1TNUA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
total genus 130
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnuA00
2ZISA 3EU5A 2H6HA 3DSWA 1JCQA 1TNBA 3E34A 1N4QA 2R2LA 1SA4A 3DSTA 3PZ3A 1D8EA 1TN7A 3HXDA 3Q7FA 4GTVA 1FT2A 3DSUA 4EHMA 3HXBA 3E33A 3DSVA 4GTRA 1MZCA 1JCRA 3C72A 1N94A 2H6IA 1DCEA 1NI1A 2F0YA 1JCSA 4LNBA 1TN6A 1S63A 2IEJA 3Q73A 3Q79A 4GTOA 1O1RA 1TN8A 4MBGA 1LTXA 3SFXA 3Q7AA 4GTSA 1KZOA 1N9AA 4LNGA 4GTMA 3DSSA 3HXFA 1SA5A 1X81A 3E32A 3DPYA 2ZIRA 4GTQA 3Q75A 3HXEA 1D8DA 4GTPA 3HXCA 1KZPA 3E37A 1N95A 3EUVA 4GTTA 3SFYA 3PZ2A 1QBQA 1TNUA 4L9PA 1O1TA 3DSXA 4YDEA 1O1SA 3DRAA 1S64A 4YDOA 1FT1A 1N4PA 3PZ4A 3KSLA 1NL4A 2H6FA 1N4RA 1LD8A 1LD7A 1FPPA 3KSQA 1TNZA 3PZ1A 1N4SA 3E30A 1O5MA 1TNYA 1TNOA 2H6GA 3Q78A 2BEDA
chains in the Genus database with same CATH superfamily
4K5BA 2GRQB 4J7WA 4XKCA 4YNDA 1ELWA 4JEUA 4GZ5A 4HBDA 3RRUA 3L82A 3IHVA 1FT2A 4XX5A 3DXKG 2PL2A 4FJYA 1E96B 5BXOA 3VLDA 5FIOA 2HO1A 1H2VC 5A7DB 4GZ3A 3J5QB 4N3CA 4DX6D 3Q47B 4CYMD 2RKKA 3FUKA 3U3WA 2L6BA 5KNGA 3ABLE 3Q7AA 3OTNA 2DBAA 4BT9A 1OCRE 1K3ZD 4U0SA 1X81A 3E32A 3OXGA 5T3RA 2DZNA 2IFUA 2XEVA 4WWOA 3U66A 3PS6A 3V2XA 2R05A 4GTTA 4JHRA 4F1PA 3HYMB 3DSXA 2XPZA 3X2QE 2YHCA 3HRAA 1YCSB 5G2NA 4HLLA 3LKUA 3KEZA 3PZ4A 1N4RA 4K0RA 5D2MC 4AOFA 4TV3A 4GYYA 3FTXA 1E8WA 4UWHA 1N54A 3PUJA 5AJLA 1EF1C 3TGOA 3D9JA 4TRQA 2XRZA 4CT4A 4Y6WA 4Y6CA 2J9QA 5FQ8A 3CQGB 5JHAA 3ZN3A 4ATGA 3TWRA 1D8EA 5CBOA 4DK5A 1HS6A 2L9BA 3PNTB 2ZGGA 5B1AE 4DX2A 3ASNE 3UUXA 4IN3B 1NI1A 2F0YA 2CHXA 4JPSA 3F6QA 3IHYA 3L17A 3PE4A 3BG0B 3TG4A 4B93B 4P29A 2IJGX 4DLOA 4KT6B 4X8QA 3CVWA 3DWLG 1NFIE 2BKGA 2DWZA 2ZGDA 2ZIRA 4UI9C 1E7UA 1D8DA 4KVOA 2EIME 4TXPA 4GTPA 1ELRA 3FHEA 2BTDA 4FHKA 3FEXA 4GMJA 3G2VA 4RG9A 5FQ7A 2VSXE 2Y69E 3FULA 2H6FA 1JWFA 4I17A 2IU1A 2VTBB 1WM5A 5H7PA 3SBTB 2J4DA 4AY6A 3NOGD 3S7FA 4CGWA 1N4SA 3U64A 3QOUA 2DYSE 3I4RB 3JUIA 2DCPA 3LY9A 3W9FA 4HOQA 4L7TA 4XZ4A 3PRZA 5HKPA 2OOEA 4ANVA 3APCA 2L0TB 2LXLA 2VSOE 1HG5A 5AJDA 3NB2A 2J09A 4TUMA 2PM6A 4XIFA 2X38A 4GTRA 1JCRA 3TWWA 3ENEA 3FTZA 4H7YA 3C5RA 4DLQA 2ONDA 4HNAD 3GYZA 5AYWD 2P58C 3OXLA 1NP7A 1SW6A 5AQ9A 2R02A 3SFXA 4JB8P 3FUDA 3LY7A 1ZB1A 3HDXA 4KBQA 2XQ0A 3UT4A 4DX7D 5BT1A 3MGBA 2Y4TA 5ENQD 3G2WA 5FZRA 4NACA 3FU6A 2Y3AA 3TWTA 2XS8A 4U04A 1SQMA 5HI7A 4YDEA 3BUAA 3CVLA 2WB2A 3FTWA 4EBAA 3UM0A 2VGEA 2IOSA 3CHSA 4B0ZA 1MQSA 2VQ2A 4BFRA 1SZ9A 3HHMA 3VLFA 4FJZA 3DEPA 3UT7A 4WWPA 1HO8A 3ESLA 4ATZD 3WXXA 2KXPC 5EIDA 1JWGA 1H2UA 4K5CA 4IRUA 4PUCA 3PUKA 3ASFA 3ZKJA 3ZHEB 4J8DA 3TWVA 5LCWJ 4J8FA 5ENPD 5CHEE 2YHEA 4UQZA 4GTOA 1RZ4A 1Z3XA 4JEHA 1N9AA 3ZYLA 3BQOA 5G55A 4G11A 4XI9A 5EX3A 1LF8A 3CQCB 1PAQA 3TWUA 4HRMB 2CFUA 1OT8A 5CEDB 1H19A 2AXVA 4U0UA 4GZCA 5ANLA 3ZFWA 5KJMA 3UM1A 5G04J 4IYPA 3ABME 3ASHA 3NAWA 4R7LA 2QYJA 4CGVA 3UKUG 5D0QD 4LERA 5LFAA 1XNFA 2LSUA 1E8XA 2I9CA 1OUVA 2F8YA 2C0MA 3AS8A 4I6EA 3FU3A 1TNOA 3FU0A 1IXVA 3ULQA 3AG3E 2FULA 3FTVA 3TJPA 3Q9UC 1D9SA 5BXUA 3WG7E 1NZNA 2WXLA 4G26A 3D9PA 3Q7FA 3DSUA 1MZCA 3C72A 1HU3A 3BU8A 1IYGA 3KD7A 3AG4E 4CRWA 3TXMA 3MV2B 3CIAA 2J08A 2X6HA 3PVLA 5KWDA 5KJNA 3AS4A 2WVIA 3G2SA 3RO2A 4GTSA 4C9BB 3ZVVA 4FLHA 5KCMA 4GPMA 2WXQA 3B7BA 3HXEA 