1TNMA

Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
91
structure length
91
Chain Sequence
RILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TITIN MODULE M5
publication title Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Muscle protein
total genus 11
structure length 91
sequence length 91
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tnmA00
4K55A 1NCAL 4MLSA 2QSTA 4HT1L 4V1DB 5E7BA 2DLIA 2Y9RT 1KCSH 4XPHH 1ROWA 5IFJB 4JDTL 3M1BA 4WI8A 3OG4B 4ONGL 4XNMB 5E2WL 4PJEF 3W9DA 5IT2H 1P1ZA 3DYOA 5DC4B 3I2CL 1QLRB 1BLNA 4UQ3A 4OFVA 5GGUB 1DBAL 2WAHA 2AVGA 1S7RA 3FFDA 1YMMD 2C1PB 3HRZA 1FRGL 5GRVK 1T83A 1X4XA 2QSCH 3U7AA 4D9QD 3DHJA 4JN2A 1IGCH 4ACPA 4YHNA 1KT2B 3ARGD 1QSFD 3L3GB 3T8XA 1JNHB 3V6ZA 1M71A 3EYFA 4X98A 4NUGH 4KMTH 3S34H 2AJZA 4UQ2B 3I3EA 1JE6A 2BNRA 2JJUA 4U6YB 1E4KA 3U9PH 4LHUG 4CJ0A 5E8DL 2DQCH 2R1XB 5E6IC 2X4RB 1ND0A 4HJJL 4PGBB 4URTB 3UBXG 5HJ3A 4ELMB 4MX7A 3RL2B 1ZT7A 2I27N 1QEWB 2DMBA 2A2QT 1X5FA 2IFGA 2AJSL 1UM5H 5GJTH 1HHGA 1VFAA 2YD8A 3RZCA 3JXAA 1KPRB 3KPSD 3KDMB 3WHXA 4XMKL 4KJWD 43C9B 4PJHE 1BQSA 1DBJL 3P9WB 5E5RB 4X4XB 3FB6B 2CIIB 3CDFA 2E6PA 3H9SA 1TZIA 4PTTB 5I1KH 3K80A 3MFFA 4TUOA 3S35X 1DQMH 4L8SC 3HMXL 3R4DA 5DURD 5DYOB 4AEIL 4YHKH 4MMXC 1ZHBB 3WJLA 4PJIE 1JPST 5FYJD 4ZUUB 1FVCB 1JWUA 4N9GB 1MIML 2QQNL 4PJHF 3JV6A 4K94C 5T5FH 5JO5A 3TNMA 2WBJD 3KPOA 2X2YA 3TFKD 2GSGB 3T2NH 3GSUB 3SE8H 3JVGA 4QXGL 1CF8L 4MDIB 4KI5C 1I85A 5T1MB 2P5WE 1GOGA 1GAFH 2VDNL 1PKQE 1K85A 4GOSA 1UFUA 2NLJB 1AE6H 1MUJB 1ZANL 5I0ZA 3RDTA 4P2QA 2AGJL 3K8LA 3RBGA 5GRYA 5D1ZC 1KC5H 3WEXB 5E8PB 1R5IB 4J3WA 4MQXD 5DQ9B 1J86A 5I30H 4HKZA 4MVBD 2XG4A 4KROD 4C4KO 1HCFX 1T20A 3BD3A 4HW6A 1TJHL 1ADQH 5C0CB 3SGDI 2VWEC 2K1MA 4LQ1A 4KRPB 4RMSA 1I8IB 4X4ZA 5EWIL 4MDJA 2WK2A 1KCRH 4D0DB 2VR5A 3BPLC 5CJ5A 3QIWB 4MA1C 5BO1L 5FCSH 1YY8B 3SKJL 3LEYH 3DV6A 3ZO0A 3MUGB 2VLJA 1NMCC 1T7VA 2ZSVA 2Z4QB 5L2JA 4ZSOB 3GB7A 4HIJB 4P5KB 4FTVE 5CLWA 4Y89A 3L3HB 1YJDL 3FQWB 4RGND 3QWRD 4ISVA 5IVNA 5JOFB 3P0GB 4X9FA 5DRNA 3BGMB 2XG5A 5J9PA 4E0RB 3BWUC 1U58B 3UEZA 2V7NB 1KYOJ 3OKEA 3B6SB 2A6KA 3U0WL 4UZGA 1NDGA 2ZCHL 1I7ZB 5E5MB 3KYNA 1HOCB 3DBXA 3C60C 1I4FB 2XWJB 3LS4L 1JTOA 4G42B 2C3XA 1N3NB 5E94A 5BS0A 4L4VE 2QTEA 1M7IB 3WIFA 3SN6N 3FAXA 1JI2A 1YNKL 3FOLB 4UMGA 3IU4H 1HNFA 5EU4A 1NAKH 4FFZH 3KLHC 2FO1A 1TMCB 4JKPH 3DTXB 1ZVHA 1KSRA 2A73A 4XBGB 4GAYB 2VN4A 4PJAA 5IGXL 5LWYL 1AGDB 5C0BD 5I1IL 4G8FB 4PBWD 4N0FB 4XXDA 3UJIL 4YWGH 2NR6D 4IOIB 1A6UL 1QLEL 1G9ML 4UINL 4EEEA 1UWEL 3VA6A 4LIQE 4NNXB 4NFDA 3ARSA 1G0DA 3PWUB 5FUZH 2EXWD 3QJHA 5DJCB 1RURH 3F58H 5F9DC 5F1OB 4QEGA 3QULB 4Y5YB 5EBMA 4FG6D 3HPJB 1DFBL 4PRAA 4GSDH 3RGVA 1XIWB 3NBNA 3QDME 1TETH 3M17B 4HS8L 4LCUB 4IM8A 3F7VB 4JFHE 15C8L 3LKOA 2ZWLT 5DJDA 3JWOC 3NPSB 2FSEA 4AIZB 3INUL 3GNML 1WCQA 4F7MB 1A2YA 5EN2B 3VI4E 2YC1B 3L9RB 2AJXL 5DSCA 4TVPH 4X7TA 5TDOA 3U6RB 2BRRL 1T0PB 3CVIL 4NWTH 4KZEH 3V5HA 1MWAH 1P9MC 4PJDE 2VWEE 4M03A 4PGDB 3BT2L 1QA9B 3AB0C 2VO5A 3GSVB 4WV1C 4I3RL 1OTUD 4LBEB 1E0OB 1RMFL 1A6TB 2GTWB 3VI4F 5JR1H 5IB4A 4K8RD 3MR9B 1EIBA 5ITFA 4NRYB 2DLTA 4K3JL 1TDQA 3OJVC 2K7PA 4J1UA 4PJDF 2HRLA 2ZSWB 4OGXL 1AGFB 1MFAH 4M5YL 2PETA 3FN0L 3EO9L 4XCNB 3VFNB 2DOCA 5ANMA 3B2VH 1WUNT 1U8HB 3O4OC 1NKOA 3QRGL 1W72A 5J6GB 2HFEB 3VXUE 5IB2B 4HCRA 1ZGLP 3UTZA 4YXLH 1H0DB 3BEWA 3AS0A 1EAJA 2FO4B 5TH2A 4U1KB 1BP3B 4MA8H 4HWZB 3I6KB 1F13A 2MJWA 5IVXB 5C07E 2BVUA 3VWJB 5E24E 3MLSL 4P2OC 1OAKH 2J88L 3CVHL 3ZHKA 1LK2B 4M7ZC 1OP5K 4H88L 2VE6B 2GTZB 4YQXH 2J12B 2IQ9L 4JFDD 1CXLA 3K2MC 2ATPA 1W72L 2F54E 4YAQB 1IGJA 3VDCA 5CZVL 5CGMA 1YPZE 2BX5A 5M95B 3C6SB 2YEZA 3EJZD 4NQEB 1X5XA 1QLRA 2G9HB 3RU8H 2VTFA 5FM5M 5GGUA 4P4RA 5F1KC 2FBJH 3ZMRA 1FL3A 4QHKJ 4Z7VE 4X5WB 3ES6B 3KPPB 2AJ3B 4ZXBA 2O61B 1ED3B 4ONHB 1C5CH 4IJ3B 5GGSY 5GIRB 5B8CC 2OJEB 1FP5A 1LK3L 3MSPA 2AXFA 5HSFA 1YEIL 5SX4H 1YPZF 1JHKL 1WIUA 4U0QB 1U2CA 4LKXB 4Z95H 4UQ2A 3KWWB 2CK0L 5AG8A 2EDTA 4WWKA 3ZTJH 4Z7VF 1BIIA 3TBYB 5AYUH 4PGBA 5IK3A 4K3EH 1QG3A 1CFNA 1U3ZA 3RL2A 5JOPD 5DK0B 3E2HB 3OXRA 6FABH 1HSBB 2H3NB 3UO1L 1YZZA 4IHOB 2OP4L 5C0FA 4UUJB 4HKBA 5HHNB 3KDMA 2Z8WC 43C9A 3SCMB 3B2UD 2BVPB 4MA7L 2CIIA 3QCUH 4Q9CA 4PLKD 2ED9A 3NCEB 4LCIL 4ZOCA 4H1LH 4Q2ZB 5D7LB 3IDXH 4N8VA 3VDBA 1FVDA 4OD3L 2XV6B 3BHBA 3RNQA 1B4RA 2AV1A 5T3ZE 4QKXB 4NJAL 3P3YA 4ZUUA 4PG2A 3EKCA 1WBZB 5F7UA 4U1JA 3BKJH 1MFCL 4XCCH 2PYEA 4QRTB 3SBWA 1C16A 3CZJA 4R97C 2B4CH 3LQAC 3FN3A 2GSGA 4FFWD 3CSGA 5T1KD 5T1MA 1KTKE 4NN5B 4EI5C 1Q8MA 5DJ2B 1TQBB 4L4JA 1T04B 1JCKA 2DQHH 4MD5B 1MUJA 2I9TB 4N0UA 4ZUSA 1UM4L 3V4VL 1ITCA 2Z8RA 1J1PL 3S35L 2N56A 3TJEH 1A1NB 2XWTB 3WEXA 1R5IA 5C0JB 1F4YL 5DQ9A 5JLZA 5KZCB 1OW0A 2IADB 4LKCB 3OTTA 1JPGB 3MUJA 3DVNB 4I0PD 4G8GE 5C0CA 1FNAA 2X09A 3A6BH 2YUVA 4QHLB 4D0DA 3IF1B 1MSPA 5DRZA 4M7JH 4JR9L 3T08A 1OVZA 3NFSL 2R0KH 1V3KA 2AK1L 4NPYB 3UJJL 1WBYB 4Q7DA 1KIRB 4OCRH 1XT5A 3BP7A 3RWEB 2Z4QA 3ARFD 4ZSOA 4P5KA 2AI0H 3EFDH 1P4BL 4HPOL 3BX7C 3FQWA 3QEQA 2XY1A 5K9QI 4MJIB 4TPRL 4GKOA 4JZNA 1BWMA 1I8KB 5ADPH 2A9MH 3C87A 3QUZC 