1TNUA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
total genus 130
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnuA00
1TNZA 3PZ2A 2ZISA 3DSSA 3E34A 3SFYA 4L9PA 4EHMA 1LD8A 1SA4A 4GTMA 1O1RA 4GTSA 1S63A 1TNBA 3C72A 3DRAA 3EUVA 1KZOA 1O5MA 1N4SA 3KSLA 1D8EA 1LTXA 4GTQA 1JCQA 3SFXA 1N9AA 3E37A 1KZPA 1SA5A 1TN8A 3PZ3A 3Q75A 1D8DA 1DCEA 1TN6A 4LNGA 1TNOA 3DPYA 1S64A 2IEJA 3PZ4A 1N95A 1TNUA 2R2LA 2H6IA 1JCRA 1N94A 2H6GA 3DSUA 1TN7A 2H6FA 1JCSA 4YDEA 1FPPA 1MZCA 4MBGA 4GTPA 1N4PA 1X81A 1QBQA 3HXEA 1O1SA 2ZIRA 4GTVA 3PZ1A 1O1TA 3HXBA 3DSWA 1FT1A 4YDOA 4GTTA 1LD7A 2BEDA 3DSVA 1NL4A 3HXFA 3Q7AA 3EU5A 3Q73A 4GTRA 3E30A 3E32A 3Q79A 3KSQA 3HXCA 4LNBA 4GTOA 3DSTA 1FT2A 3Q78A 1N4RA 2H6HA 2F0YA 1N4QA 1TNYA 3DSXA 1NI1A 3Q7FA 3HXDA 3E33A
chains in the Genus database with same CATH superfamily
4BESA 2IOLA 2A4ZA 3N71A 3DXKG 3ZHEA 2GRQB 4P29A 3RAUA 3T8MA 4CGWA 1HS6A 4BETA 3R7QA 4J8FA 3PRZA 4GPMA 4XIFA 4F6RD 3B7TA 4CDNA 3V2OA 4CDMA 3U64A 4U8HA 4FHKA 5HQ8A 1Q2ZA 2V8SE 3CLJA 4J8EA 3EDTB 4RG6A 2KCLA 2LO6A 5ITZF 1IQRA 4JEUA 4I9EA 3SBTB 3CVPA 1NP7A 4K5BA 1Y6IA 3RJVA 3FU0A 5ANRA 1FVHA 4KZ0A 2GROB 4GA1A 5JMND 5EYPF 2XCBA 1ELRA 2I1KA 3NB2A 4CCAA 4EBAA 4RLYA 4HBDA 4WAFA 1A17A 3C98A 3VLEA 3ZW3A 4IN3B 3MKRA 2BEDA 1OXJA 4GTRA 3CVUA 1DC2A 3GZSA 4JHRA 3LJNA 3PEUB 4HOQA 2Y4UA 5BUZA 1N4RA 2KZTA 2H6HA 2OVBA 5LP0A 3TWUA 1TNYA 1NI1A 1H6PA 3ESLA 2X3MA 1YA0A 3EIQC 4EPZA 3IXEA 4XZ4A 2EQXA 3EU9A 5KWDA 4MKTA 2WPVA 4C9BB 1ZU2A 2P9UG 1IYGA 3FUNA 4OVVA 4WWOA 3ISMC 3UXGA 1YYHA 3R9MA 1DCEA 3LY9A 4FULA 3ZKJA 4FP7A 3CIAA 1Z3YA 2YQ8A 2MHKA 3AG2E 4GA2A 5BV0A 1N52A 5EYLA 1OWNA 4Q96A 3KD7A 2H6GA 4NURA 3MV3B 