1TNUA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
314
structure length
314
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 130
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnuA00
1N94A 4MBGA 2IEJA 3Q78A 1TN6A 1JCRA 1FPPA 4EHMA 1FT2A 1MZCA 1TN7A 1TN8A 1TNYA 1TNUA 2ZISA 2H6HA 3HXFA 1QBQA 4GTMA 1DCEA 3PZ3A 4GTQA 1S63A 1LD7A 3DSUA 3DSSA 3DSWA 3C72A 3DSTA 1D8EA 1SA5A 1N4PA 2R2LA 3Q7AA 3PZ4A 3HXBA 1D8DA 3DSVA 2ZIRA 3E30A 1KZOA 1TNOA 2H6IA 4LNGA 3HXDA 3DPYA 1FT1A 3E32A 4GTOA 3KSQA 1X81A 4L9PA 1TNZA 3SFYA 1LD8A 3Q7FA 3EUVA 1KZPA 4GTVA 1SA4A 3HXEA 3E33A 4YDEA 1S64A 3KSLA 4LNBA 1TNBA 4GTPA 1O1TA 3Q79A 1NL4A 1JCSA 3PZ1A 4GTRA 1N95A 3E37A 1LTXA 4YDOA 1N4RA 3SFXA 2H6FA 3E34A 1O5MA 4GTTA 1O1RA 1JCQA 3EU5A 1O1SA 2F0YA 3Q73A 4GTSA 2BEDA 3PZ2A 2H6GA 1NI1A 1N4QA 3DSXA 3HXCA 3DRAA 3Q75A 1N4SA 1N9AA
chains in the Genus database with same CATH superfamily
3NZUA 4UWGA 3GZSA 4YVOA 3T5VA 2OCCE 4WNEA 5J90A 2IOLA 3AJIA 2DZOA 4ACLA 4N2QA 4EBAG 1YCSB 2HM8A 1UN8A 3LVQE 5KNHD 4AM9A 2ILRA 3FH8A 3DWLG 4CDMA 3NBNB 3UMVA 3FTXA 1BD8A 2VSNA 4GYOA 4APOA 3IEGA 5AQ7A 3D9NA 2ONDA 2V8SE 4MKTA 3HHMA 2WVIA 4GTVA 5JJ7A 1BI7B 2MRIA 1D9SA 5CBOA 5BT1A 4ANVA 1E8ZA 3G2VA 4JB8P 5BXUA 1HF8A 4UI9C 4NQ0A 2KXPC 2P58C 4TV3A 3TG5A 1OXJA 3C98A 1HH8A 2X6FA 2VGEA 4G23A 4UWFA 2HE0A 2ZXWE 4F1SA 3C5RA 2WXOA 3SHFA 5JMND 4APFA 3QOUA 2P9PG 3DSXA 4TXPA 3Q75A 4K0RA 2EIKE 4JL0A 4L23A 2VGYA 4L7TA 3ZVVA 1TN7A 4A63B 5C2YA 2FULA 3C3RA 3FU6A 3RRNB 4MLPA 4N5CA 1H6PA 2IF4A 1FVHA 2WXFA 2RD0A 3EIJA 4JVSA 4DLOA 2VGXA 3DSSA 2J09A 4KBQA 5LCWJ 4IN3B 5G04J 2XZTG 1HO8A 2RFAA 4F53A 1OUVA 4J8SA 4ILIA 3C3OA 3TXNA 4KT6B 1IXVA 3NOCD 2R17C 2GGFA 4KZ0A 4HQDA 2OEVA 4XZ4A 2P9SG 3HIZA 2KBXA 3SBSA 5EX3A 2XEEA 1NA3A 3U4TA 4U63A 3PE4A 1UJKA 3HVEA 2Y4UA 1HX8A 1JCSA 2VQ2A 2WXNA 4K5BA 5D0OD 3IHYA 3CKCA 5ENNA 3L6AA 5HS0A 1KPSB 4TUUA 2BTDA 4GMRA 2BEDA 4DK5A 3FUHA 1SVXA 3FH7A 1JWFA 1N4QA 1N4SA 1OWLA 4JEUA 3Q47B 2IEJA 1QQEA 2A4ZA 3V2XA 1RW2A 5ENSD 1TN8A 3CSTA 3HXFA 3S2AA 2BKKB 3N71A 3ASFA 4UQYA 2KZTA 2B0OE 4LERA 2WXIA 1BPOA 3DSTA 1BI8B 2J07A 2BF0X 4XE0A 4AVXA 5BNWA 3VTXA 1X81A 3KEAA 3W9FA 3EHNA 5D2MC 1KZPA 3ZUVB 4K5CA 4CYMD 5KWDA 5ANLA 1V55E 4GZCA 5ENQD 2YNQA 1K3ZD 2DBAA 3T9KA 2ZU6B 3V31A 1ELRA 3O4ZA 1NL4A 4G8KA 4Z68A 5FQ6A 3EJNA 4UWKA 1N4RA 2AWIA 3ZFWA 2WQ6A 3OTNA 2EILE 3E34A 1BLXB 5D66A 1O1SA 3JCKC 4A1GA 4GAAA 4U07A 4LUNU 3V79K 3LS8A 1S70B 4HBDA 1TJFA 3UM1A 3ZW3A 1A5EA 1KT0A 1JWGA 3RKVA 4N3AA 1SQMA 3S7BA 5FT9A 5ENRD 5BV1A 1TR4A 1PY1A 2AJAA 2F37A 1FPPA 4LG6A 2YHCA 2NSZA 3R7RA 2R5SA 2Y69E 3ZEFA 2ZISA 3FEYA 5AARA 1E8XA 1IQUA 4BT9A 4I1MA 1HE8A 3S7JA 3QKYA 4HLEA 3C72A 4BX9A 3PZ4A 4O6FA 2LAHA 3I4GA 5H7PA 3L22A 1HFAA 1SW6A 1OCRE 3RIBA 3I4RB 1LD8A 2J49A 2Y0BG 2LO6A 4ZHBA 2J9QA 2XCCA 3S7FA 3MA5A 3EIQC 2AXZA 3FUMA 4XKCA 3I3NA 1DNPA 1H19A 3FTVA 2FO1E 3TG4A 4G8LA 4G1TA 3TL5A 1ELWA 4GPMA 4UUCA 4K5AB 4QQIA 3ZHEB 5HQ8A 1O5MA 3IHVA 3Q73A 3UT8A 3CHQA 5AQAA 1EYHA 3CHRA 2IO2C 2XPYA 2GRQB 2ETBA 2RKKA 3Q15A 1TN6A 1UG3A 3BG0B 5LOZA 1IHBA 3B7UX 1QZ2A 3EHMA 3LCAA 3LPZA 2RFMA 3G2WA 3UQ3A 1MQSA 4Y6CA 3D9LA 4Q69A 5T3RA 2KCLA 3DXKG 2X6IA 3Q9NC 3SBTB 4FLHA 1IYGA 3FUJA 4KVOA 3TWQA 4KZCA 4AIFA 2J4BA 4GYWA 