2V7NA 5BQ7B 4E0RA 4I2XE 3B6SA 1MCFA 3VH8B 1AFVL 1XF4B 4WUUE 5E5MA 1QFWI 4GBXB 2Y5EA 3K1KC 4WU7A 3HZMB 4JRYA 1N3NA 4P9HL 1PEWA 4PJXA 3S7GA 5CEZL 5T33L 5D1XC 1CQYA 4NKMB 1IGYB 4JFEE 3OXSB 5DEFB 3VFVB 3QEGL 4YH6A 5IP4A 4PJ8A 3HNSH 2FGWH 3CH1B 4Q9BA 3SO5A 1RFDL 3T09A 1J0JA 1JPSH 4YX2L 4P3WA 5I1EH 4GAYA 4CGTA 4CW1B 1AGDA 4WFFE 4RGMB 5ICZB 3ARPA 3DYPA 2GQHA 3QHFH 3CFKA 2H32A 3H3KA 3IFNL 2UZIL 4LSTH 4MWFB 4IOIA 1JIBA 2Z0BA 4WI3A 4LCYB 1YDPA 4NQCB 5EU6D 3BKML 2FH8A 3T1WA 3KXFB 4XNUL 4Y4KA 5FOJA 4W6YB 3PWUA 4FQXD 2YSSA 1XF5B 4LP5A 4F37K 4LHUD 1PX3A 3SDAB 2IGFL 4Y5YA 3KJ4B 2VZVA 3HPJA 4UAOC 4C56B 2YR3A 3LZFH 4JY4B 1GZQB 1IAOA 4KKLC 1J1XL 2XZQL 2YD1A 3OSKA 2Q8AL 2P5EE 2HYMA 4ORGB 4YHPB 3VJ6A 2WIMA 1DBKH 3BPCB 5INCB 4UV4L 3V8CA 4FNLH 4AIZA 1T1YA 2F53B 3MTRA 3V7AG 4F7MA 4X7SL 4CN1A 4ENEC 5EN2A 3VG0H 2YC1A 1INEH 3L9RA 3MODL 3O3EB 3O4LE 3AMLA 4RWYL 4L3ED 4RFOL 1KEMH 2HG5B 1MY7A 5EOCH 2FL5B 1IL1B 2YUXA 4OGZA 4YBQD 5KVEH 1QA9A 1JZ3A 2OR9L 4MD0B 5FYJH 4WY7L 4KAQH 4M62H 3WCYA 2MFNA 2VERN 3EDEA 3VGGA 5KVFL 1MJJB 3C8HA 4LBEA 5I1JL 2R0WH 3V7AE 4A6YB 1QSFA 2DI9A 5EZIH 1ETZB 2Y06L 1MI5E 4G3YH 4G8IB 4IEFB 2I9LB 1FNGA 2GTWA 3GBML 2CDEA 5FXCH 3VFTB 1KFAL 1CLZH 5CZXC 3SDXB 4XCEB 4NRYA 1P7KB 1FE8H 4FQ2H 3PDDA 4MXQD 1FC2D 1LO3H 2CD0A 1HSAA 5C09E 2ZSWA 4BQBA 2E3VA 2RAMA 5TFSL 4RNRB 1AGFA 1JRHH 2C26A 2HJLA 4XCNA 1EEUA 3VFNA 4MNHB 1U8HA 5IMLB 1CU4H 3DV4A 1Q9OB 5IV2A 5J6GA 1BD2D 3TYGL 1H0DA 2FO4A 1BIHA 3BSZH 3G6AA 1FZMB 4HKXB 1MQ8A 4JG1L 4AL8H 3S4SG 1F4WH 3HAEH 4GW1B 3VWKB 4P57B 1I3RB 1FO0A 2ARJA 5IVXA 2H1PL 3MRGA 3VWJA 1UQSB 3UTSE 1ZEAH 5FECA 4QNPE 1J18A 1N5YL 4NBZB 5E6ID 5BZWB 2P24B 2FB4L 1U92B 3SGKA 2V2WA 1FDLH 5CJQL 5D5ME 4YAQA 2ENSA 3O8XC 3C8KA 3C6SA 4J4PA 3SE3C 2VXSH 5J0BA 4NQEA 5A2KH 2G9HA 2WBJA 4ZS7H 5DC0A 5L6YL 1KXVC 4QXUH 1ZA6A 1BOYA 1S7TA 2AJ3A 3HPLA 1FYTB 2O61A 1ED3A 4F8TA 3BOVA 5GIRA 1CFQA 1CVSC 1HH9A 5EA0H 4BK5A 5D6DC 4I8DA 3G5ZA 3ULUD 3FMGL 4CVXB 4M8QA 3RUGB 2E7CA 4JQVC 5D5MF 4CUCA 5LCVL 4Y19B 2ATKB 4DVBB 1CZ8H 4XVJH 1LD9B 4DGIL 4JY6B 5DJXA 1HHHB 4G9FB 3ALWA 1FIGL 3JWDH 3ULVL 2CDFA 5DVOA 2F58H 2EE2A 5C86A 5I0DA 1RZJC 1K8IA 5DK0A 5JW3H 4KI5D 3RJDA 3ZT7A 4FP8H 2PTTB 3MMEA 4YHMH 3E6HB 3ARDA 5E1AB 4IHOA 4JFHD 1IKFL 4JCLA 3BMVA 4UUJA 5DHXB 5IMKB 5HHNA 5GISL 3FONA 4KFZC 4OZIE 4O9HH 2COQA 4NM4H 1JNLH 2BVPA 5D1ZD 4MZ3A 1JPTL 2YPLE 3X3GH 1AHWB 4KC3B 4TQEH 4HMDA 4XBPA 2EECA 1F3JB 4Q2ZA 5JW5B 4YHLL 4NKIL 3TBTB 2F5AL 3IJYB 1MAML 5E2UH 3V2AR 5FAAA 4L9LB 2G2RA 3TT1L 1TLKA 1KLFA 4PY7B 4ALAH 1N2RB 5DJ6B 4AIXA 1XAUA 2CJUL 4UDUB 2VUYA 2B0SL 2RHEA 1U3HB 3Q5TA 4LCCC 4OZIF 5KVGH 1WBZA 3VXSB 3SDDC 2NXZD 5F7HA 3MCLL 3S98A 1TJIL 1CR9H 1FQ9C 5D7JB 7FABL 4WTZA 3I3BA 1B2WH 3ILPB 4ZNEA 4OQTL 4OF6A 1QSED 1N4XL 1EFXD 5CIPB 1CFSB 4NCC2 5ID1A 2V9QA 4IMLB 1FLRH 2DDQH 1MCHA 4Y5VB 4LSRL 3O45B 4J2XA 4FQJH 5D70H 1A1NA 3X12A 5CAYB 1C5BL 4HUKB 4OLYH 5FKPA 5DRWB 5C0JA 5J11C 1JVKA 4K8RH 2IADA 4KK8C 2AJYL 2FD6L 4HLZH 3ZDXE 1SM3L 2WQ8A 3HNTH 5E8NB 1QSZA 4JFFE 1NQBA 4PYGA 4HLJA 4M48H 2W07A 2C4XA 2HRPH 3TBSB 3L3JB 4C4KT 5CILH 1TXKA 3QXWA 5C0AD 3RHWK 3FAWA 4NPYA 4HUUA 1WBYA 3P11H 4Q6YA 1MPAH 4KPHH 4QRRA 3O11A 5C6WH 1X5LA 2CMRL 3RWEA 1WJ3A 4RGOL 4NCDA 4XP5L 4PREA 2VXTL 1F8TH 2B1AL 4LLVB 5DDHA 3ZDXF 1OPGH 3AROA 1KEGH 2OZ4H 4MJIA 2X41A 1N6VA 4UBDC 5C08B 1JHLH 1XGRA 5BQ7A 3T77A 4R7NB 1XF4A 1T7ZA 1CDJA 3P2TA 4Q9RH 3HZMA 4TNWF 4XP6H 2ADFL 2QSQA 1A6VH 4WUKL 1XCTB 5GHWH 4NKMA 5EDXA 1UJ3A 5DEFA 3OF6D 1L6ZA 1NC4B 3HRPA 1T7WA 3SKNB 1B9ZA 1AQDA 3WNLA 4X99B 2L4OA 3L5HA 2FX9L 3LN4B 5KAQG 4LSQL 2VH5H 3NACH 4Z0BL 1FSKC 5ICZA 5JNYB 1VDGA 4HHAB 4MWFA 5SWSB 3D39E 2OK0L 4KKAC 1QNZL 3BP6B 4LCYA 3UYRL 1GPOH 1IGFL 2RFXB 3EJJX 1JWMB 4NZTH 4CU6A 2E6QA 4MXVE 4QRPD 2DICA 2GAZB 1ZLSL 4DUVA 5F7EL 1XF5A 4WTXA 4G6FB 4WCYL 3FFCD 4AYFA 4WGVB 3QUMH 3VW3L 4ODWB 3BPNC 5I1DB 4NC2B 3SDAA 3AY4C 4OM1H 5JQ6H 2CKNA 4JJ5B 4JEGB 4DGVH 4HKJB 4UT9L 4ZTPL 4GLRI 5IHLB 5ESQA 3QDGD 5F96L 3VXMB 4OLZL 4ORGA 1OAQH 1P4IL 4JFDA 5C8JB 1K2DA 4OF7A 5EO9B 5INCA 4F33B 5T3ZD 4MXVF 3VXTB 1UZ8B 5JPNA 3OR7B 4EOWL 2F53A 1WAAA 5HYJB 2NMSA 3RWIB 2EYSB 3TPKA 2IWGA 1WIPA 1KCKA 2KH2B 3QRFM 2BSTA 3O3EA 1KJMB 4AT6A 2AQ2A 4TOYL 4ORZC 5DUML 2VDLH 4OLUH 4DN4H 2B1HH 5EOTB 2HG5A 4LNRA 2FL5A 3O9WC 1IL1A 1HILB 4LARH 3W5NA 5DWUL 3GBLA 3HUJB 4S1RH 1QKZH 3CXDL 4JQXC 3BZFB 4G8IA 2I9LA 4ZPTA 2GJ6B 4WU5B 4I48A 3MLZH 4XCEA 1P7KA 5H35B 2CQVA 4Y5XA 3LRGA 2FJGB 3SDCC 3N85L 2QSVA 4DUWA 3QSKB 4G8GD 4RNRA 5BXFB 4LRIC 3BDYH 1E4WH 2IC2A 1KXQE 2FX7H 4A6YL 4Q74A 4D0CA 4HZLB 5J06A 2ZKHL 4TSCL 3HMWL 3L3KB 4QHUA 3FO0L 1FZMA 5M94B 4H26B 1IC5H 5FFLA 4GW1A 3VWKA 1HQ4B 4P57A 5HHVL 2CKBA 3MRMA 3EBAA 4OIIH 3GMNB 1CS6A 3OR6B 2HFGH 4JQIL 5FYKD 4GKNB 1DLFL 3FQTB 2P24A 3TESA 2W59A 2M2DA 2BSSB 5DJYB 1XZ0B 3REWB 3V4PH 3T0EB 4PP1C 1RZKH 4O2FB 5EBLA 5HHOD 4PJGE 1EERB 4KY1H 2X4OA 5D72H 5E0QA 5IHBA 5H94A 5D7KE 5IJKC 5C0RH 1RIHH 5T1KA 1NGPH 5IESL 5EPMB 4KWUA 1NAMH 2NPLX 4R90H 3QQNA 1T1ZA 5LGHL 4WFFD 3WUZA 4M7LL 4KKNA 1RSFA 4CVXA 1J88A 3P77B 3RUGA 5GGVH 1IM9B 3WDIA 1QR1A 2ATKA 3GI9H 4DVBA 