4U4BA 3MV7D 3LHPH 2MPAH 1Q0YH 2AJVH 1QP1A 1KTDA 1SM3L 4KJWC 3C6LB 2DS4A 4OB5H 5I8EB 3SKJL 1FZMA 1NFIB 5E5MA 4JDVA 1ACZA 3ETBF 4XMLH 3GZKA 4N8CH 4MQSB 5DFTA 4MNHA 3OMZA 4L8BB 1YPZE 1I3UA 4CADB 3ZSSA 1CK0H 3EGSA 5HHQB 1U8QB 1FLRL 3S5LG 3BP6B 4P2OC 4N0YH 3JV5A 1VA9A 2QADD 3RVTD 4PJEA 2Q20A 2C1OB 3O6KL 4Z78A 1G7HB 1P9MC 1AIFA 2VLKD 2AS5M 4WI4A 2PXYB 3KPSA 1R5IB 4KKCD 5I8KL 4Y2DB 4RZCA 2BOBB 4K2UH 3BKYH 4ZXBB 5C86A 4GG8B 3N06B 4DKEH 1KC5H 3DX6B 4YHIB 2V7NB 1XGUA 1UJ3B 3ARFC 1S7RB 1TMCB 1FL5B 5FO8A 1LGVA 5IESL 1QYGL 4NN5C 5B3JF 1QFPA 43CAB 1K8IB 2EYTB 4XAWH 4KHTH 2J5LC 5DRWA 4X9GA 2PR4H 4ORGA 1WBZA 4O02H 2YD3A 5FYKD 4O2FB 1R3JB 4WY7H 1SEQL 3QUKB 5BOZG 2A6DB 1QRKA 2X4OA 2J3SA 1NCCL 1IRAY 4G8FA 1BBJA 4NWTL 4JM2A 3CX5J 4RA3A 4FS0A 4TULH 2ZUVA 5FECB 1N5YL 2R56L 4Q9QL 4K3HA 1JZ2A 2N4IA 1I8KA 4UU9A 1XGQB 3OKDA 3H3PH 2AEPL 2N1KA 3ARDC 2CXGA 3DX7A 3MRQB 5GJSL 3F6IA 1BFSA 2Z35A 2P7TB 3CFEA 4JY6B 3G04A 5EN2A 1PX4A 1C5CH 3IXAA 1FFQA 2BJMH 5C0IA 4H1LA 2B0SL 3CAFA 1F3RB 5JHDE 1U8JB 2P4AB 2ZUYA 1KB5L 4WO4D 3K8MA 3P40A 4PJ9B 5EBWA 4LNVA 1I3RB 1FNAA 4PS4L 1JGVH 4LSPL 4UI2A 3QJHB 3WFEH 1OWRM 1KXTB 4KRLB 2X7LA 5HHMB 2MQ0A 1RI8A 5DJAB 4AQ1B 4EBQL 5JORA 3KLSA 3F7YA 1KEMH 1FZMB 4KMTL 3CPLA 3A67L 2YUXA 2VMFA 4JFHE 4D9RD 3A6CL 1B9ZA 2H9GB 1MPAH 5D7KD 3KJ4C 5DQJB 3TM6A 3EGSB 4XHJC 2XY1A 1ZKAA 5E8OB 1QSEE 1Z9LA 5I74C 1JNNH 5J56B 4OLYH 4ZPVA 4MX7B 3PQYA 1KYOJ 1JGLH 4Z77A 4FHBD 4JJ5B 5KG9B 4ZFOA 1QSFB 4WHTB 4P46A 3MV7A 5AYUL 4M5ZH 3QIBC 1N4XL 3ZKMD 4PG9B 5AZ2L 1PDKA 3GSWB 4MQXC 4J23A 3KPSB 3MTRA 3V7MA 2V2WA 4DN3L 4RZCB 4WTZA 4MDJA 2YPLE 2PW2A 3WXWL 4EJ1C 3T8XB 4HS8L 4PJEF 3V4PH 3X17A 3G5VA 2HKFH 1UB6A 1I7RB 3BDYH 3RTQD 1FNGB 1NGPL 1Y6KR 4BQ9A 3OR7B 5TE6L 2D0GA 2VLKA 4N9OB 5FV2A 1IAOA 1MRFH 5HYJD 4KZEH 3EJZD 4X7SL 1WQVT 3IYLW 1BBJB 4G8FB 1I9EA 4JM2B 3W5MA 4LCWE 4NO2A 3RVVD 1AGBB 2YPKB 4TTDD 1Y6NR 2IMNA 5TQ0L 4E42A 3O3AB 1XF3A 4H0HB 4UU9B 3MUGA 5F44A 3PDDA 1ZS8A 5EU3A 4XP9L 3OKDB 4YDLC 3O4OC 3WNOA 3BGMA 2BXYA 3BN3B 2Y5TA 2H1PL 3QPQD 2MMXA 3DX7B 4JM2F 1RJCA 1KCUL 2Z35B 4ZO6A 2FDBP 3CFEB 3VXRD 4GLRH 4QOKD 4S11A 3LN5A 4XRCA 4HZAA 4YWGL 5JDSA 3RL1A 2YD5A 1DCLA 3RI5K 1NFKA 3ARXA 1GJIA 4YDKH 3FN9A 2GTWB 1S78D 5EBWB 1JFQL 5JHLH 4FFYH 1FYTD 4NM8H 4QY8B 3MRLA 5TFSH 3ESUF 3GGWA 4XBEH 1F42A 4ELMA 1X6LA 4N0FB 1B6DA 4Z7WB 3DI3B 5E4EC 2Y06H 4KJYB 4M93C 3CFCL 3OKYA 3VMNA 3QUZB 4U31A 1NGZA 1BJ1J 3QCUH 4FZEH 4R8WL 3CMOH 2G5RA 5GGSA 1JPFA 1MLCA 4WO4A 4S1QL 3K7UA 2VTFA 2Z91A 3PQYB 4IMLA 4MNGA 3OZ9H 2EDDA 1ZLUH 4ZFOB 1CLYH 5C8JA 2ZKHH 1NUGA 3RNKA 5MHSE 3EYFA 3C5ZD 5CUSL 3RKPA 2E8YA 3VFRA 1B4RA 4KI5C 1BQUA 2X09A 5ICZA 3GSOA 1CXLA 1I9RL 1HXYB 4O58L 4LVHB 2LAAA 3X13B 1NMCB 4PP1D 3WIFB 3AREB 3LQMA 4KFZC 4XPFL 3ZKND 5HD8C 2W9EH 5H37G 1JZ8A 4YHOL 5C0DA 2A9MH 4NQDD 2VDPL 3QUXC 4M02A 3NIGE 1QBBA 1OY3B 3AROA 2YD1A 2FH8A 2Q6WB 1XF5B 5DJ8B 4X6FA 4DZBA 1BQSA 2VXQH 3B83A 4GOSA 4ZMAT 3P0VL 2QADB 5CSGA 1UG9A 3FQTA 3VFOA 4M48H 1KN2L 4YIQA 4MDIA 4JZOA 5GGVH 4KKBD 1TETH 2HTLD 1HH9B 1KBGH 1BFVL 3FOLA 1IAOB 3LEXA 3S34L 3C9NA 5F1IB 4MLSA 3W9EB 1L0QA 5I75C 1KIRA 4N0UE 5F9JA 3IJYB 4OGXL 1HILA 1NCBH 3QXDB 5GRUH 5EU3B 3FFCB 2VUOA 4JRWA 3AXLA 3BGMB 4KY1L 4LLMA 2Y5TB 1M1SA 3RTQA 1HYRC 1I7TB 4DTGH 5C09E 3KDMB 3TPUA 