1TNOA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvim peptide derived from k-ras4b
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
molecule keywords geranylgeranyltransferase type I alpha subunit
molecule tags Transferase
source organism Rattus norvegicus
total genus 126
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnoA00
3PZ4A 1X81A 4YDOA 1N95A 1D8DA 3DSXA 1O1SA 1N4PA 3DSUA 3HXCA 1LD7A 2H6HA 1FT2A 3E34A 3DSVA 3DPYA 3Q7AA 1JCRA 4EHMA 3Q78A 2H6FA 1D8EA 2IEJA 3PZ2A 3E30A 4GTTA 3EU5A 1DCEA 1LD8A 1KZOA 4GTRA 1S64A 3Q79A 3E37A 1N4SA 1TNBA 1TNOA 1FPPA 4GTPA 1KZPA 1SA5A 3DSTA 2H6IA 2F0YA 3Q73A 3C72A 3E32A 4YDEA 2BEDA 2ZIRA 1S63A 3PZ1A 1LTXA 1TN7A 1TN8A 1NI1A 3PZ3A 1TNZA 1JCQA 3KSLA 3Q7FA 1TNUA 4MBGA 2R2LA 3E33A 3DRAA 1QBQA 1N9AA 1TNYA 4GTMA 4GTQA 3SFYA 1MZCA 1SA4A 1N4QA 3EUVA 1N4RA 3HXDA 4LNBA 3KSQA 4L9PA 4LNGA 4GTOA 1TN6A 1O5MA 1O1TA 2ZISA 2H6GA 3Q75A 3DSWA 3HXFA 1JCSA 4GTVA 1FT1A 3DSSA 3HXEA 3HXBA 4GTSA 1O1RA 1NL4A 1N94A 3SFXA
chains in the Genus database with same CATH superfamily
3JUEA 2FF4A 4YDOA 2V4HC 1D8DA 2V5FA 1B89A 2AXZA 5CHEE 2DVWA 3E30A 4IN3B 4I2WA 4Y6WA 3PEVB 4IRUA 2I9CA 3UIOC 3ZIMA 3FTSA 2OOEA 3AU4A 5FT9A 3CHRA 3I3NA 2XPIA 4PUCA 4UWHA 2WB2A 2KCKA 3ESLA 3UTMA 2NXPA 4TXPA 3MA5A 1N54A 4HS2A 3MKRA 4G23A 3CV0A 2VGYA 5HQ8A 3ULEG 4KZ0A 1E8ZA 4GTQA 4DX2A 2Q7FA 2X6JA 4HOTA 2RFMA 3RSEG 3ABLE 4J8DA 3TWQA 4N2QA 1K1BA 4LNGA 2Y3AA 3O4ZA 4J8FA 3SBSA 3L6AA 3UKRG 1YMPA 4L2LA 4A55A 5B1AE 2DBAA 4GA1A 3L08A 3B7BA 3ZHEB 3AG2E 2LSVA 5G05J 4FHJA 4A1GA 4DK5A 1FVFA 2BF0X 1YCSB 2H6FA 4LG6A 4AV7A 3CKBA 3LY8A 2PZIA 2VQ2A 4K0RA 5BV1A 1DVPA 4CGWA 5EX3A 3TWUA 3BG0B 2PM6A 2IF4A 2P9IG 1UN9A 3JXIA 2J4DA 3FY4A 3UM2A 5CEAA 3EU9A 1BLXB 3PNTB 3ZNGA 3DXKG 3HIZA 5G04J 4GAAA 1P5QA 3IXEA 3UPVA 1WDYA 3PZ1A 1ELWA 4N3CA 2YQ8A 4UWKA 4HNAD 2IQCA 2A5EA 2ETBA 4DLQA 1QNFA 4YDWA 3RIBA 4PDXA 3QARA 3L16A 1KPSB 1UOHA 1L5JA 4LCTA 4Q69A 4LSZE 1HX8A 4JZYA 3ZPJA 4GMLA 3R7RA 1IHGA 1SZ9A 2WXOA 3CVPA 3EHMA 4UI9C 4IYPA 4EZKA 5EN5D 5AQAA 3D9IA 2DZOA 4JC8A 4I1OB 4DX1A 3LJNA 4O1PA 5A23A 3DSXA 2GRMA 5HRYA 4A63B 2GRLA 3Q7AA 3UINC 2EINE 4EBAA 1D9SA 3UUXA 4I6EA 2KM4A 2P9NG 2R03A 3UKUG 1OWNA 3RO2A 4AXHA 2GGFA 2WMNA 1OWMA 3X2QE 3B95A 5E75A 2C0LA 5AIJA 4BETA 5G05C 2R17C 3FTZA 2J9QA 4HBDA 2LXLA 3ASHA 5JA4D 2JLBA 2FO7A 1TN8A 1JCQA 4Q96A 4JW1A 2ILRA 1RW2A 5FJYA 4Z68A 4OVUA 3S7JA 1SW6A 1SA4A 4G26A 4Y6CA 1OT8A 5JJ7A 4I6GA 3LS8A 2Y4TA 3UM3A 2YHCA 4UUCA 4NRHB 3ABKE 1Z5SC 3EIQC 5DBKA 3B7RL 3TWXA 4F1SA 1OXJA 3SFXA 2J49A 3C5RA 1NP7A 1V54E 5M72A 1ELKA 2P2CP 1JCRA 2VGEA 3RK6A 2XRZA 3V79K 4APOA 4JEHA 4G11A 4RVBA 4GTRA 1HZ4A 3MZLB 5ENRD 3E37A 3LCAA 1LF8A 1TNBA 2QFCA 4ILGA 3FUNA 1SQMA 3ABME 4U7EB 4I1MA 5CBOA 2YHEA 2EQXA 4B8CB 3JCKC 3SBTB 3V31A 1H6OA 5T3RA 4XEIG 2WMOA 1N0RA 3ZGQA 5J08A 2KBXA 3G2SA 1KLXA 4F3VA 1PC2A 3CGHA 3E33A 5ITZF 2X38A 3CHPA 4ANXA 2I1JA 3FTYA 3TWRA 1MX6A 3RKVA 4PH4B 3RRUA 4APFA 3CVUA 1W3BA 2ETAA 4ABNA 3UM0A 4L23A 5AENA 4B89A 1XNFA 4NURA 3ASDA 4ANUA 1JWGA 3CHQA 5EILA 3HXBA 3L17A 4EZLA 1ELRA 1U2VG 1NL4A 4V3IA 2GROB 2AXVA 1N4PA 1X5BA 3CHOA 4U8HA 5AAOA 1FT2A 3PUJA 5CBNA 2CHZA 3Q5MA 2X6FA 3TWSA 5LP0A 4JHRA 4RG6A 4GA2A 4KMOA 4O6FA 5AQ7A 1TNOA 5HI7A 4F53A 2H6IA 