2CHXA 4U0UA 5EDSA 4HRMB 4PH4B 1OT8A 4TXQA 4G2VA 4I9EA 4UWHA 3ZXPA 5CEDB 3PZDA 1TYQG 3DPDA 3JUIA 3PNLB 5T4YA 4JPSA 3HXDA 2E0IA 4LSZE 4ANXA 4L9PA 2MYOA 2FF4A 4HI8A 4JD2G 2L9BA 4DRXE 4AY5A 3SF4A 1ZBPA 2M63A 4X8QA 4KMOA 3JXIA 3NAWA 4CGWA 3EU9A 3OAWA 3TXMA 3QJZA 3BUAA 5FINA 4DUIA 2PL2A 1JPLA 1MX4A 3AAAC 3HYMB 3TGOA 4HFGA 4H7XA 3SGHA 4J8EA 1N95A 2P9NG 3ULEG 3FHEA 3UX4A 3B13A 1S0PA 4CT0A 3ENEA 5G05J 3LDZA 3KAEA 4CZ2D 4BERA 3RRUA 3ZNGA 3CK8A 4KYOB 1N11A 2IONA 4A1SA 4GA0A 1HG5A 3U9WA 1N0RA 3EHQA 5A7DB 2PM6A 4JHRA 5KCMA 1JCRA 4UWLA 4KXKB 1WAO1 4HOQA 3UT7A 2I6HA 4DX6D 4R7LA 3ABME 2VJ8A 2VSYA 2E2EA 5FQ7A 5FIOA 5FTPA 2DZNA 2R2LA 2WXHA 4XKBA 3VLEA 3K9IA 2XS8A 1E8WA 1KLXA 4PDXA 4EECA 1FT1A 3URZA 2FO7A 1H2VC 4M3OA 2F8XK 2WMNA 5CCMA 2L6JA 2VGXB 4P29A 5CCLA 5LCWC 4J8FA 2NYJA 1TNBA 3MKQA 2WB2A 3T8MA 2JEKA 4F6RD 2CFZA 4RG9A 5AYWD 3PEVB 4N39A 2PZIA 5CEAA 2WXMA 4Y6WA 4I6GA 4NIKA 2YHEA 3LVRE 2C0LA 4OVVA 2V5QC 4BESA 3B7TA 4U8HA 1ZB1A 2R05A 1O1RA 3VLFA 4CT4A 4XX5A 4F7AA 1OCCE 4UQXA 1SZAA 4L2LA 5AN8A 3RAUA 2KC7A 3IXEA 3LJNA 3FULA 3MZLB 4GCNA 3WXXA 5FQ8A 3TWWA 3CKBA 5FQ4A 3TJPA 4HLLA 5LP0A 4IULA 1XGWA 2KATA 4ZFHA 3KEZA 3D9KA 2LSUA 1FT2A 2DIWA 1MZCA 3PS6A 2J4DA 4C9BB 5IY5E 4WNFA 4I1AA 2H6HA 4GMJA 3EHRA 3G2SA 3ASHA 2L0IA 3BQOA 1LD7A 1L5JA 4AY6A 3JXJA 3D9HA 3QWPA 3U3WA 4ILGA 4I2WA 4EZKA 2V0PA 3ESLA 5EX0A 3DBSA 3APFA 1DC2A 3B7RL 5AQBA 3KD7A 4I17A 3CHPA 2KZTB 4YDEA 1QYMA 1MJ0A 4UQZA 3ML9A 3LJ3A 2P9IG 5CRVA 3ABLE 4RLYA 3ML8A 4YDWA 2ETCA 3FP3A 4MRUA 2WXJA 4RQIA 5BUZA 3PRZA 1OWMA 4ANWA 2VTBB 3PDNA 4GZ3A 3CHOA 2WXGA 1LF8A 3UKUG 3GZ2A 3CVPA 4LNUD 3LY8A 3FY4A 3P1UA 4TUMA 3SY2A 3APDA 4LCTA 2FEZA 1B89A 2XRYA 4UI9K 3Q5MA 2WM9A 2VSOE 3UTMA 2XGMA 5KJNA 4K03A 4F3VA 1S63A 3NB2A 3DSUA 1NZNA 2X6KA 2GRMA 3ONLA 5EYPF 4AV7A 2HR2A 4CDRA 4RG6A 5C1DA 3S7DA 2PQRA 4LNGA 1QNFA 2V4HC 5JJTA 3AU4A 3SD5A 2YQ8A 4A55A 4PUCA 4U8YD 1P5QA 2QFCA 3B95A 3ESKA 3R7QA 3CQGB 4HOUA 2Q7FA 4BY6A 1FCHA 3FTYA 2KCVA 4CGVA 4GZ5A 4FA6A 2R03A 1O1TA 3VLDA 1NA0A 3PEUB 5JJ6A 1YYHA 2NC9A 3LXUX 2Y3AA 1UN9A 4AJWA 2ZGGA 2XRZA 2EINE 4AOFA 2WMOA 4W9RA 2H6FA 5AQ9A 3TAXA 5EN5D 4YDYA 2QC9A 5CECB 5EILA 2ZGDA 2GRNB 4U0SA 3UIOC 2UWJG 1OCOE 2I1JA 1H0AA 1N9AA 3AG4E 5EYLA 3FUEA 2DYRE 5JHBA 1VDYA 4KVMA 1TNYA 3LYAA 3TWTA 4B0ZA 4OYSA 3UIPC 4DX5D 3HRAA 1DCEA 2HYZA 2WXPA 2UY1B 1PC2A 1UOHA 2AXVA 5ARGA 2XPIA 1E96B 3AG1E 4AEZC 4FHJA 1WM5A 4NURA 4BT8A 2QYJA 5B1AE 3RU0A 3SFYA 2QY7A 3VTYA 4N3BA 3CV0A 3E33A 3L08A 3PREA 1S64A 3PNTB 1U3DA 4YVQC 2JLBA 4TXRA 3OXFA 3PUKA 2PQNA 5AAOA 3FUDA 4FJYA 2IFUA 4TRQA 3G2UA 1OWOA 3ASDA 3J5QB 1AP7A 2GRPB 2WXKA 4BFRA 1IQRA 3EU5A 4JA9A 5EIDA 4ACKA 3PH0C 5A23A 2L0TB 5BXOA 4J8YA 4DJAA 3WG7E 4HORA 4AP2A 3CQCB 3HXCA 1DVPA 2PM7A 1E7UA 3B7BA 2Y1LE 4I9CA 5JA4D 3GW4A 3V30A 4DX2A 5G55A 4I6EA 3LY7A 4EBAA 4BX8A 4O1PA 5G05C 4ILHB 2CFUA 3NOGD 1QBQA 4GTMA 3RO2A 4GZDA 4OVUA 2BKGA 5EKQD 3PZ3A 4GTQA 5KJLA 2P2CP 1WDYA 1D8EA 1N4PA 2VSXE 2DYSE 2ZIRA 3FU0A 1KZOA 2XEVA 4FP7A 3EDTB 5FZQA 2B6CA 5DBKA 4BETA 5KJMA 4U0ZA 2FI7A 4GMLA 3CVUA 1K8KG 4MS6A 3ZYKA 4D10C 2HO1A 2QZAA 5FZSA 3HXEA 3MYVA 3Q4AB 4HS2A 4ATZD 4PS3A 2CG3A 2P9UG 1MX6A 1GW6A 3LY9A 3KSLA 4WWNA 2L6BA 2OOEA 3T5XA 1OWNA 1MYOA 2XENA 3D3MA 3DEPA 