1K9TA 1DDHB 1T22B 2DJSA 4U1LB 1LD9A 2NY5L 4UIKL 4YDIH 2AABH 2G5BB 3NZHL 4PJGF 3O6KH 4JY6A 3MROB 2JJVA 3PV6B 3MV8E 4I0PA 3RNKB 1HHHA 1UYWL 5EFIB 4M9PA 4CMHC 3CPLB 1KENH 3KYMB 1X5HA 4G6JH 2RQ8A 3MGTB 3WIIL 3ARQA 1PQZA 4EI5D 2XNAB 3PF2A 3MJ7B 3E6HA 4X4MA 4XC3H 4JREC 2GI7A 4RISH 2YD3A 3T3PE 1OF2B 3MLUH 4PJCA 1A7OL 4Y4FB 5E4EC 4LOUD 5GS0L 3F65A 1NPUA 3LEVH 4X4YA 1AHWA 4JANA 2VDRH 3O4LD 2K9UA 3PHOB 3RVVC 3V0VB 1IAIL 2IF7A 2DQGH 3K2UH 2XI9A 3TBTA 1PYWA 1EUUA 5SX5H 3IJYA 2J2ZA 3D9AH 4L9LA 1PW3A 3QA3B 3TT3L 1ZMYA 3TCXA 1N2RA 4GKZB 4HWUA 4UDUA 2WLYA 3JV4B 3GJEB 2QKIB 4QY8B 2JELH 2V5TA 5GGRB 4JO1H 1A1OA 2OI9C 5FHBH 2YN3A 1MI5D 4X5XB 3LPGA 4CNIB 4XBEH 2E27H 3NFPA 4LF3A 1BZ9B 5D7JA 1AQKH 1YY9D 2ICCA 5JA8B 3ILPA 1BFTA 1HHKA 3VG9B 5CIPA 3WNPA 5CEYB 5T1DL 5C09D 5FK9A 4GMTL 1DEEA 4LLQB 1B3JA 3L5XH 5IBUB 3QUZD 4Y5VA 1HQRB 4YZFE 2ILLA 2V2TA 4YE4H 4M6OH 4S2SB 5DRWA 1E4JA 5A43C 4N0YH 4DKEL 5IG7B 1T03H 5CSBA 3G6DL 1OTTC 2GIYA 1AJ7H 4FQHB 4LLUB 4XPAH 2Z93A 4XZUA 4ZFGH 2DTML 1RJZA 5E8NA 4E5XB 3LVEA 1D5IL 3QXDB 4QT5B 5A40E 3L3JA 2NW3A 5E9DE 5F3HA 1ERNA 3TIDB 2ZNXA 2VXVL 3DMMB 5C2BL 3TO2B 5IBLC 3UTSD 2BVTA 2D7PA 2KZ1B 4WW2A 4AENA 1PBYA 3G5XB 3L7EB 1A3RH 5I8OH 4QRSB 3PL6C 4LVOB 4BQCA 4FOMA 1KCSL 4XPHL 4XHJD 1FV1B 1G0YR 4MNQE 4GAGH 1OP3H 5C08A 5JXAH 3F6LA 1N8ZB 5L0QB 3CFDB 1G7QB 3K81A 4R7NA 4XP1H 3QFJB 3HZVA 5IT2L 2I07A 5A2LH 5C0GA 1A0QH 5TF1L 3D3VB 4MSWB 4KTDH 3ARBB 4PJBB 1PVHA 4BH8B 1SMAA 4KKLD 2XN9B 3EO1B 3PWJB 4Z7NF 1B88A 1BJ1H 4LGSB 1MHPH 2VL4A 1IGCL 4X99A 4ENED 1RK0B 3LN4A 3MRNA 5HVWA 2VDMH 2VLRE 2IMNA 3HFMH 3NGBB 4NUGL 3PWPE 4KMTL 4CAGA 5JNYA 4OV5B 3MBEA 3S34L 2WP3O 4HHAA 3MJ6A 3Q1SL 5SWSA 3IS1X 5E00B 1J0KA 1A6WH 3S3SA 4LIQH 2Y25A 3MV9B 4P5TC 4JJHA 2N7AA 4JFOA 1BD2A 2UYLB 1K8DB 2GAZA 2R0LH 4GRLB 1UC6A 3EOBA 4K94H 3UC0L 3H3BC 4ODWA 1CTNA 2IPUK 5I1DA 1CVRA 3RWGA 3ALPA 3LMJH 5EU7C 5I75B 5CZXD 1SJEA 4DTGH 1EBPA 1IZKA 1IAKB 2V5RA 3LOWA 5DGQA 3R1GH 2W0LA 5EG6C 1GIGH 1XGQA 3GI8L 5F9AC 5I1KL 5K9KB 5A2IH 2ADIA 2DIAA 3RWIA 3SGEI 3DI2B 5IMOB 1H3GA 5AEAA 1RK1A 3CLFL 4KDTC 5IHZB 3FCTB 2OLDA 3X11A 4JRXE 1T89C 4B7LA 5EOTA 3VXRE 1JGEB 1S9YB 1VKXB 4F7PB 4OCWL 4J6RL 3MRHA 4JZJA 4DCQB 1HILA 3MNVB 4BFIA 1Z3GH 5T5FL 5KBNC 3HUJA 4RAUB 3JTTB 4NQDB 5GS3A 3T2NL 3SE8L 3MV01 2ESVB 3BZFA 2UWEB 4PRDA 3ULSA 1IAII 4NO3B 3D5OF 4WU5A 2P42B 4IOSD 1GAFL 3U79A 3RWJA 3JBG7 5DFWH 5E8EB 4B53A 4R96A 4AIOA 3BZEB 2AS5M 5L2KD 1BZ7A 2FJGA 1P7QD 4FZ8H 4MJ6B 3S8WA 1PEZA 4RFNC 4HK3J 5IBTH 3MRKA 3P4OA 3EYOB 1J8HE 5ENWA 1RAMA 5L9DH 4M00A 3P40A 3RX5A 2YHGA 3T4YA 4HZLA 3CU7A 5HI3C 2IH3B 5MI0B 3L3KA 1KCRL 2Q86B 5CUSH 2Q6WB 1QTYT 3GMMA 3U30B 1LP9B 4ERSL 4KU1A 5HYQA 3LEYL 1NEZB 4P2RD 4R2GC 4FMFA 1U93A 2R9HD 1S3KL 2HN7B 4MXWL 1RQ5A 2Z31B 4UIMA 1YYLH 4Z7UA 1ZLWK 3BEVB 4OIAA 1A6ZA 1D9KC 4C83B 4PLJC 4X6CB 5DJYA 1XZ0A 5CSZB 4CDGC 1JGVH 5DK3A 3T0EA 1MCEA 1Z0NA 4O2FA 2GKIA 5TE4L 5D1QC 2AEIT 5I19H 3MLTB 5HVFB 4OLWH 4N8PA 1FCGA 1OAYL 2ARWA 2BZDA 4TUKH 2EKSB 2NY2C 3KPRD 3U4EB 3BE1H 1MREH 5EU7E 1KGCD 1QSEA 4XVTH 2VDPL 3MRDA 1EFXA 4JHAH 1BF2A 2X9WA 2ZCKL 4YDLB 1GGTA 4Q6IB 2EXYC 4YGVB 1KG0B 1MJ8H 3W0WD 1CG9A 5F89B 4OZHE 3P77A 3D25A 3V6OC 5MENE 1NDMA 1NANH 2HKFL 2ICWB 3HE7C 4FFZL 3D39D 3ZL4H 1CXFA 1BF8A 1IM9A 3FJTA 3BGFB 1X5AA 3JWOH 4HV8A 1T22A 2J5LB 4U1LA 4DOHB 3BZ4A 4WHTA 1XF3B 4B5EA 1H3PH 1GC1C 3MROA 2FATH 1VFMA 4YWGL 3PV6A 3SDDD 2DWEA 1G6VK 3RPIB 4AMKL 1RJYB 1SY6H 2ZG2A 3CPLA 5LXGH 3MLVH 2F74A 1JFQH 3MGTA 1U8LA 5C0AA 1NGZB 2XNAA 4OZHF 1I1RA 4OTXL 1TZGH 3MJ7A 3UTTD 5T3XL 3KHQA 1AGBB 3GGWB 1PY9A 4LHQB 1FYHB 3D87B 1OF2A 4Y4FA 2YD5A 5F7NC 1TETL 1LWRA 1WT5C 3WMSA 2OXGA 1PLGL 4KK8D 5GS2D 4W68A 3MREA 2XTJB 4FFYH 5GGTH 2QADB 4R7DB 5IROC 4AM0B 5T3ZH 1OSZB 3QUYC 3OJMB 3C5ZC 3GJEA 4G80A 1UH2A 3HB3D 4TVPL 1MFEH 4QY8A 4XPTH 4YHZH 5GGRA 3RTQB 5F7MC 4OT1L 4KZEL 1EPFA 2HT3C 1QBLH 3ARYA 3QP3A 4X5XA 3LV3B 4CNIA 4HFWB 5D96C 1EZVX 2ZUQB 2ZCLH 1BZ9A 4P46C 2YWZA 4RMWA 5CEXA 1RJLB 2DYPB 4XVSH 2WQRA 1FVEB 4G8EB 1MFDH 4OUUB 4KROB 4LLQA 4AJ0A 3TPUA 2LU4A 5JR1L 3I75B 1HQRA 1URLA 2VLKE 3IDIB 3CU1A 5DFVD 3PXJA 2D4DA 3FQRB 4EDXB 2D9CA 1NCDL 4ZNCD 5IG7A 1KPUB 4UNVA 1IM3B 2C1OB 3FFCA 3B2VL 5BW7A 4PV8B 4QT5A 3IFPB 1T5XB 4LSUH 1A3QA 5DRXB 4Y16D 5BZDB 4JN1H 4YXLL 4ONOA 2H41A 4PB9H 4MA8L 4RMRA 4IRZL 3SGJC 5TF0A 1KJ2A 1GZPB 4M5ZH 5HGGS 3G5XA 3L7EA 4OLXH 4MAYC 5KSVA 1YECL 3H8NA 2X89A 2XZAL 2VAAA 1VPOL 2L0DA 4YQXL 4JPWH 3R06B 4AG4L 3C5SA 5FYKH 5D6CB 4NO0B 3CFDA 1G7QA 2ZUYA 1HCVA 3QFJA 2BDNH 5FGBC 1A7PH 5K33A 3SE4A 3R8QA 1K3ZA 5HY9A 4I18C 5E99H 5TDNA 4MSWA 5HHQB 3VE0B 2XN9A 2FBJL 3PWJA 3G5YB 3DLQR 5CWSB 1WBXA 5C0DB 1LMKA 3C2SA 1WZ1L 1XF2B 3CC5B 1IARB 2MCPH 1RK0A 2W38A 1JPFB 5D93C 1CL7H 3BW9B 5JHLH 4GS7C 1EJOH 4X6DE 2AW2A 5E00A 2J4WH 3RY4A 1LVEA 2KQNA 3IYLW 3MV9A 3N50A 4CVZB 1REIA 2VDKH 2UYLA 1K8DA 4K3EL 4O58H 3DSFL 4GRLA 4CDHA 1NBZA 4GQ9H 4AEFA 1T83C 1K4CB 3SQOL 4BSJA 1A4KA 3PNWB 5F9WC 6FABL 1ORQB 1D5BA 3T0DA 2VN7A 5JW4N 3BKCH 1KB9K 5HYSG 4UU9B 4X6DF 2FYYB 3I02B 1IAKA 2XOTA 3SDCD 1NFIB 1H3UA 1KIQB 3PGFL 2AP2A 3H7BB 1J9CT 4J3XA 