4AY6A 3E32A 2WXLA 3R9AB 1BD8A 5AQBA 4L1BA 3IHVA 1LTXA 4Q94A 4JD2G 3PZ3A 1TNZA 3D9OA 4LNUD 3MV2B 1WY6A 3NZSA 5ENSD 3MJWA 4LERA 4UWGA 2XGMA 3GW4A 2R2LA 3UM1A 5FIOA 3RJVA 3PUKA 1OWPA 2HE0A 1K1AA 3CVVA 2VJ8A 3BU8A 3QWWA 4MRUA 2LUHA 3JQ0A 4JXTA 2J4BA 4UWFA 1DCQA 4KVMA 3T5VA 4ILHB 4KVOA 3P1UA 4YVOA 4HRLA 1O1TA 3FH5A 1WAO1 1HG2A 2OEWA 2HR2A 1FT1A 1TJCA 5KJNA 3D9HA 5EIBE 2WXQA 4JHJA 1N95A 3KEZA 5KJMA 1O1SA 1HO8A 4DX5D 3EHRA 4ANWA 2L6BA 3DSVA 4GMRA 3Q78A 4EQFA 5D0QD 3J5QB 4TV3A 1D8EA 3G2UA 2RKKA 4HRNA 2XZDG 2EIME 1LD8A 3G2VA 3AS4A 4DI4A 2ONDA 1OCOE 3RAUA 1Y8MA 4BTBA 4CDNA 4KBQA 3FTVA 2XEVA 5EYLA 4HXIA 2C0MA 2XCCA 4GTPA 4ZHBA 1Z3YA 1E8XA 3FU0A 2WQHA 4PS3A 4A1SA 3NF1A 2J08A 3KAEA 4BEPA 4YVQC 5LOZA 1H6PA 4F7AA 3QWPA 3CHSA 1S0PA 3FTWA 1TN7A 2IU1A 1NI1A 2WPVA 3ZYQA 2JABA 3Q9UC 4HRMB 3FUEA 5G2NA 2XCBA 2F8XK 3PE4A 4X8QA 3IBEA 4DI3A 5ENTD 3NZUA 4GZ6A 3TWVA 1NZNA 2BKGA 4N3AA 1A5EA 4I9CA 3OXLA 4G25A 1H2TC 2FO1E 4WWNA 4GCOA 1UJKA 2H6GA 2WQ6A 4XIFA 3S7DA 3R7QA 4CYMD 3UXGA 1UJJA 5CEDB 1E96B 1YA0A 4DRXE 3LYAA 3KEAA 3NOCD 3HXCA 4MLPA 2HO1A 3PEUB 2JEKA 3ZN3A 3FTUA 3PZ2A 4GTTA 3DEOA 5B1BE 2XEHA 1QZ2A 3RU0A 2C2LA 3D9JA 5D2MC 3NOGD 1EF1C 4N3BA 4UQYA 2CG2A 3FUKA 2WXGA 4CT4A 3R9MA 1ZU2A 2XRYA 1OCZE 4B0ZA 4G24A 4ZFHA 4CCAA 4U07A 3T8MA 1QQEA 4O1OA 4CT0A 2OVFA 5JMND 1ZBPA 1EYHA 4AP2A 4HLLA 4EECA 4MKTA 5EYPF 4NIKA 4DUIA 1IXVA 3DRAA 5ENOD 2P9PG 3TXMA 5CCLA 4K5CA 2EILE 2VSOE 3CQCB 3EIJA 2CG3A 4HB5A 4GU5A 3G2WA 4XI0A 4UI9K 3BUAA 2DYSE 5E76A 3QAQA 4JA9A 5AN8A 4J8SA 4XKBA 3SQVA 4W9RA 1KT0A 1TYQG 3EHNA 4UQZA 5JJTA 2GRRB 2B6CA 3JYSA 2V5QC 4GZ5A 2WXJA 4BX9A 4BT9A 1NA0A 1G3NB 4EHMA 3OXFA 3CR3A 1OWLA 3B7TA 3CSFA 3HG0D 3QC1A 4LUNU 3LJ3A 5AQ9A 3U4TA 3FDHA 3T8KA 5T8IA 3EHQA 1E7UA 3FUFA 3AS5A 3ONLA 4FJZA 3TG5A 4CZ2D 3NAWA 5JHBA 1KZPA 4AM9A 3LY7A 3HYMB 2J09A 3B7SA 3MCXA 5EKQD 3TXNA 2VSYA 1UW4B 1WM5A 2LXMA 3FTXA 4JA7A 3ZRHA 3D3MA 2P9SG 3LVRE 1TNUA 4UWLA 2WXIA 4U96D 1IQRA 3QWVA 2RFAA 3T5XA 2UY1A 2PNNA 3RRNB 2OEVA 4ACKA 4H7YA 3ZVVA 4YDYA 4JVSA 4HORA 3QNKA 2V0PA 1N4RA 4HI9A 3ESKA 1NFIE 4D10C 3PRZA 4YNDA 1O1RA 4I9EA 3PZDA 1N94A 2V8SE 5FZRA 5EDSA 2MRIA 3HVEA 3DBSA 2OVBA 5G04C 4NQ0A 1HG5A 5KCMA 2J8SD 3EU5A 2A4ZA 4C0MA 2LSUA 3IEGA 1GW6A 3PDNA 2QYJA 2E2EA 1JWFA 2AVPA 3MEKA 3D9PA 2OV8A 3UIPC 4BFRA 4FLHA 4XI9A 4FA6A 3DSTA 4DJAA 1K8KG 4U8VD 2F37A 4GPMA 1IYGA 4CEMA 1E8YA 5BXOA 3S7FA 3SO8A 3LY9A 4K5BA 5AARA 4TUUA 4JEUA 3AG1E 2EIKE 3NQPA 3FP3A 3MX3A 3L13A 2X6IA 2WXRA 3C3OA 2WXMA 3CKCA 5LCWJ 3Q9NC 4XE0A 1MZCA 1MQSA 4AOFA 4KT6B 2YINA 4LEUA 4FU3A 4U0UA 3F6QA 4TRQA 3TAXA 1SZAA 3HXEA 2B0OE 4GA0A 4OVVA 3PZ4A 2WXHA 3P2BA 4BT8A 5KBAA 3ZYMA 4M7CA 3E34A 5BW8C 4OAVB 3PE3A 5ANLA 3S7BA 2XENA 3ULYA 1DCEA 3W9GA 1E7VA 5BT1A 3PREA 2ETCA 3FU3A 3Q79A 3T9KA 5ENNA 5FQ4A 1PAQA 5KJKA 1OCCE 1Z3XA 3VTXA 3EJNA 4F6RD 3HRAA 3U9WA 3DXMG 3RRMB 3ZXSA 3BG1B 3MV3B 4C0EA 3MGBA 4E85A 3PVLA 4WWPA 4HLEA 1MX4A 4RG9A 3PH0C 3TWWA 4B93B 3GYZA 3K9IA 3IKOB 2DYRE 3U66A 3HHMA 3ASGA 2MYOA 4E6HA 4P29A 3SGHA 1Q2ZA 5CRVA 3FH8A 2XPYA 5D66A 1H2UA 1V55E 3D9NA 3APCA 3Q4AB 4A3TA 3EDTB 1OWOA 4BESA 1MYOA 1HU3A 1RZ4A 4L7TA 4J8EA 2DWZA 1E90A 5FQ6A 3ENEA 5AJLA 2WVIA 1IHBA 3ML9A 2HM8A 2DZNA 5FTPA 5HS0A 3FUHA 5J90A 3ZKJA 2RD0A 4A3VA 3HDXA 