4I9CA 3KS2A 2R5SA 5KNHD 3HXEA 4U0ZA 4HXIA 4HORA 3FH8A 3SFZA 4I43A 2ONDA 2IFUA 4NACA 2CG3A 5JJ6A 2XPIA 3HIZA 4GB9A 3T5XA 5ENPD 4DLQA 2R03A 2VTBA 4LRZA 4TXQA 3BUAA 3HVEB 2M63A 1WM5A 1WDYA 3HYMB 4L7TA 3SFYA 1BLXB 4KXKB 1E7VA 2EINE 3FTZA 4A55A 1S63A 4DI3A 5ARFA 2WXJA 3EUVA 4KZCA 2GRLA 2BKGA 2LAHA 5HRYA 3W9FA 3U66A 1LF8A 2ETAA 4N2SA 4ANUA 2DWZA 2GRMA 4ILIA 4URKA 1HG2A 1HH8A 4PDXA 2VSOE 2OOEA 1OCRE 3W9GA 2GRRB 3TGOA 4CEMA 2IO2C 1TNOA 1UJKA 2KATA 1MX2A 4GZ6A 3FUKA 4O60A 4A3TA 3D9IA 4JW1A 3B7SA 4ACKA 3ABKE 1FPPA 3AJIA 4OAUC 4FLBA 3MKQA 3PEVB 4HLEA 1EF1C 3S7DA 3ZXSA 3D9JA 5CECB 4W9RA 3D9PA 1LD7A 4K5CA 4OAVB 2FO7A 4CYMD 5CBOA 3E32A 1WY6A 3NZSA 5HKPA 2AW6A 3HXCA 3NQPA 4LNBA 4AV7A 2WVIA 3Q78A 1DCQA 3PDNA 5E75A 5BV1A 4UI9K 4TUUA 1TNZA 5AIJA 2P9KG 2P9NG 2NXPA 4G2VA 3LKUA 1U3DA 3GZ1A 1QZ2A 4FA6A 2WXLA 3ASFA 4JA7A 4J0UA 2J49A 4WUYA 4UWGA 3PE4A 5LOZA 1AP7A 3LCAA 2E0IA 3JYSA 5ENOD 3BG0B 2YHCA 3DPYA 2L9BA 5JHAA 5EX0A 4A3VA 2BF0X 2WXFA 1Z6TA 4F53A 4BERA 1IHBA 4N3CA 5B3SE 2WXQA 4I2WA 5C1DA 4I6GA 3KAEA 4A1SA 1MX4A 1E7UA 3CVQA 2XQ0A 1NZNA 4UWFA 3D9KA 3ZYQA 3FUHA 4N3BA 4F1PA 3O4ZA 4XI9A 3BQOA 3L17A 4I6EA 3Q73A 2AXVA 1ELWA 4HS2A 3MJWA 3LS8A 4BTBA 3TWQA 3RRMB 3G2SA 3ZFWA 5AN8A 3JQ1A 2Y3AA 2ZISA 2A5EA 5EKQD 3C3RA 4JXTA 4XX5A 5EIDA 3RIBA 4DK5A 5KCMA 3C72A 2V0PA 2IQCA 5JA4D 2R05A 1HO8A 3SD5A 3FTSA 3TJPA 4NQ0A 5CRUA 5AJDA 2GW1A 1KZPA 4HI9A 1OCOE 4EQFA 4AXHA 5BNWA 2AXUA 5BXOA 1OT8A 2VSXE 3U9WA 4TXPA 3L54A 2X6IA 3K9IA 4O6FA 4JB8P 5B1AE 4J8YA 3AG3E 4I17A 3FTVA 4XKBA 4NIKA 5CBNA 1XGWA 3SGHA 3DPDA 4GPKA 4UI9J 2B6CA 2DVWA 3NAWA 3PS6A 2X6KA 4TRQA 1HF8A 2RFMA 5KJMA 2F37A 4PS7A 4YDOA 2IU1A 4I1AA 4UWKA 1BI7B 2OEWA 3D9NA 5LFAA 1L5JA 2V4HC 2BKKB 2Q7FA 2ETBA 3JXIA 3TXNA 4N2QA 3T8KA 4XEIG 5ENRD 3TWWA 3RSEG 3CHQA 2EIKE 4MRUA 3MKQB 4UQXA 5A7DB 2VQ2A 1LD8A 3MZLB 4G23A 2LSVA 2I9CA 4RQIA 3HDXA 3MGBA 4FHJA 2L6BA 1ELKA 4KVOA 3IHVA 4JD2G 4LNUD 1D9SA 1HU3A 3EHMA 4GTQA 3RRUA 4EBAG 1IXVA 2XZTG 4ANVA 3HHMA 3ULEG 3MCXA 2XGOA 4CT4A 1TN6A 4LNGA 4HVBA 3PUJA 1UJJA 4R7LA 4AEZC 4KMOA 1N54A 3L6AA 3PREA 3TAXA 3D9MA 3QARA 1N0RA 3R9AB 3QWVA 2H6FA 1JCSA 3NOCD 3TWRA 4BEPA 1HZ4A 3QAQA 2VTBB 3AS8A 4FJZA 2R02A 1O1TA 4JPSA 3HVEA 5KNGA 5EDSA 3ABME 4U0SA 3CK7A 2KC7A 4ILGA 2BUGA 5BT1A 4GYOA 3RK6A 4BT9A 1E96B 2LNIA 3JUIA 4GTOA 3GW4A 4DPRA 1U2VG 5D0OD 5FZQA 2AXZA 3OXFA 3OXGA 4N5QA 3ZYKA 5FZSA 4GA0A 3L13A 2HO1A 2EILE 3APCA 4RG9A 2OCCE 1O1RA 2UWJG 3ML9A 3S7JA 3B13A 1IKND 2PQNA 4M7CA 3QKYA 3VLFA 4XKCA 4AY5A 4HQDA 3WG7E 3DEPA 3B7RL 3ZUVB 2YHEA 2ZGGA 1D8DA 4N5CA 4XI0A 4KVMA 2V5FA 3FHEA 3U4TA 3CVNA 3Q47B 3AG1E 1G3NB 3FDHA 3L9TA 3ZN3A 2X6JA 3D9HA 3ZYMA 4HI8A 2P9PG 3DSUA 3SF4A 3GZ2A 1PC2A 3FU5A 3AU4A 2XENA 4APOA 3IHYA 2WM9A 3LVRE 4TXRA 3UM0A 5CMYA 4GZ3A 2J4DA 3PVLA 3EHQA 4LG6A 3UKRG 4IRUA 2L0TB 4G11A 3ULQA 2JEKA 4Q94A 2E2EA 3TWVA 3KSQA 3I4GA 3SBSA 3TL5A 2PM6A 2R59A 2LSUA 4AJWA 3ML8A 3UIOC 4EHMA 1SA4A 4GTSA 3KEAA 4N3AA 3Q9UC 5C2YA 1JWGA 1INZA 2VSYA 4C48B 1N4SA 2IO3C 3SY2A 2DCPA 3QB2A 3NBNB 4AY6A 1OWOA 3EHNA 2RD0A 4GMLA 1SA5A 3BEEA 3MYVA 4FLHA 3NF1A 4I6JA 1BU9A 2PNNA 4GU5A 2X38A 3RRNB 2XHEA 4J6IA 1WAO1 4OVUA 1PAQA 5KJLA 2PM7A 5A6CA 2FI7A 4YVQC 4HNAD 5JJ7A 4QQIA 2WXRA 3UQ3A 1E8ZA 5CCLA 4LEUA 5G05J 4J8DA 1BD8A 4JZYA 1P5QA 3F6QA 2FBNA 1JCRA 4Z68A 4IYPA 4U63A 3CVWA 3D9OA 1N4PA 3JXJA 1S0PA 1A5EA 2EIME 3C3QA 4DUIA 2XS1A 