4J8EA 1ELKA 2I2OA 4N3BA 4BX8A 2IO2C 2Y0BG 2AVPA 1KZPA 4UWGA 3EUVA 2F37A 3I4GA 5ARGA 1E90A 3FUIA 1HF8A 4G25A 4APFA 4HRNA 2GRLA 1NA0A 4JW1A 3UM2A 1UW4B 2EILE 3GZ2A 2MYOA 4YDOA 1FT1A 5AQBA 1HE8A 2V5FA 4WNDA 4ACKA 3FUJA 2UY1B 4LRZA 1TR4A 1OCOE 5CERB 4GZ6A 3PZ1A 4CDRA 2AXUA 3CVUA 3P1UA 3SNXA 3UIPC 4AEZC 3QWPA 3FDHA 1IKND 3FWVA 3MKRA 3R9MA 3B7TA 4I43A 4CDNA 3LVQE 3CVXA 4CEMA 2FBNA 4MKTA 3MX3A 5G05J 4KZCA 3L22A 3TG5A 3EU9A 2V0PA 1N0QA 2J8SD 1YYHA 4U7EB 1WG0A 2V4LA 1N11A 5AENA 3SY2A 3OXFA 5M72A 2ETAA 2KATA 4OVUA 2WXGA 4ANXA 3SFZA 1TN8A 3AJIA 2CG3A 4E85A 3PEUB 3CK8A 3Q4AB 5LOZA 4YVQC 4L23A 2XZDG 3Q75A 3QK0A 3ASGA 2I1KA 4BETA 3ULYA 2B6CA 5CCMA 2VSNA 1H0AA 5CECB 2ZXWE 4RSYA 5JJ7A 2NYJA 4APOA 2XHEA 4KMOA 4G8LA 5BV1A 3MKQA 4O6FA 3L6AA 4HOTA 2PQRA 5FTPA 2VTBA 3IEGA 4JA9A 1LD8A 1LD7A 3RSEG 3L13A 4WAFA 1QZ2A 2WMOA 2GRPB 2ETBA 3ZRHA 2GW1A 4DX5D 4G23A 4O1OA 5G04C 4OVVA 3CLJA 2H6HA 5BUZA 1KT1A 2J07A 1U2VG 2P9NG 3B95A 3TL5A 3DSTA 1H2TC 4E6HA 2VSYA 2R03A 2XCCA 2BUGA 1UJKA 1OWPA 5EDSA 4N3AA 4K5AB 4F53A 2E0IA 4KZ0A 2XEHA 5CRUA 4L2YA 4BT8A 3EHQA 3JXIA 1S63A 4ACLA 2DZOA 3EHMA 5A23A 3V30A 4Q69A 4JD2G 2OVFA 3ML8A 4ANUA 2A5EA 2KZTA 1K1BA 1WDYA 2XEEA 4DPRA 5ANRA 3SI5A 5BV0A 3ASOE 1JPLA 2GRMA 3CKBA 4HS2A 4EQFA 3MKQB 4BSXA 4AIFA 3LXUX 4DI3A 4LUNU 1U3CA 4AV7A 5ITZF 3D9HA 3ONLA 1N4PA 3TXNA 4WWNA 3TWXA 2MHKA 3CHOA 4TXQA 1PC2A 4JA7A 2LO6A 2XCBA 2WXMA 2QYUA 2VJ8A 3MYVA 3P2BA 2DVWA 1Z3YA 4I2WA 5FZQA 1OCZE 4L9PA 4EPZA 4ANWA 4XKBA 1INZA 4TXRA 2WXPA 2P9UG 3ASDA 1SZAA 3FFLA 1JUQA 3IKOB 3IV0A 4BTBA 4JHJA 5ENSD 3U4TA 3CHQA 5EILA 1JCSA 4OYSA 4N39A 4LNBA 4UQYA 2OVBA 3RK6A 1E8ZA 4AM9A 3ZW3A 1KT0A 4GMRA 5FJYA 3T5XA 4C48B 5C1DA 3HVEA 4GTQA 5LX8A 3I5PA 1S70B 1FVHA 2JABA 1WAO1 1FVFA 2OCCE 3CK7A 3CHPA 5CMWA 4ILHB 3PZ2A 1YMPA 3MJWA 1QBQA 4I2ZA 4B89A 4XEIG 5KJLA 3LVRE 1Y8MA 4G1TA 3G2UA 3U9WA 3UM3A 5ENRD 3D9MA 1E7VA 1A17A 1UOHA 5FINA 2P9KG 3S2AA 3FUEA 5A6CA 1TJFA 3FTUA 2LNIA 3MV3B 3CR3A 5J90A 3EJNA 3QKYA 2ZISA 3EU5A 4DJAA 3FUFA 1A5EA 1KPSB 2OV8A 4I6JA 2ETCA 3BG1B 3PZ3A 3HXDA 2ILRA 3J5PA 4GAAA 4G24A 4ILGA 3PREA 5B3SE 2H6IA 4OAVB 3UIOC 3B7UX 4BWRA 5JMND 1N52A 2KZTB 1BU9A 1TN6A 4KVMA 2J4BA 2XGOA 4MLPA 3ULEG 3ZNGA 4FP7A 3JQ1A 1BLXB 2XPYA 3QWWA 2P9LG 1BD8A 1SA5A 4CZ2D 1HZ4A 4G2VA 2M63A 4UQXA 3DPYA 4I1OB 2VGYA 4LEUA 4F3VA 2WXNA 3B7SA 3HXCA 4I1AA 4ZHBA 4HORA 2YNQA 2BKKB 1NA3A 5D0OD 3Q9NC 3C3RA 2F8XK 4HOUA 1HXIA 2IONA 2QY7A 4ZFHA 3URZA 1OWMA 3FUNA 2P9IG 3R7RA 2WXRA 3ZYQA 3RRMB 4GA2A 1S64A 4I6GA 2GRNB 4BEPA 3CSTA 1TNBA 4RLYA 4BERA 4KYOB 3UTMA 1SA4A 1BPOA 1PY1A 1G3NB 1TN7A 4DRXE 5AIJA 5CCLA 3NZSA 3FY4A 1N94A 4LG6A 3LS8A 3FP3A 2RG8A 4EZLA 3SHFA 4MBGA 5FQ4A 1V55E 3UI2A 4YDYA 4MRUA 1E8YA 5KJKA 4EZKA 3HXFA 4J8YA 2WXJA 3SGHA 4DUIA 1OXJA 1QYMA 1H6KA 1MYOA 3S7DA 2VGXB 4AP2A 1DVPA 4A3TA 3KEAA 5LCWC 3DXMG 3O48A 4U8VD 4B8AA 1IHGA 5ENOD 2FEZA 4FADA 2WXHA 4FLBA 3V31A 4J8SA 4UWKA 2RD0A 4F6RD 2R5SA 4BTAA 3BEEA 1RW2A 1S0PA 4HI9A 2IOLA 2FI7A 2WQHA 2RFMA 1QQEA 4Z68A 1O5MA 4JL0A 1TNYA 4BY6A 3L08A 1UN8A 3ZXSA 3MZLB 2LSVA 4N2QA 3E34A 2WPVA 1N4QA 2KC7A 1GW6A 3LJ3A 2CFZA 3I3NA 4N5CA 3UPVA 3APDA 1DCEA 3HVEB 4HB5A 3R9AB 4U8YD 3ZHEA 5C2YA 2YQ8A 3ZPJA 1EPUA 1Q2ZA 1O1RA 1KZOA 