1TNNA

Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
RILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the I set.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Muscle protein
molecule keywords TITIN MODULE M5
total genus 13
structure length 91
sequence length 91
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tnnA00
2XV6B 5E1AB 4M5YH 3CH1A 1CLZH 1P84K 4PJEB 4PG2C 1ZHKB 4L3ED 3QUKA 5I16A 1WFTA 5KS9E 4U05A 1T21A 3UC0H 3GK8L 1UYWH 2DYPD 1YN7A 4UB0H 4GXVL 3ULUF 5HHQA 5FO8A 4YIQA 4LPUA 1MJUL 1VACB 3KJ6L 2OQJA 3BEWA 3H9SD 3KYKL 4P4RB 5FKAA 4U6VH 1CE6B 4NJ9L 2ZSVA 3QUZC 3BH9B 4UV4L 2B4CC 4MNQE 1T83A 3FN0H 4HMEA 4LASH 2NTSP 4Z7NF 3VFMB 4Y4KC 2OJZH 1KJ2L 4QRRA 2XXMB 1XF5B 3UYRL 2ZPKL 1FIGH 2YA0A 4WW2A 3ROOB 2VZ3A 3G5ZB 3R8BB 5GGSY 5I8CA 3U7AA 4P2OD 3IB4A 3KLHC 1QYGL 3VFWB 3W0WE 3GSQA 1J9CT 3CVIH 4HF5L 4Z7NE 4HJ0C 4TSAH 1G7MB 1H3UA 3PWPA 4KKBC 4Z7UE 4R2GD 1A1MA 1T0MB 4CVZA 2EEBA 1FYTD 3MRLB 4LLUA 2NY3D 3MOBL 2JCCB 2UWEA 4XPBH 3BKMH 3U9PL 2VTFA 1MY5A 1BQHB 1HSAA 2CO7B 3V8OA 4ZXBC 4HUVB 3C5JB 4NM8L 4DZ8B 3FT4B 4Z7OF 2B0SH 3R8QA 1H5BC 3PQYE 2Z9TA 2R2HA 4URTB 2LTQB 2WWMC 1FAIH 2FR4A 1FZKA 1IC7H 1Q8MA 4GRLC 5TFSL 3DI3B 4KDVA 5DDHB 4OV6F 1LEIB 1NLBL 1LO2L 4KROB 1H15A 3MGAA 3AC0A 4PGDA 2YRZA 2C3VB 1WV7T 2FO1A 3DSFL 4ZFZA 5HYJD 5B38G 5T3XH 4WRLA 3WFCL 4DN4L 4RFOL 2E8ZA 1P4LA 2R0LL 5DFVD 3QPQD 3MNWA 1KEGL 5H2BB 3IGAB 3CAFA 2VNCA 4K94C 3VGGA 3SGDI 1QQDB 1TETH 3HKFA 1U58B 5LG1A 3V5HB 1A9BB 4FP8L 4DQOL 1U91A 4WI9A 5EU6A 3DIFB 1PSKL 2RIKA 1U8PA 2BCKB 1SJHB 1JE6A 2XKSA 3IFNH 4ORZC 1JPTL 2YR3A 3ESVF 1M7DB 3DTXB 2DIAA 5J1TC 3BSZH 2IG2L 4CDHA 2X1PA 1QLFB 4LP4A 5T33H 1DQQA 1U3HD 2WLYA 3ZYIA 1ACZA 2IADB 2DTML 1HH6A 2YMXL 4U1JA 5CIPA 4MHHG 3HC4L 5GJSH 3DI2B 3VFPB 3P73B 4ZFOB 3DVFA 5C07E 3B5TA 2GY5A 2XY1A 4QHLA 5KG9A 3V6OA 1ZE3C 3ARVA 5FYKE 3BPCA 3JV4B 2MCG1 1CDYA 5JDJA 3BQUC 2RFXA 1NL0L 2X1OA 4XNXH 4OI8A 3QO0B 1T83C 2M2DA 3PL6C 4LGRB 1JHTA 4CUCA 2F54D 4PJDE 2UV3A 2C3GA 2E7CA 1X5AA 1N0LA 3LH2H 3CCHA 4DUXA 2IBZY 4KZDH 4LKCA 3ZYOA 2FEDD 1N3NB 2BSSB 1G6RA 1KGCE 2AJZB 3QEHA 4FTVE 2AABH 4MDJA 4OLYH 4ZSOE 3SE3A 3QDMD 3MCKB 1HDMB 3DVIA 2GJ6D 1URLA 4RAHA 1B6DA 5D5MB 4RGOH 3CVHB 3QXAB 3KXFE 5D1QD 1IAII 4HLJA 3MRJB 4HH8A 4QCIA 3ORJA 1IQDB 3BQUB 5DHYA 5HGBA 1FORH 4XNZB 4WJ5A 1XCQA 2Q20A 3HI6H 5IQ7H 3SGDH 4TSAL 1QLFA 3IKKA 2YPKA 3SDYL 5BV7B 2QSQA 4LMQE 2BC4B 1G7HA 4HBQA 4H1LA 4I2XA 4PJFE 2OXGA 2IFGA 2Y5TA 4XXDB 2IH3A 4OLZH 2ZUXA 1H8OA 5TPWL 1N5AA 3U9PH 1U92A 3P11H 4N8CL 1HHKA 3GFUA 1INQB 2APXA 4CMHB 3PL6D 1ORSA 2ED8A 3O2DA 4NN5C 2ARJA 5I19H 1JWUB 4YQXH 2LE9A 4HXAH 3HCVA 5F89B 4R0LC 4Q9CA 4Z7OE 5EC2A 4P3CL 2QQNL 3AVEA 4OT1H 2ICWB 1X9QA 3IKCB 2DQHL 3OZ9H 2X4NB 4P4KC 3G9VA 5DUBA 1PLGL 5EBGA 1HINL 4NBYB 3QULA 3VFSA 4AG4H 1XGRB 3E3QE 1WUNT 1T3FA 1NPUA 3PF2A 2V2XB 4JFDD 2R2HB 2Q7YB 2YUVA 4JHAL 3F58H 4DWHA 1JPGB 4YHZL 4XNMB 1TETL 2ICEB 4M61B 5L9DL 4Z8FH 5EZJB 5GHWH 4Q74A 1I8LC 4RISH 4FXGB 5IWLA 1RK0A 5EBWB 1CE1L 1WWWX 4OCYL 3SKUD 4LF3B 2PYED 3T0EE 5A2LH 1F58H 3QFJE 1ZHNB 3VMPA 1NAKH 3MRIB 5F6HJ 5CAYB 4EI6A 1JYNA 1F4WL 1F4HA 1KCLA 4JFFB 2VDOH 2ZG3A 4U4BA 4XHJD 2CUMA 1IKNC 5KJRL 4G9FA 1XMWA 3IDIA 2EYRA 1QTYT 2PF6A 1VGEH 1A8JH 4MHHI 1FGNL 4TVPD 4XNXL 1XGYH 1S5HB 3MRJA 5DHXB 3ZE1E 1DQLH 4GQ9L 4JFQA 3L7EA 2K7PA 4HV8B 1NFIB 5JMRA 4PRAB 3FCTB 5ETUB 2F58L 4YIQB 5HYSA 4JM2D 5ITBH 1JK8B 1T89C 4N8VB 4NRZB 3VXOA 5F9WB 4YHLL 4ZUUB 4KPHH 3FT3A 3GSNA 4R26H 2BP3A 1MWAH 5GSRB 4QXGL 3RWEA 1XCTB 3SE4A 1T20A 4NZTL 5EBLB 3CCHB 4M4RA 1RHHA 5DJYB 5HYJB 3P2TA 2NR6C 1T89A 3LEXB 3NFSH 1YEEH 3OKLB 12E8H 3BDBA 4KROD 1C12B 4LSPL 3IYLW 3OKNA 3UDWA 1BZ7B 3FL7A 4WDIA 1IL1A 2YZ8A 4H1LG 3MJ7B 3F7PC 5HDOA 3W0WD 5FEBA 3QDJA 4TUOA 3FB8A 4YK4C 3UAJD 3SQOL 2QSCH 2HJLB 4EQ3A 5KSBF 1Q9OA 5DK3A 4R6UA 1CR9L 2FCBA 1YMMA 1YYLL 1QZ1A 1F02I 1FG2B 1I7ZA 5F9AC 1A2YA 1Q9KA 3FFDB 2OL3A 2XRAL 3GHEL 5AYQA 4Y19D 3T4AA 3WIFB 3MSPA 4UQ2A 5FO8B 1DBMH 2HWZH 5HBBA 3T04D 4YEEA 1RJZB 4YDKL 2AW2A 5GZNC 3LOWA 3MLRL 4R2GB 5KVDH 3LN4B 3IDGB 3LS5L 1UB6B 1N2RB 4LLVA 4YQXL 5C0BA 5JHLL 1FLRH 4G6KL 4GH7B 4H20H 4KY1H 5BO1L 2VH5L 5DQDL 1JHLL 1A3RH 2A1WL 4OCSH 5ICZA 4GAJH 2MQCA 5CP3A 4KKAD 3ZE0F 5D7IA 2CK0L 1RHFA 4Y2OA 3PGCA 4L8DA 1KJVB 1JGDB 3MJ8B 1NSNL 3DUUB 1CFTA 1H3XA 5H94B 2GAZA 4FFVD 2X9XA 3MRFA 5DD0H 2X5PA 2UWEB 1G9ML 4MA3B 3QQ9C 1MCOH 5F6HI 4M5ZH 3CD4A 1RZKL 2X7LB 4P5TD 5IVXB 2WWMD 2DICA 1KB5B 3I02B 4AM0A 3C5JA 4EDWL 4ZDHA 4IMLB 2XTJB 1UM5L 4UT7H 4GW1B 2DLFH 2DQJL 4FFVC 1A7QH 5T3ZL 1GC1L 3D85D 4ORGB 1MCDA 1AP2B 4FFZL 1SY6H 4NZRH 1TXKA 1AGEB 2AJ3B 2GCYA 1F4WH 1DEDA 4HWBL 5GGSA 5DMKB 5C7XL 4HJGB 1V5JA 2VLJA 3D85B 4MA1B 4N1HB 2XA8H 5C07D 2V7NA 4FG6C 5JW3H 4YR6A 1BEYH 1E4JA 2A77L 3PV6B 2CGRH 2B39A 2Q6WA 3T0WA 1FZJA 2EE9A 1KTLB 1OAZL 5JW5A 1ZEAH 5EZLB 1EA9C 3O6FD 4NQSB 4JRWA 3RZCC 1CI5A 5FYJU 5TJWK 4OTXH 3S97C 4MQ7A 5C2BL 5LVEA 1JCKA 4RX4A 2IAMD 5D70L 3ZDYF 2DS4A 4QLRA 2DWDB 5DA4A 2CQVA 3RNKB 4H26B 1L7IL 3CFEB 2R15A 4JHWL 5I2IA 3SJVA 3UJTL 4GMSH 4ORGA 1U95A 2QHRL 1JFQH 3DSNA 4G5ZL 4OCNC 5E9DD 