3ONKA 2C0MA 3E37A 5CHEE 4E6HA 5M72A 3IKOB 3CHSA 4L2YA 2XS1A 1OY3D 4JHKA 4XI0A 1H2TC 4HXIA 3SZ7A 4C48B 3OXGA 3CVVA 4GA1A 1NI1A 3RSEG 4JC8A 2IOSA 3NZSA 4U04A 4HOTA 3Q78A 3MGBA 4CDNA 1H6KA 5D0QD 3ZYMA 2OV8A 1TNUA 4JA7A 3KS2A 5FZRA 1HU3A 1W3BA 3ZHEA 2J8SD 4QFVA 4GYYA 3RK6A 3DSVA 3UM0A 3W9GA 1FVFA 3L17A 4U8VD 3JQ1A 4URKA 1JUQA 4DX7D 3SO8A 1XNFA 3IV0A 1A17A 3SFZA 3CHMA 1N54A 2LUHA 5KNGA 1Q2ZA 1IKND 3TWUA 3B7SA 1U3CA 3U66A 3HDXA 3T8KA 3D9OA 1N0QA 4XIFA 3FU5A 4H7YA 4B94A 5CMYA 3DEOA 2EQXA 3ULQA 4G11A 2XEHA 2Y4TA 3L16A 1K1AA 5G04C 2IO3C 4GCOA 3ASOE 5LX8A 4IYPA 4I1OB 4C0MA 5DIZA 4GA2A 4JZYA 3C3QA 1Z3XA 2QYUA 3FUFA 2X38A 2WXQA 2FBNA 3ZU7B 2H6GA 2ETAA 3L54A 3D9MA 2P9LG 4XEIG 2RG8A 4HVBA 1HG2A 4O1OA 3CIAA 3QWVA 3J5PA 4DX1A 3MCXA 1DCQA 4B8CB 3FWVA 2X6JA 1YA0A 3HVEB 4G25A 3CVXA 1RZ4A 3BG1B 3Q49B 3ZXSA 4G24A 5EIBE 3ULYA 1IHGA 1EPUA 3Q7AA 3PE3A 3GYZA 4LEUA 4WNGA 2A5UA 2P9KG 2V4LA 2CG2A 3DPYA 3UINC 4B93B 4GTOA 3NQPA 4J8DA 1G3NB 2XHEA 4NACA 3UKRG 4AXHA 3AS5A 3AG3E 1SA4A 3CVYA 4A3TA 1UJJA 2IY0C 3BU8A 1PAQA 1Z3YA 2F8YA 3QWWA 4GTRA 1AWCB 3CR3A 3UUXA 1INZA 3ASNE 2MHKA 4HB5A 3SNXA 3G2TA 3AU5A 3GZ1A 1Z6TA 2CHZA 2XCBA 2F0YA 4FULA 1H6OA 4WWPA 4FHKA 3PZ2A 4JW1A 2WPVA 3UPVA 4E85A 3FTWA 4DI3A 3NF1A 3JQ0A 3F6QA 4HI9A 3MEKA 4GU5A 1N94A 1HZ4A 2GW1A 2CHWA 4G26A 2GROB 2OVBA 2X3MA 4CRWA 4V3IA 4U95D 5BV0A 3V2OA 1SA5A 1D8DA 2MOWA 3ZPJA 5LFAA 4HOSA 2V5FA 1KT1A 3SQVA 4BTAA 2LXMA 2IJGX 5KBAA 4YNDA 1OCZE 4NRHB 3L9TA 2DCPA 2VYIA 4ANUA 4UI9J 2LNIA 1Y6IA 2I1KA 4JXTA 1Z5SC 2BUGA 4FLBA 4HRLA 3ZKJA 3E4BA 3ZYQA 4Q96A 4U96D 5CERB 4GTPA 4ABNA 1TEZA 4N5QA 4PS7A 3FTSA 3FUIA 5ENPD 3PZ1A 4I2ZA 4GPKA 5B1BE 1SZ9A 3CK7A 3ABKE 3PUJA 3QDNA 5AJDA 2JABA 4M7CA 3CLJA 4BWRA 3UI2A 3MV2B 2EIJE 4J7WA 5FJYA 2WXLA 5CRUA 3L13A 2A5EA 3U64A 1H2UA 5ITZF 1BU9A 3CEQA 3DRAA 4OAUC 4FU3A 5JHAA 2LSVA 3FDHA 5CMWA 5BW8C 4EHMA 3BEEA 4O60A 3ZRHA 3O48A 3UM3A 2NXPA 3FEXA 3MJWA 1EF1C 2VTBA 1NP7A 1K1BA 4L1BA 1ELKA 4J6IA 3HXBA 1TNOA 3APCA 3QARA 3ASGA 2AW6A 3Q7FA 5CBNA 4DI4A 2KM4A 3UXGA 1OWPA 4GZ6A 4JEHA 3D9PA 5AJLA 3QAQA 1HS6A 3QC1A 4LRZA 1E7VA 4ME2A 1YMPA 4ATGA 3AS4A 4HRNA 2DVWA 3FUKA 3SFXA 3D9IA 4GTTA 3IBEA 1JCQA 4BEPA 4N2SA 1WG0A 3R9MA 4WWOA 3HG0D 2PNNA 3LEWA 3FFLA 3ZIMA 4HNAD 2LXLA 3FTZA 1U2VG 4MBGA 2R02A 2XGSA 4A3VA 2R59A 5ARFA 3CVQA 4B8AA 3FUNA 1E90A 5G2NA 3CSFA 3DSWA 3ZN3A 5T8IA 3E30A 4DLQA 4I6JA 3E32A 3KSQA 3LKUA 4BSXA 5AIJA 1TNZA 3EUVA 4N3CA 1E8YA 3D9JA 3JUEA 2I2OA 3DXMG 4WNDA 3JYSA 1TJCA 3FTUA 2XQ0A 4C0EA 4FC8A 3RO3A 4FADA 3Q79A 3MKRA 4JHJA 2GRRB 3RRMB 4OAVB 3CVLA 3X2QE 2UY1A 2WQ7A 2LAIA 2AXUA 4CCAA 2IQCA 3CVWA 2GRLA 4YDOA 3TWVA 5BPPA 2XGOA 5B3SE 3Q9UC 5J08A 4BSZB 3P2BA 4GTSA 4J0UA 3TWXA 2WQHA 4WUYA 5ENTD 1ZU2A 4PS8A 2OEWA 4I43A 4U7EB 3TWRA 4B89A 5E75A 3CVNA 3MX3A 3MKQB 3FU3A 4CEMA 3I5PA 3OXLA 3ZYLA 5HRYA 5A6CA 4RVBA 5E76A 2EIME 5HKPA 4EQFA 2X6HA 2WXRA 4FJZA 2H6IA 4GB9A 3ISMC 4XI9A 2XZDG 2AVPA 5FWQA 5ANRA 1N52A 3TWSA 2DWZA 1WY6A 4WAFA 3QK0A 3RJVA 3AG2E 3AS8A 3MV3B 1V54E 2OVFA 4LNBA 1MHQA 4EZJA 4IRUA 4RSYA 5HI7A 4EZLA 1UW4B 4EPZA 1HXIA 3CK9A 2J08A 3QB2A 4F1PA 3L82A 3SI5A 1Y8MA 1EDUA 1LTXA 3UM2A 4DPRA 3FH5A 3PVLA 3ZGQA 4BTBA 3UT4A 2C2LA 2I9CA 5ENOD 3QNKA 1MX2A 1X5BA 5AENA 5KJKA 2IU1A 4Q94A 3R9AB 2YINA 2KCKA 1NFIE 2XPZA 3CGHA