3QCUL 3VFWB 3LAFA 1NCBH 1E4KC 3IS0X 2EDQA 4DEPC 3VFSB 5K9KA 4RRPG 1X4YA 4BK4A 4NQVA 1RHHB 1A47A 3MXWH 4L4TD 3ARWA 3IDXL 3GBNH 5IHZA 4PJ5E 5ERWA 4Y4HB 3ZSTA 3OAUH 2H2SC 3CUPB 4RA0C 4NNYB 4MCZB 1JGEA 1QO3A 1MF2L 1SMOA 1S9YA 2O5ZH 1ZTXL 3RZCC 2Q7NA 4PJ7E 1E4XH 4F7PA 1DANU 4DCQA 3MNVA 3BKJL 5I66B 3D85B 3BD5A 3CDGB 4RAUA 2B4CL 2CLVB 3JTTA 4NQDA 4S1SH 1B0GB 1BECA 1BFSA 1I1YA 4E41B 4NO3A 2W91A 2CH8A 5T1LD 2NYYD 3GMLA 1I1FB 2DQHL 5E8EA 4PP1D 1FGNH 3DVIA 5DMJB 3MLPA 5E2TH 1MCWM 4MJ6A 3WJLC 1FCCA 1G6RH 3TJHD 4PJ7F 2UZYB 4OGYH 3TJEL 2AK4B 4DVRH 1P84J 3EYOA 4K3HA 1QYGH 1JNJA 4HX1B 1ZHKB 2KDGA 4ZUWB 1M7DA 3C6LA 4WI7A 3KAAA 5DD5L 3S37H 4XNZC 1IILE 3JVGC 3G6JE 3S5LA 1I85C 3A6BL 4JM2B 2Q86A 5F70A 4M7JL 3P9MB 1I9RL 2R0KL 1J0ZA 4MHHI 1HI6B 4PTUB 3VD3A 3RDTC 1NEZA 1F3RB 5D7IA 3O2DH 4MNQD 4JHWL 4OCRL 1W2KT 3FT2B 3VGDA 1KJVB 4HMEA 4JLRB 3ZYOA 3BEVA 3SJVD 1T6WA 4JO2H 4PR5B 4XAKD 1W0YT 4X6CA 1F58L 5DI8B 5EIQA 2R4RL 1QHPA 6CGTA 1YEGH 2A9ML 3PHQB 5ISZE 2O93L 3WFBH 3LD8B 3MLTA 4K7FA 2PTVA 3PJSB 4JO4L 2C3HA 4J3SA 3U4EA 1W8OA 3QIUD 1OL0A 2VLRD 4Q6IA 1KG0A 2I24N 1NBYA 3HNSL 3KNBA 2FGWL 2ICWA 1QSVA 4P4KB 5EUOB 3MUY1 1JPSL 4HAGA 5F1SA 4O5LL 5SWZD 5I1EL 5I8CB 1DVFB 3RPKA 5BV7B 4QO1A 2OMNA 1X5KA 2BVEA 3L5IA 3QHFL 4BYHA 4LSTL 2XKUA 4ODBD 1DQDH 1RJYA 3QXVA 5AUMB 5ID0B 3CX2A 4U1HB 3TBWA 1Y6NR 1JGLH 1CD8A 4DKAA 1F45A 1BOGB 3W9EB 4DGYL 4BSVB 2GUOB 2DB8A 1ZK9A 5HPOA 3VD9A 4OIBA 2ICES 1AGBA 1CLCA 3H9SE 3HCVA 5SX4I 2NXYD 4G43B 1BAFH 1Q38A 3QH3B 1RZ7H 2NY6C 1FFNA 3UZQA 1LO4L 1OTTD 1J0IA 4FNLL 4GXUM 3WIHA 4P23B 1ZA3B 2D9QB 2F8VA 5C3TA 3SPVB 1INEL 2LTQB 1P84K 3KPLA 5ICYB 5IOPB 3SDYL 3BJ91 3RTQA 3GRWA 5IF0B 3V7MA 5EC1A 4LFHG 1WZMA 2YA2A 3RGVC 3VRIB 5EOCL 3IU3B 3FB8A 5KVEL 2FNBA 3Q5OA 4JFYA 2X5PA 5FYJL 4M62L 4PG9B 4P2YA 3QDJE 4HQQL 3PL6D 2EKJA 3A6CH 1RULH 4JB9H 4P2QE 2DYPA 1YEEH 1MCCA 4G8EA 4YC2C 4G3YL 4PS4L 4JHZA 4Z8FH 4OUUA 2BSRB 4PJEB 2OR8A 2Y7QA 5E2VH 1J8HD 3IJHB 1IC1A 4NN6B 5DQJB 5IM7A 4YDVA 1BJMA 4FQ2L 3IDIA 1NGXB 1LO3L 5IHUH 3GRWL 5ELIA 4EDXA 4OF0A 1IGIH 1KPUA 1IM3A 3P4LA 4IOFD 2C1OA 4HFUH 2YUZA 5DK2B 4EUPB 3MBXH 1CU4L 4PV8A 5CP3H 3LDBC 5KSBA 1T5XA 1UXSB 5I18H 3GO1H 5DRXA 1VFUA 4N1EA 4KXZI 1XMWA 5BZDA 4NT6B 5LGKA 2B8OT 3FB5A 4PJ9D 3BRDA 3BSZL 4ZTOH 3NH7H 4AL8L 3AAZA 2EIBA 1F4WL 3MC0A 5GZNC 4OFDA 2P49B 1GZPA 1T0MB 2UVEA 2HLAA 4LLYB 5K59E 4WHCA 2B5IB 2VR9A 1V5JA 4OZGA 5I74C 2QL1A 5J56B 1JZ5A 4OZ4B 2A6DA 4KK9C 2KPNA 2Z92A 1NAMB 3R06A 1GOFA 5DJ0B 2BXZA 4MNGB 1IQWH 2FR4B 1S7UB 4NO0A 1CXHA 3D0VA 5FYLD 1G7PB 5GZOC 5HGBA 3H9HB 2CRIA 2GITB 1RZJH 4L3AA 5HHXH 2NY0B 4ZS7L 4WEBH 3VE0A 3EW3B 3WO3B 1WWWX 4K23L 3VI3E 3G5YA 2OR7A 1ZHLB 4YPGB 3RFZC 1YN6B 4Y1AD 4PJAE 4U1MA 2BNQA 3MJ9H 3TH2T 5BVJB 1MHEA 5L2KA 1AKJB 1P7QA 3BW9A 1WLHA 5C0NC 3T2QA 1RZ8B 1CZ8L 4LHUB 4PJHB 3T1FB 4XPBH 2FECL 1U8OB 1EMTH 5LBSH 1UH4A 4TRPH 1JWSB 1CGXA 2WP3T 3UBXB 3VI3F 2VITA 4CVZA 5ACLA 4TSAH 2CRMA 5EZLB 4ZXBC 2VLLB 1RUMH 1T1WA 3EHBC 2F58L 3PNWA 5CD3B 4IS6B 3IKCB 3PQYD 3F7YB 4YHML 2R1WB 5TGBB 2GT9B 2SEBA 4Z77A 4QLRA 2DQEH 2OJZL 4PGCA 3I02A 4NM4L 1NFIA 2YD2A 3H7BA 3VFWA 1I75A 1U6AH 4M6MH 4WWKC 3QUXB 2QQLH 2JCCE 2GEEA 1KV3A 1CDYA 2P5WB 1QVOB 2ED8A 3FT3A 3FRPA 5F88B 3BUYA 1EHNA 5ALBH 1R5VB 1X44A 5GS2H 4U1IB 4Y4HA 4ALAL 3CUPA 2ICWI 4MCZA 3RWDA 1IC4H 1NC2D 3O6FB 1VGEH 2FX8H 3ZHDA 2CLZB 5I17B 5KVGL 1EAPA 4AZ8A 4R2GD 3CDGA 3GJFB 3W0WA 2NW2A 2ADGB 2JCCF 5F6IC 1B2WL 3KLDA 3NFNB 4E41A 2DF3A 5EO0A 2EC8A 3L3IB 2J3SA 1D9KD 4M3JA 4OLVH 3KPNA 4HC1H 4PLJD 4M8VA 4JZOA 5ANME 2DM4A 4PG2C 1E6JL 4FQJL 4U0RC 4OLYL 3N06B 1HXYB 4K8RL 4X80H 4HX1A 1ZHKA 2NY2D 4YO0B 4FTVB 3SBWC 4RX4A 2PCPB 4D3CL 3S36X 3GHBL 3HNTL 1LDPH 5IFAH 4I3SL 1IRAY 2EXYD 3MGOA 2FHCA 4M48L 2HRPL 4JFXB 3WN5A 4XGZB 4PRIB 4YFDB 5CILL 4BFBD 3HE7D 5E6IB 3B5GA 2ORBL 5MEQB 5DMKA 4PTUA 1VADA 3IFLH 3VFRB 4QCIA 3P11L 4KPHL 2F5BH 1KN2H 2VXQH 2RGSA 4HUVA 2RCSH 3BZDA 4L4VB 1FFRA 2J6EA 2HAZA 1JUFA 3QT2A 1OW0C 3FT2A 1SJHA 5JTWA 2EYTA 5HHPB 3P0VH 2AQ3A 3IRPX 2VYRE 1A7RH 2OZ4L 4G9DB 1QPXA 4N5UA 5DI8A 3T3ME 4KRPC 4YGAB 1RUKH 2Y07H 2AKRB 4MS8C 1T2QH 5IEHB 4XP6L 3BAEL 4OJFL 4P9HC 2CUIA 4FHBD 2C7UA 2J6EL 3LN5A 5GHWL 2W0PA 2PW2A 1H8OA 1KELH 2X1XR 4PRHD 3O3UN 5CKGA 2A0LC 1TTUA 4UOJA 4PRBB 5I73B 4P4KA 3T3MF 4RZCA 3WS6A 3SE9L 1X7QB 3MRLB 5I8CA 5EB9A 3LQZB 1BEYH 1N5AA 1DVFA 1UCBL 2VH5L 3QUYD 3UTOA 1MCQA 3C5ZD 4FS0A 3QDMB 2O5YH 5KW9H 2BCKB 3MZGB 5F7YC 5FM5O 5I6XB 5AUMA 3VD7A 1KN4H 5ID0A 1GPOL 4N8VG 3WYRA 1FL5B 3QWOB 4P46D 3VGAB 3ZSSA 2BP3A 2AEQH 4Y16A 5D1ZB 1ZSDA 4YBHA 3N1GC 2A77L 4BSVA 2GUOA 4PJ8C 3TVMD 3IETB 3HE6D 2XA8H 4OM1L 3EOTH 4JM4H 5BV7L 5JQ6L 1ZGLM 4PJDB 1MCOH 4KHTH 4DGVL 4NGHH 1U95A 4YXHH 3QH3A 3DX9A 4U1NB 1UACH 2ITDB 4P23A 1NMCB 3QCTH 1WITA 4Y4KC 3SPVA 1YEJH 3DARA 5KSAB 4PUBL 2PYEE 1YEHH 2X42A 5ICYA 5IOPA 3E8UH 2R2EA 2VDLL 4OLUL 4DN4L 4Y5YC 3DUHA 5C6TH 5IF0A 1MCDA 4GH7B 1NCCL 1OD7A 5JW4R 5CBAB 3X14B 5L8LB 3VRIA 3ZE1E 1AXTH 3IU3A 3DXAD 2P1YA 5GRZA 5KTEH 5IVOA 4HS6A 2XPGB 4NUJB 4TNVK 1YN7B 1YYMH 5IWLA 4PG9A 4JPKH 4MAYD 3T65B 4N0UE 1QKZL 3C60B 4HF5L 4CKVX 3VXUB 