4WIQA 5C0AE 4KZDL 3NA9H 1CXEA 1FO0B 5HYJA 4NNPH 5JDSB 5FKPB 4OTXL 3N1GC 2FIKA 2K7PA 3LKOB 4M1DH 4A6YL 2WIMA 1FO0H 1SJHA 3TVMC 4KDTA 2UV3A 5E8DH 3ZL4L 3HKFA 1E6OH 3RNQA 1VKXA 1HHHB 1XR9A 2EDRA 4JPIA 5JLZA 3PWVB 3MRLB 2GI7A 2F8OA 3TBSA 3JWOH 2DQCL 4FTVE 1FJ1A 2XV6B 3VI3F 1MEXH 1JPTH 4U6HA 4PJAA 4BSWA 1MRDH 1XGYL 5GS2D 2V2XA 2KQNA 1MLCB 4WO4B 4PG2A 3WS6A 5D7JD 5IEKA 3CJJA 2Z91B 1RURL 3SDDC 4IOSD 1PAMA 3N1QC 4OCLC 5HBBA 3QIUB 4KKAD 4ONHB 4UAOC 5C8JB 4NO3A 5ADPH 1FYTA 2DQJH 2L0DA 4U6VL 3SE4C 3EYFB 2JLLA 2DDQH 3JTSB 3EFFB 3VFRB 2LU7A 3VXOB 1BAFL 4YE4H 4HJJL 3Q1SH 3VE0B 4TUJA 3VGAC 3FZUD 1E6JH 4GSDH 5F7LB 5KVEL 4TVSa 4PR5A 1A47A 4BH7A 1IAII 4LPXA 2JJSA 1ES0B 5GSRB 5KOVC 2XNAA 3DGGB 3H3BC 4UQ2A 5HYSA 4M6NL 4Y16D 3VFOB 5DJCA 3ILQC 5ESQB 1CFTA 1CGWA 3LEXB 1GAFH 1GC1H 2VRAA 2X4QB 5TF1L 3RX8A 4JM4H 3NPSC 5C0FB 2B1AH 4G9FA 4PD4J 1R24B 4XNXH 4WI2A 4MAYD 1S7QA 4NQDA 1DBKH 1NBYB 4PGBB 5DJ0A 3HS0A 1JHLL 2DLHA 1CN4A 2GW5A 3O2WH 4RWYL 2D03H 3AXLB 4YFLF 5DHVH 4UT7H 3RTQB 4HXAL 5GSVA 1ND0A 3ULVD 4HX1A 1YQ2A 1AD0B 1CLZH 2IBBA 1A3RL 1LDSA 2EEBA 3BIBX 4KROB 5DS8A 5ERWA 4BH8B 5HYJB 4X6CB 3IVKB 4GS7B 1V3MA 4IDJH 3OKMA 3BVNB 3RWEB 2DM2A 4UOW0 1I1FA 1MFBH 3AS0A 3KLHC 1TXKA 1LMKA 3RNQB 5GGTA 5HGBB 5JLZB 1JRHI 3MRFB 4GRWF 3RWFA 2VDQH 3QXTA 3P30L 5EU4B 3B2UD 1LK3L 3VXRB 2YWZA 4HGWB 3IKCA 4QOKB 4PJAB 1QO3A 1BP3B 2APFA 4BSWB 4UIKH 3S7GA 1KOAA 2A38A 4OZHA 5FEBA 1XZ0A 4KQ4L 2I60L 5BZWB 3C5SB 5IEKB 4GMSL 2ADIA 3D18A 1W0WA 2PTTB 1KEGL 2DKSA 1RZKH 1YEJH 1I8LC 3MXVH 4X4ME 4NO3B 5DUMH 3ROLA 3SEPA 3DYOA 4OFPA 1NBVL 4PJAF 4YFLI 4JFFE 1SY6A 3GHEH 1YQVL 3HI5H 2C3XA 1PG7H 3NFSL 5BMFL 3EOAB 4D0DB 2AK4A 1WBXA 4QRRE 4I1NB 5L9DL 1DUZA 5D7JA 4HUWA 4CMHC 4KGLA 5BRZA 2APBA 4QHLA 4NZDA 2OP4H 2P8PA 3FQNA 1BOGA 3NCFB 3OAUL 2HT2C 1HDMB 3E2HC 1NGQL 5GZND 2VH5H 4U0RB 2E9BA 2ZOKA 1J1XH 3C5ZB 1NDMB 2OBGA 2X4RB 3BP5B 3QHFL 1S7TA 2DJUA 1CTOA 3L5XL 1Q94B 2VABA 5HY9A 2IPKB 1NGWA 3HMWL 3MRJB 1AQDA 3RI5F 1ZLSL 3VI4F 4NQDB 1ORQA 2BVEA 4ZAKC 5DJ0B 5L0QC 1KENH 5M95B 5T5FL 4KI5E 1KN4L 1I3VA 5GSVB 4MB3A 1ULVA 1T1XA 2Z93A 4KQ3H 4Y16A 4HX1B 5E70A 1NL0L 4PJGA 5I19H 2ARJB 5GGUB 1MOEA 5FGBA 4IIQC 5JMOC 1IZKA 4ZS7L 1MAJA 4LQFL 4WU7A 2XN9D 5IWLC 4WDIA 2RB8A 3TFKD 3E6HB 1M7IA 4U2ZA 4PGZA 4JO2L 1G1CA 4G5ZL 3L3JA 1MCOL 5IVXE 1D9KC 5E4IA 3MLUL 1I1FB 4LL9A 4LP4A 4KMQA 4JGMA 1YC7A 4HLZH 2EDOA 1GGIL 4HFWB 1CF8H 3RWGB 3IKCB 1QO3B 1E0OB 4N1CA 1KYOK 2W0PA 1IZJA 1TQBC 1KELL 2VERN 5IROC 1RULL 1XZ0B 4NBXB 5DQDL 4GBXC 3UTSE 3L6FB 4P4KC 3V5KB 4HKXA 3GBML 2APXA 3WO4C 1UCBL 5E6ZA 1T03H 1KJ3L 1TVHB 3PDGA 5A43C 4MD5A 5GHWH 3A6BH 4OZHF 1YEFH 3WJLA 4Z6AT 2NY0D 1M7DB 3NCCB 1P4BL 3BZ4A 3I3BA 4Z0XA 5E56A 4L4TA 5C92A 1MH5A 2NY7H 4D9QE 3QDJD 4J6RH 3BJ91 3C6SB 5JOFB 4HUWB 3QEUA 4KVCL 1WLHA 1OM3H 3IAGC 2FL5A 1LP9E 5GS2H 2YK1H 2ILLA 4R4BA 2P8PB 5GPRA 3GMLA 3OSKA 2X42A 4LSVL 1A6TA 4ONFL 4H20L 3VFGL 2BVQA 3BPNB 3WLWD 2FX9H 1I1AC 4JDTL 4PJHA 5KSVB 3GO1L 3MLRH 3S4SG 4ZXBC 1NGWB 3IDJB 4XVSH 5D7LD 4M61B 3VFUB 2NCMA 3FRUA 2HG5A 4ZFZB 5BS0E 2AJSH 2JB6A 4JR9L 3ARQA 3GK8L 2F53E 1DBJH 1AFVL 3WFBL 1QBLL 5BVJA 4Y16B 4NFDA 4QXWA 5KTEL 1YEIH 4ZS6D 5FB8A 5T1LD 4FQCL 4PTTA 4DOHE 5JW4M 3D85D 3OKLA 4I9WD 4TSBH 4WDIB 1JZ6A 3AVEA 4IJ3B 5HVFB 1EJOL 2IH1B 1V7NH 2A74B 