chains in the Genus database with same CATH topology
1N94A 4MBGA 2IEJA 3Q78A 1TN6A 1JCRA 1FPPA 4EHMA 1FT2A 1MZCA 1TN7A 1TN8A 1TNYA 1TNUA 2ZISA 2H6HA 3HXFA 1QBQA 4GTMA 1DCEA 3PZ3A 4GTQA 1S63A 1LD7A 3DSUA 3DSSA 3DSWA 3C72A 3DSTA 1D8EA 1SA5A 1N4PA 2R2LA 3Q7AA 3PZ4A 3HXBA 1D8DA 3DSVA 2ZIRA 3E30A 1KZOA 1TNOA 2H6IA 4LNGA 3HXDA 3DPYA 1FT1A 3E32A 4GTOA 3KSQA 1X81A 4L9PA 1TNZA 3SFYA 1LD8A 3Q7FA 3EUVA 1KZPA 4GTVA 1SA4A 3HXEA 3E33A 4YDEA 1S64A 3KSLA 4LNBA 1TNBA 4GTPA 1O1TA 3Q79A 1NL4A 1JCSA 3PZ1A 4GTRA 1N95A 3E37A 1LTXA 4YDOA 1N4RA 3SFXA 2H6FA 3E34A 1O5MA 4GTTA 1O1RA 1JCQA 3EU5A 1O1SA 2F0YA 3Q73A 4GTSA 2BEDA 3PZ2A 2H6GA 1NI1A 1N4QA 3DSXA 3HXCA 3DRAA 3Q75A 1N4SA 1N9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N94 A;  4MBG A;  2IEJ A;  3Q78 A;  1TN6 A;  1JCR A;  1FPP A;  4EHM A;  1FT2 A;  1MZC A;  1TN7 A;  1TN8 A;  1TNY A;  1TNU A;  2ZIS A;  2H6H A;  3HXF A;  1QBQ A;  4GTM A;  1DCE A;  3PZ3 A;  4GTQ A;  1S63 A;  1LD7 A;  3DSU A;  3DSS A;  3DSW A;  3C72 A;  3DST A;  1D8E A;  1SA5 A;  1N4P A;  2R2L A;  3Q7A A;  3PZ4 A;  3HXB A;  1D8D A;  3DSV A;  2ZIR A;  3E30 A;  1KZO A;  1TNO A;  2H6I A;  4LNG A;  3HXD A;  3DPY A;  1FT1 A;  3E32 A;  4GTO A;  3KSQ A;  1X81 A;  4L9P A;  1TNZ A;  3SFY A;  1LD8 A;  3Q7F A;  3EUV A;  1KZP A;  4GTV A;  1SA4 A;  3HXE A;  3E33 A;  4YDE A;  1S64 A;  3KSL A;  4LNB A;  1TNB A;  4GTP A;  1O1T A;  3Q79 A;  1NL4 A;  1JCS A;  3PZ1 A;  4GTR A;  1N95 A;  3E37 A;  1LTX A;  4YDO A;  1N4R A;  3SFX A;  2H6F A;  3E34 A;  1O5M A;  4GTT A;  1O1R A;  1JCQ A;  3EU5 A;  1O1S A;  2F0Y A;  3Q73 A;  4GTS A;  2BED A;  3PZ2 A;  2H6G A;  1NI1 A;  1N4Q A;  3DSX A;  3HXC A;  3DRA A;  3Q75 A;  1N4S A;  1N9A A; 
#chains in the Genus database with same CATH topology
 3NZU A;  4UWG A;  3GZS A;  4YVO A;  3T5V A;  2OCC E;  4WNE A;  5J90 A;  2IOL A;  3AJI A;  2DZO A;  4ACL A;  4N2Q A;  4EBA G;  1YCS B;  2HM8 A;  1UN8 A;  3LVQ E;  5KNH D;  4AM9 A;  2ILR A;  3FH8 A;  3DWL G;  4CDM A;  3NBN B;  3UMV A;  3FTX A;  1BD8 A;  2VSN A;  4GYO A;  4APO A;  3IEG A;  5AQ7 A;  3D9N A;  2OND A;  2V8S E;  4MKT A;  3HHM A;  2WVI A;  4GTV A;  5JJ7 A;  1BI7 B;  2MRI A;  1D9S A;  5CBO A;  5BT1 A;  4ANV A;  1E8Z A;  3G2V A;  4JB8 P;  5BXU A;  1HF8 A;  4UI9 C;  4NQ0 A;  2KXP C;  2P58 C;  4TV3 A;  3TG5 A;  1OXJ A;  3C98 A;  1HH8 A;  2X6F A;  2VGE A;  4G23 A;  4UWF A;  2HE0 A;  2ZXW E;  4F1S A;  3C5R A;  2WXO A;  3SHF A;  5JMN D;  4APF A;  3QOU A;  2P9P G;  3DSX A;  4TXP A;  3Q75 A;  4K0R A;  2EIK E;  4JL0 A;  4L23 A;  2VGY A;  4L7T A;  3ZVV A;  1TN7 A;  4A63 B;  5C2Y A;  2FUL A;  3C3R A;  3FU6 A;  3RRN B;  4MLP A;  4N5C A;  1H6P A;  2IF4 A;  1FVH A;  2WXF A;  2RD0 A;  3EIJ A;  4JVS A;  4DLO A;  2VGX A;  3DSS A;  2J09 A;  4KBQ A;  5LCW J;  4IN3 B;  5G04 J;  2XZT G;  1HO8 A;  2RFA A;  4F53 A;  1OUV A;  4J8S A;  4ILI A;  3C3O A;  3TXN A;  4KT6 B;  1IXV A;  3NOC D;  2R17 C;  2GGF A;  4KZ0 A;  4HQD A;  2OEV A;  4XZ4 A;  2P9S G;  3HIZ A;  2KBX A;  3SBS A;  5EX3 A;  2XEE A;  1NA3 A;  3U4T A;  4U63 A;  3PE4 A;  1UJK A;  3HVE A;  2Y4U A;  1HX8 A;  1JCS A;  2VQ2 A;  2WXN A;  4K5B A;  5D0O D;  3IHY