5EZOH 3ULVF 1DUZB 1KJMA 1ORQB 3HMXL 2YKLH 3MRHA 4NWTL 3REWB 2ILLA 1YN6A 2G5RA 1RHHB 4KQ3H 4U1NA 1OT2A 3HRZA 4NCC2 3T0AA 4U1MA 4PV8B 5T1MA 3ZHKA 3GSNB 4ZD3H 4XH2A 4NOFA 4Z0XA 5CKAA 1HKLL 4PLKD 3BP5B 3MNZA 3AUVA 4OLEA 1JGDA 1QFWH 2GK2A 1JNLL 2B5IC 2V7NB 1IM9B 4M43L 4XAWH 4K23H 2ORBH 3KJ4B 2NY7L 1L6ZA 5F9DC 1NCAL 3KYOB 1QD0A 2XT1B 4HCRH 4RDQF 1RIVH 4I2XE 1R6VA 1AQKL 1DE4A 5HGAA 5KZCD 4O58H 4DGYH 5D1XA 4HCRA 3KNBB 5J6GA 1B0RB 3EYVA 4Z18A 4AEHH 3TO2A 3WE6A 1JHLH 2A1WH 4CDGC 1ZS8B 1UKSA 3GMOB 3AS3A 3RWFB 3U2SB 3VG0L 4UNVA 1IEHA 4JDTL 3CFBB 4DKEH 4WWKA 5CHNA 1CICD 5F88B 3RA7L 1NGXA 3BUTA 2E27H 3REWA 5JXED 4YFLF 1ZAGA 4X6EA 2AXFA 1DBJL 5BS0E 2IPTH 4QT5A 5DO2C 4U3CA 4JFYB 4X99B 4N9GB 5HDBF 3O81A 1MCNA 3RTQB 5HVHC 1SHMA 3GB7A 4LHUB 1TZHB 2FSEA 5I1GH 4L8DB 3RUGB 3RVUD 3INUH 4HSQA 5M7QA 1VESA 4MDIB 3P0YL 1X5YA 4EDWH 5IK3B 1YNLL 1QRNE 2AJVH 3TZVA 5BRZE 5TQ0L 5HGDA 4YE4H 4S1DD 4QXUL 5EG6C 1T5WA 5MI0B 2CDFA 2DJUA 4NQCD 3MRBA 2JCCF 3BO8A 3G5VB 5ENWA 5SWZE 2VL5A 1W0WB 4MNHB 1IGYB 5CILH 1A02N 3NTCH 2A9NL 4MD0A 3TFKC 2ED9A 5D2NC 1JI1A 2G60H 3G6JB 4HIEA 4O5LH 3OAYK 2AJYL 3ARED 3T65A 2VLKE 5IEHB 1ZA3A 3VH8A 4EN3B 5CEZD 3IDUA 1BEYL 3SKOB 4HFWA 1QEWB 4J3UA 2IJ0C 2Q3AA 3UTQA 3OMZA 5DZLA 4OCXL 4G7VL 5BV7C 2D9QB 3AGVA 2FX9H 1A5FH 2WLZA 4PGJA 3V4PH 1FL5B 4GKSB 4G8EA 4AIZA 3ECBB 1LE5A 3MRRB 3R4DA 1U8HB 2OTPA 3RY6C 5D72L 4D0CB 5ACLA 3QQ4A 2XTLA 4U0QB 1AH1A 3BZEB 2FO4A 4NCC1 1NMAH 1GHFH 2JK5B 5IW6B 1K8IA 1Y18B 3W9EB 1F00I 1E4KC 3MROA 3GO1H 1KJVA 3BH8A 3WHXA 3BHBA 3PL6B 5IT2H 2ITDB 4LVNC 5ISZE 4PV9B 4AY0A 2QQLL 4I4WA 1NGZA 3EOBA 3L3HB 1PQZA 2DQDL 4XB8A 4AENB 4P46B 2NY1C 4WEUD 1TVHA 3QPXH 3KPSE 3ZL4H 4P5TC 1SVZA 4ZFFA 4JKLA 2XFXA 3FFCE 1YEKH 3KPSB 4QF1A 4FQ1L 3RWIA 2VXVL 3LIZL 3IFLH 2JELL 1P1ZA 4PY7B 2NY7H 4LSDA 1NAMH 1Q72L 4FS0A 4G9FD 4L3AA 2ITCB 1DFBH 3MJ9H 3BQUD 5L2KE 4X6BA 4FZEL 3TWCL 1INDH 4HWZA 2JJSC 1IGTB 3D2UB 5IW3A 4DVRL 1BVLA 5FYLL 4D9QD 4AMKL 3OXSA 4IIQC 1I9IH 4QWWC 1ZTXL 3S9DB 1S7UB 2Q8BL 4LNRB 1HXMA 1OPGL 3AXLA 4HZAA 4ZUSB 4JM4H 4ACPA 2BVUA 4XVJL 1FO0A 4WI7A 1WBXB 3CSYA 5LXGH 3MLVH 3QHFH 4TUOB 4C56B 4YWGH 1NFDB 4KUZH 3NH7H 3VJ6B 1EZVY 4YHYC 4OFVA 2IALB 5EU6B 3TH4T 5DLMH 4OV5A 3ARXA 2F54B 2VQ1A 1ULVA 2YA1A 1EDQA 3LDBC 1RZGB 3D69B 3DV4B 5IW1B 2Z4QA 4M48L 1BOYA 4I18C 4O4YH 1QLRA 2F8XC 2IPUK 4N8VA 4JFHE 1F6AA 4MSWB 1XR9A 4MB3A 3FKUS 2B1AH 4WWKC 5E8NA 2NX5B 3NABH 4F9LA 5F7FA 1NANH 1YY8B 4L8CA 2ZCKH 3OKLA 1GGCL 1P1ZB 1AO7B 3RWJB 1WBYB 3V52H 2EXWD 2FD6L 3MRQA 4KROC 2AJXL 4ZAKB 1WTLA 2IMNA 4KK9D 5FB8A 1RZ7H 1P5VA 4JVPA 2BNUB 4OGAD 2BSSA 2OP4L 3L5HA 4FQCL 1BWWA 1ONQB 3O4LB 3H9HA 3MV9D 1TZIB 3MRKB 1T6VN 3BH8B 5K93A 3WHXB 2H2SC 1MH5A 3P77B 4WV1A 5HYIA 1TJIH 1JUFB 1U6AH 1QBML 1RUPL 4MLIA 3CX5K 2JTDA 1VEOA 1MQ8A 4FQLH 1X5JA 1AKJA 1MHEB 1MRDH 4FQIL 4Q0XH 1A5FL 3EDFA 1JNNL 5FDWA 5KBNC 4MXVE 4CJ0A 4GKOA 4WEBL 5DJ6A 5E2UL 4RWYL 4P2QB 3UPCA 4PRIE 3MX0A 4OLVL 3BVNA 4OFIA 5K9KB 1KUMA 1NC4D 1FNFA 2QTEA 3AB0C 4M9PA 4PJ5D 4OZIF 1KCVH 4CMHC 3BRDA 2HFEA 3ARRA 1NMAL 2YD8A 2FHCA 2IANE 1UZ8B 3TM6A 2DD8L 1R3HA 2ZNWA 3NIFE 4NWUL 4ETYA 4QHUA 5KSBE 2VWEC 4QRRB 3RY5A 4AYFA 2R4RH 2APVA 4O02L 4IOSD 4LNRA 3RHWK 1BD2E 3L3JB 2ENSA 5DRXA 1D5IH 1WZMA 2V5TA 4I9WD 1NDMB 4LCWD 3TJHD 4CNIA 1H0DA 3DROA 4LKXB 1DL7L 2A6IB 5KG9B 3QUZD 1FYTB 1H3PL 3HCVB 2IBGA 3CMOH 2WINA 3U46A 1KCRH 3EJZC 4PYHA 5HVWA 4O2FA 1IGJB 4NC1C 5SWSE 1TQBC 5C86A 3PWLA 4TNWF 3T08A 3V7AG 3CH1B 2DMCA 5DQJA 5DUBB 4BUHA 5IB2B 1T5WB 3MJ9L 3KPRD 1EX0A 5FYKL 4FZEH 2F74B 3U46B 4P9HL 4P2OB 1DN2A 5ITFA 5IV2A 4AENA 2R56H 2WBJB 3MRPA 5ID0A 5KSVA 2W0FA 3V79C 4OCRH 3NAAL 3MUZ1 3GKWL 1I3GL 4XP9H 4NBXB 1JWMB 4LCYA 1X5FA 1OPGH 1AGBA 1FH5L 4JFXB 3U48A 4PJGF 3PHOB 1G9MC 2QSTA 2DI7A 3QHFL 4I5BA 4HGKC 2DBLL 5E4EB 1B0WA 4KQ4H 3A6BH 2GTZA 5F8QC 4N90D 1TDQA 1A6AB 1U8HA 4LDEB 5D6CB 1BF2A 5BVPL 1FFNA 2H2PC 5FECA 1UYWL 3DECA 3NIGE 4L3EB 5D9SA 5GRVK 3CU7A 1C12A 4R0LA 4MZ2A 4X83A 1WTGT 3BFOA 3SDCB 1A3QA 5CP7A 4M8VA 3ARDC 2VSCA 2JLLA 1ADQL 4NPYA 4HBCL 1NMCC 3CDFA 2NY2D 2AJZA 4NGHH 5GISL 3DXAE 3EFFA 3QAZB 1I1FB 4Z78A 5LWYL 3TBWB 4RGMB 4HG4J 3SO3C 2A83A 4JZJA 4KMTH 4JN2B 3VDCA 3QXAA 2EICA 3VFTA 2MCPL 1CQKA 1G6RH 5ICYA 4ZXBD 5BRZA 2AJXH 2BVEA 1RPQA 3GHBH 4MD0B 4D9LL 5D1ZB 4YK4B 5DI8B 1GIGL 2HJKB 5C09A 5DMGD 1RVFH 5HYSG 1UA6L 3E6HA 4MA7L 2DQFB 4HHAB 2AP2A 2RCSL 3K46A 4PJEA 4PUBH 2HLFD 2DM4A 5A2FA 1DQQB 1AQDB 2GTZB 4NOBA 3V0AC 1IAOA 3RDTC 3MBEB 2RFXB 1B4JH 1OY3B 4I5BB 5J06A 5LKNA 4M1DH 4CN1A 5I1CH 4IOFC 1PKQA 4B53A 5E0QA 3SE3C 3WD5L 1XGQB 5E00B 4IRJA 2FJGA 5D7SH 4FXGA 5GGRA 3L3IA 2CKNA 4KV5E 1NCTA 4HIXL 4N1CA 5F1SA 4PJFF 1G0XA 2VN4A 3D5OF 4EVNA 1MPAL 1XIWC 4OB5H 3CGTA 1QSVA 5D93C 3MRPB 1CDHA 2WBJA 2ZJSH 1D9KC 2YOCA 5ESVB 1QSFE 5TDOB 1MQKL 1AO7E 2OCFD 2HJFA 2IQAB 3QUKB 2KZWA 3U36A 2X2YA 1U3YA 5IESH 3JTSA 1I3RB 4L4VD 1CD0A 4NQCA 4JO4L 5IB3B 3VI4F 3PDGA 3RWGA 1MCFA 4ZPTA 1MAMH 4LCCB 5F8RC 5HVHB 2GCYB 35C8H 3MV7D 1BPVA 4WO4C 5IFAL 4IS6B 5HI3C 3DNKA 3NCMA 3T77B 1SBSH 1X5GA 1ZLWH 3BP4B 5DFWH 1Q94A 5MERB 1NBQA 3X17A 5EOQL 5HI5C 4LLMA 3BN9D 