3CSTA 1INZA 4PS7A 4EBAG 5BV0A 5BPPA 3C72A 2CFZA 5KNGA 1OCRE 4AIFA 5BXUA 3PS6A 4HI8A 4C48B 1N52A 2VSXE 2ZU6B 3U64A 3S2AA 3CK9A 1BPOA 4U04A 3VLDA 2M63A 4MBGA 3WG7E 3NBNB 5ARGA 4GTMA 1H19A 4BX8A 2R05A 2ZGGA 4N39A 3TWTA 4J0UA 1FVHA 2CFUA 5CECB 4DX6D 4LNBA 2VGXA 3UX4A 2VTBB 2UY1B 4BSZB 3FHEA 5KNHD 3SFZA 4GYYA 5LFAA 1BI7B 3DSSA 5CMYA 4FHKA 2I6HA 2Y69E 3SZ7A 3AS8A 3UT4A 4U63A 3TL5A 2X6KA 1LD7A 2H6HA 4TXQA 4WNGA 4URKA 3LDZA 2L9BA 5C2YA 4HOSA 2PQNA 4UI9J 1S64A 3HVEB 5FWQA 3URZA 4CDRA 4AVXA 4IULA 3SI5A 1N4SA 1UN8A 3L9TA 3CVNA 1EPUA 1FPPA 2XGSA 3GZ1A 4WWOA 2XGOA 2F0YA 4J6IA 5T4YA 3V30A 2PL2A 4GMJA 1HH8A 1TEZA 3LPZA 2NYJA 3GZ2A 1KT1A 3I4GA 3SF4A 5DIZA 4HQDA 5A7DB 4WUYA 4N5QA 1QBQA 4GCNA 4JPSA 2AW6A 3LEWA 4F1PA 3ZFWA 5FZQA 3OTNA 3PNLB 4G1TA 3E4BA 3SHFA 4HVBA 3KSQA 3CK7A 4GB9A 4GYWA 4BWRA 3DEPA 3VLEA 3CVYA 1HF8A 1O5MA 4ILIA 1EDUA 4WNFA 2CHWA 3FH7A 1DC2A 5CMWA 2QZAA 4HFGA 3L54A 3B7UX 3CQGB 4GTSA 4FADA 4J7WA 4N2SA 2UWJG 4KZCA 1TJFA 3CHMA 5FQ7A 1H0AA 3CVLA 3DPYA 5CRUA 2RG8A 4GZDA 3CVWA 4QFVA 2P9LG 3FUIA 2XHEA 2PQRA 1KZOA 3NB2A 1H6KA 4HOUA 4FLBA 4N5CA 3QKYA 2L0TB 4L2YA 4DX7D 1OUVA 3DWLG 4CRWA 1MJ0A 4LRZA 4AY5A 2R5SA 4HOQA 4JB8P 4AEZC 2IO3C 2R59A 4K5AB 3FU6A 2IY0C 4FC8A 3V2OA 2KCLA 4M3OA 2WXFA 3FUMA 4XKCA 3AU5A 3MKQA 3BQOA 2KZTA 1IQUA 4B8AA 1SVXA 5EIDA 2A5UA 3ISMC 3ZW3A 3D9MA 2DCPA 2BKKB 4J8YA 4RQIA 3SNXA 4BERA 3QK0A 2XPZA 1N4QA 2AJAA 3ULQA 1U3CA 3UT8A 1K3ZD 2Y1LE 3Q47B 3ZYLA 3DPDA 3J5PA 3FEXA 5HKPA 4I43A 1HS6A 2IOSA 2FEZA 1QYMA 2VTBA 3U3WA 2P9UG 1H2VC 3CK8A 3RO3A 5BNWA 3FUDA 4RSYA 2QC9A 4XZ4A 2GRQB 4NACA 5CCMA 4KYOB 2OCCE 4ACLA 3ZU7B 1MHQA 4G8LA 2IEJA 2L0IA 3FWVA 3C3RA 1IKND 3SD5A 1HE8A 2V4LA 4BY6A 1JPLA 4FJYA 4I6JA 3AJIA 2R02A 5EX0A 1HXIA 2GRNB 2MHKA 3ZUVB 3KD7A 1E8WA 3D9LA 3QJZA 5G55A 4YDEA 2BEDA 2KATA 1S63A 2IONA 3UMVA 4R7LA 3L22A 2YNQA 4UQXA 3JXJA 2X6HA 3ML8A 2IJGX 2J07A 2BUGA 3KSLA 3CVQA 1HFAA 2I1KA 1AP7A 2WXNA 3BEEA 5AYWD 4GZCA 2ZGDA 2LAHA 4G2VA 3VTYA 1S70B 4C9BB 1N9AA 1TNYA 5ENQD 2MOWA 2EIJE 1AWCB 3EUVA 4U0SA 5B3SE 4GYOA 2LO6A 4JL0A 1ZB1A 2XS8A 2Y0BG 2QYUA 3UI2A 3ZHEA 2IO2C 4DLOA 4EPZA 4OYSA 3AAAC 2XQ0A 3I5PA 1N11A 3HXFA 2I2OA 3UQ3A 2WXPA 1MX2A 1Z6TA 3FUJA 3I4RB 3FULA 4KXKB 2VGXB 4OAUC 3CIAA 2XZTG 4WNEA 3ZEFA 3LVQE 1YYHA 2AXUA 3FEYA 3O48A 1JUQA 3ASOE 5FZSA 4FP7A 4U95D 4I1AA 5FQ8A 1WG0A 5AJDA 3B13A 5JHAA 5FINA 3ASNE 1BI8B 3UT7A 3TGOA 4U0ZA 4AJWA 5ENPD 1NA3A 3CEQA 5LX8A 1SA5A 1Y6IA 4K03A 3IHYA 3CVXA 5IY5E 1UG3A 3APDA 1XGWA 2F8YA 2ZIRA 1PY1A 4TUMA 2PM7A 3QB2A 3MYVA 4ATZD 4PS8A 3JUIA 3Q7FA 4TXRA 3TG4A 3FFLA 4BTAA 2XS1A 3ZYKA 1FCHA 4ME2A 3D9KA 4WNDA 5A6CA 4B94A 2X3MA 1BU9A 1N0QA 3QOUA 2GW1A 3HXDA 4FULA 4L9PA 5H7PA 2WXKA 2LNIA 3ONKA 5BUZA 2ZISA 4U8YD 3DSWA 1JCSA 3GZSA 5C1DA 4EZJA 3W9FA 4GPKA 3Q75A 1VDYA 4JHKA 3AG4E 3ZXPA 1X81A 5ARFA 2GRPB 2VYIA 5CERB 4RLYA 3LKUA 3DSUA 5ANRA 3L82A 5JJ6A 3CLJA 5KWDA 4O60A 1U3DA 3Q49B 3V2XA 3KS2A 4ANVA 2AWIA 4GZ3A 2ZXWE 2L6JA 3C98A 3LXUX 3OAWA 1OY3D 4I2ZA 2FI7A 2WM9A 2FBNA 5D0OD 2HYZA 5LCWC 2E0IA 4G8KA 3N71A 3G2TA 3Q73A 3IV0A 2VSNA 3OXGA 2P58C 2FULA 4H7XA 4QQIA 2IOLA 2NC9A 2DIWA 3QDNA 3FU5A 5KJLA 4XX5A 2KC7A 3TJPA 1DNPA 3ASFA 2WQ7A 4BSXA 2KCVA 1TR4A 1A17A 3SFYA 4MS6A 4CGVA 4CDMA 3WXXA 2NSZA 3MKQB 2KZTB 2KXPC 2IFUA 2CHXA 4I17A 2LAIA 4ATGA 4GTOA 4WAFA 1TN6A 3Q15A 2QY7A 3JQ1A 4DPRA 3APFA 4GTVA 3VLFA 3C3QA 2Y4UA 3AG3E 2XEEA 2P9KG 3SY2A 2BTDA