A;  3CKC A;  5ENN A;  3L6A A;  5HS0 A;  1KPS B;  4TUU A;  2BTD A;  4GMR A;  2BED A;  4DK5 A;  3FUH A;  1SVX A;  3FH7 A;  1JWF A;  1N4Q A;  1N4S A;  1OWL A;  4JEU A;  3Q47 B;  2IEJ A;  1QQE A;  2A4Z A;  3V2X A;  1RW2 A;  5ENS D;  1TN8 A;  3CST A;  3HXF A;  3S2A A;  2BKK B;  3N71 A;  3ASF A;  4UQY A;  2KZT A;  2B0O E;  4LER A;  2WXI A;  1BPO A;  3DST A;  1BI8 B;  2J07 A;  2BF0 X;  4XE0 A;  4AVX A;  5BNW A;  3VTX A;  1X81 A;  3KEA A;  3W9F A;  3EHN A;  5D2M C;  1KZP A;  3ZUV B;  4K5C A;  4CYM D;  5KWD A;  5ANL A;  1V55 E;  4GZC A;  5ENQ D;  2YNQ A;  1K3Z D;  2DBA A;  3T9K A;  2ZU6 B;  3V31 A;  1ELR A;  3O4Z A;  1NL4 A;  4G8K A;  4Z68 A;  5FQ6 A;  3EJN A;  4UWK A;  1N4R A;  2AWI A;  3ZFW A;  2WQ6 A;  3OTN A;  2EIL E;  3E34 A;  1BLX B;  5D66 A;  1O1S A;  3JCK C;  4A1G A;  4GAA A;  4U07 A;  4LUN U;  3V79 K;  3LS8 A;  1S70 B;  4HBD A;  1TJF A;  3UM1 A;  3ZW3 A;  1A5E A;  1KT0 A;  1JWG A;  3RKV A;  4N3A A;  1SQM A;  3S7B A;  5FT9 A;  5ENR D;  5BV1 A;  1TR4 A;  1PY1 A;  2AJA A;  2F37 A;  1FPP A;  4LG6 A;  2YHC A;  2NSZ A;  3R7R A;  2R5S A;  2Y69 E;  3ZEF A;  2ZIS A;  3FEY A;  5AAR A;  1E8X A;  1IQU A;  4BT9 A;  4I1M A;  1HE8 A;  3S7J A;  3QKY A;  4HLE A;  3C72 A;  4BX9 A;  3PZ4 A;  4O6F A;  2LAH A;  3I4G A;  5H7P A;  3L22 A;  1HFA A;  1SW6 A;  1OCR E;  3RIB A;  3I4R B;  1LD8 A;  2J49 A;  2Y0B G;  2LO6 A;  4ZHB A;  2J9Q A;  2XCC A;  3S7F A;  3MA5 A;  3EIQ C;  2AXZ A;  3FUM A;  4XKC A;  3I3N A;  1DNP A;  1H19 A;  3FTV A;  2FO1 E;  3TG4 A;  4G8L A;  4G1T A;  3TL5 A;  1ELW A;  4GPM A;  4UUC A;  4K5A B;  4QQI A;  3ZHE B;  5HQ8 A;  1O5M A;  3IHV A;  3Q73 A;  3UT8 A;  3CHQ A;  5AQA A;  1EYH A;  3CHR A;  2IO2 C;  2XPY A;  2GRQ B;  2ETB A;  2RKK A;  3Q15 A;  1TN6 A;  1UG3 A;  3BG0 B;  5LOZ A;  1IHB A;  3B7U X;  1QZ2 A;  3EHM A;  3LCA A;  3LPZ A;  2RFM A;  3G2W A;  3UQ3 A;  1MQS A;  4Y6C A;  3D9L A;  4Q69 A;  5T3R A;  2KCL A;  3DXK G;  2X6I A;  3Q9N C;  3SBT B;  4FLH A;  1IYG A;  3FUJ A;  4KVO A;  3TWQ A;  4KZC A;  4AIF A;  2J4B A;  4GYW A;  2CHX A;  4U0U A;  5EDS A;  4HRM B;  4PH4 B;  1OT8 A;  4TXQ A;  4G2V A;  4I9E A;  4UWH A;  3ZXP A;  5CED B;  3PZD A;  1TYQ G;  3DPD A;  3JUI A;  3PNL B;  5T4Y A;  4JPS A;  3HXD A;  2E0I A;  4LSZ E;  4ANX A;  4L9P A;  2MYO A;  2FF4 A;  4HI8 A;  4JD2 G;  2L9B A;  4DRX E;  4AY5 A;  3SF4 A;  1ZBP A;  2M63 A;  4X8Q A;  4KMO A;  3JXI A;  3NAW A;  4CGW A;  3EU9 A;  3OAW A;  3TXM A;  3QJZ A;  3BUA A;  5FIN A;  4DUI A;  2PL2 A;  1JPL A;  1MX4 A;  3AAA C;  3HYM B;  3TGO A;  4HFG A;  4H7X A;  3SGH A;  4J8E A;  1N95 A;  2P9N G;  3ULE G;  3FHE A;  3UX4 A;  3B13 A;  1S0P A;  4CT0 A;  3ENE A;  5G05 J;  3LDZ A;  3KAE A;  4CZ2 D;  4BER A;  3RRU A;  3ZNG A;  3CK8 A;  4KYO B;  1N11 A;  2ION A;  4A1S A;  4GA0 A;  1HG5 A;  3U9W A;  1N0R A;  3EHQ A;  5A7D B;  2PM6 A;  4JHR A;  5KCM A;  1JCR A;  4UWL A;  4KXK B;  1WAO 1;  4HOQ A;  3UT7 A;  2I6H A;  4DX6 D;  4R7L A;  3ABM E;  2VJ8 A;  2VSY A;  2E2E A;  5FQ7 A;  5FIO A;  5FTP A;  2DZN A;  2R2L A;  2WXH A;  4XKB A;  3VLE A;  3K9I A;  2XS8 A;  1E8W A;  1KLX A;  4PDX A;  4EEC A;  1FT1 A;  3URZ A;  2FO7 A;  1H2V C;  4M3O A;  2F8X K;  2WMN A;  5CCM A;  2L6J A;  