4ZOCA 2FX8L 4MAYB 4G43A 5IB5A 3AUVA 2XA8L 3GDBA 2G9HB 1I7UA 1L7IL 1BQHA 5A3IC 3OJ2C 3PWPD 5EIQA 2VDNH 2QR0A 3L7EA 1A1OA 2CRYA 2W92A 4WFED 2ADJB 4WY7L 1BZ7A 1FH5L 2XN9A 3BWUC 4R7DA 4JFDE 1X5HA 4OJFL 1MVUB 3D3VB 5KSBB 5L2KE 4DUVA 3HUJA 3ULVF 2NZ9D 3SDCD 3BD5A 3ZHLA 3CXDH 1AO7E 2QSCH 3AS1A 3QEQE 5CZXD 1MQKL 3JZ7A 4G8IA 3RZCD 5SV4A 4MD5B 1A7NH 2R1WA 1NMBL 4M43H 4R97B 1FCCA 2QQKL 5HTSA 1X7QA 3SOBH 3GSVA 2PTVA 5E7BA 5EBLA 4LCYA 2ZWLT 3DV6A 1T1WA 2FB4H 1RK0B 1CLOH 1QACA 3HG1D 1T0PB 3NZ8A 1FZJA 3QEUB 4U1GB 4UINL 4N8VG 3T3MF 1MHCA 1KGCE 2DTSA 4JDZB 3NFNA 4XNZB 2M2DA 3QWOB 3GMLB 3LEVL 3JWNC 5E8PA 4WI5A 2BVQB 1F2XK 4DKFH 3ZZ1A 3QQ4A 1BREA 2EDXA 4PJHB 4L3ED 1YEHL 3MRMA 1FGNL 25C8H 3WE6A 1ZSDA 5JOPD 3GRWA 4JFYA 3OHXB 4EIZC 5CEYA 3CZFB 3FRUB 5FDWB 2ZUWA 3HE6D 3QDJA 1S3KH 3GMRA 4KJPD 1N8ZA 4PJHF 2VDRL 4DGIH 4RX4D 2FCBA 3WCYA 3THMH 3WHE1 3VFWA 2PKDA 3I6LD 1U8KA 2ZCKL 3D0LB 5D1QA 2GHWB 5C07D 1A7PH 3VU2A 1FBIH 2MOVA 4JM2C 4LSTL 4ZUVA 1CDYA 4RISL 4MA7H 5D7LA 3A0OA 3O3EA 5D7IB 4Z5RA 1NAMB 1A6UH 4LLDA 4AMKL 3HZVB 1D5MA 1DBAL 1FVCA 4LAJH 1DL7H 1BQHB 5KW9H 3UCRA 1A3LL 1WWAX 1NAKH 1LE9A 2IAND 1HNGA 1NAMH 2XFXB 5FYKU 2B2XH 4N8PA 3MA7B 3UJJH 1IM3B 5EG6C 3L7EB 3QP3A 1A1OB 2PTUA 1AH1A 5DEGA 3MLWL 4ZOBA 3B9EA 5DJ2A 4X99A 3L3DA 2V2TA 4LCCB 3IRPX 1T0NB 4D0CB 2GJ6D 4QXTB 4J3XA 3D85A 1EJ6A 1MFEL 1W72H 2YKLL 2A1WH 5CJOH 5F7UA 4OIIL 1W0VA 4KJQD 4NFCA 4TNVK 1KIPA 1CE6A 1D7FA 3HC3H 1JIBA 3O8XD 3SGDI 3U36A 1UA6L 3S36L 3P0YL 2PF6A 4G8IB 1WCBB 4I77L 4JHZA 4E9LA 3SO5A 5CCKL 2R1WB 3ALXA 3OGOE 2QQQA 1V3KA 3U4BL 1OTUD 4RWHA 3WHXA 2XZAL 4XMPL 1EZVY 2O26U 4F58L 4HIHA 4JHWH 2Y1VA 5DMIL 1S7SA 2OMBA 1MI5E 3HUJF 4PJDA 3GSVB 5EBLB 2F5AH 3DIFB 1MAML 4NRYB 3VFNA 2LQRA 3DV6B 1ZHNA 1T1WB 4LCIL 3V6ZB 2SEBB 1Z3GH 3GMOB 5D6DC 2O93L 4PJ7B 5GGQH 3SDCA 3U1SH 3VH8A 3ROOB 1LDPL 1MHCB 2P24B 2CUIA 1AQKH 4G6KL 1K2DB 2BRQA 3HC4L 3NFNB 3BPCB 4CMMA 4P46C 5E8PB 3RZCA 5DJ6A 4NQSB 4PD4K 4R6UA 2BERA 2JK5A 3CFDB 4HIIA 3QQ4B 1VFBA 4JY5H 3MRMB 5IQ7H 2BMKB 3V95A 1Z9OA 5EPMB 2OTUA 2I07B 4JFYB 3O41A 5T1MB 2EDLA 1PEWA 5CEYB 1CCZA 2DMCA 2VC2L 3QDJB 4FXLA 1ZMYA 2BHZA 2VDOH 5AAWA 1JVKA 5TE7L 5IEHB 4JB9L 2R8SL 5EUOA 4EQ2A 1J8HE 4K3JL 3RVTC 2DTMH 3WLBA 2VE6B 3BO8B 4KHXL 3VFWB 5HGAB 3PNWA 4L3EA 1KFAH 4KKCC 5DR5L 1NKOA 4ZFOL 4ZUVB 1MIEH 4I3SL 5D7LB 3O3EB 4Z5RB 2CIIB 3NA4A 3HNSL 3DYMA 2ZUUA 5EU5A 4JFED 3MACH 4Q0XL 3WFDL 4JN1L 5B3JE 5E0QA 1AGDB 3FJTA 4Y19D 1LE9B 4R26H 3LKSA 4JGUA 4M62L 1MRCL 1F2QA 1Q9WB 1OAXL 3MSPA 1JPSH 2AKRB 5EZOH 3EDFA 1ZA6A 5T1LB 2XKNB 4NC1C 4M7JL 4LU5H 1FCGA 4X99B 4Y1AB 4K94C 2V2TB 1F3JB 3RX7A 5I8OL 5C07A 3KYAA 5DHXB 2OK0H 1CDCA 2BVUA 5E9DE 3ARBB 1RVFH 5J1TC 4ZO8A 4ODHH 4JZNA 1N2RB 4QTHB 3OXRA 4U7SA 3L3OA 1T6VN 1CE6B 4XVJL 2BP3A 3EYQD 4KK5D 5C0BD 3O3BB 2IANA 4PY7A 3PHQB 2X05A 5ESVA 3PWPB 3EYVA 5DUPH 4GAJL 1WZ1H 1N64H 3VRLF 3LY6A 4NBYB 4XBPA 1F4XH 3RU8H 2X41A 4PJDB 4F7CA 2GJ6A 1B90A 2IMMA 4E5XA 3VFNB 1IAIL 3MV8E 1G7MB 5EBMA 2OZ4A 1CICD 2EC9T 4ZNEA 3RP1A 1J05B 5FYKL 1MCWM 2YA0A 5J7CC 2X4NB 4WO4C 4FQIH 3FB8A 1CDUA 3QDGA 2XQYG 4K94L 1FL3A 3L3HA 3O8XA 2WAHA 1YUHA 1D5XA 3CFJA 3SGEI 3WIHH 5T3XD 4Z76A 4NQCD 4PJDF 5CINL 3GB7B 3RZCB 5ENWA 3BH8A 4WI8A 5DUBA 2JK5B 4LRIA 4HIIB 1VFBB 4MMZC 4N1EA 5IW1A 4HBQA 4M5YL 