1ZBPA 4FC8A 3NF1A 3CSFA 4L2LA 2EIJE 3AG1E 3G2TA 4U63A 2QC9A 3UINC 2I1JA 4JHKA 1HG2A 2WM9A 5T8IA 3FH7A 4LSZE 5HS0A 4B8CB 2A5UA 2P9SG 2HR2A 4YVOA 2WXIA 3PH0C 5EYLA 4HVBA 1ZU2A 4Q94A 4U07A 3TWSA 4NQ0A 4PDXA 2MRIA 2Y4UA 4RQIA 4PS3A 2GRRB 3ZIMA 3RIBA 4AXHA 5AN8A 3JCKC 3UQ3A 4GCNA 3ZYKA 4GYWA 3JXJA 4GCOA 2X6FA 1OWOA 5CMYA 3UKRG 3JUEA 2XGSA 5JA4D 1TJCA 5IY5E 2Y1LE 3MEKA 2KCVA 4GMLA 3HXBA 3FH8A 3ISMC 2QFCA 4F7AA 3RRNB 2LXMA 1Z5SC 3ESKA 3AU5A 4BESA 2EINE 3QJZA 4G8KA 4U95D 4HRLA 4GA1A 4C0MA 4LNGA 1P5QA 4WNGA 2RFAA 2KCLA 3S7BA 5HQ8A 4A55A 3DSSA 5E75A 3D3MA 4A63B 3PDNA 2IO3C 4HLEA 5JJTA 2WQ7A 4I9CA 3PZDA 1IHBA 3L9TA 4H7XA 5G05C 5EKQD 5AARA 2IY0C 4UI9J 2J49A 3Q49B 4D10C 3VLEA 5ARFA 3CKCA 3CVQA 3PE3A 3QNKA 2PNNA 3SBSA 5JHBA 4A1GA 3FTYA 3SF4A 3Q15A 4MS6A 2IF4A 3FH5A 1NL4A 2CHZA 4QQIA 1OWNA 4UUCA 5EYPF 1IQUA 4PS7A 2HM8A 1UJJA 3EHRA 3FTSA 5FWQA 3LCAA 2L0IA 4EZJA 3DEOA 3TWQA 2OEVA 2LUHA 4DI4A 1YA0A 3CHRA 1JCQA 1BI7B 5KBAA 3L16A 3KS2A 3C3QA 4JC8A 3CGHA 3CVNA 4JVSA 4EHMA 3EIQC 2NSZA 3SO8A 4M3OA 4GZDA 2DYRE 1K1AA 4TUUA 2NXPA 2V4HC 3S7JA 4RVBA 3VTYA 3CVVA 4L1BA 3LPZA 3RJVA 3ZEFA 2WXFA 2FF4A 2FO7A 4A1SA 3T5VA 4GTMA 4BSZB 1HX8A 5CBNA 1HFAA 3CV0A 2LAHA 5D66A 4V3IA 5KNHD 2L6JA 3QDNA 4URKA 2LAIA 4UI9K 4LCTA 3K9IA 5JJ6A 3B7RL 2XS1A 3GZ1A 1K8KG 3E37A 2HE0A 2EIKE 5CRVA 4ME2A 1DC2A 1H6PA 1L5JA 4U0ZA 3ZXPA 5FT9A 3NOCD 4NRHB 2WQ6A 1W3BA 3QWVA 4GPKA 3KSLA 4OAUC 3FUMA 4JZYA 3CHMA 2X3MA 3NZUA 4KXKB 5FZSA 3KSQA 5DIZA 1IQRA 2B0OE 3MCXA 2PZIA 4FU3A 3E30A 2E2EA 4EBAG 1AP7A 2C2LA 3DSWA 3ZGQA 5EX0A 2R2LA 5AQ7A 4N5QA 1MX6A 2V5QC 1N0RA 3EHNA 3FEYA 1XGWA 2AWIA 3D9IA 3E33A 3DPDA 5ENTD 2WXOA 4O1PA 1Y6IA 4HI8A 4GA0A 1OCCE 2XZTG 3AAAC 2XRYA 3HG0D 1AWCB 2KCKA 3B13A 3MA5A 5LP0A 3GW4A 5E76A 4XI0A 4HOSA 3QARA 5T4YA 5HRYA 3RKVA 2JEKA 2KBXA 4N2SA 4J6IA 4DX1A 3HIZA 3E4BA 4BX9A 4A3VA 3CVYA 4W9RA 2JLBA 2HYZA 4JXTA 1N95A 4I9EA 3SFYA 2UWJG 1O1TA 3ML9A 1UN9A 1VDYA 3AU4A 3DRAA 4M7CA 1MJ0A 2GROB 3EDTB 2V8SE 4HQDA 3LEWA 5EIBE 5J08A 3SD5A 2X6KA 2MOWA 3ABKE 3W9GA 1FPPA 3T9KA 1V54E 5BNWA 1TNZA 3NQPA 3QC1A 3LYAA 2X6IA 2VYIA 3EIJA 1QNFA 2BF0X 3RO3A 1UG3A 2UY1A 2Q7FA 4K03A 3NBNB 4IULA 1TYQG 4UWFA 1Z6TA 2FO1E 2AJAA 4O60A 1WY6A 3N71A 4LNUD 1DCQA 4F1SA 1BI8B 2KM4A 4GB9A 4RG6A 4ILIA 2YINA 2NC9A 2CHWA 3UXGA 2AW6A 3V2OA 2IEJA 3CVPA 4UWLA 2X6JA 1SVXA 5DBKA 2I6HA 2OEWA 4GU5A 3GZSA 3QAQA 3PNLB 3T8MA 5ENNA 3FU5A 3CK9A 3VTXA 2A4ZA 3RAUA 2GGFA 1DNPA 2P9PG 2XPIA 3CEQA 1OWLA 5CEAA 1U3DA 3SQVA 4GYOA 1TEZA 2DIWA 4C0EA 3AG2E 1TNUA 4AVXA 1EDUA 1O1SA 2CG2A 3D9KA 3D9LA 2PM7A 3UMVA 1H6OA 3KAEA 1OY3D 3ZYMA 2ZU6B 3OAWA 4AJWA 3IXEA 5AAOA 4PH4B 4QFVA 3DBSA 2R17C 1EYHA 2BEDA 1MX2A 2IQCA 2XENA 4NIKA 3D9OA 3ONKA 3IBEA 4NURA 3APFA 3LY8A 4GTVA 4EECA 3Q5MA 5AQAA 4FULA 3DSVA 2C0LA 2XGMA 4I1MA 4WNFA 3TAXA 4U8HA 1FCHA 2R59A 3UT8A 5FQ6A 2VGXA 5EN5D 3V79K 3Q73A 4XE0A 3Q79A 1LTXA 3T8KA 4YDWA 2AXZA 1X5BA 3L54A 4Q96A 2WMNA 3LDZA 5BPPA 4FHJA 2PQNA 3R7QA 3QB2A 3AS5A 3C98A 4CDMA 4HXIA 4WNEA 4U96D 5BW8C 4B94A 1B89A 3SZ7A 3D9NA 2QZAA 2EQXA 3LJNA 1KLXA 3UX4A 3RU0A 4PS8A 4FA6A 4J0UA 3PEVB 1MX4A 3JYSA 3O4ZA 3JQ0A 4AY5A 2P2CP 3FUHA 4CCAA 1HH8A 4WUYA 3ZUVB 4ABNA 4CT0A 4HFGA 1MHQA 3ZU7B 2H6GA 3C3OA 2WXKA 3Q78A 5B1BE