2VGX B;  4P29 A;  5CCL A;  5LCW C;  4J8F A;  2NYJ A;  1TNB A;  3MKQ A;  2WB2 A;  3T8M A;  2JEK A;  4F6R D;  2CFZ A;  4RG9 A;  5AYW D;  3PEV B;  4N39 A;  2PZI A;  5CEA A;  2WXM A;  4Y6W A;  4I6G A;  4NIK A;  2YHE A;  3LVR E;  2C0L A;  4OVV A;  2V5Q C;  4BES A;  3B7T A;  4U8H A;  1ZB1 A;  2R05 A;  1O1R A;  3VLF A;  4CT4 A;  4XX5 A;  4F7A A;  1OCC E;  4UQX A;  1SZA A;  4L2L A;  5AN8 A;  3RAU A;  2KC7 A;  3IXE A;  3LJN A;  3FUL A;  3MZL B;  4GCN A;  3WXX A;  5FQ8 A;  3TWW A;  3CKB A;  5FQ4 A;  3TJP A;  4HLL A;  5LP0 A;  4IUL A;  1XGW A;  2KAT A;  4ZFH A;  3KEZ A;  3D9K A;  2LSU A;  1FT2 A;  2DIW A;  1MZC A;  3PS6 A;  2J4D A;  4C9B B;  5IY5 E;  4WNF A;  4I1A A;  2H6H A;  4GMJ A;  3EHR A;  3G2S A;  3ASH A;  2L0I A;  3BQO A;  1LD7 A;  1L5J A;  4AY6 A;  3JXJ A;  3D9H A;  3QWP A;  3U3W A;  4ILG A;  4I2W A;  4EZK A;  2V0P A;  3ESL A;  5EX0 A;  3DBS A;  3APF A;  1DC2 A;  3B7R L;  5AQB A;  3KD7 A;  4I17 A;  3CHP A;  2KZT B;  4YDE A;  1QYM A;  1MJ0 A;  4UQZ A;  3ML9 A;  3LJ3 A;  2P9I G;  5CRV A;  3ABL E;  4RLY A;  3ML8 A;  4YDW A;  2ETC A;  3FP3 A;  4MRU A;  2WXJ A;  4RQI A;  5BUZ A;  3PRZ A;  1OWM A;  4ANW A;  2VTB B;  3PDN A;  4GZ3 A;  3CHO A;  2WXG A;  1LF8 A;  3UKU G;  3GZ2 A;  3CVP A;  4LNU D;  3LY8 A;  3FY4 A;  3P1U A;  4TUM A;  3SY2 A;  3APD A;  4LCT A;  2FEZ A;  1B89 A;  2XRY A;  4UI9 K;  3Q5M A;  2WM9 A;  2VSO E;  3UTM A;  2XGM A;  5KJN A;  4K03 A;  4F3V A;  1S63 A;  3NB2 A;  3DSU A;  1NZN A;  2X6K A;  2GRM A;  3ONL A;  5EYP F;  4AV7 A;  2HR2 A;  4CDR A;  4RG6 A;  5C1D A;  3S7D A;  2PQR A;  4LNG A;  1QNF A;  2V4H C;  5JJT A;  3AU4 A;  3SD5 A;  2YQ8 A;  4A55 A;  4PUC A;  4U8Y D;  1P5Q A;  2QFC A;  3B95 A;  3ESK A;  3R7Q A;  3CQG B;  4HOU A;  2Q7F A;  4BY6 A;  1FCH A;  3FTY A;  2KCV A;  4CGV A;  4GZ5 A;  4FA6 A;  2R03 A;  1O1T A;  3VLD A;  1NA0 A;  3PEU B;  5JJ6 A;  1YYH A;  2NC9 A;  3LXU X;  2Y3A A;  1UN9 A;  4AJW A;  2ZGG A;  2XRZ A;  2EIN E;  4AOF A;  2WMO A;  4W9R A;  2H6F A;  5AQ9 A;  3TAX A;  5EN5 D;  4YDY A;  2QC9 A;  5CEC B;  5EIL A;  2ZGD A;  2GRN B;  4U0S A;  3UIO C;  2UWJ G;  1OCO E;  2I1J A;  1H0A A;  1N9A A;  3AG4 E;  5EYL A;  3FUE A;  2DYR E;  5JHB A;  1VDY A;  4KVM A;  1TNY A;  3LYA A;  3TWT A;  4B0Z A;  4OYS A;  3UIP C;  4DX5 D;  3HRA A;  1DCE A;  2HYZ A;  2WXP A;  2UY1 B;  1PC2 A;  1UOH A;  2AXV A;  5ARG A;  2XPI A;  1E96 B;  3AG1 E;  4AEZ C;  4FHJ A;  1WM5 A;  4NUR A;  4BT8 A;  2QYJ A;  5B1A E;  3RU0 A;  3SFY A;  2QY7 A;  3VTY A;  4N3B A;  3CV0 A;  3E33 A;  3L08 A;  3PRE A;  1S64 A;  3PNT B;  1U3D A;  4YVQ C;  2JLB A;  4TXR A;  3OXF A;  3PUK A;  2PQN A;  5AAO A;  3FUD A;  4FJY A;  2IFU A;  4TRQ A;  3G2U A;  1OWO A;  3ASD A;  3J5Q B;  1AP7 A;  2GRP B;  2WXK A;  4BFR A;  1IQR A;  3EU5 A;  4JA9 A;  5EID A;  4ACK A;  3PH0 C;  5A23 A;  2L0T B;  5BXO A;  4J8Y A;  4DJA A;  3WG7 E;  4HOR A;  4AP2 A;  3CQC B;  3HXC A;  1DVP A;  2PM7 A;  1E7U A;  3B7B A;  2Y1L E;  4I9C A;  5JA4 D;  3GW4 A;  3V30 A;  4DX2 A;  5G55 A;  4I6E A;  3LY7 A;  4EBA A;  4BX8 A;  4O1P A;  5G05 C;  4ILH B;  2CFU A;  3NOG D;  1QBQ A;  4GTM A;  3RO2 A;  4GZD A;  4OVU A;  2BKG A;  5EKQ D;  3PZ3 A;  4GTQ A;  5KJL A;  2P2C P;  