4QRQA 2UY6A 1UENA 4QGTA 3WBDA 2ZCHH 3DROB 3B4NA 4JO4L 4B53A 3W39A 4O4YL 3HG1B 2BCKA 3P11H 3MLSH 4LSQL 1HSAA 4WEBL 2ENYA 4PBWD 5TPWH 5HHME 2HJLB 3FTGA 4KI1A 4JZJB 4P57A 4IBLT 2Q8BL 1IGIH 1TTGA 2OTWB 1DDHB 1UM4H 2W65A 1X5IA 3ARUA 3FONA 5C3LD 4JAMA 1IKFH 5CD5D 2HP4A 3SKMA 3VD4A 1MFAH 2HAZA 1CXKA 3PNWB 3ZKMC 2YUVA 3RDTD 3HPLB 4L3EB 1I9IH 2CUMA 1BD2D 4UNTA 5LCVL 1YEGH 5IGXL 3BDXA 3UJIL 5DK0B 5EUOF 3C5JB 1F8TL 5I1DB 3NACH 3HE6B 3UTPD 1JRHL 5DD1L 4PJEE 4PGDA 3VG9B 4OF8A 5D2LB 1HHKB 1PX3A 1QLRB 1S7WB 1Q9KA 4ODUA 2X70B 3LKSB 3KPSE 3RTQC 3BPLC 4ELKA 2B5IB 1ZA6B 2V7HA 1T66D 1RZ8A 4N0CD 1FAKT 2E7MA 5MEQB 4NRZB 1AY1L 3EJZC 4ZUSB 5C07B 3H42L 3EAKA 4TTGA 3QHZL 2NW3A 2XPGB 4JZNB 3Q6FB 3JUZA 4M8QA 4LGSB 4TTDC 2C26A 2EDEA 1R6VA 3Q5TA 4JFEA 2ORBH 3SCMB 3NCYP 4KDTC 4PJ5D 5C1MB 2MCPH 4Y19A 2IANB 2OJEB 4PY7B 3BE1H 2DYPB 3QPQC 4XBPB 4UT7L 4HWBA 4GKZA 4MS8D 4F7CB 1C1EH 4CW1B 2GJ6B 2G2RA 2FHBA 2IADA 4E5XB 2E7BA 1ZANH 5MEND 1UVQB 3K4DA 3G9AB 3IFPA 4PG2C 3QZWB 2XWBA 3FB8B 4O5LL 3WS6C 5DDHA 1FL3B 3L3HB 1EEUA 3O8XB 3LDBB 4MA1B 5C0BA 2VO5A 4OCRL 1CS6A 4ERSL 1EFXA 4I48B 4Z76B 2F58L 2QSQA 5L8JB 3VMPA 2EDTA 2FBJL 3BH8B 4ALAL 1IEAA 1T04B 1GIGH 1IM9D 5IBUG 2AI0H 3WKMH 4L8CA 3T2NH 5EC2A 2BZDA 4EVNB 1I1YA 4ODVH 1ZGLA 4F8QA 3IS1X 1CICA 1YNTB 3W39B 1AC6A 3ZKXB 4HH8A 5IF0B 2JJSC 5FCUL 2BC4A 3SPVB 1RIHH 3I84A 3TBTB 4PRPB 5ESAB 2W65B 4NQCA 4ZUTA 2HFGL 2CQVA 4JAMB 3ZE0F 1KIQB 4RGMB 1G6VK 1JL8A 4GQ9L 3BKML 4PPTA 5IUSA 3PQYE 3T0EB 1A4KA 5E2UL 4KK9D 4PP1C 1R5VA 3ZKNC 2GSIB 3M1BA 4GUPA 1GXEA 2APWA 3GFUA 3MV7E 1DQLH 4TNVF 3ARRA 2EZ0C 5E2TL 2B20A 4B50A 4F15B 1TPXB 1O7SA 2YN5A 2J7LA 1CD9B 3R1GH 1EH9A 4H0GA 2V7HB 4KKBC 1CBVL 1HHIB 5F6HJ 2HTLC 3RDTA 1DLFH 1BD2A 2Y23A 4N5UA 2AABL 2BNRD 2W9LA 2DJ4A 2D2OA 4IRSD 1TQCC 4M8QB 3O4LA 4JFEB 3GHBL 2Q86B 1JF1B 4Y4KD 1G7QA 2VLKE 4NT6A 4KRMB 3SDAA 4Y19B 1EEZA 5CIPB 5CMAA 1YNKL 2WP3O 5JNYA 3SE8H 5AG9A 4M1CD 3WFCL 1KUMA 3P4OA 2DI7A 1NMAL 1RZFH 1OWWA 2W0KA 4GKZB 3WMSA 4HIXH 2G2RB 5CIPH 1HXMA 2NXZD 2DQHH 4DFIA 3HR6A 1B6UA 4C83A 5FYLD 4ISVB 1VGKA 3D0VA 5DJZB 4PP2A 1S8DA 3IFPB 5BW7A 2XWBB 3UC0H 1EZVX 3MLZL 3U4EA 2X4PA 1ZLWH 2Y07H 5FYKE 3V0WH 3RRQA 4AEIH 5IHZA 4JRXA 4NC1E 3I9GL 2NY4D 1OD9A 2BVOA 5ICYA 1X4YA 3RVWD 4S1SL 5IIEA 3BHBB 1QZ1A 3CK0L 4JREC 5EC2B 3V4UL 5IW6B 4YC2C 3H9SB 1A9BA 3OKKB 1I1YB 1ZGLB 4WI6A 5GGTL 5C7XH 1OCWL 4P2RD 1QTYT 1CICB 2P8LB 3H9YA 4YK4B 1RZJC 4D8PB 5D7JC 3UYOD 4PGJA 2BC4B 1RZIB 3QQ3A 4NZUH 4ELME 5A2FA 1CD8A 1QBAA 4KKAC 1GPOL 5D72H 1VFMA 3STBA 2AEQL 2EXYC 4AT6A 3CH1A 3BPNC 4OGYL 1EPFA 3FQUB 2FSEB 1HHJB 3LKRB 2C3VB 1A8JH 5I1JH 4MNGE 1R5VB 3FZUC 3M1BB 1MLBA 4K9EC 1SY6L 5KS9A 2E3VA 4YX2H 4IOIA 1CG9A 4CN6A 4LFHD 1MCLA 4CBPA 1OAZH 4Y16C 2PO6D 4CRPA 1AKJD 1RZJL 4ODXA 2C4XA 5D7KE 5FGBC 4ZSOB 1J10A 3RDTB 4ZFFA 2P1YA 3EOTH 1BD2B 4RFOL 4ONGH 4UNUA 2WBJD 3X11B 3HMXH 2YC1B 3E8UH 2NX5D 4GAFB 5E2VL 3BD3A 4LARH 4WI3A 1P4IL 4KRPD 3X3FL 1G6RA 2Z8WC 2A9NL 3MO1A 2B39A 2W1NA 4XCYA 5JNYB 1A14L 3ULVC 4BUGA 4K9EL 3FQRB 3ULUD 1FZKB 2G5BB 4NQVA 3I6KA 4D0BA 4L4VB 2AV1B 3C09C 4OF5A 4JPVL 2DN7A 2FGWH 3UTOA 1K8DA 3QULA 1P6FA 5F9WC 5GRXG 4RMRA 4Z7NF 5T1DH 4PP2B 1S8DB 1TJGH 2DLFH 3U4EB 2FECI 3LIZH 4NM4H 3KS0H 4ZTPL 5IHZB 1DUYA 4PJ5B 1ADQA 1IGCL 2L7UA 3WN5A 4OLXH 