chains in the Genus database with same CATH topology
2ZISA 3EU5A 2H6HA 3DSWA 1JCQA 1TNBA 3E34A 1N4QA 2R2LA 1SA4A 3DSTA 3PZ3A 1D8EA 1TN7A 3HXDA 3Q7FA 4GTVA 1FT2A 3DSUA 4EHMA 3HXBA 3E33A 3DSVA 4GTRA 1MZCA 1JCRA 3C72A 1N94A 2H6IA 1DCEA 1NI1A 2F0YA 1JCSA 4LNBA 1TN6A 1S63A 2IEJA 3Q73A 3Q79A 4GTOA 1O1RA 1TN8A 4MBGA 1LTXA 3SFXA 3Q7AA 4GTSA 1KZOA 1N9AA 4LNGA 4GTMA 3DSSA 3HXFA 1SA5A 1X81A 3E32A 3DPYA 2ZIRA 4GTQA 3Q75A 3HXEA 1D8DA 4GTPA 3HXCA 1KZPA 3E37A 1N95A 3EUVA 4GTTA 3SFYA 3PZ2A 1QBQA 1TNUA 4L9PA 1O1TA 3DSXA 4YDEA 1O1SA 3DRAA 1S64A 4YDOA 1FT1A 1N4PA 3PZ4A 3KSLA 1NL4A 2H6FA 1N4RA 1LD8A 1LD7A 1FPPA 3KSQA 1TNZA 3PZ1A 1N4SA 3E30A 1O5MA 1TNYA 1TNOA 2H6GA 3Q78A 2BEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIS A;  3EU5 A;  2H6H A;  3DSW A;  1JCQ A;  1TNB A;  3E34 A;  1N4Q A;  2R2L A;  1SA4 A;  3DST A;  3PZ3 A;  1D8E A;  1TN7 A;  3HXD A;  3Q7F A;  4GTV A;  1FT2 A;  3DSU A;  4EHM A;  3HXB A;  3E33 A;  3DSV A;  4GTR A;  1MZC A;  1JCR A;  3C72 A;  1N94 A;  2H6I A;  1DCE A;  1NI1 A;  2F0Y A;  1JCS A;  4LNB A;  1TN6 A;  1S63 A;  2IEJ A;  3Q73 A;  3Q79 A;  4GTO A;  1O1R A;  1TN8 A;  4MBG A;  1LTX A;  3SFX A;  3Q7A A;  4GTS A;  1KZO A;  1N9A A;  4LNG A;  4GTM A;  3DSS A;  3HXF A;  1SA5 A;  1X81 A;  3E32 A;  3DPY A;  2ZIR A;  4GTQ A;  3Q75 A;  3HXE A;  1D8D A;  4GTP A;  3HXC A;  1KZP A;  3E37 A;  1N95 A;  3EUV A;  4GTT A;  3SFY A;  3PZ2 A;  1QBQ A;  1TNU A;  4L9P A;  1O1T A;  3DSX A;  4YDE A;  1O1S A;  3DRA A;  1S64 A;  4YDO A;  1FT1 A;  1N4P A;  3PZ4 A;  3KSL A;  1NL4 A;  2H6F A;  1N4R A;  1LD8 A;  1LD7 A;  1FPP A;  3KSQ A;  1TNZ A;  3PZ1 A;  1N4S A;  3E30 A;  1O5M A;  1TNY A;  1TNO A;  2H6G A;  3Q78 A;  2BED A; 
#chains in the Genus database with same CATH topology
 4K5B A;  2GRQ B;  4J7W A;  4XKC A;  4YND A;  1ELW A;  4JEU A;  4GZ5 A;  4HBD A;  3RRU A;  3L82 A;  3IHV A;  1FT2 A;  4XX5 A;  3DXK G;  2PL2 A;  4FJY A;  1E96 B;  5BXO A;  3VLD A;  5FIO A;  2HO1 A;  1H2V C;  5A7D B;  4GZ3 A;  3J5Q B;  4N3C A;  4DX6 D;  3Q47 B;  4CYM D;  2RKK A;  3FUK A;  3U3W A;  2L6B A;  5KNG A;  3ABL E;  3Q7A A;  3OTN A;  2DBA A;  4BT9 A;  1OCR E;  1K3Z D;  4U0S A;  1X81 A;  3E32 A;  3OXG A;  5T3R A;  2DZN A;  2IFU A;  2XEV A;  4WWO A;  3U66 A;  3PS6 A;  3V2X A;  2R05 A;  4GTT A;  4JHR A;  4F1P A;  3HYM B;  3DSX A;  2XPZ A;  3X2Q E;  2YHC A;  3HRA A;  1YCS B;  5G2N A;  4HLL A;  3LKU A;  3KEZ A;  3PZ4 A;  1N4R A;  4K0R A;  5D2M C;  4AOF A;  4TV3 A;  4GYY A;  3FTX A;  1E8W A;  4UWH A;  1N54 A;  3PUJ A;  5AJL A;  1EF1 C;  3TGO A;  3D9J A;  4TRQ A;  2XRZ A;  4CT4 A;  4Y6W A;  4Y6C A;  2J9Q A;  5FQ8 A;  3CQG B;  5JHA A;  3ZN3 A;  4ATG A;  3TWR A;  1D8E A;  5CBO A;  4DK5 A;  1HS6 A;  2L9B A;  3PNT B;  2ZGG A;  5B1A E;  4DX2 A;  3ASN E;  3UUX A;  4IN3 B;  1NI1 A;  2F0Y A;  2CHX A;  4JPS A;  3F6Q A;  3IHY A;  3L17 A;  3PE4 A;  3BG0 B;  3TG4 A;  4B93 B;  4P29 A;  2IJG X;  4DLO A;  4KT6 B;  4X8Q A;  3CVW A;  3DWL G;  1NFI E;  2BKG A;  2DWZ A;  2ZGD A;  2ZIR A;  4UI9 C;  1E7U A;  1D8D A;  4KVO A;  2EIM E;  4TXP A;  4GTP A;  1ELR A;  3FHE A;  2BTD A;  4FHK A;  3FEX A;  4GMJ A;  3G2V A;  4RG9 A;  5FQ7 A;  2VSX E;  2Y69 E;  3FUL