4G25A 3PZ1A 3UT8A 3OAWA 2J08A 5BXUA 4GTTA 3DBSA 3FULA 3ZVVA 4O1OA 1MQSA 2XEVA 4DI4A 3KEZA 4GMRA 4BFRA 5ENNA 3LJ3A 4DX5D 4DX2A 3Q7FA 3HXDA 3NZUA 2YINA 5D66A 1KLXA 4BX8A 2MOWA 3U3WA 1DNPA 2VGYA 4M3OA 4HOSA 3HRAA 1OCCE 4HRMB 2ZGDA 3WXXA 4CDRA 3D3MA 1OWMA 3FUFA 4UQYA 3FU6A 4F3VA 3SFXA 3UM3A 1N9AA 5ENSD 3J5PA 1PY1A 2NSZA 3Q75A 5BW8C 4PH4B 3QOUA 2WMNA 3V31A 4WNEA 3CQGB 2CHXA 1QYMA 2Y1LE 5DBKA 3G2TA 4F1SA 5AYWD 2OVFA 2CHZA 3LDZA 4JC8A 4GMJA 2XRYA 4I1MA 5D0QD 3E4BA 2WXHA 3AS5A 2ZU6B 3ENEA 4I2ZA 2JABA 1EYHA 2FO1E 1N0QA 4DX1A 2DYSE 3MV2B 3Q15A 4BSXA 4ACLA 4V3IA 1E8YA 5A23A 2I1JA 3QC1A 5H7PA 3ESKA 4WNGA 2P9SG 3PH0C 5DIZA 3FTWA 2HR2A 3Q79A 3AS4A 1KT1A 1K1AA 3ZEFA 3FEYA 2WXOA 1N4QA 4DX6D 3L16A 4GCNA 2DIWA 4Q69A 2C0MA 4YVOA 2C2LA 1SQMA 4BY6A 4B89A 1JUQA 4E6HA 4UWLA 1Z3XA 1SW6A 2QYJA 3TG5A 5B1BE 1UN8A 1JCQA 2FULA 3FY4A 3T9KA 3UTMA 2WXNA 3P2BA 4ATZD 1NFIE 2Y69E 4U8VD 3ASOE 2V5QC 4X8QA 3VTYA 3BG1B 5FZRA 3CKCA 4ZHBA 2DYRE 2HE0A 1EPUA 1TNUA 4ZFHA 1JPLA 1N94A 4BTAA 2WQ7A 4E85A 3UM1A 4YDEA 4MBGA 4UQZA 5KJNA 5BPPA 4K5AB 4HRLA 3L22A 3TWSA 2YNQA 3I3NA 2CG2A 4AOFA 4GTVA 3PNLB 4Y6CA 3LEWA 4LUNU 1H2UA 5J90A 3ONLA 3I5PA 4LERA 4DX7D 2MYOA 3ZU7B 1NL4A 4ANWA 5EIBE 3QDNA 5EN5D 2DZOA 2IOSA 3C3OA 3LPZA 3RO3A 4G8KA 4U7EB 3CHMA 1IHGA 4WWPA 3DSXA 4L2LA 4B94A 3Q5MA 2CFZA 3DSSA 4APFA 5HI7A 1UW4B 3CHOA 3DRAA 3MEKA 1TYQG 4U0UA 4JHJA 3CHPA 2WXKA 2MRIA 2F8YA 2WXIA 4XE0A 4H7XA 4G8LA 4C0MA 4CZ2D 3IBEA 3JCKC 5EX3A 2J09A 2A5UA 2IY0C 1MX6A 5ENQD 5G04J 3PZ4A 4HLLA 4J8SA 4B93B 3P1UA 2H6IA 4HOUA 3ZIMA 5G04C 5T3RA 1OCZE 2CFUA 3FEXA 4UI9C 2QZAA 3ZGQA 1E8XA 1E8WA 1X81A 1Y8MA 3I4RB 5HS0A 3PUKA 3EJNA 4JVSA 4AVXA 2OEVA 2Y0BG 