1H0DA 5C0CA 5ECJE 4QHKJ 4GRWE 1IGJA 4RMWA 3WJLC 1ORSA 4LIQH 1A9BB 2YWYA 4U1IA 1WIOA 3LQAH 5JPNA 2DJSA 2IPTL 5IB4B 5KSAD 5MENB 1FE8H 3ULVL 3S3SA 5F71A 4I4WA 4FQ1L 2YSSA 3MR9A 1MJUH 3S98A 3UYRH 2R1XB 3MUJA 2Q76A 2V5SA 5B38B 4Q58C 3U0WL 2P42B 1WFUA 4HMDA 4PJAE 1VGEL 1IM9B 3ISWA 1A7RH 4YNYB 3VCLA 4CVZA 5E08H 1J1PH 5EZLA 2BNUB 4G7YH 4R90H 1IEHA 4P2RA 5FUZH 3VWJD 1A0QH 3W5NA 5IG7A 3MRIA 4LSUL 3MLXL 2YBRB 1FYTE 3LPFA 1CG9B 1NPUA 4OV5A 3CVIH 4A2LA 2PYFA 2UVEA 1EAPB 2OQJB 3LEYL 2NY1D 1JGUL 3C08L 2FEDD 5GZNC 1MFCH 4GG6A 4HLZG 2VUYA 4ZOEA 4RA0C 1NGYB 1QLFA 3ZYOA 2XT1B 1BZQK 5K9KB 2P48B 32C2A 5KS9F 5EU7C 3MV01 4HQQL 4G8GD 4EDXA 5FA4A 3GMPA 4M4RA 1RHFA 4N1HB 2F5BH 3VI4E 4YHZH 1DEEA 2P5WD 4IHOB 1UFUA 1G6RB 1WZMA 3Q5YA 3QUMA 2DBJA 5HPMA 1WICA 1A6WH 3CD4A 5F7EL 5HSFA 4PJXA 3TO2A 1QFUH 1X5FA 2PO6A 1AKJA 2BNQD 3TT1H 4G9FE 3H0TA 2YZ1A 1RZ7H 4JFQB 4NQDE 4TVPL 3FO1A 1ZHBB 3DMMD 2BNRB 1DSFL 5F96L 4IRSB 1VFOA 1BJ8A 2LTQB 4P5KA 5FGCB 2NX5A 1CDBA 3HB3D 1A4JB 1E28A 3O9WD 2X44D 5IM7A 4F37K 4U1HA 4Y4KB 3DUHA 2EH7H 3WL9A 2QLVB 5TDOA 1Q1JL 2P45B 1RHHA 4YXKH 4PRDA 4OLUL 1ORSB 3ABZA 3BSZL 2NXZB 2HRPL 1Q9LB 4HK0A 5JPNB 3VRJA 2W59A 5IMLB 3VXPA 1UWXK 1L6XA 5I1AB 1QEWB 5I0DA 1A7OH 4P59H 4X8JB 1X44A 4QWWD 4AL8L 2FHCA 5HHOD 2Q76B 2JB5L 3STZA 1FAIL 3KGRA 5I1IH 2NY4B 3OXSA 3VJ6A 4LCUA 2OI9C 5CHNA 1UACH 2R2CA 3DURA 4OZHE 1ZGLM 1NLDH 3QNXA 3CFKA 2VKWA 1DBML 2NY0C 4MZ2A 5KSAA 3FO0H 1FSKB 4M8VA 3GBLA 2O61A 5EC1A 2ADFL 1UEYA 2C4FT 4XI5D 1K4CA 1KLGB 4X6BB 1KXVC 4R2GD 2HWZL 4I0PB 1WEJL 4G3YL 3WLWC 4H26A 4W6XB 5EOQH 4DGVL 4UILL 2X4TB 1NUFA 3I75B 4BK5A 5D1QC 4QYOB 1H3UA 2AK4E 5BO1H 3DLQR 4JPWL 3BMVA 1LO2L 5BRZE 1BFOA 5FA4B 2NY3D 5B4MC 4OCXH 3GMPB 1D6VH 6FABH 1M7XA 3QUMB 3LV3A 2AJUH 1P7KA 4GG6F 5B39G 4X98B 4JANA 3GRWL 1T7WA 1OB1A 5CJQH 3BYTA 3QUMH 2VNCA 1T20A 3ELAT 1B4JH 3JV0A 3DX8B 4YQXL 1OD7A 3QAZB 4WW2A 2EXWC 4U1KB 1VPOL 1U6AL 3MLTA 5IB1A 1V7MH 2WBJB 1S9KC 4MQ7A 4G8GA 3ZT6A 3CLEH 2A0LD 4PJXF 4CNIB 5DMKA 4FZ8L 2NX5B 4WGWB 4KRPB 2P5WA 1WFOA 4PJGE 3B9DA 4FFVC 1OT2A 5BVPH 1FNSL 2ZSVA 4U1LB 4MVBC 1ZT7A 4PGEB 1MUJB 1TVDA 1RHHB 3TIEB 3VFSB 3F7VB 2JELH 4OKDA 1DQML 3U9PH 5KSUA 3QH3B 5K9JL 4YDJB 2D7TL 2ATKB 1RU9L 1EFQA 2BNQA 1GZQB 1ED3A 3AB0B 5E8NB 1RUPH 1SJEA 2W07A 1IBGL 4HK0B 3MRCB 4XB8A 3NN8A 5F9AC 3VXPB 1U93B 1U92A 3ULSB 1EBPA 3CU7A 4HPYH 1KACB 1G0DA 1FN4A 5FXCH 3SDCC 2ZJSL 3ULVE 3O9WA 5ADOL 2VL5A 4ZPTA 3ULUF 3SE3A 2OL3A 1CYGA 2R0KH 5CZXC 4PB0H 4X9FA 3GMMA 1GHFL 3VJ6B 4G7VL 3RZCC 1MHPL 4OLWL 5CHNB 5INCB 1JHKH 3TJEL 4NJAH 1CXFA 1KCLA 3CFKB 4U3CA 5D1ZD 2NLJA 4LHUB 4NRXB 1PLGL 5F89A 5J13B 4P3DB 1BM3H 2O61B 2R0LH 3G5XA 4WFGE 4PGCB 2GTZB 2Y5EA 2FR4B 5HHOA 3CDFA 3T3ME 12E8H 3RGHA 3KYOB 1L4IA 3EJYD 4G9DA 3RVUD 1S5HA 2A6JB 2AQ3A 3ALWA 4DK6A 3G08A 1WFNA 2AV7A 4L4TE 2B1HH 1WF5A 3KR3L 1KNOB 1K9TA 4K3DH 4NO0D 4ODSL 3VWJB 1J5OH 3V7AG 3HNTH 1AI1H 2EKJA 1MCBA 3MC0A 1E4WH 1MIMH 1K5NA 5EU6A 3VG9C 1I9JL 2J8UA 4KJPC 4ZODA 4GMTH 3S96A 5GS3A 2FX7H 5TF0A 2Y36L 2NY1B 4PJHE 2R0WL 4OAWB 3IDMA 4EUPA 2B5IC 2CLZA 1GOGA 1B0RB 4GRMB 2W9DH 4HKZA 3IRZA 2KUTA 3OJDA 4U6TA 3MLTB 2V5TA 5IB1B 5IFHL 5DMYA 1LK2A 3QBTB 2I5YL 4G8GB 5L6YL 4TVPE 1KTKE 3GUTA 1M6OA 4HUNB 4AENA 3EBAA 5I71C 3KNBA 3RJQB 3RPKA 2ZSVB 2HMID 4WW2F 1NFDA 4OM0L 