A;  2H6F A;  1JWF A;  4I17 A;  2IU1 A;  2VTB B;  1WM5 A;  5H7P A;  3SBT B;  2J4D A;  4AY6 A;  3NOG D;  3S7F A;  4CGW A;  1N4S A;  3U64 A;  3QOU A;  2DYS E;  3I4R B;  3JUI A;  2DCP A;  3LY9 A;  3W9F A;  4HOQ A;  4L7T A;  4XZ4 A;  3PRZ A;  5HKP A;  2OOE A;  4ANV A;  3APC A;  2L0T B;  2LXL A;  2VSO E;  1HG5 A;  5AJD A;  3NB2 A;  2J09 A;  4TUM A;  2PM6 A;  4XIF A;  2X38 A;  4GTR A;  1JCR A;  3TWW A;  3ENE A;  3FTZ A;  4H7Y A;  3C5R A;  4DLQ A;  2OND A;  4HNA D;  3GYZ A;  5AYW D;  2P58 C;  3OXL A;  1NP7 A;  1SW6 A;  5AQ9 A;  2R02 A;  3SFX A;  4JB8 P;  3FUD A;  3LY7 A;  1ZB1 A;  3HDX A;  4KBQ A;  2XQ0 A;  3UT4 A;  4DX7 D;  5BT1 A;  3MGB A;  2Y4T A;  5ENQ D;  3G2W A;  5FZR A;  4NAC A;  3FU6 A;  2Y3A A;  3TWT A;  2XS8 A;  4U04 A;  1SQM A;  5HI7 A;  4YDE A;  3BUA A;  3CVL A;  2WB2 A;  3FTW A;  4EBA A;  3UM0 A;  2VGE A;  2IOS A;  3CHS A;  4B0Z A;  1MQS A;  2VQ2 A;  4BFR A;  1SZ9 A;  3HHM A;  3VLF A;  4FJZ A;  3DEP A;  3UT7 A;  4WWP A;  1HO8 A;  3ESL A;  4ATZ D;  3WXX A;  2KXP C;  5EID A;  1JWG A;  1H2U A;  4K5C A;  4IRU A;  4PUC A;  3PUK A;  3ASF A;  3ZKJ A;  3ZHE B;  4J8D A;  3TWV A;  5LCW J;  4J8F A;  5ENP D;  5CHE E;  2YHE A;  4UQZ A;  4GTO A;  1RZ4 A;  1Z3X A;  4JEH A;  1N9A A;  3ZYL A;  3BQO A;  5G55 A;  4G11 A;  4XI9 A;  5EX3 A;  1LF8 A;  3CQC B;  1PAQ A;  3TWU A;  4HRM B;  2CFU A;  1OT8 A;  5CED B;  1H19 A;  2AXV A;  4U0U A;  4GZC A;  5ANL A;  3ZFW A;  5KJM A;  3UM1 A;  5G04 J;  4IYP A;  3ABM E;  3ASH A;  3NAW A;  4R7L A;  2QYJ A;  4CGV A;  3UKU G;  5D0Q D;  4LER A;  5LFA A;  1XNF A;  2LSU A;  1E8X A;  2I9C A;  1OUV A;  2F8Y A;  2C0M A;  3AS8 A;  4I6E A;  3FU3 A;  1TNO A;  3FU0 A;  1IXV A;  3ULQ A;  3AG3 E;  2FUL A;  3FTV A;  3TJP A;  3Q9U C;  1D9S A;  5BXU A;  3WG7 E;  1NZN A;  2WXL A;  4G26 A;  3D9P A;  3Q7F A;  3DSU A;  1MZC A;  3C72 A;  1HU3 A;  3BU8 A;  1IYG A;  3KD7 A;  3AG4 E;  4CRW A;  3TXM A;  3MV2 B;  3CIA A;  2J08 A;  2X6H A;  3PVL A;  5KWD A;  5KJN A;  3AS4 A;  2WVI A;  3G2S A;  3RO2 A;  4GTS A;  4C9B B;  3ZVV A;  4FLH A;  5KCM A;  4GPM A;  2WXQ A;  3B7B A;  3HXE A;  4J8E A;  1ELK A;  2I2O A;  4N3B A;  4BX8 A;  2IO2 C;  2Y0B G;  2AVP A;  1KZP A;  4UWG A;  3EUV A;  2F37 A;  3I4G A;  5ARG A;  1E90 A;  3FUI A;  1HF8 A;  4G25 A;  4APF A;  4HRN A;  2GRL A;  1NA0 A;  4JW1 A;  3UM2 A;  1UW4 B;  2EIL E;  3GZ2 A;  2MYO A;  4YDO A;  1FT1 A;  5AQB A;  1HE8 A;  2V5F A;  4WND A;  4ACK A;  3FUJ A;  2UY1 B;  4LRZ A;  1TR4 A;  1OCO E;  5CER B;  4GZ6 A;  3PZ1 A;  4CDR A;  2AXU A;  3CVU A;  3P1U A;  3SNX A;  3UIP C;  4AEZ C;  3QWP A;  3FDH A;  1IKN D;  3FWV A;  3MKR A;  3R9M A;  3B7T A;  4I43 A;  4CDN A;  3LVQ E;  3CVX A;  4CEM A;  2FBN A;  4MKT A;  3MX3 A;  5G05 J;  4KZC A;  3L22 A;  3TG5 A;  3EU9 A;  2V0P A;  1N0Q A;  2J8S D;  1YYH A;  4U7E B;  1WG0 A;  2V4L A;  1N11 A;  5AEN A;  3SY2 A;  3OXF A;  5M72 A;  2ETA A;  2KAT A;  4OVU A;  2WXG A;  4ANX A;  3SFZ A;  1TN8 A;  3AJI A;  2CG3 A;  4E85 A;  3PEU B;  3CK8 A;  3Q4A B;  5LOZ A;  4YVQ C;  4L23 A;  2XZD G;  3Q75 A;  3QK0 A;  3ASG A;  2I1K A;  4BET A;  3ULY A;  2B6C A;  5CCM A;  2VSN A;  1H0A A;  5CEC B;  2ZXW E;  4RSY A;  5JJ7 A;  2NYJ A;  4APO