chains in the Genus database with same CATH topology
3PZ4A 1X81A 4YDOA 1N95A 1D8DA 3DSXA 1O1SA 1N4PA 3DSUA 3HXCA 1LD7A 2H6HA 1FT2A 3E34A 3DSVA 3DPYA 3Q7AA 1JCRA 4EHMA 3Q78A 2H6FA 1D8EA 2IEJA 3PZ2A 3E30A 4GTTA 3EU5A 1DCEA 1LD8A 1KZOA 4GTRA 1S64A 3Q79A 3E37A 1N4SA 1TNBA 1TNOA 1FPPA 4GTPA 1KZPA 1SA5A 3DSTA 2H6IA 2F0YA 3Q73A 3C72A 3E32A 4YDEA 2BEDA 2ZIRA 1S63A 3PZ1A 1LTXA 1TN7A 1TN8A 1NI1A 3PZ3A 1TNZA 1JCQA 3KSLA 3Q7FA 1TNUA 4MBGA 2R2LA 3E33A 3DRAA 1QBQA 1N9AA 1TNYA 4GTMA 4GTQA 3SFYA 1MZCA 1SA4A 1N4QA 3EUVA 1N4RA 3HXDA 4LNBA 3KSQA 4L9PA 4LNGA 4GTOA 1TN6A 1O5MA 1O1TA 2ZISA 2H6GA 3Q75A 3DSWA 3HXFA 1JCSA 4GTVA 1FT1A 3DSSA 3HXEA 3HXBA 4GTSA 1O1RA 1NL4A 1N94A 3SFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ4 A;  1X81 A;  4YDO A;  1N95 A;  1D8D A;  3DSX A;  1O1S A;  1N4P A;  3DSU A;  3HXC A;  1LD7 A;  2H6H A;  1FT2 A;  3E34 A;  3DSV A;  3DPY A;  3Q7A A;  1JCR A;  4EHM A;  3Q78 A;  2H6F A;  1D8E A;  2IEJ A;  3PZ2 A;  3E30 A;  4GTT A;  3EU5 A;  1DCE A;  1LD8 A;  1KZO A;  4GTR A;  1S64 A;  3Q79 A;  3E37 A;  1N4S A;  1TNB A;  1TNO A;  1FPP A;  4GTP A;  1KZP A;  1SA5 A;  3DST A;  2H6I A;  2F0Y A;  3Q73 A;  3C72 A;  3E32 A;  4YDE A;  2BED A;  2ZIR A;  1S63 A;  3PZ1 A;  1LTX A;  1TN7 A;  1TN8 A;  1NI1 A;  3PZ3 A;  1TNZ A;  1JCQ A;  3KSL A;  3Q7F A;  1TNU A;  4MBG A;  2R2L A;  3E33 A;  3DRA A;  1QBQ A;  1N9A A;  1TNY A;  4GTM A;  4GTQ A;  3SFY A;  1MZC A;  1SA4 A;  1N4Q A;  3EUV A;  1N4R A;  3HXD A;  4LNB A;  3KSQ A;  4L9P A;  4LNG A;  4GTO A;  1TN6 A;  1O5M A;  1O1T A;  2ZIS A;  2H6G A;  3Q75 A;  3DSW A;  3HXF A;  1JCS A;  4GTV A;  1FT1 A;  3DSS A;  3HXE A;  3HXB A;  4GTS A;  1O1R A;  1NL4 A;  1N94 A;  3SFX A; 
#chains in the Genus database with same CATH topology
 3JUE A;  2FF4 A;  4YDO A;  2V4H C;  1D8D A;  2V5F A;  1B89 A;  2AXZ A;  5CHE E;  2DVW A;  3E30 A;  4IN3 B;  4I2W A;  4Y6W A;  3PEV B;  4IRU A;  2I9C A;  3UIO C;  3ZIM A;  3FTS A;  2OOE A;  3AU4 A;  5FT9 A;  3CHR A;  3I3N A;  2XPI A;  4PUC A;  4UWH A;  2WB2 A;  2KCK A;  3ESL A;  3UTM A;  2NXP A;  4TXP A;  3MA5 A;  1N54 A;  4HS2 A;  3MKR A;  4G23 A;  3CV0 A;  2VGY A;  5HQ8 A;  3ULE G;  4KZ0 A;  1E8Z A;  4GTQ A;  4DX2 A;  2Q7F A;  2X6J A;  4HOT A;  2RFM A;  3RSE G;  3ABL E;  4J8D A;  3TWQ A;  4N2Q A;  1K1B A;  4LNG A;  2Y3A A;  3O4Z A;  4J8F A;  3SBS A;  3L6A A;  3UKR G;  1YMP A;  4L2L A;  4A55 A;  5B1A E;  2DBA A;  4GA1 A;  3L08 A;  3B7B A;  3ZHE B;  3AG2 E;  2LSV A;  5G05 J;  4FHJ A;  4A1G A;  4DK5 A;  1FVF A;  2BF0 X;  1YCS B;  2H6F A;  4LG6 A;  4AV7 A;  3CKB A;  3LY8 A;  2PZI A;  2VQ2 A;  4K0R A;  5BV1 A;  1DVP A;  4CGW A;  5EX3 A;  3TWU A;  3BG0 B;  2PM6 A;  2IF4 A;  2P9I G;  1UN9 A;  3JXI A;  2J4D A;  3FY4 A;  3UM2 A;  5CEA A;  3EU9 A;  1BLX B;  3PNT B;  3ZNG A;  3DXK G;  3HIZ A;  5G04 J;  4GAA A;  1P5Q A;  3IXE A;  3UPV A;  1WDY A;  3PZ1 A;  1ELW A;  4N3C A;  2YQ8 A;  4UWK A;  4HNA D;  2IQC A;  2A5E A;  2ETB A;  4DLQ A;  1QNF A;  4YDW A;  3RIB A;  4PDX A;  3QAR A;  3L16 A;  1KPS B;  1UOH A;  1L5J A;  4LCT A;  4Q69 A;  4LSZ E;  1HX8 A;  4JZY A;  3ZPJ A;  4GML A;  3R7R A;  1IHG A;  1SZ9 A;  2WXO A;  3CVP A;  3EHM A;  4UI9 C;  4IYP A;  4EZK A;  5EN5 D;  5AQA A;  3D9I A;  2DZO A;  4JC8 A;  4I1O B;  4DX1 A;  3LJN A;  4O1P A;  5A23 A;  3DSX A;  2GRM A;  5HRY A;  4A63 B;  2GRL A;  3Q7A A;  3UIN C;  2EIN E;  4EBA A;  1D9S A;  3UUX A;  4I6E A;  2KM4 A;  2P9N G;  2R03 A;  3UKU G;  1OWN A;  3RO2 A;  4AXH A;  2GGF A;  2WMN A;  1OWM A;  3X2Q E;  3B95 A;  5E75 A;  2C0L A;  5AIJ A;  4BET A;  5G05 C;  2R17 C;  3FTZ A;  2J9Q A;  4HBD A;  2LXL A;  3ASH A;  5JA4 D;  2JLB A;  2FO7 A;  1TN8 A;  1JCQ A;  4Q96 A;  4JW1 A;  2ILR A;  1RW2 A;  5FJY A;  4Z68 A;  4OVU A;  3S7J A;  1SW6 A;  1SA4 A;  4G26 A;  4Y6C A;  1OT8 A;  5JJ7 A;  4I6G A;  3LS8 A;  2Y4T A;  3UM3 A;  2YHC A;  4UUC A;  4NRH B;  3ABK E;  1Z5S C;  3EIQ C;  5DBK A;  3B7R L;  3TWX A;  4F1S A;  1OXJ A;  3SFX A;  2J49 A;  3C5R A;  1NP7 A;  1V54 E;  5M72 A;  1ELK A;  2P2C P;  1JCR A;  2VGE A;  3RK6 A;  2XRZ A;  3V79 K;  4APO A;  4JEH A;  4G11 A;  4RVB A;  4GTR A;  1HZ4 A;  3MZL B;  5ENR D;  3E37 A;  3LCA A;  1LF8 A;  1TNB A;  2QFC A;  4ILG A;  3FUN A;  1SQM A;  3ABM E;  4U7E B;  4I1M A;  5CBO A;  2YHE A;  2EQX A;  4B8C B;  3JCK C;  3SBT B;  3V31 A;  1H6O A;  5T3R A;  4XEI G;  2WMO A;  1N0R A;  3ZGQ A;  5J08 A;  2KBX A;  3G2S A;  1KLX A;  4F3V A;  1PC2 A;  3CGH A;  3E33 A;  5ITZ F;  2X38 A;  3CHP A;  4ANX A;  2I1J A;  3FTY A;  3TWR A;  1MX6 A;  3RKV A;  4PH4 B;  3RRU A;  4APF A;  3CVU A;  1W3B A;  2ETA A;  4ABN A;  3UM0 A;  4L23 A;  5AEN A;  4B89 A;  1XNF A;  4NUR A;  3ASD A;  4ANU A;  1JWG A;  3CHQ A;  5EIL A;  3HXB A;  3L17 A;  4EZL A;  1ELR A;  1U2V G;  1NL4 A;  4V3I A;  2GRO B;  2AXV A;  1N4P A;  1X5B A;  3CHO A;  4U8H A;  5AAO A;  1FT2 A;  3PUJ A;  5CBN A;  2CHZ A;  3Q5M A;  2X6F A;  3TWS A;  5LP0 A;  4JHR A;  4RG6 A;  4GA2 A;  4KMO A;  4O6F A;  5AQ7 A;  1TNO A;  5HI7 A;  4F53 A;  2H6I A;  4AY6 A;  3E32 A;  2WXL A;  3R9A B;  1BD8 A;  5AQB A;  4L1B A;  3IHV A;  1LTX A;  4Q94 A;  4JD2 G;  3PZ3 A;  1TNZ A;  3D9O A;  4LNU D;  3MV2 B;  1WY6 A;  3NZS A;  5ENS D;  3MJW A;  4LER A;  4UWG A;  2XGM A;  3GW4 A;  2R2L A;  3UM1 A;  5FIO A;  3RJV A;  3PUK A;  1OWP A;  2HE0 A;  1K1A A;  3CVV A;  2VJ8 A;  3BU8 A;  3QWW A;  4MRU A;  2LUH A;  3JQ0 A;  4JXT A;  2J4B A;  4UWF A;  1DCQ A;  4KVM A;  3T5V A;  4ILH B;  4KVO A;  3P1U A;  4YVO A;  4HRL A;  1O1T A;  3FH5 A;  1WAO 1;  1HG2 A;  2OEW A;  2HR2 A;  1FT1 A;  1TJC A;  5KJN A;  3D9H A;  5EIB E;  2WXQ A;  4JHJ A;  1N95 A;  3KEZ A;  5KJM A;  1O1S A;  1HO8 A;  4DX5 D;  3EHR A;  4ANW A;  2L6B A;  3DSV A;  4GMR A;  3Q78 A;  4EQF A;  5D0Q D;  3J5Q B;  4TV3 A;  1D8E A;  3G2U A;  2RKK A;  4HRN A;  2XZD G;  2EIM E;  1LD8 A;  3G2V A;  3AS4 A;  4DI4 A;  2OND A;  1OCO E;  3RAU A;  1Y8M A;  4BTB A;  4CDN A;  4KBQ A;  3FTV A;  2XEV A;  5EYL A;  4HXI A;  2C0M A;  2XCC A;  4GTP A;  4ZHB A;  1Z3Y A;  1E8X A;  3FU0 A;  2WQH A;  4PS3 A;  4A1S A;  3NF1 A;  2J08 A;  3KAE A;  4BEP A;  4YVQ C;  5LOZ A;  1H6P A;  4F7A A;  3QWP A;  3CHS A;  1S0P A;  3FTW A;  1TN7 A;  2IU1 A;  1NI1 A;  2WPV A;  3ZYQ A;  2JAB A;  3Q9U C;  4HRM B;  3FUE A;  5G2N A;  2XCB A;  2F8X K;  3PE4 A;  4X8Q A;  3IBE A;  