3I50H 3CFCH 3G08A 4ZUWA 1WCBA 4XP9L 1FV1A 5IHUH 3P4NB 5JUEH 5L2KA 5FUOL 2IWGA 3E0GA 1TVBA 1TLKA 5J9PB 5GGTL 3VXMA 4ETQA 2DM7A 4P5MB 3GSQB 4WO4B 3LQAL 4P2QA 4PRHE 3LZFL 1RZJL 3HI5H 2HFTA 1FVEB 4FTVA 1OP5H 1AR1D 1MIEL 2C1PB 3ZKXB 1GGIH 4NQVA 4G7YL 1UVQA 4MX7A 3TNNA 5C0ND 1OB1B 4PJFA 4LSSH 1MCIA 3KPQB 5FGBA 1NCBL 3SO5A 3W5MA 3PP4H 4L29B 1B2WH 3LKRB 3OGCB 3HMWH 4NQED 5ACZA 1NCWL 3WKML 4P23D 3O2VH 3GMLB 4YDJA 4BZ2H 4U1MB 3CZFA 4XNZC 4IM8A 1A7RL 2O5ZL 5CSZB 2MCPH 1U8JA 4DCQA 4RBPH 3GHBL 3AU1B 3DX9B 3TO4B 2CJUH 1RAMA 3IXAB 1I1AA 4M7LL 3HI6L 3LSOB 2NLJA 3Q48A 4OLXL 5IQ7L 3SKNB 4R3SB 3GK8H 5D2LB 3STLB 3EO1B 3QIUC 3UTTD 5I0DA 4FQQB 1CD8A 5I18H 1L0XA 2OJEA 3FB8B 3KR3L 1NBZA 1JNHB 2GSIB 5JHDE 1ZHKA 1M71A 3EFDH 4H0HB 4PJ8C 2CDFB 3WSQL 3UAJC 5ALCL 4KGLA 4U6YB 1KJ2H 1T04B 3DMMD 4QRTB 4DKDC 3HUJB 5JHDB 4WV1C 3DTXA 4PJXF 2WBKA 1I7RB 4KU1A 4HZLB 2MSPA 4QGTA 4MA8H 5HTSA 3MLXH 3FO1A 3X14B 4JFED 4GW4B 2Z93B 4NRZA 3VXOB 3RKDD 2YPLE 4PJ5E 2E3VA 4X99A 1KIRA 4JDVA 3V5KB 3RU8L 1T0NB 1MREH 1S7UA 2AXFB 1PLGH 4JQXA 4QWWD 3IVKA 1DBKL 1S78C 4D0DA 4PRIA 5F7MC 3OKOA 1M7IA 3DUSA 1C16A 2NY6D 3HI1B 3IDYC 4IRSD 4WEMB 3UTSD 3RZWA 2J6EA 3V7MA 1NAMA 3EO0A 4A6YL 5AD0A 5EU7C 5M94B 2X4OB 1M7XA 5IESL 2CLRB 1CFVL 3DUHA 3LMJH 2BNRA 4MXQD 5CZXD 4YHZH 1UADC 3HI1A 3MCLH 1MHHB 1X4XA 2VE6B 1ZVYA 5FF6B 1XF4B 1V7NH 4OZGE 3VW3H 3K2UH 4JB9H 1I85C 1AHWB 2XNAB 4ZUTB 2X09A 2QJDA 3MO1B 2NW3A 3W9EA 2I60L 3NZHH 5DWUH 1A2YB 1Q9KB 2CR6A 5JPNB 1L7TL 1DVFD 1R5IB 4NN6B 4Y7MA 2FH6A 2NZIA 4NSKB 5F9OL 4ESKA 4TUJB 5FCUH 1J1OH 5KSUA 3DSFH 5DUPL 1I7RA 2CRZA 4K3JL 1CBVH 1KULA 1BFOB 4OCLC 5IBTH 4M61A 2Z93A 3MV8E 5HHXH 4TOYH 1EBPA 1VGKA 2QEJA 3MZGB 2Z8SA 5IHUL 4X4YB 2XWTA 1FC2D 1KEGH 1AKJD 1AFVH 2Y36L 1FGNH 3NGBB 4P4KD 1FNGB 3I6KA 1P4IL 3SN6N 1B6UA 1GGYA 5LCVL 4NN7B 4FN0A 1AE6H 3SKNA 4JY4B 1LO4L 4JCMA 1JJUA 1AHWC 1I1AB 1AGCB 1JPTH 4P2YA 2GQHA 4WTZG 1KG0B 3N50A 3G6JE 2LTQC 1GGIL 5ITBL 4S1QH 2EDFA 4KRPC 3FB6A 1U3JA 4FQXD 2W0PA 1SYSA 5A3IC 1TVDA 4QXGH 5F89A 2XN9E 4PGBA 1K4CA 1M6OA 5L88L 2BY1A 2H9GA 4LLDA 4HLZH 3M8OL 5CJBA 4PJ5B 2WK2A 5JW5B 4PRBB 3KYNB 1MNUH 3S37H 4LEXL 4G8IB 1M05A 1W0YT 5DMIL 1CGXA 3X3FL 2BRRH 1K2DB 1SEQL 5INCB 3ULVE 4K7FA 4ELMA 3VDBA 1TJGH 3NIGF 4HFUH 3V0WH 1XH3A 3B9KA 4PRNA 4ZAKC 5FCSH 1CR9H 4TUKL 5JO5A 3C6LA 5DMKA 4ZO8A 3KYAA 5E2WH 4V1DD 3MV9B 3O4LD 3KR3H 4X7FC 2OTUB 5IB5A 1JP5A 3PXJA 4S11A 4YLQT 4FNLH 5EC1A 2X05A 2AQ3A 3BP6B 1SYVB 2BOBA 4MCZB 3O3DA 2VB5A 4JRXE 1KJ3L 1MRCL 4PRHA 1IQWH 5D2NE 7FABL 1J1PL 2KDGA 4JFYA 4PJ9C 4GLRI 2VERN 3DGGB 4YHML 4ZAKD 1Z6JT 3QISA 5I17B 1KJ2B 1AO7D 3KS0H 3LV3B 4CVXB 3ARPA 5C9JB 2BVYA 4L4VE 5DQDH 3SEPA 3IU3B 4WVRA 2NY6C 4A2LA 4FQXB 4OZHB 4YGVB 4UILL 3O2DH 2F8OA 3QUXA 3MV7E 4GG6E 4G80A 2R0WH 3U7YL 4JO3L 1JGUH 3IKCA 1QSEB 1TIUA 4XBGB 1I3RA 2Y6SC 2ZOLA 3EOAA 4ZUVB 3MYJB 1KIRB 2DMKA 4XMKH 4H1LH 4P4KB 3QI9A 4M5ZL 1YY9D 3MMEA 1RZKH 3CZJA 1A4JB 3GI9H 4OFYA 3R06A 1OTTD 1RURH 4OUUA 5J13C 1C5CL 2NY3C 3MCLL 1RZFL 4F33A 2RAMA 2R1YA 3QP3A 2A6DB 3V4UL 4DVBA 4XNUL 1A4KB 2ICEA 5E70A 1ES0A 3RIFK 1NGWA 3L6FA 2QADB 2BK8A 4JFEA 3W11D 2VXTH 1DVFB 3DHMA 1AXIB 1QFOA 4P57B 4ZODA 3IFOB 1NBZB 3T2NL 4L9LA 4K3JH 5DEGA 2E7HA 4JANB 3UTZA 3V0VB 3FQNB 1E28B 3BN3B 2MHAB 2P43B 4BKLA 4NO0A 5F72S 2XA8L 2XA3A 3QXVA 1E6JH 3E6FA 3P9WB 3QDJB 4GG8B 1HHIB 1BJ1H 1QRNA 3WEXB 3VFUB 2B1HH 5L9DH 1PZ5A 3QIWA 1U8KB 4TQEL 5F44A 2DQFA 4HHAA 3ZE1F 2V5RA 1G84A 4P46D 3CPLA 4WI6A 1YMMD 2FJHB 5IKCB 1W72B 4KH2A 4U6HA 2PR4H 2LU4A 2DTSA 1KXQE 3GMMB 3QNZB 5DDHA 4NIKB 4S1QL 5J3HD 2DM2A 1FZKB 4XNYL 1RJCA 4MXWL 2Z31D 4PRPE 4M7KL 1F2XK 1F6FB 3WO4B 4P2RE 1CD1A 4G43B 4JHWH 3UTTE 3DX8B 1NQBA 1AI1L 1LO0H 4MXVF 5CZVH 4GAYA 4OZGA 1KBGH 2CO6B 4QRPB 1QOKA 1S7RA 5JHDD 3RBGA 1Z3GH 4UIKL 4NNYB 4XMPH 3BPCB 5GGSB 1KN4L 5DVNA 3DMMB 2UVFA 4QHLB 5KVGL 4OFKA 4OD3L 2EDTA 5E03A 5D9SB 3MRLA 4LLUB 3RVTC 5B3NA 5GS1B 4IRZL 3BGAA 4HFUL 5ADPL 3UC0L 4YBLB 3VXMB 1WWCA 2APFA 2FYYB 2YUWA 3OPZH 1MFCH 4WCYL 1EEZA 4KTDL 3BKYH 3MRFB 4EUPH 5I71B 4YXLL 2PUQT 4XAWL 3FN0L 1FDLH 4KDTC 3F7VB 3BPNB 2PTVA 2WWKT 4L1DA 3EYOA 4NHUA 4QTHA 5DEZA 4AL8H 3RPIB 3HPJA 1JN6B 4NNXA 4U33A 4HFWB 1QEWA 1EHNA 2W0FB 4HC1L 2BNQE 3D39B 3N1GC 2V5YA 1AGBB 3PWUB 4JY6A 4DGYL 5I1AB 1NDGB 3NPSB 4NNPH 3UTPD 4XBPA 4ISVB 3EJYC 1VHPA 1ZLSL 5FXCH 3HE7A 2AEQL 1N2RA 3CVIL 3SDAA 3SY0B 3JTTA 4KK8C 3SQOH 3ZE2F 2O5YH 5F7EL 1LEGB 2CPCA 4ODHL 4WENB 4LQFH 3GGWB 1P9MC 1OAKH 2DWEA 2W9DL 1NFKA 1U2HA 2A6IA 3WO4C 5D71L 1JMXA 5BV7L 2PW1A 4LAQH 4LCUB 4EOWL 4LHUD 1W0VB 5FUCC 3UTSE 4FMFA 4X80L 2D7MA 4UUJA 3UXFA 3ARBB 4Q9RL 1T6WA 1DEEB 2YXMA 3GSNL 3MLRH 2SEBA 4U0RB 2OL3H 43C9A 1RZFH 4G6JL 2JIXB 3H42H 1UM4L 4WHYH 3NZ8A 3IRPX 1JWUA 5IEKB 4LCCC 1D5XB 2KH2B 1YMMB 2LVEA 1CDGA 4C55A 1FAIL 4Y4HB 1WIOA 3PP3H 5IQ9B 2BJML 4JG0L 1NH6A 2X89D 1WAAE 1UZ8A 4LSQL 3THMH 2F19L 4ZS7L 3UTTA 1MCKA 1FJ1A 5FOBB 5KZCB 3QIBA 3RL2B 2V9QA 5IVNA 2PKDA 4HS3B 3IDJB 3OAYH 2DQCL 2W1NA 1U8QA 1TZGH 3KPOB 4I0PA 3UX9B 4G42A 4RSVA 5DTFA 4Q9QH 1E6JL 1VKXA 5IWLC 1PW3A 1LEKB 1ZGLP 2RB8A 5DS8A 4PRAA 1KIUA 4PJGA 3OKKA 3LKOB 