A;  2XHE A;  4KMO A;  4G8L A;  5BV1 A;  3MKQ A;  4O6F A;  3L6A A;  4HOT A;  2PQR A;  5FTP A;  2VTB A;  3IEG A;  4JA9 A;  1LD8 A;  1LD7 A;  3RSE G;  3L13 A;  4WAF A;  1QZ2 A;  2WMO A;  2GRP B;  2ETB A;  3ZRH A;  2GW1 A;  4DX5 D;  4G23 A;  4O1O A;  5G04 C;  4OVV A;  3CLJ A;  2H6H A;  5BUZ A;  1KT1 A;  2J07 A;  1U2V G;  2P9N G;  3B95 A;  3TL5 A;  3DST A;  1H2T C;  4E6H A;  2VSY A;  2R03 A;  2XCC A;  2BUG A;  1UJK A;  1OWP A;  5EDS A;  4N3A A;  4K5A B;  4F53 A;  2E0I A;  4KZ0 A;  2XEH A;  5CRU A;  4L2Y A;  4BT8 A;  3EHQ A;  3JXI A;  1S63 A;  4ACL A;  2DZO A;  3EHM A;  5A23 A;  3V30 A;  4Q69 A;  4JD2 G;  2OVF A;  3ML8 A;  4ANU A;  2A5E A;  2KZT A;  1K1B A;  1WDY A;  2XEE A;  4DPR A;  5ANR A;  3SI5 A;  5BV0 A;  3ASO E;  1JPL A;  2GRM A;  3CKB A;  4HS2 A;  4EQF A;  3MKQ B;  4BSX A;  4AIF A;  3LXU X;  4DI3 A;  4LUN U;  1U3C A;  4AV7 A;  5ITZ F;  3D9H A;  3ONL A;  1N4P A;  3TXN A;  4WWN A;  3TWX A;  2MHK A;  3CHO A;  4TXQ A;  1PC2 A;  4JA7 A;  2LO6 A;  2XCB A;  2WXM A;  2QYU A;  2VJ8 A;  3MYV A;  3P2B A;  2DVW A;  1Z3Y A;  4I2W A;  5FZQ A;  1OCZ E;  4L9P A;  4EPZ A;  4ANW A;  4XKB A;  1INZ A;  4TXR A;  2WXP A;  2P9U G;  3ASD A;  1SZA A;  3FFL A;  1JUQ A;  3IKO B;  3IV0 A;  4BTB A;  4JHJ A;  5ENS D;  3U4T A;  3CHQ A;  5EIL A;  1JCS A;  4OYS A;  4N39 A;  4LNB A;  4UQY A;  2OVB A;  3RK6 A;  1E8Z A;  4AM9 A;  3ZW3 A;  1KT0 A;  4GMR A;  5FJY A;  3T5X A;  4C48 B;  5C1D A;  3HVE A;  4GTQ A;  5LX8 A;  3I5P A;  1S70 B;  1FVH A;  2JAB A;  1WAO 1;  1FVF A;  2OCC E;  3CK7 A;  3CHP A;  5CMW A;  4ILH B;  3PZ2 A;  1YMP A;  3MJW A;  1QBQ A;  4I2Z A;  4B89 A;  4XEI G;  5KJL A;  3LVR E;  1Y8M A;  4G1T A;  3G2U A;  3U9W A;  3UM3 A;  5ENR D;  3D9M A;  1E7V A;  1A17 A;  1UOH A;  5FIN A;  2P9K G;  3S2A A;  3FUE A;  5A6C A;  1TJF A;  3FTU A;  2LNI A;  3MV3 B;  3CR3 A;  5J90 A;  3EJN A;  3QKY A;  2ZIS A;  3EU5 A;  4DJA A;  3FUF A;  1A5E A;  1KPS B;  2OV8 A;  4I6J A;  2ETC A;  3BG1 B;  3PZ3 A;  3HXD A;  2ILR A;  3J5P A;  4GAA A;  4G24 A;  4ILG A;  3PRE A;  5B3S E;  2H6I A;  4OAV B;  3UIO C;  3B7U X;  4BWR A;  5JMN D;  1N52 A;  2KZT B;  1BU9 A;  1TN6 A;  4KVM A;  2J4B A;  2XGO A;  4MLP A;  3ULE G;  3ZNG A;  4FP7 A;  3JQ1 A;  1BLX B;  2XPY A;  3QWW A;  2P9L G;  1BD8 A;  1SA5 A;  4CZ2 D;  1HZ4 A;  4G2V A;  2M63 A;  4UQX A;  3DPY A;  4I1O B;  2VGY A;  4LEU A;  4F3V A;  2WXN A;  3B7S A;  3HXC A;  4I1A A;  4ZHB A;  4HOR A;  2YNQ A;  2BKK B;  1NA3 A;  5D0O D;  3Q9N C;  3C3R A;  2F8X K;  4HOU A;  1HXI A;  2ION A;  2QY7 A;  4ZFH A;  3URZ A;  1OWM A;  3FUN A;  2P9I G;  3R7R A;  2WXR A;  3ZYQ A;  3RRM B;  4GA2 A;  1S64 A;  4I6G A;  2GRN B;  4BEP A;  3CST A;  1TNB A;  4RLY A;  4BER A;  4KYO B;  3UTM A;  1SA4 A;  1BPO A;  1PY1 A;  1G3N B;  1TN7 A;  4DRX E;  5AIJ A;  5CCL A;  3NZS A;  3FY4 A;  1N94 A;  4LG6 A;  3LS8 A;  3FP3 A;  2RG8 A;  4EZL A;  3SHF A;  4MBG A;  5FQ4 A;  1V55 E;  3UI2 A;  4YDY A;  4MRU A;  1E8Y A;  5KJK A;  4EZK A;  3HXF A;  4J8Y A;  2WXJ A;  3SGH A;  4DUI A;  1OXJ A;  1QYM A;  1H6K A;  1MYO A;  3S7D A;  2VGX B;  4AP2 A;  1DVP A;  4A3T A;  3KEA A;  5LCW C;  3DXM G;  3O48 A;  4U8V D;  4B8A A;  1IHG A;  5ENO D;  2FEZ A;  