4DI3 A;  5ENT D;  3NZU A;  4GZ6 A;  3TWV A;  1NZN A;  2BKG A;  4N3A A;  1A5E A;  4I9C A;  3OXL A;  4G25 A;  1H2T C;  2FO1 E;  4WWN A;  4GCO A;  1UJK A;  2H6G A;  2WQ6 A;  4XIF A;  3S7D A;  3R7Q A;  4CYM D;  3UXG A;  1UJJ A;  5CED B;  1E96 B;  1YA0 A;  4DRX E;  3LYA A;  3KEA A;  3NOC D;  3HXC A;  4MLP A;  2HO1 A;  3PEU B;  2JEK A;  3ZN3 A;  3FTU A;  3PZ2 A;  4GTT A;  3DEO A;  5B1B E;  2XEH A;  1QZ2 A;  3RU0 A;  2C2L A;  3D9J A;  5D2M C;  3NOG D;  1EF1 C;  4N3B A;  4UQY A;  2CG2 A;  3FUK A;  2WXG A;  4CT4 A;  3R9M A;  1ZU2 A;  2XRY A;  1OCZ E;  4B0Z A;  4G24 A;  4ZFH A;  4CCA A;  4U07 A;  3T8M A;  1QQE A;  4O1O A;  4CT0 A;  2OVF A;  5JMN D;  1ZBP A;  1EYH A;  4AP2 A;  4HLL A;  4EEC A;  4MKT A;  5EYP F;  4NIK A;  4DUI A;  1IXV A;  3DRA A;  5ENO D;  2P9P G;  3TXM A;  5CCL A;  4K5C A;  2EIL E;  2VSO E;  3CQC B;  3EIJ A;  2CG3 A;  4HB5 A;  4GU5 A;  3G2W A;  4XI0 A;  4UI9 K;  3BUA A;  2DYS E;  5E76 A;  3QAQ A;  4JA9 A;  5AN8 A;  4J8S A;  4XKB A;  3SQV A;  4W9R A;  1KT0 A;  1TYQ G;  3EHN A;  4UQZ A;  5JJT A;  2GRR B;  2B6C A;  3JYS A;  2V5Q C;  4GZ5 A;  2WXJ A;  4BX9 A;  4BT9 A;  1NA0 A;  1G3N B;  4EHM A;  3OXF A;  3CR3 A;  1OWL A;  3B7T A;  3CSF A;  3HG0 D;  3QC1 A;  4LUN U;  3LJ3 A;  5AQ9 A;  3U4T A;  3FDH A;  3T8K A;  5T8I A;  3EHQ A;  1E7U A;  3FUF A;  3AS5 A;  3ONL A;  4FJZ A;  3TG5 A;  4CZ2 D;  3NAW A;  5JHB A;  1KZP A;  4AM9 A;  3LY7 A;  3HYM B;  2J09 A;  3B7S A;  3MCX A;  5EKQ D;  3TXN A;  2VSY A;  1UW4 B;  1WM5 A;  2LXM A;  3FTX A;  4JA7 A;  3ZRH A;  3D3M A;  2P9S G;  3LVR E;  1TNU A;  4UWL A;  2WXI A;  4U96 D;  1IQR A;  3QWV A;  2RFA A;  3T5X A;  2UY1 A;  2PNN A;  3RRN B;  2OEV A;  4ACK A;  4H7Y A;  3ZVV A;  4YDY A;  4JVS A;  4HOR A;  3QNK A;  2V0P A;  1N4R A;  4HI9 A;  3ESK A;  1NFI E;  4D10 C;  3PRZ A;  4YND A;  1O1R A;  4I9E A;  3PZD A;  1N94 A;  2V8S E;  5FZR A;  5EDS A;  2MRI A;  3HVE A;  3DBS A;  2OVB A;  5G04 C;  4NQ0 A;  1HG5 A;  5KCM A;  2J8S D;  3EU5 A;  2A4Z A;  4C0M A;  2LSU A;  3IEG A;  1GW6 A;  3PDN A;  2QYJ A;  2E2E A;  1JWF A;  2AVP A;  3MEK A;  3D9P A;  2OV8 A;  3UIP C;  4BFR A;  4FLH A;  4XI9 A;  4FA6 A;  3DST A;  4DJA A;  1K8K G;  4U8V D;  2F37 A;  4GPM A;  1IYG A;  4CEM A;  1E8Y A;  5BXO A;  3S7F A;  3SO8 A;  3LY9 A;  4K5B A;  5AAR A;  4TUU A;  4JEU A;  3AG1 E;  2EIK E;  3NQP A;  3FP3 A;  3MX3 A;  3L13 A;  2X6I A;  2WXR A;  3C3O A;  2WXM A;  3CKC A;  5LCW J;  3Q9N C;  4XE0 A;  1MZC A;  1MQS A;  4AOF A;  4KT6 B;  2YIN A;  4LEU A;  4FU3 A;  4U0U A;  3F6Q A;  4TRQ A;  3TAX A;  1SZA A;  3HXE A;  2B0O E;  4GA0 A;  4OVV A;  3PZ4 A;  2WXH A;  3P2B A;  4BT8 A;  5KBA A;  3ZYM A;  4M7C A;  3E34 A;  5BW8 C;  4OAV B;  3PE3 A;  5ANL A;  3S7B A;  2XEN A;  3ULY A;  1DCE A;  3W9G A;  1E7V A;  5BT1 A;  3PRE A;  2ETC A;  3FU3 A;  3Q79 A;  3T9K A;  5ENN A;  5FQ4 A;  1PAQ A;  5KJK A;  1OCC E;  1Z3X A;  3VTX A;  3EJN A;  4F6R D;  3HRA A;  3U9W A;  3DXM G;  3RRM B;  3ZXS A;  3BG1 B;  3MV3 B;  4C0E A;  3MGB A;  4E85 A;  3PVL A;  4WWP A;  4HLE A;  1MX4 A;  4RG9 A;  3PH0 C;  3TWW A;  4B93 B;  3GYZ A;  3K9I A;  3IKO B;  2DYR E;  3U66 A;  3HHM A;  3ASG A;  2MYO A;  4E6H A;  4P29 A;  3SGH A;  1Q2Z A;  5CRV A;  3FH8 A;  