3UYOD 4GAYB 4X9BA 4YBHA 2UZXB 5CJ8A 2OSLA 3HFML 5D7JC 4KI5F 3WCYA 4TSBL 2J5LC 4NQDD 1HI6B 3IFNL 3SGKC 3JBG7 4PGZA 2ICWI 3QWOB 3GIZL 2WQ8A 4ODWB 5IGXL 1W72H 1JV5B 3EFFB 5GRYA 4ONGH 1BM3H 1C5DA 5C7XH 1L6XA 4JFFE 4P99A 3ET9F 3MLTB 4NUGL 1FNEB 1PZ5B 5JW4N 2B4CL 3MXWH 5E1AA 1KBGL 3C09C 3GSXA 4K8RL 3NCCB 1GHFL 1QLRB 2VZTA 2VLJE 4DN3H 3WBDA 1WT5A 1KN4H 3DV4A 2ZUUA 4JY5H 2HA1A 5E8NB 1FFOB 3SOBH 1CFNB 2OTWB 3EYFB 1J87A 5FHBH 1Q0XH 3O6FB 2J2ZA 4LVEA 1VFUA 4XNMA 1OM3H 5ESQB 4KRPD 5EO0B 3ROOA 3ZSTA 1UM6H 2P49B 1NGQH 5EBWA 2FHBA 1QHOA 2IADA 1W2KT 5D1ZD 1OP3H 4RMSA 3BESR 3WFZA 1TMCB 4KTDH 4XGZA 1MLCB 1SY6A 4H8WC 4UUJB 1EXUA 2V17L 2EH7H 2JJWA 4QXTA 4ZUSA 4KRLB 5D1QA 4AL8L 5IIEB 2Q6WB 2VXUH 1L0YA 3QDGA 2NW2B 4JO1H 2ICWA 3VGEA 2R39A 2VLKB 3QCTH 2A74A 3OV6A 4TRPL 5DD3L 5HHOE 4AMKH 1MELA 2W91A 1J5OL 4NKDB 1ZLSH 1ZTXH 3GRWH 5H2BA 4R4FL 1BLNA 2NYYD 1S7QB 2OS7A 2XTJD 3A67H 4LQFL 5TDPA 2P5WD 3P0VH 2YD4A 1D6VH 1FQ9C 3LEVH 4YWGL 2HKHH 3N0PB 5AYUL 5I9QC 4XBPB 1QSEA 4EBQH 4JFZH 4OLZL 1PQZB 4MAYB 1XEDA 2XZCL 3S4SB 1JYXA 1H8NA 4Q9RH 4ZFFB 2FR4B 3HA0A 5GIRA 4GG6A 5D7IF 3DURB 4U0RC 4NN7C 1PYWB 4OF6A 3W5NA 4HXAL 2BXZA 5GS0H 2EE6A 3BGFB 1BHGA 2BOBB 4B5EA 3K3QA 4P3CH 3G5YA 5GS2D 1JGEA 2B1AL 2P5EB 3SGEI 4JFHD 4LHQB 3QDJE 1YEFL 4YHYB 3IU4H 1QR1A 4JG0H 2H8PB 4GRMA 4X6DA 5D7KE 3B9KD 2DQHH 4AIZB 4HUUA 3PGCB 1G1YA 5ICXA 3G5YB 1AKJB 3QQ4B 1AR2A 2OBGA 4XPGL 3S5LG 1QSFD 1TZGL 3FJTA 3VA6A 2ED7A 3CXHK 4O2EA 1KXVC 5DJ2B 1Q1JH 1MI5B 1KLGB 2CDGB 1A6ZA 4LCWB 3VFGH 1P69B 2P5ED 2GJ6E 5FV1L 3DLQR 1ZA3B 1J0JA 4Z8FL 1SM3H 2YUXA 3AM8C 4RFNC 3UTQB 1GPOL 1OLZA 4X0KA 2A73A 5TDPB 1YPZB 1KEML 1YJDH 2J1KA 3S7GA 1BAFL 1MF2H 3DV6A 2XZQL 5IJVA 1J8HA 3L3KB 1WWAX 5LJYH 2F5AL 4R90H 1NAKL 3T3PE 3QO0A 5FKAB 2AQ1A 3R1GL 1G7IB 5CILL 5SWSA 1XGPA 1J11A 3UTZB 4L9LB 1AGCA 4PP2A 5IK3A 5IIEA 3BO8B 4OF5A 4OFYD 5BVJA 1ITBB 3SQBA 3RY6A 3ZE0E 2VJXA 2CKBH 5D96C 4KGJA 4QNPE 4ELMF 4TN9A 4TPRL 4N0CD 1FNLA 1QLEL 2D3VA 2G5BA 2FL5A 4JN1L 3FONA 2BMKB 5TF1L 1M1SA 4Z7WB 3UBXB 5BXFB 3MO1A 2Q8AL 1LD9A 5DFVC 5EUKA 3IXTA 4E42A 5DJ8B 1MCPL 3O6KL 3V6ZA 4RX4D 4Y5XA 2JB5H 4NSKA 4R96A 4Y5VB 4OZIE 5IVOA 3QRGH 2A6JB 1R5VA 1YEEL 3RWCB 3TYFA 4BH8A 4X6BB 2ZUYA 3PABA 2FX7L 5DURD 5SWZB 5HPOA 5DJXB 4ZTPH 2R56L 3VH8G 3HE6D 4NHCL 4Y4FC 1I3GH 2X44D 4Z7QE 2XG5A 2GYSA 5CMAA 4F2MB 2DQDH 1T2JA 5DJXA 5GZOC 2YSSA 4Q6IB 2EDBA 1YYLH 2W92A 3MRIA 5AYUH 4PGCA 3QIUB 2BSED 3FO0H 3TZVC 3O11B 3GMQB 3BWAA 1IM9A 1NEUA 3KWWB 4C56D 3G6AB 3JXAA 4NQDB 3ES6B 5GSVA 1A0QH 4MGXA 5FO7B 3RIFF 4GMTL 3ZDYE 1U8OB 4RGNE 5DK2A 1KLFA 4Z7UA 3ARFD 2DQIL 6FABH 3D2UD 5T5NG 2VOTA 2DQGH 3P4MB 4JFDE 3LRSB 4B41A 1KJMB 1ORQA 4LFHD 1M05B 2D2OA 4G8IA 4U6YA 2FNBA 1PG7W 1R5WB 3GIVB 4DZBA 1HWHB 3M45A 2E9BA 2PO6C 3LKNB 4MNGE 1QUNA 1F4AA 2R0ZL 4NT6B 3L3KA 1H3GA 4DGIH 3DVNB 2A9ML 4WTZA 5HVGB 1RUAH 1RVFL 3JV5A 3DYPA 3RI5F 4X9GA 1AXTH 3WFDL 1A6WH 2I07A 4PJ9B 5HHME 3RVXD 2VIRA 1P7QD 1UM5H 3MV7B 3W39B 1ETZB 1AD9B 4M1GL 3C5ZC 4S1RL 1MI5A 3L95A 2IGFH 4D3CH 4YR6B 5MEPB 1OSZA 3VU2A 3X13B 2BY0A 5BS0A 3WD5H 3MYZA 3ROLB 5GSVB 3LQMA 3ZDXF 2EKJA 1S7VB 4JHBA 1CL7I 5C07A 5KW9L 5D1QC 2VL4A 3KPLB 3ABZA 4RNRA 4XPHL 1QSFA 3CFJA 3G6DH 3QA3B 1HIML 1R5IA 3TCLA 5F88A 1RFDH 2AV7B 2OK0H 2A77H 7CGTA 3NA9L 2P5EA 4KHXH 2UY7A 4TPRH 4NQCE 1TJIL 1KELL 4OQTA 3TYGH 3F65A 4G8GA 5I75B 1I85A 1D5ZB 4FQHA 2ZOKB 4QRUB 2E6JA 3PNWA 3BP4A 4Q0XL 3W2DL 5A43C 1T1WB 1S7XB 5GIRB 3HHRB 4FQJH 4YBLC 3HNVH 3FO9B 4APQA 3B5GA 3ALXA 4N0FA 3QQNA 5GS2H 4R7NA 4LBEB 2P5WE 5HHNA 4ENED 4U7KA 1U3HA 1YMHA 4NP4L 3SKMA 5HPMA 4RAVA 3QEQA 1RY7B 2VO5A 3X13A 4ZO9A 1KCSH 1UB5A 4N0FB 3EYQD 2HLAB 3I50L 4N0UE 1B88A 1XZ0A 5IHLB 5T3XE 2O93L 5EBMB 1UQSA 1UKTA 4QRPD 4GUPB 3BYYA 3FMGH 2HAZA 1Q0YL 4U6HB 3OR7B 5I1IH 1TFHA 4TNVF 4L8SB 4H5SA 3BD5A 2CLZA 4RQQA 3QEGL 2DKSA 4FP8H 3FO1B 1RZJH 1HNGA 3X14A 1Q9WA 2YN3A 3EGSA 2Z31B 4C4KO 3HZKB 1MJ8H 1TCMA 1IAIH 1VADB 4XAKD 5I1LB 1NC2D 1NCNA 4Z0BH 2UYLB 1NCAH 4XMLL 2VC2L 1HYSD 4P9HH 3S3PA 5F3HA 4PREB 3KJ4C 4RGMC 1J18A 1E28A 1VSCA 2AK4D 4LLWA 3EUUA 3PP4L 3NAAH 3CDYA 4PJDF 3G04A 5TDNA 3QDJD 5EZLA 2WBWB 3S36L 5CFHA 1V3MA 3MLUL 2YD2A 3MLTA 1WFOA 5TGBB 3VG0H 3CLFL 4X7DC 4XPFL 4H0GA 4GRLB 4UNTA 1DQML 4JRYA 1OAXH 1ACYH 3CMGA 4YDLC 2OMBA 4PP1C 1BREA 5FO9B 4OF3A 4DGIL 4M7LH 3MFFB 4OLXH 2IPTL 3LH2L 4D9RD 2XQBH 1CXEA 1S3KH 2HJKA 1JZ3A 3VFOA 1KYOJ 5DMYA 2H26B 1NEZG 2WBJD 3LQAC 1OW0A 3WUWB 5GGQL 1RJYA 5ID1A 3KPNA 3MUGA 3LRHA 3RX5A 1MFBH 3EJZD 4F9PC 1O0VA 3WFDH 5IJKA 1UZ6F 3OGOE 3E2HB 4JFQB 5C08B 5ANMA 1DDHB 2DJ4A 4XPTL 4Y4KB 4M1GH 1A1NB 2YZ1A 1N64H 5C0FB 1IGMH 3RKPA 3QFJA 2WBJC 3QUZB 1J05B 5C0AD 1I7TB 4QEGA 5TQ2H 5E08H 2EDRA 4Z7WE 5FECB 5BMFL 4EXPX 1MCWM 2QV2A 1KNOA 1QSED 5T5NF 2HYMA 2P8MA 2DYPA 3O9WB 4RGNC 1ZHNA 4R0LB 1LK3H 1UXWA 4HQQL 4CW1A 2DJSA 4MA3A 1J8KA 2ADFH 1EGJL 1MJJB 3P4NA 3WFEL 4WTXA 2DIJA 3QDMA 3VRJA 2FB4L 4BSWA 2VR4A 4J1UA 1LNUA 4EI5C 5HYFA 3LS4L 2OR9L 3RWDA 3TYGL 2BVPB 2GK0A 4P2QD 1XGRA 3BKCL 3V9FA 2EKSA 1ZVHA 5I1CL 4PJXE 3W2DH 5IB2A 3BEWB 3H7LA 3HN3A 1ZT1B 3NN8B 5GZND 3QULB 3VFSB 2H2SD 4FTVD 