4FAD A;  2WXH A;  4FLB A;  3V31 A;  4J8S A;  4UWK A;  2RD0 A;  4F6R D;  2R5S A;  4BTA A;  3BEE A;  1RW2 A;  1S0P A;  4HI9 A;  2IOL A;  2FI7 A;  2WQH A;  2RFM A;  1QQE A;  4Z68 A;  1O5M A;  4JL0 A;  1TNY A;  4BY6 A;  3L08 A;  1UN8 A;  3ZXS A;  3MZL B;  2LSV A;  4N2Q A;  3E34 A;  2WPV A;  1N4Q A;  2KC7 A;  1GW6 A;  3LJ3 A;  2CFZ A;  3I3N A;  4N5C A;  3UPV A;  3APD A;  1DCE A;  3HVE B;  4HB5 A;  3R9A B;  4U8Y D;  3ZHE A;  5C2Y A;  2YQ8 A;  3ZPJ A;  1EPU A;  1Q2Z A;  1O1R A;  1KZO A;  1ZBP A;  4FC8 A;  3NF1 A;  3CSF A;  4L2L A;  2EIJ E;  3AG1 E;  3G2T A;  4U63 A;  2QC9 A;  3UIN C;  2I1J A;  4JHK A;  1HG2 A;  2WM9 A;  5T8I A;  3FH7 A;  4LSZ E;  5HS0 A;  4B8C B;  2A5U A;  2P9S G;  2HR2 A;  4YVO A;  2WXI A;  3PH0 C;  5EYL A;  4HVB A;  1ZU2 A;  4Q94 A;  4U07 A;  3TWS A;  4NQ0 A;  4PDX A;  2MRI A;  2Y4U A;  4RQI A;  4PS3 A;  2GRR B;  3ZIM A;  3RIB A;  4AXH A;  5AN8 A;  3JCK C;  3UQ3 A;  4GCN A;  3ZYK A;  4GYW A;  3JXJ A;  4GCO A;  2X6F A;  1OWO A;  5CMY A;  3UKR G;  3JUE A;  2XGS A;  5JA4 D;  1TJC A;  5IY5 E;  2Y1L E;  3MEK A;  2KCV A;  4GML A;  3HXB A;  3FH8 A;  3ISM C;  2QFC A;  4F7A A;  3RRN B;  2LXM A;  1Z5S C;  3ESK A;  3AU5 A;  4BES A;  2EIN E;  3QJZ A;  4G8K A;  4U95 D;  4HRL A;  4GA1 A;  4C0M A;  4LNG A;  1P5Q A;  4WNG A;  2RFA A;  2KCL A;  3S7B A;  5HQ8 A;  4A55 A;  3DSS A;  5E75 A;  3D3M A;  4A63 B;  3PDN A;  2IO3 C;  4HLE A;  5JJT A;  2WQ7 A;  4I9C A;  3PZD A;  1IHB A;  3L9T A;  4H7X A;  5G05 C;  5EKQ D;  5AAR A;  2IY0 C;  4UI9 J;  2J49 A;  3Q49 B;  4D10 C;  3VLE A;  5ARF A;  3CKC A;  3CVQ A;  3PE3 A;  3QNK A;  2PNN A;  3SBS A;  5JHB A;  4A1G A;  3FTY A;  3SF4 A;  3Q15 A;  4MS6 A;  2IF4 A;  3FH5 A;  1NL4 A;  2CHZ A;  4QQI A;  1OWN A;  4UUC A;  5EYP F;  1IQU A;  4PS7 A;  2HM8 A;  1UJJ A;  3EHR A;  3FTS A;  5FWQ A;  3LCA A;  2L0I A;  4EZJ A;  3DEO A;  3TWQ A;  2OEV A;  2LUH A;  4DI4 A;  1YA0 A;  3CHR A;  1JCQ A;  1BI7 B;  5KBA A;  3L16 A;  3KS2 A;  3C3Q A;  4JC8 A;  3CGH A;  3CVN A;  4JVS A;  4EHM A;  3EIQ C;  2NSZ A;  3SO8 A;  4M3O A;  4GZD A;  2DYR E;  1K1A A;  4TUU A;  2NXP A;  2V4H C;  3S7J A;  4RVB A;  3VTY A;  3CVV A;  4L1B A;  3LPZ A;  3RJV A;  3ZEF A;  2WXF A;  2FF4 A;  2FO7 A;  4A1S A;  3T5V A;  4GTM A;  4BSZ B;  1HX8 A;  5CBN A;  1HFA A;  3CV0 A;  2LAH A;  5D66 A;  4V3I A;  5KNH D;  2L6J A;  3QDN A;  4URK A;  2LAI A;  4UI9 K;  4LCT A;  3K9I A;  5JJ6 A;  3B7R L;  2XS1 A;  3GZ1 A;  1K8K G;  3E37 A;  2HE0 A;  2EIK E;  5CRV A;  4ME2 A;  1DC2 A;  1H6P A;  1L5J A;  4U0Z A;  3ZXP A;  5FT9 A;  3NOC D;  4NRH B;  2WQ6 A;  1W3B A;  3QWV A;  4GPK A;  3KSL A;  4OAU C;  3FUM A;  4JZY A;  3CHM A;  2X3M A;  3NZU A;  4KXK B;  5FZS A;  3KSQ A;  5DIZ A;  1IQR A;  2B0O E;  3MCX A;  2PZI A;  4FU3 A;  3E30 A;  2E2E A;  4EBA G;  1AP7 A;  2C2L A;  3DSW A;  3ZGQ A;  5EX0 A;  2R2L A;  5AQ7 A;  4N5Q A;  1MX6 A;  2V5Q C;  1N0R A;  3EHN A;  3FEY A;  1XGW A;  2AWI A;  3D9I A;  3E33 A;  3DPD A;  5ENT D;  2WXO A;  4O1P A;  1Y6I A;  4HI8 A;  4GA0 A;  1OCC E;  2XZT G;  3AAA C;  2XRY A;  3HG0 D;  1AWC B;  2KCK A;  3B13 A;  3MA5 A;  5LP0 A;  3GW4 A;  5E76 A;  4XI0 A;  4HOS A;  3QAR A;  5T4Y A;  5HRY A;  3RKV A;  2JEK