2XPY A;  5D66 A;  1H2U A;  1V55 E;  3D9N A;  3APC A;  3Q4A B;  4A3T A;  3EDT B;  1OWO A;  4BES A;  1MYO A;  1HU3 A;  1RZ4 A;  4L7T A;  4J8E A;  2DWZ A;  1E90 A;  5FQ6 A;  3ENE A;  5AJL A;  2WVI A;  1IHB A;  3ML9 A;  2HM8 A;  2DZN A;  5FTP A;  5HS0 A;  3FUH A;  5J90 A;  3ZKJ A;  2RD0 A;  4A3V A;  3HDX A;  3CST A;  1INZ A;  4PS7 A;  4EBA G;  5BV0 A;  5BPP A;  3C72 A;  2CFZ A;  5KNG A;  1OCR E;  4AIF A;  5BXU A;  3PS6 A;  4HI8 A;  4C48 B;  1N52 A;  2VSX E;  2ZU6 B;  3U64 A;  3S2A A;  3CK9 A;  1BPO A;  4U04 A;  3VLD A;  2M63 A;  4MBG A;  3WG7 E;  3NBN B;  5ARG A;  4GTM A;  1H19 A;  4BX8 A;  2R05 A;  2ZGG A;  4N39 A;  3TWT A;  4J0U A;  1FVH A;  2CFU A;  5CEC B;  4DX6 D;  4LNB A;  2VGX A;  3UX4 A;  2VTB B;  2UY1 B;  4BSZ B;  3FHE A;  5KNH D;  3SFZ A;  4GYY A;  5LFA A;  1BI7 B;  3DSS A;  5CMY A;  4FHK A;  2I6H A;  2Y69 E;  3SZ7 A;  3AS8 A;  3UT4 A;  4U63 A;  3TL5 A;  2X6K A;  1LD7 A;  2H6H A;  4TXQ A;  4WNG A;  4URK A;  3LDZ A;  2L9B A;  5C2Y A;  4HOS A;  2PQN A;  4UI9 J;  1S64 A;  3HVE B;  5FWQ A;  3URZ A;  4CDR A;  4AVX A;  4IUL A;  3SI5 A;  1N4S A;  1UN8 A;  3L9T A;  3CVN A;  1EPU A;  1FPP A;  2XGS A;  3GZ1 A;  4WWO A;  2XGO A;  2F0Y A;  4J6I A;  5T4Y A;  3V30 A;  2PL2 A;  4GMJ A;  1HH8 A;  1TEZ A;  3LPZ A;  2NYJ A;  3GZ2 A;  1KT1 A;  3I4G A;  3SF4 A;  5DIZ A;  4HQD A;  5A7D B;  4WUY A;  4N5Q A;  1QBQ A;  4GCN A;  4JPS A;  2AW6 A;  3LEW A;  4F1P A;  3ZFW A;  5FZQ A;  3OTN A;  3PNL B;  4G1T A;  3E4B A;  3SHF A;  4HVB A;  3KSQ A;  3CK7 A;  4GB9 A;  4GYW A;  4BWR A;  3DEP A;  3VLE A;  3CVY A;  1HF8 A;  1O5M A;  4ILI A;  1EDU A;  4WNF A;  2CHW A;  3FH7 A;  1DC2 A;  5CMW A;  2QZA A;  4HFG A;  3L54 A;  3B7U X;  3CQG B;  4GTS A;  4FAD A;  4J7W A;  4N2S A;  2UWJ G;  4KZC A;  1TJF A;  3CHM A;  5FQ7 A;  1H0A A;  3CVL A;  3DPY A;  5CRU A;  2RG8 A;  4GZD A;  3CVW A;  4QFV A;  2P9L G;  3FUI A;  2XHE A;  2PQR A;  1KZO A;  3NB2 A;  1H6K A;  4HOU A;  4FLB A;  4N5C A;  3QKY A;  2L0T B;  4L2Y A;  4DX7 D;  1OUV A;  3DWL G;  4CRW A;  1MJ0 A;  4LRZ A;  4AY5 A;  2R5S A;  4HOQ A;  4JB8 P;  4AEZ C;  2IO3 C;  2R59 A;  4K5A B;  3FU6 A;  2IY0 C;  4FC8 A;  3V2O A;  2KCL A;  4M3O A;  2WXF A;  3FUM A;  4XKC A;  3AU5 A;  3MKQ A;  3BQO A;  2KZT A;  1IQU A;  4B8A A;  1SVX A;  5EID A;  2A5U A;  3ISM C;  3ZW3 A;  3D9M A;  2DCP A;  2BKK B;  4J8Y A;  4RQI A;  3SNX A;  4BER A;  3QK0 A;  2XPZ A;  1N4Q A;  2AJA A;  3ULQ A;  1U3C A;  3UT8 A;  1K3Z D;  2Y1L E;  3Q47 B;  3ZYL A;  3DPD A;  3J5P A;  3FEX A;  5HKP A;  4I43 A;  1HS6 A;  2IOS A;  2FEZ A;  1QYM A;  2VTB A;  3U3W A;  2P9U G;  1H2V C;  3CK8 A;  3RO3 A;  5BNW A;  3FUD A;  4RSY A;  2QC9 A;  4XZ4 A;  2GRQ B;  4NAC A;  5CCM A;  4KYO B;  2OCC E;  4ACL A;  3ZU7 B;  1MHQ A;  4G8L A;  2IEJ A;  2L0I A;  3FWV A;  3C3R A;  1IKN D;  3SD5 A;  1HE8 A;  2V4L A;  4BY6 A;  1JPL A;  4FJY A;  4I6J A;  3AJI A;  2R02 A;  5EX0 A;  1HXI A;  2GRN B;  2MHK A;  3ZUV B;  3KD7 A;  1E8W A;  3D9L A;  3QJZ A;  5G55 A;  4YDE A;  2BED A;  2KAT A;  1S63 A;  2ION A;  3UMV A;  4R7L A;  3L22 A;  2YNQ A;  4UQX A;  3JXJ A;  2X6H A;  3ML8 A;  2IJG X;  2J07 A;  2BUG A;  3KSL A;  3CVQ A;  1HFA A;  2I1K A;  1AP7 A;  2WXN A;  3BEE A;  5AYW D;  4GZC