2APTA 3NCBB 3V4PL 1V7NL 3RWGB 2ZUTA 4I0KA 1K2DA 3TJEL 2V7HB 5D7SL 2DI8A 2WAHA 4QHNB 1EK3A 4F7EB 4NZUL 5C0CD 5DSCB 1YY9C 4R4BA 3HE7B 2A6JA 1LDSA 3GGWA 4F9LC 4J8RB 1EEUA 3LKQA 2VKXA 2DKMA 2C1OB 4Z6AT 4IMKA 2WUCL 5EA0L 2VABB 5IROC 4CN4A 5ABDE 5A3ID 1KG0A 1EO5A 3QG7H 4JCLA 2AJUL 1IL1B 4YEFA 1Q9OB 1PKQE 2ICWJ 1A6ZB 4LCWA 1JRHI 3S5LB 1TCRA 3VGAB 5GGVY 4KK6C 1DN0A 3GMPB 1HZHH 5IFAH 4Z7VE 1NAML 2X70A 3QEUA 1MAJA 4HIHB 3UEZA 2XWBB 5DJCA 3WIIH 4HUXB 1C5DB 3EJJX 3RIAK 1KPUB 3GSUA 4LPWA 4YHIB 3JV6A 1GGBL 1NKRA 1HSBB 1O7VA 2P4AB 1QA9B 1KTDA 1NFIA 4TUJA 3FT3B 5C6TH 3BD3A 4Y5YB 2BVQA 3S36H 1D9KB 5ESAB 1KB9K 3D3VD 2WUBH 3QJFA 1HH9A 1FRGH 4OGAC 1N0XH 43CAA 2Z31C 1CVSC 4HH9B 5DRNA 1B0GB 4YXHL 5DA0B 3QCVH 4HUNB 4YFLI 3O8XC 3FQWA 3TESA 3ARDD 3LQZA 1TTUA 1FZMB 4PRPA 3A0OA 4XVSL 2HVKA 4K3EL 4Z95H 5EUOE 5HD8C 3KYKH 4LKCB 4ZTOH 5D7LD 1CLCA 4MJIA 3OHXB 4NJ9H 1KLUA 4FNLL 1NCBH 1CU4L 2R4SL 3BPOC 2FEDC 3HMWL 5HDQL 4HUUB 3UYRH 2AEIT 1U8KA 4U6XA 4G6AD 3WLBB 2EXYC 5GQBA 2FGWL 4JFXA 1IAMA 2AV1B 2X9WA 1LK3L 4D8PA 4E41D 3MPCA 5CWSA 2R1WB 1Y6NR 4N0CC 1RZ7L 1ZT7B 3IRZA 1ZWIB 1S7SB 5GRUH 3B2UC 4JM2B 1MHCB 4N5ED 2MMXA 2J6EH 2YC1A 3S4SA 4HLZG 4J12A 4TVPE 1IC5H 4JFEB 5DSCA 3C5ZD 4H88L 3FTGB 4NQXA 3JWDH 4ZPVA 5E5RB 1IGTA 1XGPB 3D2UA 5ALCH 5AUMA 3EO1A 3SDCC 1LMKA 2X4UA 3T1FB 2XOTA 1C1EL 4XBEH 4K2UH 5E99H 3C2SA 3CH8A 4JFFD 1GYAA 3C60C 1A3RL 5IVZB 3TT1H 2MKWA 3VWKB 4DOHB 1D5MA 5D1XC 2ADJB 2CKBA 4EN3D 1DBKH 4ODWA 3I75B 4O02H 5DQ9A 4N68A 1OHQA 1UENA 4RFOH 5MENE 5INDB 2WM0A 3VXUD 2AV7A 3MREA 5F97E 5ISZA 4F3FA 5IR1B 4DZ8A 4NC1E 1SMOA 3SJVE 3KLDA 4UI2A 1EFXD 1WWBX 3GBLA 3AROA 3SDDB 2EC9U 3VW3L 2PO6B 1KCRL 1R3KB 1UCTA 2DLFL 2DQJH 3BZ4A 4MCZA 3MRNB 5C08A 2YPLA 3AMKA 4NJAL 1JGEB 3KPOA 4I0PB 2WQRA 4Y19E 5FA3A 4V1DA 3A6OA 3PP3K 4RIRA 1NUFA 3WIIL 2J7LA 3K0WA 1WCBB 3KXFA 3LY6A 5EO9B 5A1AA 1T7VA 3IJYB 2V5SA 1AIFB 2DTMH 1AI1H 1QO3A 1BBDH 2BSRA 1CLOH 5C6TL 1NMBH 3RBSA 1OTUD 1AFVL 3UTOA 4IRSC 4BQ6A 1DCLA 4NFDA 2JIXA 5F1KC 3VI3F 2DBLH 2VXSL 3IDNB 2P42B 4MJIE 4MSWA 5E24E 3WL9A 3VWKC 4GG8A 2A0LD 3DYOA 5T1LA 5BVPH 2VYRE 1UACH 2CIKB 2IBBA 4U1LB 3IDMA 4P3DB 3FQTB 4WW2F 4F57L 4LIQL 1R5WA 2AABL 3GIVA 4OLYL 3EKCA 1X4YA 5EIIB 4M7JL 2Q3ZA 4ZTOL 3BMVA 4I13B 3QI9D 3IDJA 2R4SH 3VI4E 3RFZC 1R3LA 5GISH 5HDQH 1OVZA 2A6KB 4P48A 4JKPH 4YO0B 5SWQB 5HGDB 4LHUG 2RJMA 4APQC 3OKEB 5DD1L 3TBVB 4NWTH 4JE4B 5JZ7C 3P9LB 4LSUH 2H3NB 4P2QE 2Z92B 2H6PA 4FFYL 3DO3A 1FORL 1S9YA 1X5ZA 5HYEA 5J1AB 5JW4R 3GMQA 4BSVB 3QDMB 4DKFH 3PWJA 3U9UB 2L0DA 5C71A 4MCYA 2XZZA 5E2VL 2SEBB 4BSJA 4LPVA 2ATPB 1LP9A 2ZSWB 4PJ8A 1KOAA 1OAKL 3PWNA 2J8UF 4LIQE 3T4YA 4I3GA 1MJUH 3WDHA 1CQYA 5FYLD 4G80B 2QQQA 1CFQB 4E0RA 4EOWH 3GSXB 1UGNA 4UT6L 4LASL 2ATKA 5H37H 3VXNA 5D5ME 3SDXE 3OR6B 2C5DC 5KANI 4X7SL 4WFGE 1I1AC 2DKUA 4MVBD 1TVHB 4KKCC 1FIGL 3MBED 4PS4L 3TYFB 4P46A 4G6JH 1C1EH 4XP6L 3OKDB 2F53A 1PVHA 4U3XA 4L4TD 5AWNH 3CFIC 3KPSA 3LKSB 5E6IA 2QQNH 3CUPB 1TTGA 5CJQH 4Q2ZA 2BHUA 2QR0B 1BD2D 4KJWD 4R4NC 1K85A 4EUPG 3OZ9L 4B7LA 4ZS7H 2Z8WC 3MLYL 3TN0A 1MPAH 4CRPA 1MJ7L 3VXRD 2EECA 1MHPH 4G9DA 1G7LB 4JJHA 3OX8B 4AG4L 3HC0A 3J7HA 2ZOKA 1DBJH 2CDEA 3TH2T 4Y16B 3WS6C 4PJ7E 2V2TB 2EIDA 3BZEA 3D48R 2W59A 2MPAL 4N9OB 3VFWA 1A9EB 3VD5A 1A14L 3S34H 1YEDB 3Q6GH 5GS1A 4X4MA 2CRIA 1CXKA 1B9ZA 4XNUH 1MAML 1NFDE 3T2PA 3DXAD 4X7TA 2DWDA 3MRGB 3H2WA 4XX1G 3VWJA 4WIQA 5J6HB 3TGXA 2CIKA 4PJ5A 1QPXA 5ANMB 3TVMD 3EOTH 4OGZA 4P5TB 5E8EA 4O2CA 4KI5C 3RZCD 5T3XL 1MCLA 4ONGL 3QZWG 1YPZA 3RL1A 1E27A 2FJFB 5HHQB 1Q9WB 3EGSB 1YN7B 4NQTA 1JIBA 4OIIL 1KN2L 4H5SB 4LVOC 1CE6A 2MFNA 1AJ7H 4P4RA 4U1IB 5GRJH 3BI9X 4DFHA 5FUOH 4O5LL 3IDYB 3IDXH 3DX7B 1XGTA 4XCYB 5DC9B 1NBVH 5AG9A 3LQAH 1AIFA 4YNYB 3SGKA 1XGYL 5IHZB 1LEGA 5IFJA 4HKXA 4HGWB 5C0AB 1F97A 4S2SA 2NY3B 3KPRB 5TDNB 1MFEL 2PR4L 4HWBA 3SKMB 1MIEH 3L3JA 1YEIH 2W9EH 5EUOB 1T7ZA 4F7CB 1S7TB 5JIIA 5HHNB 1CIDA 1ZXQA 5C08D 4MJ6A 4JFOA 4YHLH 5IB4A 3UJIL 3ZKSD 5KSUB 5LAXA 3QH3A 5JLZA 3U6RB 4Y19B 3HC4H 3TVMC 1OSPL 4F3FB 3NFSL 1EJOH 1J0IA 2QBWA 3C08H 4JZOB 1IC1A 4UIKH 1JZ5A 4NUJB 2CLZB 5D2LF 4D0BB 3GO1L 2HTLC 3IAGC 1IFHH 4LSUL 5D7IE 3PGFL 5DJ6B 3F5WB 3BN9C 4DW2L 3QWRA 4AQOA 4ZOEA 3B3IA 2QQLH 5F7DB 4HJJH 5FOJA 4PTTA 4KKLD 5HGHA 1WITA 3QIBD 1WIUA 1RIUH 3WIHA 1OAUL 3WLWC 4ZFGL 3GM8A 4KI1A 3RZCB 3ULUD 3VXQA 4LCCA 3OF6A 1K6QH 3RWCA 4BH8B 3TVMB 3CC5B 4KJQD 2NXZB 4OZIA 4Y4KA 2VXVH 3LIZH 2OZ4A 3T77A 3O3UN 1Z9MA 5E8DL 3EFDL 3MGTB 3W81A 1CTNA 3UO1H 1HHHB 1Q72H 3GEWB 4MJ2A 5J56B 5IFJB 5HY9A 4EUPA 1EHAA 5KAQF 4JFPB 3S96A 4G3YH 3HZYB 5CEXA 2E6PA 1JF1A 4M8QB 5JHLH 4RA0C 5CS7A 4TNWK 5CKGA 4PRBA 3PDDA 3GSRA 2IQAA 3U36B 2EDKA 1HWGB 2PN5A 4Q7DA 4U2YA 3EZJB 2BOCA 1T2XA 4F7MA 1T5XA 3ME0A 5DJ8A 5EUOF 2J8UA 3VXRB 5EUKB 5CWSB 4N8PA 3BWUC 3T4AB 3WIFA 2HTKD 3UBXA 2W9DH 1QRNB 3H9SE 1CCZA 1CZ8H 4CADA 3NH7L 1NKOA 1NSNH 2X4QB 5D71H 4XPGH 1ZSDA 1EHLL 5KVMC 4LLYA 2X4PA 4L4TB 4QHMA 5T5FH 5MP6L 2E9JA 4K94H 3LMJL 4NKIL 4UMGA 3V6FA 3LEXA 2BNQA 3TBTB 2YEZA 5DJYA 3Q0HA 1JYWA 2XKNA 4GXUN 4A6YB 4E5XA 4HGWA 15C8L 3GMLA 1GPOH 5DMGC 3GNMH 1CGUA 2LV4A 