3CVYA 3E30A 2RG8A 4NRHB 4ANXA 1SZAA 2L6JA 2EIJE 3FTUA 1DVPA 2LUHA 5ANLA 3CK9A 4L23A 2IJGX 3EHRA 4GTMA 3FFLA 1NA0A 4ABNA 4RSYA 1D8EA 4O1PA 4HOTA 1LTXA 3LVQE 2KZTB 3UPVA 3CGHA 4EECA 3FH7A 1TN8A 3PZ3A 3SQVA 2QYUA 2GRPB 3DXMG 3G2UA 4YDWA 3ZYLA 2IEJA 1H0AA 4LSZE 1UN9A 1TR4A 5FJYA 2FF4A 3LXUX 3UI2A 5FINA 2WXPA 5LCWC 3SHFA 1MZCA 1OUVA 4GTPA 3OTNA 2J07A 4GZ5A 2WQHA 2WXMA 2NC9A 3TWXA 4BWRA 2JLBA 3ASGA 2ZIRA 5CMWA 2AVPA 5G2NA 4F7AA 3LY8A 3CSTA 4K0RA 3DSWA 5CCMA 4GZDA 3MX3A 4DLOA 3JQ0A 4K03A 3HXFA 1OY3D 5T8IA 3QNKA 2QY7A 4MLPA 4D10C 2P58C 4G1TA 2F0YA 3RKVA 2J8SD 1MHQA 1K1BA 1ZBPA 3PZ2A 4A1GA 3L82A 5FTPA 2XEHA 4RVBA 4HRNA 1KZOA 3FUEA 3CV0A 3FH5A 3CEQA 2AWIA 2ETCA 4YNDA 2QFCA 3E37A 2B0OE 3AU5A 1K3ZD 3FU3A 2KXPC 2FEZA 1V54E 2XPYA 2HYZA 2UY1A 3MA5A 4N39A 3NOGD 2P9LG 5AARA 4U95D 4PS3A 4FU3A 5AQBA 2OV8A 3TXMA 2XEEA 2R2LA 5IY5E 2XZDG 2NYJA 3UMVA 3Q9NC 1HXIA 4GAAA 3CKBA 4BT8A 2LAIA 1YMPA 3C5RA 3ZRHA 4C0EA 1RZ4A 1U3CA 3QK0A 3PZDA 5CEAA 1EDUA 4PUCA 5ARGA 3LY7A 2ILRA 1SVXA 2VYIA 3R7RA 1TJCA 5FIOA 5FWQA 2J4BA 4I1OB 2DBAA 3CK8A 4JA9A 1HFAA 1VDYA 2GGFA 3V79K 4Y6WA 2VGEA 3FP3A 1H19A 3DSTA 5AQAA 1FCHA 3HG0D 3FUDA 3S7BA 5T4YA 3E33A 3E34A 2LXLA 3IEGA 4TV3A 2XRZA 2WQ6A 2L0IA 1TNBA 3PE3A 1O5MA 4U8YD 4CRWA 3UKUG 3G2WA 3ASHA 2WB2A 3GYZA 3VLDA 4KBQA 4UWHA 1K8KG 3B95A 4HFGA 4PS8A 4GYWA 2Y4TA 2X6HA 3EIJA 5FQ7A 3L08A 3SO8A 3APDA 1S64A 1HE8A 2KBXA 5E76A 5CEDB 3FUJA 2RKKA 2CHWA 1WG0A 3TG4A 4GCOA 2XGMA 3UIPC 1JWFA 2R17C 3B7UX 4J7WA 2P9IG 2KCVA 3SNXA 2VGXA 2GRNB 3APFA 4LCTA 1Z5SC 4WNDA 2VSNA 2F8XK 4H7YA 4CGVA 1NA3A 3ASDA 4FADA 2X6FA 5AJLA 4U96D 3FTYA 2QC9A 3Q7AA 3EU5A 1H2VC 3PNTB 3FUMA 3UX4A 2WMOA 4KT6B 2BTDA 