A;  2ZGD A;  2LAH A;  4G2V A;  3VTY A;  1S70 B;  4C9B B;  1N9A A;  1TNY A;  5ENQ D;  2MOW A;  2EIJ E;  1AWC B;  3EUV A;  4U0S A;  5B3S E;  4GYO A;  2LO6 A;  4JL0 A;  1ZB1 A;  2XS8 A;  2Y0B G;  2QYU A;  3UI2 A;  3ZHE A;  2IO2 C;  4DLO A;  4EPZ A;  4OYS A;  3AAA C;  2XQ0 A;  3I5P A;  1N11 A;  3HXF A;  2I2O A;  3UQ3 A;  2WXP A;  1MX2 A;  1Z6T A;  3FUJ A;  3I4R B;  3FUL A;  4KXK B;  2VGX B;  4OAU C;  3CIA A;  2XZT G;  4WNE A;  3ZEF A;  3LVQ E;  1YYH A;  2AXU A;  3FEY A;  3O48 A;  1JUQ A;  3ASO E;  5FZS A;  4FP7 A;  4U95 D;  4I1A A;  5FQ8 A;  1WG0 A;  5AJD A;  3B13 A;  5JHA A;  5FIN A;  3ASN E;  1BI8 B;  3UT7 A;  3TGO A;  4U0Z A;  4AJW A;  5ENP D;  1NA3 A;  3CEQ A;  5LX8 A;  1SA5 A;  1Y6I A;  4K03 A;  3IHY A;  3CVX A;  5IY5 E;  1UG3 A;  3APD A;  1XGW A;  2F8Y A;  2ZIR A;  1PY1 A;  4TUM A;  2PM7 A;  3QB2 A;  3MYV A;  4ATZ D;  4PS8 A;  3JUI A;  3Q7F A;  4TXR A;  3TG4 A;  3FFL A;  4BTA A;  2XS1 A;  3ZYK A;  1FCH A;  4ME2 A;  3D9K A;  4WND A;  5A6C A;  4B94 A;  2X3M A;  1BU9 A;  1N0Q A;  3QOU A;  2GW1 A;  3HXD A;  4FUL A;  4L9P A;  5H7P A;  2WXK A;  2LNI A;  3ONK A;  5BUZ A;  2ZIS A;  4U8Y D;  3DSW A;  1JCS A;  3GZS A;  5C1D A;  4EZJ A;  3W9F A;  4GPK A;  3Q75 A;  1VDY A;  4JHK A;  3AG4 E;  3ZXP A;  1X81 A;  5ARF A;  2GRP B;  2VYI A;  5CER B;  4RLY A;  3LKU A;  3DSU A;  5ANR A;  3L82 A;  5JJ6 A;  3CLJ A;  5KWD A;  4O60 A;  1U3D A;  3Q49 B;  3V2X A;  3KS2 A;  4ANV A;  2AWI A;  4GZ3 A;  2ZXW E;  2L6J A;  3C98 A;  3LXU X;  3OAW A;  1OY3 D;  4I2Z A;  2FI7 A;  2WM9 A;  2FBN A;  5D0O D;  2HYZ A;  5LCW C;  2E0I A;  4G8K A;  3N71 A;  3G2T A;  3Q73 A;  3IV0 A;  2VSN A;  3OXG A;  2P58 C;  2FUL A;  4H7X A;  4QQI A;  2IOL A;  2NC9 A;  2DIW A;  3QDN A;  3FU5 A;  5KJL A;  4XX5 A;  2KC7 A;  3TJP A;  1DNP A;  3ASF A;  2WQ7 A;  4BSX A;  2KCV A;  1TR4 A;  1A17 A;  3SFY A;  4MS6 A;  4CGV A;  4CDM A;  3WXX A;  2NSZ A;  3MKQ B;  2KZT B;  2KXP C;  2IFU A;  2CHX A;  4I17 A;  2LAI A;  4ATG A;  4GTO A;  4WAF A;  1TN6 A;  3Q15 A;  2QY7 A;  3JQ1 A;  4DPR A;  3APF A;  4GTV A;  3VLF A;  3C3Q A;  2Y4U A;  3AG3 E;  2XEE A;  2P9K G;  3SY2 A;  2BTD A; 
#chains in the Genus database with same CATH homology
 3PZ4 A;  1X81 A;  4YDO A;  1N95 A;  1D8D A;  3DSX A;  1O1S A;  1N4P A;  3DSU A;  3HXC A;  1LD7 A;  2H6H A;  1FT2 A;  3E34 A;  3DSV A;  3DPY A;  3Q7A A;  1JCR A;  4EHM A;  3Q78 A;  2H6F A;  1D8E A;  2IEJ A;  3PZ2 A;  3E30 A;  4GTT A;  3EU5 A;  1DCE A;  1LD8 A;  1KZO A;  4GTR A;  1S64 A;  3Q79 A;  3E37 A;  1N4S A;  1TNB A;  1TNO A;  1FPP A;  4GTP A;  1KZP A;  1SA5 A;  3DST A;  2H6I A;  2F0Y A;  3Q73 A;  3C72 A;  3E32 A;  4YDE A;  2BED A;  2ZIR A;  1S63 A;  3PZ1 A;  1LTX A;  1TN7 A;  1TN8 A;  1NI1 A;  3PZ3 A;  1TNZ A;  1JCQ A;  3KSL A;  3Q7F A;  1TNU A;  4MBG A;  2R2L A;  3E33 A;  3DRA A;  1QBQ A;  1N9A A;  1TNY A;  4GTM A;  4GTQ A;  3SFY A;  1MZC A;  1SA4 A;  1N4Q A;  3EUV A;  1N4R A;  3HXD A;  4LNB A;  3KSQ A;  4L9P A;  4LNG A;  4GTO A;  1TN6 A;  1O5M A;  1O1T A;  2ZIS A;  2H6G A;  3Q75 A;  3DSW A;  3HXF A;  1JCS A;  4GTV A;  1FT1 A;  3DSS A;  3HXE A;  3HXB A;  4GTS A;  1O1R A;  1NL4 A;  1N94 A;  3SFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...