4H1LG 5DFTA 1FG2B 2BSRA 4PJEA 4XH2B 1FPTH 3U36B 1PSKH 3V0AC 5DLML 3UYPA 2VMFA 5C07B 1NGXA 2A83A 4U3CA 2EEDA 4OKDA 2A6IB 2GK0A 3ZE1F 4RWHA 4ZODA 5LAXA 1IE5A 3QEUA 1QACA 2CXGA 1E4WL 3EOAB 4XPGH 4IBLT 2Q1EA 4EUPA 2X4TA 4CBPA 1JL8A 5TDPA 2X4NA 2F54B 1UXSA 1CLYH 3IJSA 1N64H 1M6OB 1YPZB 4NT6A 3KYOB 5HDQH 1GGUA 1IC5L 1ZLUH 4M02A 2E7MA 3QEQE 4KJYB 4PRPE 4DN3H 4OIIL 2E8YA 4Z7VB 2HFGL 4UT6H 1G7IB 4QOKD 4JO3L 1WEJL 4LU5L 1QFOA 1HKLH 1L0YA 5DJ0A 1I3UA 3EDJA 1KNOB 4MNGA 4JRYE 3V4PL 2D0FA 4HDIB 4PJXE 1D5MB 2W9EL 1HDMB 3GSWA 4FABL 1ZLVK 2VIRB 4ONFH 1XH3A 2NY4B 4KY1L 5D72L 2X4PB 5JXEA 4D9LL 5JZ7D 2DQFA 4U1SA 4U6TA 3VWJC 4NC1C 5C0RL 3H7LA 1RIHL 1GJIA 2BNRD 4YPGA 1NGPL 3QBTB 4GAJH 3IDMB 5HHMD 4Z18A 1NAML 4R90L 5INDB 3NCJH 4CN4A 4HWEH 1PG7X 3D2UB 4EIGB 5BVJA 3AB0B 5J1AB 1G7HB 4WV1B 5GGVL 3SGKC 1A7NL 3L7FB 4GJTB 4KI1A 3RWHB 4PJXF 4NDMB 2DAVA 3WNNA 3GI9L 2C5DC 4J4PC 1U8NB 4QHMB 4YDIL 3T1FA 1U3JA 4ELKB 2AABL 4BKLA 1U8OA 3RZCD 2EH8H 2AJUH 2WBJC 3P73A 4HGWA 2YRZA 1JNNL 1JWSA 4W70A 5J7CC 4HZAA 2MHAB 1I7TB 5I1LB 4D9RD 1BZQK 1TITA 2EICA 3ULVC 5CD3A 4JKLA 4IIQB 1AP2A 5DJZB 2QHLA 3OHXA 3UP1A 3IKCA 3F7YA 4U49A 2R1WA 1EEYB 3O4OB 3STZB 4XC3L 5B4MC 1F02I 2MTPA 3TZVD 1FL6A 4YUEH 3MA7A 1JK8B 3LEVL 1EO8H 2CO6B 4XMLH 2DBLL 3SJVA 3BRFA 2VDRL 3NAAH 3QUXA 2O26U 2P5WA 1GCFA 2YPKB 2DQGL 1KACB 3K2UL 4OZFH 5F88A 1R3KB 1YMME 1CE1L 2YMXH 3D9AL 4P2OB 3E2HC 4KJPD 2FJHB 4U1IA 5D7SH 2JE8A 3ARDC 5A2FA 3ROOB 3O6FA 1M4KA 4GXVL 1QSFE 2CLZA 3L5WB 2AV7B 3TGXA 3QIUA 3RDTD 4P2QD 4XBEL 3GJFA 1H5BA 3NABL 4RGNC 1CXIA 3PP4H 4LGPB 3HG1A 1ZS8B 3U4AA 3NFNA 4TULH 2APVA 3L3IA 1NMBH 4DZ8B 1MIEH 2PW1B 3CCHA 2VLMD 3L5XL 2HFFA 3MNWB 5JHDB 2DLHA 4LSPL 1C5DB 5E08H 4NNPH 1Q0XH 4MQ7B 1Y6MR 1U36A 1X3DA 3LKRB 1IC7H 3U9UB 1LEGB 1HXYA 4N0YL 3EZJB 1CQKA 3KPSE 4R3SB 4YO0A 4DKFL 1T03L 4UOW1 2VLJD 1S7VB 3ZKNC 1AJ7L 4XPAL 5I2IB 4EVNB 4FXGB 3NOIA 3TYFB 4WJ5B 3VGBA 5IVXE 5IW1A 1GRWA 2WINB 4PRIA 4XGZA 4NC1E 1TQBC 2CIKA 4I2XB 3EYQD 1QP1A 5MEQA 1R5WA 2R0ZL 3M07A 3RBSA 3WXWL 3I9GL 1KB5H 4WUUB 4X0KB 3VFRA 4OZFA 3GMQA 2NR6C 1AI1H 4NFBA 3X3FH 1YNTB 3VFPA 3TCLB 4JFEB 5I8OL 2NX5D 5BS0D 3RVUC 1I7UA 2FIKB 1R0AH 4NQTA 3GIZH 3BXNB 4GAGL 5M7QA 3CFIC 4FG6C 2Y5TB 2DQDL 5I1CH 4XP1L 3S36L 1D3CA 2AXJA 1A0QL 3HAEG 1E28B 4KTDL 5FYLH 4K07A 3TH3T 2Q8BH 4M6NL 5IEHA 3UPRB 4P59L 4POYA 2QV2A 4U7KA 2NY6D 3IGAB 1DQJA 2AERT 1KCUH 1OOAA 4PRBA 4JPVH 1P5UA 3MRLA 4OD1H 3HFML 3ZTNH 1A8JH 2VISA 4ODSH 5AZ2L 2G75B 4EI5B 3QDMA 1IKNA 2IFFH 2BCKA 3D69B 5GQBA 2P5EB 4JDZA 4U2YA 1A6WL 1KB5A 1S7WB 1RU9H 4LIQL 3QWOA 3RIAK 2ERJC 3I50L 2R0LL 4PJ9A 1UJ3C 4K94L 3WHE1 3WJJA 5LQBL 1IEHA 2YK1H 3IETA 2VDOL 3BWAB 2IBZY 4RGNE 4XNQB 3LMJL 1NEUA 5IIEA 4EXKA 4KV5E 1PDKA 4PJDA 3QB7C 4XT1C 2QR0A 5H2BB 4AH2B 5C9JB 3QXUA 4N0RA 4HWBA 5BRZB 4CADB 4XP9L 1DSFH 3R1GL 3UTQB 1OAZL 3WKMH 1PY4A 3ARTA 4XCFH 4QXTA 5CCKH 5TE7H 5JPMA 5KSAA 4GKSA 1B90A 5F71A 1S9XB 3VFGL 1LO2H 2EH7H 3SDAC 3QPXH 4KUCD 3S37X 3ZYZA 4KV5F 3OB0K 1MRDH 5C09B 5GZND 5CBAA 3X14A 2OTUB 4ZNEE 3QUZB 5EZJA 4HWBL 4Y1AA 2XPGA 2DQJH 3QG7H 1HZHH 4TVSa 3KYKH 5C0BE 1IQDB 2YA1A 3UBXI 1OCWL 4HIIB 1AO7D 3VXUA 4LRNL 3VXQA 1Q9KA 2P4AB 3TC9A 5D1XB 1KLGB 1TCRB 3EJZC 4S1DD 5GZOD 5C07A 1JGDB 4O2CB 4LVNC 4MJ5B 5IBTL 3CFBB 3UTSB 3EOAA 4DW2H 3IB4A 5L9DL 1CDHA 1TCMA 1O5DT 3QO0B 4V1DD 4GT7A 4QRRE 2F54A 4LCWB 5D5MB 3QDAA 1FFOB 3S4SB 1EXUB 1HEZB 1HH6B 1YA5A 1YPZA 4ODHL 5IQ7H 5CUSL 3KYOA 4F7CB 1EHXA 3QYCA 2DL9A 3PWLA 2XKNA 1UCTA 2I25N 2IPTH 1UA6H 3CMOH 1NH6A 3I6LD 1CDCA 4Y5XC 4OCMC 1MHHA 2YBRA 2LVCA 1OLLA 4UAOB 5DJ8A 4S0TD 2FLBT 3BH9A 5DTFA 1GC1H 4ZXBD 4M61B 5FIEA 2WLZA 1JGVL 4GW5B 5C7XH 2J8UE 4HDIA 1D5MA 1UENA 3LHPH 4GG8B 1WFTA 1YNLH 2IH1B 5I19L 4OLWL 3VWKC 2VIRA 2APXA 2NNAB 1A14H 2XIDA 4PLKC 1XR8B 1FZKB 4TUKL 4Q97A 4X9IA 1BFOB 1KCLA 4LSDA 1U8JA 4HXAH 2BHYA 4JHAL 2E7BA 3S96A 4XRCB 1KPVB 3DX7A 1GOHA 1A9BB 3H9ZA 4HD9A 3CK0L 1I8LA 4NKOB 2W60B 4G6MH 4O4YH 3GKZA 1G7HA 3ZYIA 2J8UF 4NDMA 4RAHA 4OZIB 3JWOL 1Z5LB 3OKMB 1U8NA 2VQ1A 4QHMA 2WM0A 4ELKA 4BM7A 5JUEH 1H3PL 2BNUB 2YPLB 4GAFB 3HLAA 1SBSL 1J87A 2UY7A 4QTIL 2MHAA 2AJVH 1FNEB 5I1LA 1AY1H 3CZFA 1MNUL 1MAKA 5KS9E 1CFVH 1C1EH 4JKMA 5LXGL 3QHTC 3MLVL 1D5XB 1FBIL 5E4IA 4IIQA 5DS8A 4HK0B 4FZEH 2DJUA 2QHRH 3WS3B 4NQSA 1EEYA 2VABB 4KMLB 3STZA 4JFDE 3MOBH 3GHEH 3L3OB 3SGDH 4DQOH 2QEJA 4FQ1H 4NZDA 2ICWJ 5FO8A 1CT8B 1F6LL 1JK8A 3FQXA 4K3GA 4CMMB 1PG7L 4KJQC 3BN9D 4GUPA 5SV3A 4FQQB 1MRFH 3BDBA 4I0PC 5KS9F 1EGJH 4WENB 2MKWA 3T4AA 2YPKA 4PGJA 3VD4A 1R3KA 2L7UA 3SKUD 3MLYH 3SKMB 2Q76B 5T3ZL 1G84A 3ROOA 1MFEL 2KUTA 4ZQKA 1G0XA 1DR9A 2BC4B 3L5WA 2AV7A 4NRZA 3GSNH 3MRFB 2XQYK 1QBLL 3O8XB 3WLWD 2EDXA 4PRHA 3CFJA 4LPYA 1H8NA 1ZVSB 1AHWC 1TVHB 2YPVH 2ZCLL 3MPCA 1ZS8A 1C7SA 4JFFB 3NIFF 4WHYG 5DUBB 3S3PA 4XVSL 2OX5A 5GGRY 1MRCH 3X13A 4DZ8A 5C0CD 2PW1A 2BHZA 4L9LC 1SYVB 4KRPD 3L3DA 4HT1H 1DQQB 3MNWA 3IVKA 1G7LB 2DLFH 5JHDA 3MRCB 1C5DA 5JOPE 4OKVB 5EIVA 4MQ7A 4JDTH 3PG2A 3U9UA 3UROR 2OM5A 4NZRH 4R3SA 5ACZB 1P6FA 1S7VA 1UGNA 1CIDA 3RL1B 4M93C 3TBVA 4WW1A 5I2IA 5CBEB 1DN0A 1RUAL 5FF6B 4OSUH 5D7JC 