1OF2A 2I60H 3NZHL 3HR5B 3NABL 1MF2L 1AXSB 1SY6L 2F19H 1N59B 5EU6D 5E1HB 1J0YA 4WI2A 3N1FC 5IROA 4BZ1L 2CDGA 2DQUL 2KQMA 3ARFC 4CMMA 3ZO0A 2EO9A 3O11A 1IGCL 4HG4K 1W8OA 4KDWA 2AKRB 1NUDA 4AEIH 3AS1A 4GAFB 25C8L 3TJHC 1H8SA 3VFTB 4CVUA 4ODUB 5D96B 3GSWB 4ODSL 1NBVL 4V2BA 1BWMA 4W6XB 4X6CA 1EHXA 5LCVH 1OARL 4G42B 1KLGA 5E5MB 4IMLA 1CGWA 1OAZH 3WUZA 1DQJB 4HS3A 2ATKB 3QIWC 3LD8C 4ZYKA 4MWFB 3RDTA 5FA3B 1BQHG 1P7QB 5J11C 3TH3T 5IMOB 1T0NA 4PJ9D 5FDYA 4PJAB 2BRQA 2PO6A 4Y16A 1IC4H 3VDAA 2JB5L 1DZBA 3IS1X 1L4IA 3V4VH 1OSPH 3QRGL 2HG5A 1CG9B 4OZ4A 1ND0A 3D25A 4LF3A 5L0QB 1EJOL 2BX5A 1X7QA 3G5XB 1VGEL 3AFLA 3C08L 5IB5B 2VABA 3OBAA 4ZO6A 1O5DT 3O6LL 5T1DH 2HT4C 4OD2B 1R24A 2R4RL 4TSCH 3EOYG 4LCUA 1MEXL 3C8KB 4I0CC 1OM3L 1B3JA 5KTEH 3ARFB 2EO1A 1F2QA 1YUHB 2W0LA 3SO3B 1J0HA 2VSDA 2WW8A 3FQTA 4K23L 2ZWLT 3C60D 2EDWA 1XF3B 3SDDD 3GMRA 7FABH 3PWUA 5I1AA 1A22B 2I9TB 2JJUA 5DRZB 4EN3C 4UIMB 3FOMB 2A73B 2C3XA 3N1QC 1IRAY 3QCTL 4GMTH 1JF6A 5J57B 4M93C 3VXUB 3QIUD 5BCAA 4DUWA 5I8KH 1R3JA 3SDXA 4X4ZA 1EMTH 1YZZA 2HFEB 5TE7H 3O0RL 3S98A 2ESVB 2YC1B 4ODXA 3GDBA 2IEPA 5IMOA 3HNSL 3VRIA 1II4E 1QPPA 1U92B 4YXKL 4JDTH 4HX1B 3C5SB 5TF0A 1IKFL 1PKOA 3VXSA 3C87A 3HE6B 5JOFA 1TQCC 4JFZL 5DURB 5SWZD 2EDQA 5KS9A 3TO4C 1ED3B 2G9HA 4QCIB 3PGDB 2WP3O 5CBAA 4U6XB 4R3SA 5I1GL 5KVDL 3E8UH 4P5MA 5I74C 5J9PA 1BIIA 4J4PA 5GJTH 3IETA 1ZSDB 1Z5LB 3V4UH 5K59E 4MNQA 3KYMA 1I9EA 5CEZE 5JXEC 3MBXL 3BKJL 4KJPC 5K9OA 5ESAA 1QNZL 3RWFA 5JA8B 3RTQD 3VFOB 3TBYA 1FLTX 3CU1A 5LWYH 1Z5LA 4PGEA 5DC4B 1QR4A 4J23A 3KPMA 2F53B 1A6UH 5D6DA 3LKRA 1OTSC 5HHPB 1YDPA 1DLHB 5CZXC 1IGCH 2YUZA 1CICB 2YRLA 3ZTNL 5FB8B 1SJXA 3TBYB 1OWWA 4QTIL 5JQ6H 3ZKNC 5KW9H 4QOKB 2XPGB 4KJYB 4QRSB 1F4XL 1H5BA 3DBXB 1VA9A 1U8IB 3VFGL 3G04B 4J3TA 3B83A 4FQXC 3PG2A 5J13B 4PJXB 3X3GH 1FCCA 1SM3L 5T1KD 4ODXB 1Q38A 1WZLA 4UT7L 3PDOA 2GHWB 2LVCA 1N6UA 3OB8A 1GC1H 1F11B 1ED3A 1RUKH 1D6EB 4PYGA 5C09E 3TFKD 1BAFH 4NZRL 2F5AH 4YBQC 5EOCJ 1U8PB 4OLUL 4UNUA 1QBLL 1RK1A 1LK2A 4CN6A 2F74A 3S5LA 1MCSA 3ULUE 5IQ9A 5C0RH 5BJTB 4X6FA 4UOJA 4KKNA 4LDOB 4X7EC 1UEMA 5TH2B 3ZE2E 4NKOB 3D3VE 5HJ3B 5JW3L 2GKIA 3D3VB 4ODTH 4P4KA 2OYPA 2D0GA 1CFNA 3KPTA 5DRZA 4R8WH 5GGVH 1DUYA 3QBTB 2OMNA 4XNQA 3IDMB 4DCQB 1W0VA 3MA9L 3STBA 1H15B 2X4SA 4LBEA 1KXTB 4LSVH 3T1FA 4EI5D 3QPXL 5E94B 5C9KA 3VXQB 4LOUD 2XPGA 4KJYA 4HK0A 5AUMB 2K3TA 3BPLB 4ONFL 3BPOB 2ZCLH 3A6CL 4I18A 1MLBB 3NPSC 4PY8I 3IU3A 1T1XB 3C9NA 4G6MH 1JV5A 3UCRA 1NEZA 4CVXA 2BSRB 5J8OA 2VLRB 4C83A 2ZG1A 1FO0L 1MJJA 1HOCA 4MAYD 4G5ZH 3PL6A 2XYCA 1A6TB 4HC1H 2FYYA 5EOQH 2H32H 1K9TA 2NMSA 3C8DA 3NVQA 5EZOL 8CGTA 4DVRH 4OI9A 5C3LD 4KQ3L 2P5WB 4XP1H 3IETB 4JM4L 4OGYL 4JQVC 4L4VA 5C07B 3NACL 1HSBA 4UOW1 5ADOL 3RVUC 4J7RA 1HQ4B 3EDEA 4J3OC 2PTUA 2Y4SA 3B9AA 1ACYL 5C0CB 2UUDH 1QFWL 2OZ4H 4PJAF 2ORBL 2OX5A 1OGAB 4WW1B 5F21B 3VWJC 4DEPB 2VLLA 5EZIH 3ECBA 4QOKA 3G08B 5HHOD 1MCCA 4XVUD 3QDME 1KPRB 3H9SA 4HKZA 4PJHB 4HIIA 4KK6D 4XP4L 3U7WH 5JORA 3H42L 3LQZB 1JYVA 4O58L 2FECL 2ID5A 2XQYG 4POZD 2H2PD 3UJJH 4WW2B 3X11B 2DQIH 3VWKA 5T3ZE 6FABL 4KAQH 3BP7B 1N3NA 5BW7C 2P45B 1N7MH 2J88L 2VN7A 4Z78B 2VDLH 4PB0H 2ZCKL 1QG3A 4OM0L 3KLAB 5FYJD 4XCCH 4CMMB 3L3DB 3G6JA 2ARJQ 1SJEB 2FD6H 2NQCA 3DX6B 4JVWA 3QWQB 3QG6B 4H8WL 1AGFA 3EO9H 5J1SC 1W72A 1NGYA 3O9WD 4OV5B 2A9MH 2ZUQC 3B8YA 3AY4A 3FZUC 2J4WL 2XIDA 4HIHA 5KANG 3PIQB 3VXNB 2Z91B 3QT2A 4UTBL 4Y2DA 4R2GC 4QYOB 1A6AA 2MJWA 3X3GL 4M00A 3QUXC 5D7KD 1I7UA 3DPBA 4WFEE 2C4XA 3MLZH 5TQ0H 1QBMH 5C0NC 2CR3A 3FT2B 1YECH 2R1WA 4N9GA 4Y89A 3O3EA 4P0DA 2C4FU 3DO7A 2VDNL 1KYOK 5MENA 4Z76A 2P8PA 2MQ3A 1ZT4A 5DEGB 1JWSB 4PBVC 2UYLA 5I1JH 4LCWE 5F6IB 3P30L 3MLXL 4RWYH 5E2UH 3NCYS 3P9LA 2CH8A 1BM3L 4PJAA 3CFDB 1LGVA 1ZGLM 3NTCL 1F3JB 3O6FC 4CU6A 1X4ZA 2R9HD 1XGUA 2DBJA 3RU8H 1AC6A 4ZNEE 1SVCP 1YMHB 1OP3K 4GRLD 4XPHH 3RGVC 4Y8DC 3NPZB 2VDQH 2ADIA 3L3GA 3W0WB 1DE4B 4JY5L 2FZ3A 5K9QG 2AJSH 5HHVL 3QIWD 3WE6B 5HI5D 1C5BH 3EYVB 1FBIL 1FVCB 1UB5B 2IAND 2UWEF 4IJ3B 4JJ5A 4OJFL 5JIPA 2N4IA 5GGRY 1P53A 1UM6L 3U4EA 2FX9L 3QNXB 1RZ8A 3V6ZB 3BHBB 1EZVX 1LD9B 4ONFH 2GITB 4WUUE 3E2HC 3MUGB 3FT4A 3R0MA 4IIQA 2V17H 2Q86A 1N6QL 5EC1B 4PTTB 5L6YL 3SDAC 1CF8L 5D7JB 3L3OB 4P59H 4OZFA 3O45B 4XT1C 1R0AH 3L1OL 5TE4L 2AERT 4Z0XB 2EIZA 4IRSA 3X12A 4MD4B 5LGJB 1KFAL 2V9RA 5B39B 3S88L 4KK5C 4OCRL 3B6SB 3WFHB 4PR5B 5D6CA 4PP2B 4JM2F 4OGYH 5IHZA 4I8DA 5I1IL 3ZT5A 3VRIB 5ECJE 1P4IH 4HWNA 4BKLB 1YA5A 4XP5L 1YEKL 3RQ3A 4X5WB 5EWIL 3DX6A 4PJ9A 2HH0H 2WANA 3GKZA 4Z7UF 4WWKD 5EZIL 5EOTA 2FIKA 2YHGA 3G9AB 1JBJA 5KSVB 1BQUA 1NUNB 2I5YL 1NANI 2VZVA 4XCNA 2VC2H 5AZEL 3I6GA 1A7NL 1OCWH 4M6OH 3TWCH 4J6RH 5CD5C 4XP4H 5CBEA 1EJ6A 3BE1H 1IMHC 3ULVH 4HBCH 2LU7A 4M3KB 4NZJA 1WBYA 4OGXL 3VXMD 2NCMA 4F33B 1YEFH 3S37L 4JFDB 1NLDH 1U93A 2WIIA 3KPPB 2FGWH 4C58B 1XIWA 4HWZB 3X3FH 1E4WH 1V3LA 2YEZB 5ELIA 4H8WH 3I2CL 1T22A 3O45A 3NGBC 4OZIB 3MV8D 4BUGA 2B5IB 1GIGH 1OTTC 3MXVL 1PEZA 4JGJA 3FQNA 4W4OA 1MWAA 4OZHA 4P2CG 4BSWB 4U6VL 4PR5A 5F3BB 4M48H 4N0UB 5LGHL 3I9GH 2X41A 4JQIH 2LABA 4PV9A 4I1NB 1AHWA 3WJJA 