4R4FH 2QQLL 1OSPH 2R69L 3BGFB 5EU7E 5KJRH 4Q7DA 5ILTH 4ETQB 1QA9A 5E6ID 1V8HA 2BNQB 1ED3B 1CD1A 4BZ1H 3LKPA 4HW6A 5CEZD 4XNYH 4GW4B 1GGBL 3MOBL 5GGSY 3NN8B 3DMMB 4GFTB 4LSRL 2X10A 2FD6L 2FWOB 1YEKL 1FN4B 3AMKA 3O9WB 5KVGL 4KJQC 2VL5B 3TO4A 3CH8A 3O8XC 4ZDHB 2Y9RT 4HJ0D 5DJXA 1PKQB 2ORBL 3GMMB 4YXHH 2NXYC 3HFMH 2XN9E 4Z9KB 1OTUC 3Q48A 4LRIC 1UM5H 3VMOA 2R2EA 1MVFA 3NCJH 4M7LH 2AJYL 3HUJE 1YYLH 2NLJB 1VACA 4P9HH 1YC8A 5F89B 1L7TL 3C8HA 4OSUL 5MHSD 3CGTA 5DO2D 1DR9A 2F15A 5HHOB 4Y4HA 3LCYA 1BGXL 4KVNL 3B9KD 1MJ8L 2Y7QA 1YPZB 2OZ4L 1I7ZA 1NCDH 3UROR 4R96B 2VDKL 5D1ZA 1OPGH 3S37L 3UMTA 5CJBA 4CVUA 4MD0A 3U2SA 1IGTB 4OLVL 2DQFA 3QDHA 3P9MA 2IWGA 4GRLC 5FAAA 3W2DH 5JW4N 3FT4B 4L5FH 3GSXA 2X4UA 2KL6A 4LLWB 5E2WL 1UGNA 2J8UB 4X7DC 4F37F 2OCFD 4F15C 5JA8B 4P2OD 3B6SA 1TPXC 1H8OA 3X12B 4HFUH 3QI9A 4EUPB 2CLZB 2VYRE 4HKZB 2EYSA 4YUEH 1GGCL 1T2XA 2GT9A 3WSQH 3UJTL 3NIFF 5FDYA 1Z0NA 4OT1L 3QEGH 1IGYA 3EFDH 3QDJE 1A2YB 4NO0A 3GSQB 2BFVL 2J8UF 4P49A 4GXVH 1INDL 2EEAA 2L7JA 4LLYA 1FQ9C 3FL7A 4LSSL 3OG6B 3ARFD 1ZT4A 2YMXH 5HDQL 2J2ZA 3MJ7A 4HAFA 2BOCB 2IBZY 3EYUL 2OTPA 4LLUB 3HLAA 2XWTA 4KDVA 1SMOA 4Y8DC 3BAEL 1QA9B 3MLYL 3PL6B 3PWUB 1K3IA 1N3NB 5D7LE 1A1MB 1BQLL 2E27L 4O51B 3FO9B 2FBOJ 5AUMA 4OF0A 2XYCA 3NTCH 4OLEA 5LXGH 2BY3A 4KPHH 1QFWI 2IALB 4FTVD 2F8XC 5C6TH 2AEWA 3EYQC 4FQ2H 4KK5C 4X7TB 2BY0A 3HTLX 3MA9H 1TTUA 2DM4A 2R2BA 1QBMH 5JHDB 3GM0A 3LKQB 1RJYA 1SBSL 2DQDH 3VRLE 3ARDD 5E6IA 1JNLL 1Y0LB 3H9HB 1NGXA 3E3QC 5JIIA 3PV7A 2ERJB 5KANI 5SX4I 1EXUA 1CICC 1MCEA 3VXNA 4YK4C 2IQ9H 4HMEA 1AD9B 3BEWB 5GRWA 1X6NA 3DVFA 4HWBL 5F6IC 3DARA 1KJ2A 3ME0A 4G42A 4WFEE 1KT2B 4PJDE 3IAPA 3GEWB 4Q9RH 1P7HL 3VA2C 1KCVL 3EOBA 3S9DB 4V1DA 4MD4A 4NQEA 1MY5A 2DQEH 5D1ZB 1GRWA 3ZYIA 4MD0B 3U2SB 3RA7L 2DQFB 5DZLA 2EDQA 3P9MB 4HUXA 4OGZA 3KYKL 3QG7H 2DKMA 5EA0L 1JBJA 5GQBA 3OKNA 35C8H 3H7BB 3K1DA 2A6IB 3RUGA 2ARWA 4NP4L 4IRZH 3MFFB 3S36X 1AE6L 5I15L 5GRVL 4L29A 1PVHA 2YPLB 3B9KA 4YR6A 3P4MA 4PYHA 1SJVA 4OCWH 3PIQA 1I1RA 5TGBA 1QD0A 2F54A 5CD5C 3HA0A 1RMFH 3IKKA 3WNPA 2GFBA 4RFNB 1UQSB 1IGYB 1JWMB 4NO0B 2FECL 3RWIB 2EE3A 4M7ZB 5T3XL 1CZ8L 5EUOE 1H3PL 5D70L 3INUL 4FQJL 4HIEA 1ZT4B 2N56A 2QQNL 1H3GA 1XH3A 3SGKA 5I1LA 5I6XB 3SDAC 4LCWB 3MCKB 3HLAB 4L3EE 5TQ2L 1DVFD 5DYOA 5JOPE 1UXSB 5SWSA 1IQWH 5HGGS 5K33A 3DV4A 1EDQA 4N0CC 3QZWG 4Y4FB 4DN4L 4K23L 3LH2L 5AUMB 1T5WB 3NMEA 5I2IA 1M05A 1VEOA 2V17H 3BKCH 1MF2H 2HFEA 2G60L 4P23D 4M6AA 5BW7C 3KXFD 5JR1L 1K4DA 5KVDH 3E8UL 2FZ3B 3IU3A 2YA1A 3O81A 5C2BH 3O11A 4S1RH 2R2BB 5I0ZA 3BW9A 1HIMH 1WWBX 5C07E 1RJYB 5E6IB 1DBBH 3MRBA 4MS8C 4XPGL 1NGXB 1T2QL 2R29L 2UZIH 2HVJA 1AXIB 2VSCA 4JFFD 1KLFA 2LVEA 1RZGA 3U0TB 4DUXA 2Z4QA 4YO0A 2IANE 3QFDA 5FV1L 1AXTL 4EN3D 1CXHA 2CK0L 2XQBL 5FK9A 3MGTB 3DVNA 2VZOA 5FHAH 2R4SH 2GJ6E 4HXBL 4NSKB 4U49A 2BXZA 4Z0BL 4ZNEE 3SKJH 1SM3H 2AK1L 4R7NA 3DECA 4LIQL 2GCYA 3QDGE 3HR5A 5C71A 2J88L 1OGAA 1A6AA 2VZSA 1QFWM 4OF7A 5FM5O 3OKNB 1FLRH 5DWUL 4L9LB 3B9KB 5GZOC 3PV6A 3PIQB 5EOCL 4DWHA 2HH0L 2Q7NA 3FN3A 1QUNA 5TGBB 5DURB 1IMHC 2ZOLA 3O6KH 3FAXA 3ZE0E 2GFBB 4OGAD 1JWSA 5I8KH 3GI8L 1BIIA 4KUCD 3RUGF 2Z31D 1BWMA 2CDGA 4KK9C 4QCIA 3JV4A 4FN0A 1H3WM 4P5MA 3ECBA 3DVIA 5HD8D 1YDPA 4IEFB 3IFOB 5IESH 1IQDB 1QYGH 3QUXD 5I1LB 