1C12B 3TVMA 4HIHA 3TYFA 3HNVL 1JZ7A 3W5MA 2A0LD 4WJ5A 1WIOA 3BGAA 3RX8A 3HE6A 2WINA 4I2XA 4LSUL 1LO0H 4X6FB 3UTPD 3LKNB 4JN1L 4WUUA 1FRGH 5EU5B 4PB9L 4JKKA 4Y5VC 2FWOA 3DECA 1YNTA 2BVQB 3DIFA 3WLBB 3I84A 4OLXL 1JYVA 4JFEA 1AGEB 3L6FB 3LQMA 3Q6GH 4ZFOB 5DC9B 2FIKA 4P9ML 4PGEB 4P3CL 4JPWL 3UZVB 3ZKMC 1BBDL 4YK4C 2OS7A 5E8DH 2BOBA 2Y5TA 1JF5A 2BDNL 1A7PL 4EN3B 1BQLL 4TSBH 5E99L 1E28A 3D39B 1NJ9B 2EEAA 5DVNA 4HJ0C 3UPRA 2H8PA 3DVGB 3WXVL 4WW2C 4TUJB 2BMKB 3IGAA 3QHZH 3T0BA 4BUHA 1RZGB 4XMKH 1ORSA 5MEPB 1DBJH 4NHCH 2Z91B 2OQJA 2MCPL 1R3JA 2DQTL 2IAMB 1NGWB 2PXYB 2WIIB 1SQ2N 1CL7L 5B39G 4NHUB 5JHLL 2G75A 5DUPH 5DGRA 3VGHA 3B8YA 3G9VA 3LEXB 4U6VH 4ODXB 4ZD3L 1F3DJ 1XIWD 3DYMA 1S7WA 5GSRB 5D2LA 2VZUA 2R39A 1I8MB 1NGYB 3NCBB 2X70B 1QBMH 5I8EB 4O58L 2A74A 1MIMH 4OB5L 1QBAA 1IBGH 4PJCE 3LKSB 2MMXA 3JTSB 1I9JL 3DI3B 3BWAA 3LQAL 4XNQA 4MXQC 3KPQA 3P0YH 2LV4A 3BKCL 5D4QA 5H2BA 4AH2A 5DD6B 4PFEA 3MBEC 2UZXB 4QOKA 3HA0A 2VDNH 5BRZA 4J23A 4CADA 2EZ0D 1NCBL 7CGTA 2AGJH 2RIKA 5FO9B 2DMCA 4PJCF 3MXWL 4ZFZB 4WNQB 1FNLA 3OAUL 5LGJB 1CBVL 2MQ0A 4M4RA 2O5ZL 3BPOB 4WFED 2OTUA 3NA9H 4F7TB 5DA0B 5BO1H 4GG6A 2PO6B 2JB6A 3B9AA 4ZPVA 1T21B 1KTLA 1EHAA 4HIIA 5L7XH 3HMXA 1FFPB 4YNYB 1K3IA 5F3BB 5EU6E 1TCRA 2BVOB 3OWEA 5E2TL 3V9FA 1BQHG 4OGYL 2ID5A 3CFBA 4DVRL 4JZJC 1QYGL 3AREB 3VWJD 3JUZA 3PIQB 2WWKO 1FSKB 3RP1A 1G7MA 2FJFA 3U0WH 2ZCHH 3S37L 3ULUC 1LE9A 4LCWA 5D5MA 3LS4H 3OKLB 1EXUA 1HH6A 2UY6A 5A1AA 3TZVA 3GSQA 2Y23A 4JPIB 2CLRA 4PJGB 1KIPA 1OGAA 2CXKA 4J4PD 2DKMA 1N6QH 3D6GA 3O2DL 3CJJA 4NQED 3BPNB 3RKDC 1FGVL 1OHQA 1S5IH 1S9KC 4L3EE 2BHUA 4K7PX 5IGXH 1PZ5B 1NFDA 3STBA 4P5MB 5I1IH 4YHIB 3GUTA 4M61A 4RSVA 3ULVD 3UJIH 4JO2L 1YQVL 1A6UH 4GW5A 1QLEH 1G9MH 2CSPA 4UINH 1YEGL 1UWEH 4WW2F 1U0QA 2DQUH 4PJIF 2FGZA 3WFBL 3P4NB 1QFWM 2R56L 3H0TB 5B4MD 3PGCB 3EFFA 4F7EB 1XR8A 1SEQH 5BCAA 3MV8B 4OFYA 4PGZA 3R8BB 2BY2A 2DRUA 1VFBA 1DFBH 1B0RA 3WE6A 1KPVA 2IQAB 2BERA 1FAIH 3OL2A 4MA3B 4IDJH 3O9WB 3E1F1 4WI5A 4M7KH 3MQIA 4NKOA 3DX6B 3H2WA 1MVUB 15C8H 4Z76B 3ARDD 3VRLE 1BD2E 3OKDB 2DKSA 2NXZC 1CDGA 1WK0A 1CWVA 43CAB 1SVCP 2AJXH 3B3IB 2Y1VA 1T3FB 3PDOA 4YDKL 4ZS6D 3DURB 2D31B 1WSST 3CVIH 3SDCB 1EBAA 1D5XA 4R0LB 3RI5K 4DJMA 1AC0A 2CUMA 1DE4B 5L88H 4NJ9L 5D7LD 2FZ3A 4YEEA 3WS3A 3KYAA 5DEGA 4JGJA 4V2CB 2NY3B 3L3OA 3SY0B 2QBWA 1CL7I 1CT8A 4CMMA 1RMFH 3SEPA 2E6JA 2NX5A 1BAFL 2EDRA 3LPWA 1KCVH 4FQQA 4RAVB 2AXGA 4L1DA 3ZKND 1TNMA 4K3JH 3LKPB 2J1KA 4PBVC 4M5YH 2Q76A 3FN0H 4FXKB 3O0RH 2Z8VC 5DT1H 1A9EB 3F7QA 5T1LB 3ULUE 4D0BB 2WZPD 1AXSA 4Y4FC 5J1TC 1ZVSA 1QFWH 1TVHA 1Q9LB 1UJTA 1JF1A 3OKOA 5E1HB 3RVUD 1UB6B 3T0VA 1XGPA 3A6CL 1J05A 3BQUB 3MLSH 1KIUA 5E9DB 1CDIA 2Y36H 2B39A 5E2VL 1DQQA 4H88H 1TTFA 1S7XA 4OCXH 3BO8A 4HJGA 2G5RA 3GMPB 4KI5E 1OM3L 3ULUF 4LEOA 4O2EB 5IHUL 1W72H 4QRRD 2FEDD 1IGIL 1XFPA 5ACZA 1U8QB 4HCRH 1P7HL 3CFEA 4HFUL 5FF6A 1QLFB 3MBXL 2Z35B 4KH2A 3NIGE 3GO1L 4MJID 4X6FA 2GSIB 3FQUA 5IEKB 4CMHB 4ZTOL 5EU5A 3NH7L 1KTDB 1S8DA 1QFPA 8FABB 4KI5F 3DGGA 1ZLWH 3TA3A 1LK3H 4LLWB 4Z7UE 4GBXD 1VACB 2P8PB 1AGEA 4JFPA 1JHKH 4NN7C 2FCBA 2HT4C 3U0TB 2JJTA 2CK0H 5BW7C 1IQWL 3NIGF 1KXTB 3B43A 3RZWA 3Q6FB 3PWPB 5A3IC 5KG9A 4I13B 1MQKL 1EO7A 4S1QH 4UB0H 2RJMA 5DHVA 4EN3A 1QSEE 1ZHNA 5F1IB 5I16A 5F93C 1Q1JH 1JV5A 5MERA 1C08A 4Z7UF 3CVHA 3DVGA 2H2PC 2IEPA 3E3QC 1AO7A 4TUJA 5T3XE 1NFKA 3NZ8B 3MRIA 4NQCD 4ZFOL 2OI9B 4LVOC 4NQUA 4Y2DB 1F42A 5EZOL 3SKOB 1AIFA 2Z91A 4MA7H 5GSVA 3WDHA 2X10A 5HPMB 2ZG1A 1LNUA 2IAMA 4LCIH 2PXYA 2WIIA 4EDWL 2W65B 5L0QC 1IZJA 2XXMB 4J3VA 3SDAD 1R3HB 3SE4C 3VCLB 3LEXA 1X4ZA 4XPBL 4C56D 2E9BA 5C0AE 4EKXA 1Y0LB 5LBSL 4OD3H 4Z9KB 3BDXA 2MWCA 4V1DA 2OTWB 4NJAH 5GSRA 4RMTA 4RDQG 1NGYA 5IFJA 4QXWA 1RUML 4APQB 1L6XA 3LKSA 2X6MA 4XNMA 2F53D 4OGAC 3FZUD 4JRXB 1EX0A 4U6HB 2H26B 3VXRB 2ZUXA 2BOCB 5FDWB 2EDFA 3VMNA 4XP4H 5EUKB 5DD6A 5EORL 3AUVA 3F6IA 3HS0B 2XWBB 1UEMA 1XGUB 2C1PA 2PNDA 1UM4H 3V4VH 1ULVA 3S35H 4LDEB 4R6UA 3WUWB 5FO9A 4Q0XL 4GRLC 1KT2A 3L3GA 1JNHA 1GGIH 5JIHA 4ZFZA 4K3DH 2V17H 4LVEA 4G6AD 3VRJB 5LGJA 3T04D 4M3KB 1IC4L 2PF6A 4WFHD 2FX8L 2VZOA 4U6YA 4OFKA 1LEKB 1J8HB 1NCTA 3EZ8A 1I1AB 4JR9H 3UAJC 2R1XA 3KGRA 2PO6A 2X4RA 3FO2B 4H5SB 1T21A 2AK1H 2F9BT 4PP2B 4ELMA 3UJJH 4YNYA 1QEWA 4KZDL 5F3BA 3VXPB 2BVOA 3F5WB 1KPRA 4QRPE 3B4NA 1FNFA 4HPOH 1J12A 4MJ4A 3FFCE 4JHBA 2HT2C 4TPRH 3VWKD 1J1OH 4X4XA 2H45A 3FB6A 4KUZL 3AREA 4X80L 3U2SB 4PTTA 3BP4B 2EDKA 1TTGA 1AFVH 1F11B 1MAJA 3F7RA 3S6CA 3QDGE 2ZZUT 5GRUH 1K4DB 2FDBP 3OKLA 4P9HH 5DYOA 5ITBH 1ZHBA 4P5TB 2EE9A 4LLAA 4XTRC 3O3BB 3CH8A 1FVCA 4N9GA 5I1GL 3IFLL 2FLRT 3WO4C 4GQPH 1W0WB 2F5BL 3RIFF 1JGUL 25C8L 1RFDH 1Z9LA 3OX8B 1ZAGA 1FFQA 4LEXL 3GSUA 1PZ5A 2HTLC 4MDIA 3C6LC 4YHIA 3WKNA 4W81A 4OZHB 3BD4A 5MENB 1G9NC 4R8WL 1AC6A 2C4FT 2NLJA 2XN9E 2NZIA 3GK8H 4NM8H 1RUKL 4LOUC 3MYJB 3U30C 1S78C 2I26N 2IALB 3W39B 5E8PA 5CJBA 1L0XA 2NTFB 5GS0D 4KJQD 2IGFH 5IMMB 1GGBH 4MCYB 4JFQB 3RJQB 1WCBB 1QFUH 2IQAA 2V2XB 4G9FD 2Q3AA 4NIKB 2LQRA 1I8IA 1BX2B 2XZQH 2H32H 1EK3A 3DX6A 3TO4B 1CLOH 3QIWA 1MVUA 3MV11 4Z76A 1YY8A 4K7PL 