3U1SL 1XF4A 3MZTA 3U4EB 1RK1B 1U9KA 3MROB 3QNYB 1G9EA 5BMFH 5EU5A 3DETD 4R9HA 3V52L 1T7YA 2GSGB 1IQDA 3R1GH 1OWRM 4L9LC 1BJ8A 5BS0D 2R23A 4OKVB 2ESVE 5JNYB 2ADFL 5DZNA 2J3SA 5CP3H 3PWPD 1PEWA 8FABA 4R4ND 4KVNH 3IVKB 5B8CC 2X40A 3U7YH 5C0BB 2Z8VC 1JGUL 2X4UB 4J4PD 4DGVL 4HKXB 1CD1B 4C59B 2XN9B 3P9MB 4OKDA 4JFDA 1P2CA 3M1BB 3EO0B 1T2QL 4O9HH 1U6AL 2HFFB 1RUMH 3PABB 1SQ2N 1WLHA 3BZDA 5D1QB 5F1IA 4Q58C 4NM8H 4Y2DC 1AXSA 4G8GD 2O61A 2I07B 3MA7A 5E2JA 1JNNH 3FB7B 3OKEA 2HRPH 1G7PA 2GJ6B 2QL1A 2ZSWA 2V5MA 4OLVH 1IC7L 4IRJB 3SKJH 5AZ2L 5BVJB 5CGYD 4MCYB 5CINL 3KYMB 4LSRL 2HN7B 3GJFH 2DLTA 4Y5YC 3TIEB 4H26A 4HZLA 3SCMB 4XRCB 3T2QA 3IF1A 1CK0L 4EZMA 2BZDA 4P3DA 4YHIA 3QUMB 4R97B 3WFCH 4N0RA 1KPUA 3GSUB 5I9QB 2P5EE 4KRMB 3O4OB 5F7LB 5INCA 3I6LD 1S5IH 2BNQB 3D39E 3KPPA 4JVUA 1YEHL 4LVHC 1NCCL 1HHJB 4GBXA 3E1F1 5CUSH 2Y7QB 1FFPB 3AXLB 1FIEA 1HZHL 1T20B 4M7LT 5EBLA 3OTTA 1UACL 3HZYA 4FZ8H 4G7YH 3WNLA 1A7NH 3P9MA 1KT2A 4IDJH 1SYSB 1IAKB 1I1FA 5T3XD 5DEFB 3BP7A 4GAGH 4RAVB 2I25N 4POUB 2KUTA 4V1DB 4TVPL 4F2MA 1PX4A 1KPVA 4QOKE 3IDIB 1EGJA 4OBSA 4U1KB 1I4FB 5CZKA 4FFWC 2PCPB 5I1KL 1Z3GL 3MRGA 3RY4A 5E8PB 1TVBB 4XAKE 1A7RH 4MD5A 4EIZC 5CSBA 3WXWH 5K9JL 1YEDA 4WUUB 5E8OA 4HPOH 4L5FH 2R2BB 4MXQC 1DANT 3I2CH 5D8JH 2XWTB 4NUJA 4HPYH 1HQ4A 1M4KA 4EKXA 1WC7A 1ZKAA 3BKYL 4BYHA 1KIQB 3VXUA 5LGHH 3RJQB 4BJLA 4EIGB 1EEQA 1WISA 4OIAA 4Z76B 2DMBA 1MCEA 3FQUB 4NGHL 4S1RH 1Z2KA 2DDQH 5CCKH 2V2XA 4ZUWB 3WN5B 4G8EB 2Q1EA 5GRVL 4CW1B 3CXDH 2VLRA 4C83B 1Z0NA 4X4ME 2P8MB 1JZ2A 4L4TE 5IF0B 1PG7H 2NW2A 2NZ9D 4NO3B 3GJFB 4MJ4A 3CX2A 2O5YL 4YHKH 4ODHH 4LFHG 2HTLD 2PCPA 1UA6H 1WFNA 4KVNL 3C8KA 3OJMB 4X98A 2J6EL 5EUOA 1MHPL 1KPVB 1K3ZA 3W9DB 4DGVH 4HIEB 5IBLD 4NKDA 2BVOB 3D39A 4E42B 2DF3A 3OKMA 2JJTA 1UH4A 5DD5L 5C0AE 5HI3D 1J86A 2IAMC 1PAMA 5BZWA 1ZGLB 1CFVH 1G7JB 4P5TA 4X8XA 4HKJA 5DVLA 2Y72A 2ZKHL 3VE0A 3QR2A 4OCWH 2PW2B 3O3EB 5JIKA 2KZ1B 4JPWH 5BJTA 3V5DA 5BRZD 3H9SB 3K2UL 3ZKND 3REVA 3QCUH 5HI4C 3EDDA 2VLJB 2Y07H 5E2TH 1IBGL 2DYPB 3O9WA 3KAAA 3B9VA 5DVMA 5GS0C 1KNOB 3THML 2YWYA 4L3EE 2B20A 3B6SA 1G7QB 5E5UB 3V6FB 4IRSB 3X12B 4FQQA 1WK0A 4YDIL 2NXYB 4X9IA 2LQRA 3LDBB 4RBPK 5HHXL 1WBZA 1KB5H 1ZLUK 3FQWB 3K74B 3QWOA 3IDXL 2VLKD 4YPJA 4YC2C 5L7XL 5GHWL 2P24B 1RJYB 3MJGX 5ID1B 5DQ9B 5CUSL 3QNXA 2DRUA 4NN5B 1BIIB 1UKQA 4PD4K 4L8SC 3LVEA 3WV0A 4ZSOA 3KPMB 4FZ8L 3JUYA 5DTFB 2QLVB 4IIQB 2V2WA 5DJZA 1GZQB 2AEWA 5KSAB 5HHMB 2AXHA 5L88H 1WCQA 3LN9A 2AEPL 1F6AB 1FYTE 1AY1L 3TBTA 3UTTB 4Y5YA 3RVTD 1YNTA 2XTJC 1CD9B 3ILQC 4I9WE 5I1KH 4L4TA 4XNQB 3BZ4B 5E56A 1HH6B 4GT7A 5GGTH 1X3DA 4UAOC 4OLWL 1P4BH 3RP1A 3WXWL 5K9JH 1ZHLA 5IOPB 5MEQA 3SOBL 5GXBB 3HI5L 4XH2B 5IP4A 3FTGA 1Q0XL 5GGTA 1BMGA 3DMMC 2PTTB 1MUJB 1BJMA 5BQ7B 3O2WH 3ARDA 2AK1H 1TCRB 3T4YB 1IT9H 3P0GB 1MFBL 3L3IB 4PJ8B 4LSSL 3VD4A 1U58A 4JZOA 4EXKA 1OAQH 4X6DE 1GOFA 1MWAL 3U79A 4UV4H 5F3BA 4U6TA 2O5XL 3UO1L 1KJ3H 4PJ7B 3PJSB 1J1PH 4WWID 2V7HA 1DSFH 2HLAA 4JO1L 1DBBL 3QJHA 2E7BA 3U0TA 4OCMC 4ISVA 4RMUA 1QYGH 1WIPA 3LB6C 4XVTH 3DV6B 4HT1L 3TVMA 3EYUL 5JNYA 5L8KB 4HF5H 2D7TH 1KCKA 3VFVB 4YHKL 4QHUB 1BVKB 1U93B 3OXRB 1T1WA 4PRPB 3JTTB 1LEIA 3PNWB 3W82A 4N0YH 1KIPA 1LHZA 4P5KB 1KPRA 2OR9H 4PJHA 1BX2B 4PG9A 4Y4HD 5B4MD 1DBML 2HWZL 5DD5H 2XZCH 3QHZH 5EIQA 1PX3A 4YDKH 3QUYD 3T3PF 1AR1C 4UAOB 3ZLQC 2QKIA 3SE9H 4RAUB 5IMLB 5A2JH 5CJXC 3TZVD 1QFWM 3VWJB 5D2NB 4OCSL 4F7CA 1RUQL 4L4VB 2ADGB 2Y6SD 4GAJL 3VXSE 4ETQB 2MTPA 4QRPE 4ODUA 3IJHB 2VXTL 1OTUC 1LO2H 1MREL 2CK0H 2P5WA 1LP9E 4K7FB 5DK0B 1MCQA 5FOBA 2X7LA 3WDIA 4MD5B 5C3TA 1I75A 2JKXA 3BXNB 2DQTL 3GJEB 3SKOA 2GIYA 5HHPA 3K2MC 3RTQC 3B9EA 3QG7L 1IEBA 2J12B 3D39D 3LB6D 1R3JB 2MOVA 4IS6A 2AJUH 5EFIA 5SX4H 1VACA 3HTLX 1RJLB 4FA8A 2X89A 3BIBX 4KFZC 2R9HC 4JB9L 3ARBA 4Q6IA 1KEMH 1YJDL 3ZMRA 2D7PA 1HOCB 4FMKA 4P5KA 4X8JA 5JR1L 5B4MC 2MHAA 4JRYB 1PD6A 4AEEA 3QEQD 5T33L 2DQEH 3V0VA 3QDAA 1IC4L 4JANA 5TGBA 5KSAD 1UT9A 3AAZA 5IVZA 1X5HA 5KSBB 4TTGA 1IVLA 4TOYL 4UT9H 3DYMA 3WEXA 4Y4FA 1AJ7L 2YD6A 3OG6B 1G9NC 3VG9B 3DIFA 1LK2B 5DR5H 1FG2A 1I7ZB 2WUBL 4UOW0 3M07A 4ZXBB 1N0XL 2CGRL 1OOAA 2GUOB 1YEGL 2F54A 2VQ1B 2OI9B 4UV7H 5IMKA 4CADB 3O6FA 4X9FA 4NQXB 4R7DA 5ILTH 3DO7B 5FM5M 2GITA 1YEIL 3FOMA 2GUOA 1RZIA 1VEPA 1WICA 1IT9L 3K81A 3MBEC 1A3LL 3U2SA 3WHE0 1NGWB 4BQ8A 1MFCL 4WCYH 4PIRF 3SDCD 3QZWA 1AQDA 4OSUL 1ZWIA 5SWSD 1L7IH 5I71C 4ZYKB 1EEYB 5AG8A 4QRSA 2CLRA 3MJ9A 2NY4D 5ANME 1U2CA 5AD0B 4NYLA 1V05A 4KC3B 1MNUL 5L0QC 5JIHA 2VDRL 1TPXC 4LEXH 3DMMA 3U30B 3WNNA 4U1KA 3DGCR 2XICA 3QG6A 5GPRA 1SEQH 4DW2H 2X9YA 4BH7B 4HJJL 5DHVB 5C0EB 4G6FD 3IXTB 4B0MM 3TBWA 1F6LL 5DT1L 3RWDB 5EN2A 2VLRE 4LPCA 2AXJA 4XC1H 1TJHL 2AXGA 4HC1A 4WHTA 3MODL 5EU5B 4OI7A 4N0YL 2G5BB 3P4LA 3VFNB 1WC7B 5BW7A 4N8CH 3GJEA 4OUOA 5IKCA 5CSGA 1H3TA 4Y88A 3VCLB 1MRCH 3BXNA 3QHZL 2KPNA 5C0JA 2LU3A 5I19L 1WSST 3QJFB 4BELD 1UM4H 1XR9B 4Z5RB 1G1CA 3PIQA 1FJ1B 4RIRB 2X10A 4K2UL 1EPFA 4NRYA 3G5ZA 5I8CB 4D0CA 1KACB 4Q97A 2NY0D 5CIPB 5EPMB 1RUQH 3TT1L 5I66B 1CDBA 5C70A 2VIRB 5F93C 4S10A 2L4OA 1A7PH 4NNYA 2L7JA 1BF8A 