A;  2KBX A;  4N2S A;  4J6I A;  4DX1 A;  3HIZ A;  3E4B A;  4BX9 A;  4A3V A;  3CVY A;  4W9R A;  2JLB A;  2HYZ A;  4JXT A;  1N95 A;  4I9E A;  3SFY A;  2UWJ G;  1O1T A;  3ML9 A;  1UN9 A;  1VDY A;  3AU4 A;  3DRA A;  4M7C A;  1MJ0 A;  2GRO B;  3EDT B;  2V8S E;  4HQD A;  3LEW A;  5EIB E;  5J08 A;  3SD5 A;  2X6K A;  2MOW A;  3ABK E;  3W9G A;  1FPP A;  3T9K A;  1V54 E;  5BNW A;  1TNZ A;  3NQP A;  3QC1 A;  3LYA A;  2X6I A;  2VYI A;  3EIJ A;  1QNF A;  2BF0 X;  3RO3 A;  1UG3 A;  2UY1 A;  2Q7F A;  4K03 A;  3NBN B;  4IUL A;  1TYQ G;  4UWF A;  1Z6T A;  2FO1 E;  2AJA A;  4O60 A;  1WY6 A;  3N71 A;  4LNU D;  1DCQ A;  4F1S A;  1BI8 B;  2KM4 A;  4GB9 A;  4RG6 A;  4ILI A;  2YIN A;  2NC9 A;  2CHW A;  3UXG A;  2AW6 A;  3V2O A;  2IEJ A;  3CVP A;  4UWL A;  2X6J A;  1SVX A;  5DBK A;  2I6H A;  2OEW A;  4GU5 A;  3GZS A;  3QAQ A;  3PNL B;  3T8M A;  5ENN A;  3FU5 A;  3CK9 A;  3VTX A;  2A4Z A;  3RAU A;  2GGF A;  1DNP A;  2P9P G;  2XPI A;  3CEQ A;  1OWL A;  5CEA A;  1U3D A;  3SQV A;  4GYO A;  1TEZ A;  2DIW A;  4C0E A;  3AG2 E;  1TNU A;  4AVX A;  1EDU A;  1O1S A;  2CG2 A;  3D9K A;  3D9L A;  2PM7 A;  3UMV A;  1H6O A;  3KAE A;  1OY3 D;  3ZYM A;  2ZU6 B;  3OAW A;  4AJW A;  3IXE A;  5AAO A;  4PH4 B;  4QFV A;  3DBS A;  2R17 C;  1EYH A;  2BED A;  1MX2 A;  2IQC A;  2XEN A;  4NIK A;  3D9O A;  3ONK A;  3IBE A;  4NUR A;  3APF A;  3LY8 A;  4GTV A;  4EEC A;  3Q5M A;  5AQA A;  4FUL A;  3DSV A;  2C0L A;  2XGM A;  4I1M A;  4WNF A;  3TAX A;  4U8H A;  1FCH A;  2R59 A;  3UT8 A;  5FQ6 A;  2VGX A;  5EN5 D;  3V79 K;  3Q73 A;  4XE0 A;  3Q79 A;  1LTX A;  3T8K A;  4YDW A;  2AXZ A;  1X5B A;  3L54 A;  4Q96 A;  2WMN A;  3LDZ A;  5BPP A;  4FHJ A;  2PQN A;  3R7Q A;  3QB2 A;  3AS5 A;  3C98 A;  4CDM A;  4HXI A;  4WNE A;  4U96 D;  5BW8 C;  4B94 A;  1B89 A;  3SZ7 A;  3D9N A;  2QZA A;  2EQX A;  3LJN A;  1KLX A;  3UX4 A;  3RU0 A;  4PS8 A;  4FA6 A;  4J0U A;  3PEV B;  1MX4 A;  3JYS A;  3O4Z A;  3JQ0 A;  4AY5 A;  2P2C P;  3FUH A;  4CCA A;  1HH8 A;  4WUY A;  3ZUV B;  4ABN A;  4CT0 A;  4HFG A;  1MHQ A;  3ZU7 B;  2H6G A;  3C3O A;  2WXK A;  3Q78 A;  5B1B E; 
#chains in the Genus database with same CATH homology
 2ZIS A;  3EU5 A;  2H6H A;  3DSW A;  1JCQ A;  1TNB A;  3E34 A;  1N4Q A;  2R2L A;  1SA4 A;  3DST A;  3PZ3 A;  1D8E A;  1TN7 A;  3HXD A;  3Q7F A;  4GTV A;  1FT2 A;  3DSU A;  4EHM A;  3HXB A;  3E33 A;  3DSV A;  4GTR A;  1MZC A;  1JCR A;  3C72 A;  1N94 A;  2H6I A;  1DCE A;  1NI1 A;  2F0Y A;  1JCS A;  4LNB A;  1TN6 A;  1S63 A;  2IEJ A;  3Q73 A;  3Q79 A;  4GTO A;  1O1R A;  1TN8 A;  4MBG A;  1LTX A;  3SFX A;  3Q7A A;  4GTS A;  1KZO A;  1N9A A;  4LNG A;  4GTM A;  3DSS A;  3HXF A;  1SA5 A;  1X81 A;  3E32 A;  3DPY A;  2ZIR A;  4GTQ A;  3Q75 A;  3HXE A;  1D8D A;  4GTP A;  3HXC A;  1KZP A;  3E37 A;  1N95 A;  3EUV A;  4GTT A;  3SFY A;  3PZ2 A;  1QBQ A;  1TNU A;  4L9P A;  1O1T A;  3DSX A;  4YDE A;  1O1S A;  3DRA A;  1S64 A;  4YDO A;  1FT1 A;  1N4P A;  3PZ4 A;  3KSL A;  1NL4 A;  2H6F A;  1N4R A;  1LD8 A;  1LD7 A;  1FPP A;  3KSQ A;  1TNZ A;  3PZ1 A;  1N4S A;  3E30 A;  1O5M A;  1TNY A;  1TNO A;  2H6G A;  3Q78 A;  2BED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...