4UV4H 2FH6A 5KJRL 1MVFA 2X7LB 3MUGA 3NTCH 2O5YL 4IRJB 5KW9L 4X7SH 43CAA 3M8OL 1HYRC 1YY9C 1A5FL 4HIJA 3UX9B 3ZT5A 1T3FA 1KN4L 4CU8A 3L3HA 2D31A 4R0LA 5HYIA 4RFNB 2XT1B 4YDLC 1XCQB 5SX5K 5JOFA 1DE4A 4Q6IC 4YDJB 3DPBA 3BGMA 3VFOB 1U58A 5FYKE 1Y18B 2DTSA 2OR9H 3MA9L 4LSVH 5KVFH 1I7ZA 4NQXB 5I1JH 3CXHJ 3BGFC 4I9WD 1HOCA 2X9XA 1Q0YL 4JM4L 2Y06H 1I4FA 2XWJA 4Y8DC 2YRPA 4G42A 4NGHL 3DWTA 5FKAB 3CDYA 3L95B 4RAVA 1M7IA 2WUBH 2D7TH 5HHOE 3BIKB 3DVFA 1A6AB 1SHMA 5K9JH 3FOLA 5BOZG 1UACL 3LKPA 4LAJH 5D7JD 4X83A 2WW8A 4M1GL 5TFSH 3QCTL 4W4OA 3DTXA 4FXKA 4XBGA 1A9EA 1YEHL 3PP3H 1PG7W 3E8UL 4NOFA 1QZ1A 4G8FA 2VLKB 4N0FA 2LAGB 3ZDZE 5ALCH 2A9NL 2DIBA 3TYGH 1AXTL 2JTDA 3U1SH 4AQOA 3V79C 3GJFK 5D1QB 5ICXB 1HHIB 2XQBH 1O7SA 1NUDA 4NNXA 1YYML 2Q7YB 4XHJC 3S5LG 2WMPA 5E70A 4K9EC 1V05A 2H1PH 2YA0A 1VGKB 5DJCA 3BQUA 2NY2B 1DBBH 5E9DA 3ZKMD 2HVKB 2JKXA 1K5NB 3QULA 4ZO7A 1RUPH 5B3NA 1N5YH 1XIWA 2GFBB 4O2EA 3M17A 5CGYD 3RTQC 1RIUH 2JIXB 3EIFA 4LCUA 3ZDZF 4ODVL 2AXHA 3FQNB 4WEUD 3ROLB 4H25B 3F7VA 5CJQH 4HJ0D 5DD1L 1U8QA 4OI8A 1CTOA 2ZUQC 4XPGL 5HGAB 1QLFA 3EO0B 3T0WA 4BH7B 1E6OL 1FO0H 5CJXA 1OP3K 4NZJA 3V52L 2Z35A 4LGRB 5D7IE 3IRZA 1F2QA 4WO4B 3TWCL 1CLYL 4G5ZH 2GSIA 3U6RA 1RVFH 5IEKA 4HGMA 5C08D 5HDQL 8FABA 4PGDA 4GW4B 4G6KL 4LLWA 3SO3B 3OKNB 4DN3L 5JDSB 4X6CE 3GSVA 4F58L 4UT6L 5J12C 4JCMA 4OM0L 5HYFA 4GLRH 3U0TA 4DGIH 1A6TA 5D7IF 1NC4D 3MR9A 3Q6FA 2YOCA 4NSKB 2BY0A 1FIGH 3ULVH 1V7NL 4X6DB 5F1IA 3U46B 3MLWL 4LQFH 5F7WC 3PWNB 3W2DL 1N7MH 4ONFL 3MBED 4XHQA 1INDL 2GY7B 4RMQA 3QUYB 1DN2A 5SWSD 3C5ZB 1IKFH 1BWWA 2HVJB 3NZ8A 4GAJL 1Z0MA 2R2CA 1A22B 4Y2DA 2HFEA 3CXHK 3SKOA 5IB2A 5D96B 1LGVA 5HPMA 4G6FD 4U1GC 2R8SL 4U1KA 4HWZA 1A7BA 2XYCA 3I6KA 4KDVA 1R3HA 3VCLA 4BZ1L 4NKIH 4MQTB 3X17A 4D8PB 1MAMH 1NMAL 2EH8L 2AJUL 3FB7B 3QDHA 5I1AB 3MCKB 1LK2A 2F19L 2OTWA 3K4ZA 4KK6C 2CJUH 4KKCC 3VXMD 1ZWIB 2GTZA 1AXIB 2VE6A 1F6AB 4H0HB 1P2CB 3ESUF 3QEHB 5J3HC 3O3DB 5EO1B 4APQA 4XVUD 5F8QC 1AD9B 4PJ5B 5HYJD 3QZWG 1TJIH 5HYSB 5IVZB 3VXRA 5FDWA 4PJ7B 5EUKA 3ZDYE 1TQCC 1N4XH 3GSNB 2JK5B 3HS0A 1BHGA 2GJZB 3C08H 3GM0A 4X5WA 3ES6A 3KPPA 3N1QC 3ILQD 4ONHA 4H8WL 4QNPF 1IEBB 2OJEA 2WUCL 3IDYC 3TIEB 3WUWA 3IKKA 3A67L 1C5BH 3BKYL 3HR5B 2AJYH 2GJ6D 3GMRB 5D7SL 1SM3H 2HH0L 4LKXA 3KWWA 3PGDB 4RA3A 1KF9B 2R23B 4MB5A 1LEKA 1NSNH 2R9HC 5K9OB 1T7YA 1I1AA 2GY5A 3QFDB 4JY5H 3RKDD 5AD0B 1T0NB 3TBYA 2MPAH 3FO2A 5B22A 3LB6D 4I18B 2DLEA 4N8CH 3IFOB 1BVKB 2OL3B 3G6JB 4I5BB 2CMRH 4DFIA 3S9DB 1HSBA 1RZFL 2H3NA 3QNZB 4GXUN 3VXPA 1OB1B 4RGOH 4XP5H 5DHYB 1MIEL 2VXTH 2W9DL 2HTKD 4OCYH 4YEFA 3TF7C 2B1AH 3I6GB 4AEHH 4Y4HC 3SCMA 4BUGA 3OPZL 1EFQA 4TN9A 2BFVH 1VB9A 3M1BB 2YKLH 3WFDL 3BVNB 5D93B 5KSBE 2VJXA 5IB5B 4HMCA 5D7LA 1A64A 1F11A 1YUHB 4MYWB 4OQTA 1XGYL 4QGYA 5AAMA 1K4DA 2WWKT 3N1MC 2X44D 2V6HA 4LMQI 1S7RB 5ISZB 1DZBA 3V6BR 3QAZB 4AY0A 3O3BA 5JA9A 3CSPA 5I8KL 3T0ED 3HRZB 4OZGE 4XMPL 4CU7A 3LPFA 1AI1L 1KOAA 5F9WB 3X3FL 4QRTA 4F15B 4FQCL 3OX8A 3T8XB 3TH4T 4Y7MA 5KSBF 4G7VH 3V6ZB 4LSQH 1M71B 1Z9OA 3BP5B 1ZT4B 1UWXK 4Z0BH 5TE6H 3MV7B 1FH5L 2AJZB 4F9LA 1OLZA 5DJ2A 1T04A 5MENA 3GIZL 1I1CA 4MD5A 2XKSA 4N5ED 4DEPB 4PJFE 2I9TA 3IAPA 3WN5C 3GDBA 1T2JA 3RAJH 1P69B 5T3XD 3MYJA 4X7CC 1IM9D 2IALA 4OZGF 2XWTA 1ZLSH 5FHAH 5HJ3B 3W39A 4MX7B 5F7EH 3GSXB 4WCYH 3G04B 2NTFA 2BNQE 2Q8BL 1ACYL 3CSBA 5L2KE 4LKCA 5IMMA 4MCYA 4JFQA 2D7QA 1JPGA 5KANG 3DVNA 1RY7B 1WCBA 3WHXB 1KCUL 1BX2A 4QHLA 3IF1A 5F96H 3TO4A 1LEIB 1TPXB 1NLDH 4HPYH 3HB3C 1P4IH 5ETUB 4ODTL 2W0KA 4PJFF 3BMWA 4OD1L 3H9SB 1TZIB 4W6WB 4EOWH 1KIRA 4OF3A 3LD8C 3MFFB 4ODSL 4TUOB 4TVPD 3Q48A 4IRJA 4RFEB 2IFFL 3MJ8B 4Y4FD 3IAGC 3WSQH 1RU9L 3QNYB 5DR5H 1I9IH 4P2RE 2EO9A 4QRQB 4YHOH 4YDJA 1JWUB 4ZYKB 2PTUA 2EIDA 1I8KA 3W11C 1OAXL 4LPXA 5JO5B 4N9OB 3TNMB 4P4KC 2ZJSL 3WS6C 3VH8A 3KPOB 4XNZB 4NQXA 2GK2A 5DFVC 4GBXA 1DVFC 3U4BL 5BV7C 2NY7H 3QQ3B 2W0FB 1TJGL 5C92A 5FKAA 5LG1A 1L9MA 3MUHL 1DSFL 1IGYA 3FHQA 3BIKA 3ZKXB 1A6AA 3OXSA 3QDJB 3WKML 3VFVA 3N85H 4CL7A 2VXUL 1NBVH 3CH1A 3KPRE 4Y16C 3IDGB 5CCKL 1KGCE 4CW1A 3W0WE 1LO2L 2EH7L 1F4XL 2VLKA 3QPXL 5I76B 4QF1B 1YEFL 2PKDA 2ZKHH 5D1QA 1I9EA 4NQCA 1HHIA 5ICXA 3FO0H 1AGCB 4RQQB 1HZHL 3LCYA 5TPWL 3ESVF 3KXFA 5GS1B 4IDLA 3DX8B 2OTPA 1VGKA 1JYNA 2HT4D 3BRGC 1IAIM 2YN5A 2X40A 4P23C 2HVKA 3C5JB 2ZSVB 4OI7A 4C56A 3QWQB 5FUOH 5A3ID 3CMGA 4JY4A 1GZQA 1KJ3H 2GFBA 4NP4L 3FO1B 3DMMD 3WFCH 3UTTE 3FQNA 2Y4SA 2HWZH 1MELA 4YHPA 4WHYH 2H2PD 3BPCA 4DW2L 4I77L 5IWLC 4LSSL 1Q9WB 2VNCA 1DTUA 2CKBH 1NLBH 2X89D 5KAQF 4WO4A 5ILTL 3MXVH 5E94B 3PE9A 4YBLC 2JJWA 1GGYA 1IFHH 1CDUA 3QFJD 4NN6C 2IPTL 4GW4A 4Z7WE 5LGHH 3CMOL 2GHWB 3OKNA 4MD0A 2EDWA 1NGQH 2I60H 3ARBD 1MJJA 2LE9A 1TZHB 1QRNB 4A6YA 2XN9D 3VMOA 4PJAB 1ETZA 4UIKH 4YFLI 2XY2A 1GC1L 3NZHH 4PBXA 3VFTA 5FGRA 3SDXA 4OGAD 5I9QB 2F8XC 2J8OA 1BREA 3SGEH 4X6DA 3U46A 3QI9B 1YNLL 1DBMH 3PWNA 4Z7WF 1A14L 3P4MB 2YD4A 3R0MA 1B4JH 1K6QL 4MNHA 3RWCB 5IMLA 2B5IC 5EBMB 4JG0L 4HXAL 1GHFH 1Q9OA 3MV9D 3QJFB 4HBCH 4XNYH 3RGVB 5IUSA 3QPQD 4GRLD 4HKXA 3STLB 5B3JE 4PD4J 1I3RA 1IAIH 4R4FL 1UQSA 4XAWH 4YXKH 