1WDY A;  1D8E A;  1N4P A;  2VSX E;  2DYS E;  2ZIR A;  3FU0 A;  1KZO A;  2XEV A;  4FP7 A;  3EDT B;  5FZQ A;  2B6C A;  5DBK A;  4BET A;  5KJM A;  4U0Z A;  2FI7 A;  4GML A;  3CVU A;  1K8K G;  4MS6 A;  3ZYK A;  4D10 C;  2HO1 A;  2QZA A;  5FZS A;  3HXE A;  3MYV A;  3Q4A B;  4HS2 A;  4ATZ D;  4PS3 A;  2CG3 A;  2P9U G;  1MX6 A;  1GW6 A;  3LY9 A;  3KSL A;  4WWN A;  2L6B A;  2OOE A;  3T5X A;  1OWN A;  1MYO A;  2XEN A;  3D3M A;  3DEP A;  3ONK A;  2C0M A;  3E37 A;  5CHE E;  4E6H A;  5M72 A;  3IKO B;  3CHS A;  4L2Y A;  2XS1 A;  1OY3 D;  4JHK A;  4XI0 A;  1H2T C;  4HXI A;  3SZ7 A;  4C48 B;  3OXG A;  3CVV A;  4GA1 A;  1NI1 A;  3RSE G;  4JC8 A;  2IOS A;  3NZS A;  4U04 A;  4HOT A;  3Q78 A;  3MGB A;  4CDN A;  1H6K A;  5D0Q D;  3ZYM A;  2OV8 A;  1TNU A;  4JA7 A;  3KS2 A;  5FZR A;  1HU3 A;  1W3B A;  3ZHE A;  2J8S D;  4QFV A;  4GYY A;  3RK6 A;  3DSV A;  3UM0 A;  3W9G A;  1FVF A;  3L17 A;  4U8V D;  3JQ1 A;  4URK A;  1JUQ A;  4DX7 D;  3SO8 A;  1XNF A;  3IV0 A;  1A17 A;  3SFZ A;  3CHM A;  1N54 A;  2LUH A;  5KNG A;  1Q2Z A;  1IKN D;  3TWU A;  3B7S A;  1U3C A;  3U66 A;  3HDX A;  3T8K A;  3D9O A;  1N0Q A;  4XIF A;  3FU5 A;  4H7Y A;  4B94 A;  5CMY A;  3DEO A;  2EQX A;  3ULQ A;  4G11 A;  2XEH A;  2Y4T A;  3L16 A;  1K1A A;  5G04 C;  2IO3 C;  4GCO A;  3ASO E;  5LX8 A;  4IYP A;  4I1O B;  4C0M A;  5DIZ A;  4GA2 A;  4JZY A;  3C3Q A;  1Z3X A;  2QYU A;  3FUF A;  2X38 A;  2WXQ A;  2FBN A;  3ZU7 B;  2H6G A;  2ETA A;  3L54 A;  3D9M A;  2P9L G;  4XEI G;  2RG8 A;  4HVB A;  1HG2 A;  4O1O A;  3CIA A;  3QWV A;  3J5P A;  4DX1 A;  3MCX A;  1DCQ A;  4B8C B;  3FWV A;  2X6J A;  1YA0 A;  3HVE B;  4G25 A;  3CVX A;  1RZ4 A;  3BG1 B;  3Q49 B;  3ZXS A;  4G24 A;  5EIB E;  3ULY A;  1IHG A;  1EPU A;  3Q7A A;  3PE3 A;  3GYZ A;  4LEU A;  4WNG A;  2A5U A;  2P9K G;  2V4L A;  2CG2 A;  3DPY A;  3UIN C;  4B93 B;  4GTO A;  3NQP A;  4J8D A;  1G3N B;  2XHE A;  4NAC A;  3UKR G;  4AXH A;  3AS5 A;  3AG3 E;  1SA4 A;  3CVY A;  4A3T A;  1UJJ A;  2IY0 C;  3BU8 A;  1PAQ A;  1Z3Y A;  2F8Y A;  3QWW A;  4GTR A;  1AWC B;  3CR3 A;  3UUX A;  1INZ A;  3ASN E;  2MHK A;  4HB5 A;  3SNX A;  3G2T A;  3AU5 A;  3GZ1 A;  1Z6T A;  2CHZ A;  2XCB A;  2F0Y A;  4FUL A;  1H6O A;  4WWP A;  4FHK A;  3PZ2 A;  4JW1 A;  2WPV A;  3UPV A;  4E85 A;  3FTW A;  4DI3 A;  3NF1 A;  3JQ0 A;  3F6Q A;  4HI9 A;  3MEK A;  4GU5 A;  1N94 A;  1HZ4 A;  2GW1 A;  2CHW A;  4G26 A;  2GRO B;  2OVB A;  2X3M A;  4CRW A;  4V3I A;  4U95 D;  5BV0 A;  3V2O A;  1SA5 A;  1D8D A;  2MOW A;  3ZPJ A;  5LFA A;  4HOS A;  2V5F A;  1KT1 A;  3SQV A;  4BTA A;  2LXM A;  2IJG X;  5KBA A;  4YND A;  1OCZ E;  4NRH B;  3L9T A;  2DCP A;  2VYI A;  4ANU A;  4UI9 J;  2LNI A;  1Y6I A;  2I1K A;  4JXT A;  1Z5S C;  2BUG A;  4FLB A;  4HRL A;  3ZKJ A;  3E4B A;  3ZYQ A;  4Q96 A;  4U96 D;  5CER B;  4GTP A;  4ABN A;  1TEZ A;  4N5Q A;  4PS7 A;  3FTS A;  3FUI A;  5ENP D;  3PZ1 A;  4I2Z A;  4GPK A;  5B1B E;  1SZ9 A;  3CK7 A;  3ABK E;  3PUJ A;  3QDN A;  5AJD A;  2JAB A;  4M7C A;  3CLJ A;  4BWR A;  3UI2 A;  3MV2 B;  2EIJ E;  4J7W A;  5FJY A;  2WXL A;  5CRU A;  3L13 A;  2A5E A;  3U64 A;  1H2U A;  5ITZ F;  1BU9 A;  3CEQ A;  3DRA A;  4OAU C;  4FU3 A;  5JHA A;  2LSV