3O2DL 5IMLA 5FKPB 1FCGA 3H9HB 2VITA 5D5MA 4NN6C 4Y1AD 1L0QA 2PYEE 4RMQA 4C56A 5KN5A 3GMPA 3C5SA 4HX1A 4QKXB 4MS8D 5DD6B 1F4XH 2HFGH 1CL7H 1ZK9A 3U0PA 3FB7A 4L8BB 1ZHBA 4NRXA 5I16B 3DETC 3GI9L 4U7SA 1AXTL 1RULH 1HCFX 4BQBA 4OQTL 5HI4D 2F8VA 1FAKT 1NBYB 4UBDC 1YUHA 3CSBA 2X4NA 3QUYA 1G6VK 1XZ0B 1LE9B 3QB7C 4YX2L 3ARGD 2YPLD 4QXUH 1T1ZB 3HPLB 4NJAH 4D3CL 5I8OH 4MS8C 2E7MA 3TP4A 5E8EB 5EDXA 2B8OT 2EKSB 4FOMA 8FABB 4QO1A 4HWEL 3QUML 4JY6B 3T2NH 2DQUH 3U0TB 1CGSL 1CT8B 2RHEA 1GH7A 3ULUL 5C0RL 4AEIL 4J3SA 1H9VA 5KJRH 3WYRA 4X5LA 3T0DA 2G60L 1NMBL 2PYFA 4HEPG 5A16B 1T4KA 4YUEH 1FV1B 2AJYH 3L5IA 1Z9LA 1NFDA 1JPSL 5FA4B 2V2TA 1OTSD 3FO2B 3PHQB 1UXWB 3NA4A 1DQLL 2O61B 4OCXH 1TITA 3O3AB 2PTTA 5HYQB 1I1RA 1K8IB 1Y18A 4PJ7F 3KWWA 5EU4A 1WZKA 1MHEA 4YAQB 3MACL 3OR6A 4XNYH 3PDOB 3OSKA 4MJ6B 5F9JB 2NTFB 5MI0C 3LPGA 2HKFH 3K8KA 3F62A 3HR6A 4K7PH 1I3UA 2Y06L 2NY0B 1LO0L 5D72H 2ZUWA 3JTSB 4ZOCA 5KSAA 3LN5A 1FNHA 4OKVA 5KOVC 4XMPL 3D9AH 2V2WB 1VFOA 2ICCA 2WZPD 1J5OH 2XWJB 3JVGC 1A1NA 1NUGA 3F5WA 2CIIA 4WU7B 1HHJA 3QZWB 1CFSB 1JHTB 5KTEL 5DT1H 2D03L 3RGHA 4FQ2L 2R29L 4N0UA 1J88A 2OSLB 3RAJL 2XRAH 3GHEH 2OJEB 5IJKC 3DRTA 2Z92A 5J1AA 1SMAA 2VL5B 1LQSR 4OZFH 1IGFL 3NBNA 2FX8H 3TBVA 1DFBL 1PDKA 2W65B 4JZJC 4XMLH 4PJXA 4XRCA 5EB9A 4PS4H 2X6MA 1T04A 2VAAB 3I84A 1JTTA 2VISB 5BS0B 1FLRL 4G6KH 3KPSD 4KY1L 4NQSA 4ELMB 5BO1H 4MJIB 1OSZB 5DK2B 1N5YH 3RL2A 5D6DC 1T1ZA 3O0RH 1JVKA 1DN0B 1T5XB 4DOHE 3NOIA 3BYTA 3RNKA 5F7EH 3HNSH 3OGCA 5HYJE 3S4SG 5JXEA 1IKFH 2CMRH 2YPVH 4U1IA 1OAXL 3CIQA 5EU3B 4M62L 3R06B 5BV7H 4PJAE 4JR9L 1EUTA 5C0IB 4U3HA 4X80H 2XQBL 2EXYD 4I48B 2UUDK 1FNSL 4BQ9A 1FGVL 4X0KB 1QFHA 4QRQA 5ACZB 2J4WH 4ODBD 2ITCA 1V7MH 4M6NH 4I0PC 4UINL 4MA1C 3E8UL 2C3VA 1F45A 4LSTH 1A14H 4NPYB 3S34L 1CICC 4P2RB 1ZA6A 3MRBB 2IH1B 1YYML 3DXAA 3P4OA 4PB9L 3Q3GA 1N64L 5DFTA 1NAMB 5T3ZH 5IB1A 3IT8D 2Y1VA 1P2CB 3M1BA 2VZOA 1MY7A 5I8OL 1T03L 4ALAL 5HY9B 5EU4B 4FFZH 3HE6C 3KYOA 1UWXK 5E6ZA 1BFVL 4QY8A 3F6IA 4R90L 5D93B 3QEQB 1JNJA 3IJHA 1KJ2A 3ARSA 3T0EC 4GRWH 1Z9SA 2DQCH 3AREB 3NFNA 3BEVA 1RI8A 4WI5A 4QTIH 2VKWA 1RU9L 4PFEA 3WFEH 4Y1AA 5B3JF 2GSGA 4YUEL 1UCBH 1EVTC 4P23B 2HMID 2FB4H 4DK6A 1HEZB 4YHPA 3H3BC 3LS4H 3HFMH 4PJDA 4PJIB 1T3FB 1P9MA 4WUKL 5IB3A 5I75C 1DUZA 4TSBH 4NQCB 3RDTB 5F1NB 1KIPB 1PY9A 4FQLL 4JG1L 1IGIL 2EE2A 3OKDA 4MWFA 1MRDL 4FQIH 2PYEA 3FFCA 2AS5M 4KVCH 2W9EL 3K4ZA 4GO6B 1D5BB 3LPFA 4F8TA 3EHBD 4XWOD 4Z7QF 5D70H 4ZPVB 5FGSA 1RSFA 1I8MA 4POYA 2IH1A 3QPQC 2YD3A 1IEAB 2Y06H 3UJTH 1ZHBB 1CGTA 2QHLA 2C4FT 4PJEF 3JWOL 3ARZA 4K8RH 4WO4D 4XGZB 4JPVL 1R3IH 3D9AL 3HS0B 3HMXH 3C6SB 1KT2B 4PLNC 1LE9A 3QAZC 1QSEE 3PGFH 2WUCH 5EA0H 5C92A 2AV1A 1AD0B 2E5EA 3FAXA 2FL5B 3G5VA 1K4DA 4OZHF 3FFDA 1NGQL 2EE3A 5HD8D 4L8BA 3OF6D 4Y5XC 3MRHB 2HT2D 4JM2A 2IANB 4PRPD 3FO0L 3P4MA 4HJGA 2ZUQB 3QIWB 4WW1A 4U1GB 4D8PB 2Z91A 5C1MB 4OBRA 1P7HL 4O2CB 4KK8D 5LGJA 3QFJB 4LHUA 3MLPA 1JK8A 2VDMH 4GQPH 3ZTJG 1FZMA 1QR1B 1Y6KR 3OX8A 1X5IA 2CXKA 2JCCE 1HNFA 3BE1L 4XPAL 1YNTB 3DRTB 1WJ3A 3CDCA 1DLFH 4PP1D 4XP1L 4R4FH 1KLUB 5CSZA 1PGRB 4DFIA 2QQKL 4ELKA 1FH5H 1IARB 1QKZH 3SBWA 2EIEA 1FRGL 3X11A 3R0NA 4YZFF 1G6RB 5IMMA 2DLGA 4CAGA 1NC2A 3UPRA 4PJ8D 3ZHDA 5J6GB 3C2AH 2PXYB 2DL9A 3SDCA 3MJ8A 1EHLH 4JR9H 3RVWD 4GRLA 5JDSB 2R2EA 4JZJB 3NMEA 1E0OB 3MXVH 4Y0GA 4K3DH 2ADIB 5EN2B 2AK4A 1XFPA 4P9HC 1UFUA 4XVSH 4HDIA 1YC8A 3EOAB 3BDYL 1HHIA 1DTUA 3KG5A 5DRWA 3OAUL 1Z0MA 4XBGA 4B50A 4UZGA 1N6VA 2NTFA 5F96L 1UB6A 4LLVB 5I1DA 3GNML 5SV3A 5L8LB 1KCUH 2VZSA 3OJDB 4ALAH 4KHTH 5J12B 1JZ7A 5HHMD 2X4QA 1G7QA 2VDLL 4PB0L 3TPUA 1BFVH 5TH2A 5HGHB 4KMTL 5GS3A 3B3IB 3EDKA 1PYWA 3RPKA 1G6RL 3L5WB 1OP5K 2Q7YA 1OD7A 2P47B 2C3HA 3BT2H 4XHJC 4XX1E 3KLHD 3JWDC 2A9NH 3NIDF 4MA7H 1CFTB 1KENL 1REIA 3ARBC 4H25B 4KXZH 1IGJA 3OXSB 2ZZUT 4PUBL 1X5LA 4ZS6C 5IEKA 5CEXB 1A7OH 4V1DE 4EUPB 3NA9H 3EIFA 1NGYB 4KI5D 4KWUA 2NY2B 4C54A 3JWDL 4G7VH 1I9JL 3PUCA 4OM1H 4P2OA 2EDDA 4BFIA 3MRDB 3GUTB 1JPST 3JV0A 3F7QA 2BVPA 2GK0B 4HDIB 4LRIA 4LNVA 5I1JL 1GZQA 1FSKB 3HPLA 1DBAH 2P8LB 3RPIA 4IOIA 3N9GL 5C09B 3PQYD 3WHE1 5ESVA 5F70A 2G2RA 5EIIA 1MCHA 2VLJD 3DVGB 1HCVA 5TE6L 4NP4H 1NC4A 4LEOA 1E6OL 3S35L 4PRDB 4JPVH 4HUVA 2YXFA 4Z7VF 4PPTA 4FABL 3WN5A 4WHYG 1BZQK 1ZT7A 5AAWA 4XWGH 2YA2A 1FNAA 1MQKH 3DVNA 1PG7X 2VITB 3ARGA 3WNMA 4DTGL 2HG5B 4OZ4B 3MNVB 4JY4A 4JFOB 4F9PA 2G9HB 3QEGH 1JHKL 4XCEB 2Y23A 1MCPH 35C8L 3O6KH 2XXCB 2JJTC 3G6JF 3HUJF 5MHSE 4MMXC 4Z7UB 2RGSA 4X9HA 1A6TA 4P59L 3BIAX 2VDML 4C57C 5JDSA 2FIRT 2ADGA 2FX7H 3MFFA 1R0AL 4YHOH 4KZEL 4MAUL 3CFCL 4FXLA 3T0BA 2FJHA 1T66D 3VE0B 3ISWA 2H32A 3VA2C 2ZSVB 1CWVA 2UZYB 3QWRD 4QRRD 1ZGLA 2AXGB 5D2LE 3DURA 3MLVL 1WF5A 4YGAB 3KPNB 2QR0A 2EZ0C 5C0IA 3LKQB 4ZOBA 4DJMA 3P73A 4ZFOA 2I26N 3CUPA 5ERWB 2NNAB 3I3DA 4HPOL 5EU3A 5T1KB 1FZOA 3QFDA 1IEAA 1NC4B 5HDLA 1YPZE 3T8XA 5JPMB 5CP7B 1F3DH 2EH8H 3RWJA 4DZBB 1A64A 4HPYL 4PRID 3MOAH 1T1XA 4K3DL 3U4BH 3VXUE 1BVKA 4Z77B 2XI9A 4HK0B 1A0QL 3FFCB 1NGPH 1KGCD 4MDIA 4P46C 4EVNB 4CNIB 4EEEA 1CVRA 3CLEL 4M3JA 3MRDA 2DAVA 1XR8B 1MUJA 3L5XL 1NCWH