2YD2A 4MXWL 4P2OB 4G6ML 3MJ9L 5C9KA 1JNJA 1V3LA 3IJSA 3L7FA 5DYOB 3IDIB 1VFUA 2VLRA 2JIXD 3DV4B 1SEQH 3O6LL 3VA6A 2HLFD 1P1ZA 1XT5A 3BPOC 4NYLB 1MCPL 5D6CA 1A1NA 4YXLL 1NCCH 3BGAA 3NBNA 4NWTH 5C09B 4K7PL 3H2WA 1JWUA 4DKDC 1UWEL 2EIZA 3IS0X 5C0AB 5KAQF 1N5YH 2LTQC 4W4NA 4OZFA 2R56H 4Q9QH 3ARFB 1K4DB 1BX2A 4F33A 4JKPL 2EO1A 3JV6B 3REWA 1CLCA 1FC2D 2EIEA 3WN5C 1X3DA 4NN5B 5L2JA 2AEPH 1DVFA 2XTJD 3BP7A 4M1CC 2J5LB 2KH2B 5GJSH 2PNDA 3MRBB 1G6RL 1KB5B 4JO1L 4NZTL 4HAGA 1J86A 2J6EA 4BYHA 4HH9A 5IK3A 2HVJB 1HN1A 4JFEE 5ICXA 5F88A 2B0SH 4RAUB 1RZGB 2Z4QB 1KB5H 4FTVB 4P23A 4Y19E 5I1KL 3KXFA 4X9BA 4RDQF 4W6WB 1EEQA 3QDMD 1HI6B 3MNZB 3HZMA 5FK9B 4BJLA 3U0PA 1M71B 3PABA 3FFDA 4PS4H 3ARSA 3WEXA 4LSPH 3QDAA 1C7TA 3CSGA 4XPHL 5DD0L 1A6PA 4LVOC 3RVWC 5CP7B 3ARDB 2P47B 4EBQH 1E4KA 4KMTH 5FA3A 3E6FB 2NTFA 2HN7B 5F3HA 1ADQL 3A67H 4R0LA 4KWUA 3HAEB 3LSOB 3UBXA 3A6CH 1GZPA 2AJZB 5C0BE 1INQA 5JXED 1TNMA 3QWRD 4EN3A 1NBZA 1S5IL 3HAEH 3EO1B 3VXUA 4XXDB 3PV6B 3G5YA 3SDDD 3DO7A 3DSNA 1D5ZB 1HSBB 1I4FA 5FYLL 5AYUH 2Q7YA 1U95A 2PUQT 3FCTB 4LHJB 3E3QE 1N4XH 4UNVA 4WRLA 5BS0D 5AZ2H 4PRBB 2P8MB 4DN3H 1C8PA 3AS3A 2BSSA 2F53D 4HBCL 5DQ9A 5IR1A 2FATL 2FO4A 3WXWH 4JGJA 1D6EA 2K3TA 4ZD3L 4NKDB 5CZKA 3WNNA 3ECBB 1CDHA 4HS8H 4WV1A 4NQCE 5T3XE 1YDPB 3FQXA 3DTXA 5I74B 3KAAA 3PWJA 4FQXD 4X9IA 4XVUD 5HJ3A 1NGPH 1P5VA 2PO6C 5TE6H 2BDNL 4OV6F 3QIBB 3QAZC 3HI6L 4RAVB 2WP3T 4X7SH 1KG0A 3DRTA 3NOIA 2FIRT 2Z31A 3M07A 2AERT 1JWUB 1YN6A 4UQ3A 4FABL 4O2EB 4RMUA 3CDCA 3MZTA 4OZFB 4KK6C 4WFFE 4PV8A 5TQ0H 1VEPA 2NY5C 1BX2B 4X80L 4K3EL 4F9PA 4KRPC 1H3TA 4F33B 4QF1A 3REWB 4JFXB 4XP9H 5L2JB 1DVFB 4ZUUA 1CVSC 1BD2E 2APTA 2VR5A 2H1PH 3BP7B 1J11A 4DUWA 3BUYB 4JG1L 3ULUC 3IGAA 2JIXA 2XZQL 1KCUH 5HXMA 3QUML 3QEQD 3B3IB 1HKFA 4HH9B 3O4LE 4YWGH 3UTPE 1XMWA 5IK3B 1ACYL 5F88B 4Z7NE 2D0HA 5B38G 2AXGB 4HK3N 4P23B 4XP1L 5TJWK 1F58L 3KXFB 1UXWB 1VB9A 1JFQH 3U0PB 3HZMB 1KJVA 1K6QL 4RMSA 3PABB 3WEXB 4LLVA 4OCYL 3O4OB 3ZMRA 4F7TA 5LGJA 3FRPA 2NY5L 3SO3C 1CDIA 4HPOL 1KGCD 1I8MB 4X4ZA 4J4PD 3CFCH 4F7EB 3UBXB 1OHQA 4X6EA 4R8WH 3C60A 5KSAC 1MCIA 5I18L 1KTLA 4JFFB 4RBPH 4JRXE 1XGTA 2BHYA 4LIQE 4NUJA 3ULUL 4S1QH 1OL0A 1JI1A 1NBZB 3QDMA 4GKNB 2WQ8A 3VFPA 3VXMD 1EVUA 5F1NA 4QRRB 3WDJA 5CUSH 1ZHKB 3RIFK 3EDKA 4OFYD 2BSSB 4YHKL 4YLQT 2LFGA 5DQ9B 3T2OA 1I9RH 3PP3K 5DGQA 2FO4B 5E4EB 4O58H 4M93B 4UOW1 1D6EB 2BVPA 3B2VL 4JPKL 4XPFH 4Z18A 3OAZH 4YHOH 2VDPH 5JXEA 3QWRA 3RWHA 2XWJA 3MNVA 1GH7A 1YJDC 3D39A 3KLDA 3P0VH 3UTZB 3MRHB 5IV2B 2XOTA 1KN2H 4XCEB 4I3RL 1HCVA 1BFVH 4WW2C 4FQLL 2X6MA 3S34H 2CMRL 1DN0A 4PY8I 4U05A 5KS9E 4MQTB 1AR2A 1KG0B 5C0GA 3DRTB 3DX9A 3CIQA 2Y25A 1R3KB 2ZUTA 1AJ7L 3LRSB 3TT3L 3VWKD 4I0KA 4PV8B 4OGXH 4ODWA 3QUXB 1T1ZA 4EOWL 4FQXA 4KY1H 2D9QB 1REIA 5IVXB 3BGFC 4FP8L 2EE9A 5IVZA 1H15B 4KZDH 4A6YB 3UBXI 3F58L 2HVKA 4NO5A 5CP3A 3O45A 4L3AA 1ONQA 2NY2C 2CD0A 3BEVA 1YJDL 3T1WA 3K2UL 1G7IA 4OTXH 2ZSWB 2C1PB 1FIGL 4GW5A 4A6YH 1C16A 3HB3C 3O9WC 1MI5D 3SE3C 3ZL4H 1KJVB 4QRTA 5DEFA 5DJDA 4TPRL 1OAQL 2JTDA 4F7TB 5LGJB 3OKEB 2RFXB 4R4FL 3UTSB 1JZ3A 1HH6A 2DQCH 3PJSB 2ITCB 5DD3L 5EZJA 4XNQB 4R3SB 4PV9A 1ZVSA 4X6EB 1XGYH 1TJIL 2A73B 3BWAA 1NSNL 5ALBL 3TCXA 3MGOA 4XPTL 1J87A 4JFPB 1ZTXL 5C0CE 3V5DA 2Z92A 3TJHD 1RURH 