5JUEL 4D8PA 4LASH 1Q94B 1A2YB 5I1AA 2NY0C 4PLOB 5B38G 5JXEC 1KBGL 2AJVL 2GJJA 4K71B 1AY1L 1OARL 3UAJD 2W92A 3RY6A 2JCCB 5DSCB 5BZWA 2YD7A 1DQLH 1CFVL 1P2CA 3CLEH 3O3DA 1NCNA 2NYYC 3NCMA 1U92A 3J8F7 4FZEL 3CGTA 1AD9A 4BFGA 5HYSA 5IVZA 5B3JF 1CK0L 2DD8L 3TJHC 3MOBL 4PJ7A 4DQOL 3E0GA 4FQ1L 3CAFA 3RVTC 5FM8A 2JK5A 1WZLA 2GJZA 2HT2D 3TN0B 4CRPA 4RRPA 4GMTH 1FYTA 1VA9A 5IB4B 2NY1B 1MRFL 1IEBA 3TIEA 1OY3B 1EGJL 5KOMC 4NQDD 3BESR 4DKEH 2ESVD 3G6DH 4Y19A 1VEOA 5ANMB 4XTRD 1MLCB 4ZOBA 3VMPA 2GW5A 4JVPA 5CIPH 3GSNL 1MJUH 3QFDA 5AD0A 1NKRA 1T0NA 4G9FA 2EDDA 3BEWB 3T0XA 2YPVL 3IFOA 5TQ2L 1X9QA 3QUXC 2HTLD 1BVKA 2OL3A 5D71L 4HSQA 3C6LD 2IANB 3P30L 2PTTA 2A6JB 5F1NB 5E1AA 1OB1A 5JORB 3I6GA 5IMKA 4HGKC 4W6XB 2DLFL 4J7RA 1MWAB 5E5UB 1JF6A 4FXLA 1S78D 3O6FC 2Y6SC 2ATPB 3BVNA 4NZRL 3QIUC 1SJXA 5IB5A 2JB5H 1UM6L 1IGJB 1F3JA 4YHYB 1BFVL 5JW5A 1H5BC 1YUHA 2WWMC 2YEZB 4ZOEA 3EYSL 1CICB 2E7LA 5TF1H 4OSUL 2OL3L 2Z31D 5CINL 2ZPKH 4PY7A 3VGEA 4P4RB 5JMRA 1BQUA 5DJ6A 5ISZA 2R69H 1FL3B 1LO0L 2VZ1A 4ZOAA 4ZXBB 1U3HA 4YJZL 4IRSB 4L4TE 3T3PF 2CK2A 3VXSA 2DIJA 3GEWB 2A38A 4M43L 4MNGE 2AXFB 3PHSA 3F7PC 3BP5A 1ZT4A 5T5NG 4PD4K 3MV7A 4XWGH 3Q6GL 4HXBH 4PLNC 3Q1SH 1CFSA 2CR3A 1ZLVH 1DLHB 4IMLA 1TVBB 5JW4Q 3ARVA 4WWKB 4HUWB 4BZ2L 3KR3H 1BIIB 5IK3B 3O45A 2NXYC 1VFOA 1CFNB 3V0WL 4TSBL 3GSXA 2C9AA 3G04A 3UC0H 5BMFL 3LIZH 4O02H 3OXRB 3O2WH 1RUQL 4KQ3L 5C0FB 2P8LB 2DLGA 3QHZL 4HKBB 5EC2B 2EDNA 3TBSA 3RGHA 4NHCL 1LEIA 3IXAB 3TV3H 5IKCB 1WICA 5ETUA 5GRWA 2YD6A 3GI8H 2Q3ZA 5KVDL 4RBPK 5F6IB 1U3YA 4YZFF 1QPPA 4RFEA 5DUPL 3MJ8A 4U6VL 5JQHC 2OCFD 1LQSR 2EDLA 3JV5A 4N8VB 3SQBA 3CLFH 1FVDB 3BHBB 3RNQB 5T5NF 4LLVA 2AV1B 3QNYA 4N1HB 4QRQA 4U0RB 1QBML 2VL5B 4ZYKA 1IBGL 4J6RH 2XTJD 4OCWH 2EDBA 4U1JB 2PYEB 3GMOB 2QADD 5I73C 1C16B 4ZAKB 2VZTA 3SJVE 4XAKE 3QQ3A 2W0FA 3P0YL 4N68A 1IKNC 3RTQD 4IOFC 2D0HA 1XCTA 5FOBB 1AH1A 5I6XC 5GPRA 4L9DA 3QDJA 3V95A 4N0UB 4ZUSB 1T66D 2QSCL 1NC4A 3VGAC 4QRUB 2QQKH 3SKNA 3OBAA 3IDGA 4WI9A 3J7HA 4PJ9C 1SYSB 5JLZB 5MHSD 2ZUSA 2DYPD 3WJJC 4F2MB 1A6PA 4MAUH 5I76A 3ULUH 3B9KB 4N0CC 3HG1E 4QF1A 5CJOH 5SWZE 3U9PL 3MOAH 3BP6A 4DZBB 2RFXA 3NA9L 1JWMA 1AGCA 5DD0H 4RQQA 5DRZB 2DQCL 1CD0A 3T2OA 2XZZA 4H1LB 5GS1A 4ERSH 3DX8A 1ES0B 5L7XL 3C5JA 3BP7B 4OZFG 1HYSD 1UM5L 5GJTL 5KSAC 1S3KH 4B7IA 4JJ5A 4MXWH 1TNNA 4TNWK 2CDGB 3QEQB 3FO1A 4HKJA 4PRPB 1YEKH 1CI5A 3VXMA 4QGTA 4I3GA 4JZNB 1GL4B 5C8JA 3N9GH 4F37F 5EO9A 4PRIE 5DMIH 5TE4H 2X1PA 4F33A 3VXTA 5HGDB 1UZ8A 4LAQH 3OR7A 1OAYH 5HYJA 5HVHC 1Q9WA 1DQML 2EYSA 3QIBB 4C55A 4WU7B 4JRYB 3WL9B 1KJMA 4YHKL 1ODAA 4PJXB 4Y2OA 3N0PB 2WBKA 2VDPH 2ZCKH 1FG9C 4FQPA 2R2BB 4NO0D 1IMHC 4TYUA 1O7VA 1NUFA 2EC9T 4LNVA 1N6QL 4PJ8B 2HKFH 4WFGD 4EQ3A 1EEZB 1S5IL 1TZHA 1QRNA 4KK6D 4KKCD 1SEBB 1ADQA 1KLUB 3O6MH 3G5VB 2GJ6A 5J3HD 3CFKB 2H32B 3UPCA 1V3LA 3ARRA 2QLVB 2BNQD 4AMKH 1AE6L 3HI5H 1YDPB 3EGSB 5H35A 2DQUL 3QI9A 3AS3A 3IDJB 4Y4KB 1JZ4A 1KC5L 3P4MA 2YSSB 5BXFA 4OTXH 1FC1A 4GRWE 5I30L 3RA7H 1SEQL 5T3XH 2MCG1 4JGMA 3RWCA 4XWOD 4X7DC 3MLRH 1UWGH 3QJFA 5EU3B 1ADQL 4DWHA 1FAIL 3MO1B 4IDJL 1IAOB 5FDYA 1UZ6E 4M7KL 3K74B 3V4UH 3STLA 4H26A 4JKWA 1PLGH 1HQ4A 3VJ6B 4KDWA 2APBA 5KN5B 5E8OB 1T1YB 3GMNA 3OR6A 1Q94A 1YC8A 2NY4C 3GSRB 4GRWF 1I7RB 5SV4A 2VQUA 2JCCA 4GKNA 3WNOA 3FQTA 4OT1H 1QRKA 1S9VB 1YMMB 2BSSA 5L88L 3MOQA 1V7MH 3REWA 5FGCE 1UZ6F 1Y6KR 4F3FB 3EUUA 1I8LC 4X9GA 3W82A 1JZ6A 5TQ0H 3F62A 4Y4HD 3ARGB 1QSFB 2HKHH 1NCWH 3DUUB 5FYLE 3TN0A 1FNGB 3THMH 2CDEB 3GKWH 3BJLA 1KCVL 5EPMA 3D85D 3CFCH 1GGCH 3OB0H 1DUZB 4KVNH 3IU4L 5CS7A 1HSAB 1NAKL 1NCDH 1UVQB 3QXAB 4IIQC 4ZUVB 4E41D 3V8OA 4JKPL 2HJLB 4Y1AE 3O0RL 5DT1L 1DDHA 1MLCA 2G5BA 1KYOK 4P49A 3DV4B 3RVWC 5IV2B 3U7YH 3KPSB 1RD6A 3RNKA 5EFIA 2AK4D 4UNTA 1QFWL 3AVEA 3G6AB 3KYMA 4IRZH 1FO0B 4YFEA 2ADJB 2ARJB 2IANA 2MQCA 4RX4D 3MRGB 3ETBF 5FUZL 2A6JA 5F1NA 5J13B 1RURL 3F58L 5F72S 5JORA 1L7TH 4I0KA 1A7QH 2Y36L 3MLXH 4PB0H 1YECH 5FECB 4JM2D 2XZAH 4OCXL 3ZKSD 4C58B 1MWAA 1VPOH 5DURB 3EDKA 4GSDL 2XRAH 4AG4H 4BSWB 3PQYE 3KPMB 2V2WB 3PHOA 3RVXC 1NL0H 4HCRL 2XA3A 3V0VA 1W0VB 3C8KB 5HYEA 1CICA 2WBJB 3K4AA 1KJ2H 3QA3A 3UZEA 4GKZA 5FO7B 4XI5C 1ZA6B 4F80A 3JV4A 1S7TB 5H37H 3HPLB 2QKIA 4KGJA 5JIIA 4PY8I 4IRSA 4NWTL 4Z78B 1CFQB 1MWAL 1HH9B 1WZ1H 3G5ZB 4M8QB 3AGVA 1KB9J 1JI1A 5C70A 1JHTB 4O51B 3QNXB 2X9YA 5CEYA 4Y0GA 3TVMC 1DLHA 1WFNA 1TVBA 4HUMB 3W11D 1J11A 3HE6C 4HUWA 5DJXB 3HAEB 4P4KD 4S1QL 3DSFH 4UB0L 4HH8A 4TTGA 1AR1C 4S2SA 2CDFB 3SQOH 1DVFD 1Q1JL 1K8IB 1MFAL 1CGTA 3MMEB 3EJYD 4FQHA 4LLUA 3ARDB 4FQLH 2P8LA 4R26H 4E5XA 3ME0A 3QXDA 5EC2A 3FONB 5AZEH 3PDGA 3IXAA 3PGFH 3TIDA 5IKCA 1F97A 1J5OH 4RGNB 3DMMA 2P45B 3TO2A 3H42H 4XBPB 2R2HB 4ZDHB 4QHNB 3FOMB 3V6OE 2Z8SA 1OAKL 2G2RB 1WTLA 4QRSA 1P53A 1FV1A 1MF2H 1ZTXH 4WI2A 2VL5A 1CDBA 3RHWF 2R4SH 3KVQA 1DUYB 1N8ZA 4P23D 3GMOA 1QD0A 4ZAKA 3UPAA 1MCNA 3D3VA 3RU8L 3ARBA 4KXZH 4PJBA 1OT1A 4XP4L 4BH8A 3EO1A 4HG4J 3B9EA 4XPFH 3IT8D 5ID1B 5FOBA 5C0BB 3L5JA 5C9KA 5I71C 1C5CL 2YS4A 1U41A 4QRUA 3MX0A 5GGQH 3X12B 5FKPB 1SYSA 1GGIL 4K3DL 2V17L 1F00I 2PYFB 4F2MA 4PRHE 4OV5