A;  3FDH A;  5CMW A;  5BW8 C;  4EHM A;  3BEE A;  4O60 A;  3ZRH A;  3O48 A;  3UM3 A;  2NXP A;  3FEX A;  3MJW A;  1EF1 C;  2VTB A;  1NP7 A;  1K1B A;  4L1B A;  1ELK A;  4J6I A;  3HXB A;  1TNO A;  3APC A;  3QAR A;  3ASG A;  2AW6 A;  3Q7F A;  5CBN A;  4DI4 A;  2KM4 A;  3UXG A;  1OWP A;  4GZ6 A;  4JEH A;  3D9P A;  5AJL A;  3QAQ A;  1HS6 A;  3QC1 A;  4LRZ A;  1E7V A;  4ME2 A;  1YMP A;  4ATG A;  3AS4 A;  4HRN A;  2DVW A;  3FUK A;  3SFX A;  3D9I A;  4GTT A;  3IBE A;  1JCQ A;  4BEP A;  4N2S A;  1WG0 A;  3R9M A;  4WWO A;  3HG0 D;  2PNN A;  3LEW A;  3FFL A;  3ZIM A;  4HNA D;  2LXL A;  3FTZ A;  1U2V G;  4MBG A;  2R02 A;  2XGS A;  4A3V A;  2R59 A;  5ARF A;  3CVQ A;  4B8A A;  3FUN A;  1E90 A;  5G2N A;  3CSF A;  3DSW A;  3ZN3 A;  5T8I A;  3E30 A;  4DLQ A;  4I6J A;  3E32 A;  3KSQ A;  3LKU A;  4BSX A;  5AIJ A;  1TNZ A;  3EUV A;  4N3C A;  1E8Y A;  3D9J A;  3JUE A;  2I2O A;  3DXM G;  4WND A;  3JYS A;  1TJC A;  3FTU A;  2XQ0 A;  4C0E A;  4FC8 A;  3RO3 A;  4FAD A;  3Q79 A;  3MKR A;  4JHJ A;  2GRR B;  3RRM B;  4OAV B;  3CVL A;  3X2Q E;  2UY1 A;  2WQ7 A;  2LAI A;  2AXU A;  4CCA A;  2IQC A;  3CVW A;  2GRL A;  4YDO A;  3TWV A;  5BPP A;  2XGO A;  5B3S E;  3Q9U C;  5J08 A;  4BSZ B;  3P2B A;  4GTS A;  4J0U A;  3TWX A;  2WQH A;  4WUY A;  5ENT D;  1ZU2 A;  4PS8 A;  2OEW A;  4I43 A;  4U7E B;  3TWR A;  4B89 A;  5E75 A;  3CVN A;  3MX3 A;  3MKQ B;  3FU3 A;  4CEM A;  3I5P A;  3OXL A;  3ZYL A;  5HRY A;  5A6C A;  4RVB A;  5E76 A;  2EIM E;  5HKP A;  4EQF A;  2X6H A;  2WXR A;  4FJZ A;  2H6I A;  4GB9 A;  3ISM C;  4XI9 A;  2XZD G;  2AVP A;  5FWQ A;  5ANR A;  1N52 A;  3TWS A;  2DWZ A;  1WY6 A;  4WAF A;  3QK0 A;  3RJV A;  3AG2 E;  3AS8 A;  3MV3 B;  1V54 E;  2OVF A;  4LNB A;  1MHQ A;  4EZJ A;  4IRU A;  4RSY A;  5HI7 A;  4EZL A;  1UW4 B;  4EPZ A;  1HXI A;  3CK9 A;  2J08 A;  3QB2 A;  4F1P A;  3L82 A;  3SI5 A;  1Y8M A;  1EDU A;  1LTX A;  3UM2 A;  4DPR A;  3FH5 A;  3PVL A;  3ZGQ A;  4BTB A;  3UT4 A;  2C2L A;  2I9C A;  5ENO D;  3QNK A;  1MX2 A;  1X5B A;  5AEN A;  5KJK A;  2IU1 A;  4Q94 A;  3R9A B;  2YIN A;  2KCK A;  1NFI E;  2XPZ A;  3CGH A; 
#chains in the Genus database with same CATH homology
 1N94 A;  4MBG A;  2IEJ A;  3Q78 A;  1TN6 A;  1JCR A;  1FPP A;  4EHM A;  1FT2 A;  1MZC A;  1TN7 A;  1TN8 A;  1TNY A;  1TNU A;  2ZIS A;  2H6H A;  3HXF A;  1QBQ A;  4GTM A;  1DCE A;  3PZ3 A;  4GTQ A;  1S63 A;  1LD7 A;  3DSU A;  3DSS A;  3DSW A;  3C72 A;  3DST A;  1D8E A;  1SA5 A;  1N4P A;  2R2L A;  3Q7A A;  3PZ4 A;  3HXB A;  1D8D A;  3DSV A;  2ZIR A;  3E30 A;  1KZO A;  1TNO A;  2H6I A;  4LNG A;  3HXD A;  3DPY A;  1FT1 A;  3E32 A;  4GTO A;  3KSQ A;  1X81 A;  4L9P A;  1TNZ A;  3SFY A;  1LD8 A;  3Q7F A;  3EUV A;  1KZP A;  4GTV A;  1SA4 A;  3HXE A;  3E33 A;  4YDE A;  1S64 A;  3KSL A;  4LNB A;  1TNB A;  4GTP A;  1O1T A;  3Q79 A;  1NL4 A;  1JCS A;  3PZ1 A;  4GTR A;  1N95 A;  3E37 A;  1LTX A;  4YDO A;  1N4R A;  3SFX A;  2H6F A;  3E34 A;  1O5M A;  4GTT A;  1O1R A;  1JCQ A;  3EU5 A;  1O1S A;  2F0Y A;  3Q73 A;  4GTS A;  2BED A;  3PZ2 A;  2H6G A;  1NI1 A;  1N4Q A;  3DSX A;  3HXC A;  3DRA A;  3Q75 A;  1N4S A;  1N9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...