2ADGB 4QWWC 3QDMB 4MA8L 4MWFB 4P4KD 5IVNA 4X8XA 5F3BB 5DSCB 4U6VH 4WI9A 4YXHL 3O2DA 2O5ZL 2EKSA 1TZIB 5FYLE 3BT2L 4XX1E 4BM7A 4YEFA 1LP9B 2OL3L 1BAFH 2MNUA 4HJJH 2VN7A 4J4PA 4DCQB 4GKSA 2HFFA 4S0TD 4XP4L 5CBEB 4DAGL 4OFIA 4ZFGL 5KVEH 3PGCA 5IMKA 3KHQA 5TDPA 2EC9U 2ATPB 5DA4A 1CFSB 1W2KT 4C58B 3SDDB 1F3DH 1T7XA 3VXMA 3E1F1 4PB9L 2J4WL 4M6NH 4R2GC 4UAOB 3MJ6A 2I25N 4P2RE 5BS0B 3RQ3A 1QFWL 3WFZA 4J3UA 4WFHD 4OFYA 2G75A 2F53B 2VKXA 3C8DA 5TF1H 3W81A 5C0GB 4GJTB 4LF3A 3MXWL 2NY3C 2NY6D 3VGAB 3BOVA 5INDA 3TWCL 3X3GL 1Q9OB 5C0RL 4ODWB 2D4DA 5HDLA 1XR8A 3HC0B 1FNFA 1JHLH 4GG6E 4FQXB 4LEOA 1G0XA 4RWYH 5E9DD 4HXAH 4V2CB 3EIFA 3MRGA 2J12B 3RWJB 3IDGA 2PYED 3OR6A 4RNRA 3GMQA 3D25A 4K7FA 1A3RH 3BP4A 4WCYL 1ZVHA 3O45B 3C2SA 1ONQB 1GGTA 1DE4B 3B8SA 3QXWA 1UKTA 1BBDL 2GUOB 1CQKA 1D3CA 3QJFA 2GJJA 4JVPA 3NPSB 4RIRA 2OSLB 3VWKA 4PJXE 2ZUQC 3TO4C 5DC4B 4U7KA 5DEFB 5DJDB 3TP4A 2Y72A 4I3GA 3W0WA 2C3HA 3DXAD 5L2KB 5MERA 4WUUD 4LHUG 5AD0A 2P5ED 3P30H 4OD2B 1LK3H 3QEQB 3P77A 1B0WA 2NX5E 4P9ML 3VXQA 1ZVSB 1IL1A 2ZG1A 3SDYL 5LJYH 4MA3A 4P3CL 2VJXA 3KPNB 2OR7A 3EUUA 4KQ4H 4NGHL 5DRNA 2I60H 4RGOL 5J1AA 3V5DB 4Y4HC 4NNYA 1NCWL 4Y7MA 3ULUE 1KEGH 4BA8A 3TZVD 3MRPB 1PSKL 4FQ2L 4CDGC 1NBVH 3EO0B 1IVLA 1YQVH 3VFVB 4M03A 3K74B 5D1ZC 2YD4A 5AZEL 4XWGL 4MJ4A 3KPMB 5DRZA 1FDLL 2HFFB 1JZ7A 3NFSH 5BMFH 3L3IA 4KXZH 1OF2A 5I73C 3WKNA 5L9DH 4RFEA 4BSVB 4HUVA 2B4CC 2GYSA 4HMCA 4X0KB 3F7PC 5J89A 3VXMB 3RAJL 3L3GB 1SEBA 2C7UB 2QJDA 3QI9C 3RVUC 1NGQH 4L3CA 1J9CT 3QHFH 5ACZA 2GK0A 1UZ6F 4BFGA 3L5XH 3HE7D 1SHMA 3T4AB 2H32A 3I50L 4OBSA 3HMWH 4LF3B 5K9QI 1FGVL 3GIZL 1ZLSH 1EO7A 5EUKA 4XTRD 3ZHKA 1EGJA 3VDAA 4MNQA 2DRUA 2YEZA 1HEZA 1ZLVH 1BLNA 5T5FH 4CMHB 3LKNA 3PGDA 4AEEA 1PQZA 1XGRA 1NL0H 4RNRB 2X40A 1MWAA 4G6FB 1DQJA 1S9VB 2B4CL 3D25B 4K7FB 4D9LL 4ZS7H 1IT9L 4LQFH 2X9YA 4HC1A 1U8IA 1ZVYA 3QA3B 4JO2H 5BV7C 4G5ZH 3C8KB 3VWKB 1MCOH 3JXAA 2WANA 3Q3GA 3L9RA 3MLUH 4U0QB 4ZAKB 3ARGD 1T22B 5L0QB 5MERB 3T77A 3FT3B 3MNWB 2HMIC 4YHNB 5IOPA 1T4KA 1TZHB 4XH2B 4Q9CA 1GGIH 2PYEA 1N6VA 2WLYA 1Q0XL 4G8GE 4JQIL 5DVLA 3RIFF 3NH7L 1ZWIA 4S1DD 3ZTNL 4IIQB 1IL1B 2P5WE 1KELH 3GMNA 1RULH 4NKIL 3QCVL 2WZPD 3VDCA 2GAZA 5DQDH 1JF5A 4QHUB 4ONOA 3F62A 1MI5B 1D9KB 4LASL 4NNYB 3GBMH 3MLVL 2UZXB 4LKCA 3GSNA 2FJGA 1UCBH 3IF1A 2GK2A 1KJ3H 2BNQE 3DXAA 4WUUA 5HYFA 4GAYA 1RJZA 5BV7L 5LGHL 2P5EA 4RMVA 1DN2A 1UEMA 2PCPA 4Q6IA 5KANG 5FOBA 2IH3B 5DRZB 1P4BH 2RAMA 5DVKA 1CT8B 2WIIA 3QXVA 1TQBB 5DRXA 4UBDC 4HUVB 5GJTL 2CK2A 2UZYB 3V8OA 4KVCH 2VXTL 5AWNL 5CEZL 4P4KB 5EFIB 4I8DA 3B9KC 4U1NA 3TZVA 2GJZA 4X5WA 2FYYB 1YEDB 3WO4B 3UX9B 4LMQE 4LSVH 1AGCB 5JIHA 4NNXA 5SWQA 5LWYL 4ONFH 4H20H 3VFGH 5T1KD 4P46D 3P4NA 4JDTH 1KJ2L 5GS1A 1II4E 3GO1H 1L9MA 2E9IA 3ZYJA 3MUZ1 4P3WA 1YEEL 2H32B 1J8HB 2WNGA 3TF7C 3RKDD 5HHOE 3QXAA 2WV3A 4JG0L 5F7WC 5EUKB 3AM8A 3TBVA 1XIWD 3LMJL 5ISZD 2YEZB 1RIUL 2H32H 4JR9H 1BLNB 1OARL 5ITBL 4OF6A 3SGKC 3PGDB 3GK8H 1AFVH 4K3GA 1PQZB 3L95B 3VFTA 1XGRB 3WFBH 1QBLH 1OAYL 3QSKB 5KTEH 2AQ2A 3TIDA 4FG6D 1MWAB 1F3DJ 3WUZA 4YDVA 1F11B 3NIFE 2IGFL 1B0GA 1IJ9A 4FQCH 1I1AB 4ZYKB 2FJFA 3OPZL 3HE7A 5EU6E 2J8UE 1EJOH 1FG2A 3GIVA 2HJFB 2GQHA 2NY6B 2FX8H 5CD3B 2CDEB 2I24N 3KPPA 4XP6L 3L9RB 4QXUL 3O2VL 1Z5LB 3R8QA 3LPGA 2XA8H 2H6P