1N11A 1X5BA 1SZ9A 3Q4AB 3S2AA 3AG4E 1MYOA 4TUMA 5CHEE 4DRXE 4L9PA 3J5QB 3IV0A 5JHBA 1BI8B 4YDYA 2HM8A 3OXLA 3VTXA 5FQ6A 5AAOA 3SZ7A 4AIFA 5M72A 3Q49B 3KSLA 5FQ8A 5JJTA 2IONA 3DEOA 4B0ZA 5LX8A 3CVVA 4ATGA 1XNFA 4AP2A 3B7BA 2VJ8A 1S70B 2RFAA 4QFVA 4GZCA 1UOHA 1QNFA 5CERB 3QWPA 4HB5A 2I2OA 2XCCA 3UUXA 4KYOB 5AQ9A 1OWPA 1TEZA 3UT4A 3CQCB 5AENA 2WXGA 2C0LA 1TN7A 4MS6A 2DZNA 1IQUA 5G55A 2PQRA 5KBAA 3T5VA 3RU0A 1QBQA 4FC8A 4BX9A 4CT0A 2PL2A 4GYYA 3ZPJA 3CVLA 2PZIA 2VGXB 2J9QA 4DJAA 3BU8A 3UM2A 3V30A 3CHSA 3G2VA 1FT1A 1H6KA 3LYAA 2LXMA 3S7FA 3ZXPA 4G24A 3V2XA 3TWTA 4EZJA 2V4LA 4A63B 3ONKA 1W3BA 3QJZA 1UG3A 5ENTD 1BPOA 1FVFA 1TJFA 3FWVA 4G26A 5G05C 1OWLA 1GW6A 1ZB1A 3CSFA 1MJ0A 4JEHA 3ULYA 4AM9A 1YCSB 3AAAC 3ZHEB 5LCWJ 3CHRA 4WNFA 4L2YA 3ABLE 3DWLG 3CR3A 3UT7A 1HG5A 1H2TC 1B89A 1AWCB 2IF4A 3SI5A 2AJAA 1E90A 4B8CB 2P2CP 2XS8A 4L1BA 4OYSA 3RO2A 4JL0A 5CRVA 1N95A 2I6HA 5AQ7A 4U04A 3ZNGA 2XGSA 5KJKA 3JUEA 3URZA 1RW2A 5D2MC 1KT0A 1HX8A 4ME2A 4FJYA 4B8AA 1O1SA 1QQEA 4WWNA 1V55E 4ILHB 5EILA 5FT9A 3HXBA 4EZLA 3FUIA 1KPSB 3IKOB 3X2QE 2ZXWE 4BSZB 3DSVA 3QWWA 2UY1B 4UUCA 3UINC 2XPZA 2KCKA 3D9LA 4IULA 3O48A 1H6OA 4JHKA 5J08A 3ASNE 4EZKA 1FT2A 2KM4A 3CVXA 3FTXA 5FQ4A 4U07A
chains in the Genus database with same CATH topology
1TNZA 3PZ2A 2ZISA 3DSSA 3E34A 3SFYA 4L9PA 4EHMA 1LD8A 1SA4A 4GTMA 1O1RA 4GTSA 1S63A 1TNBA 3C72A 3DRAA 3EUVA 1KZOA 1O5MA 1N4SA 3KSLA 1D8EA 1LTXA 4GTQA 1JCQA 3SFXA 1N9AA 3E37A 1KZPA 1SA5A 1TN8A 3PZ3A 3Q75A 1D8DA 1DCEA 1TN6A 4LNGA 1TNOA 3DPYA 1S64A 2IEJA 3PZ4A 1N95A 1TNUA 2R2LA 2H6IA 1JCRA 1N94A 2H6GA 3DSUA 1TN7A 2H6FA 1JCSA 4YDEA 1FPPA 1MZCA 4MBGA 4GTPA 1N4PA 1X81A 1QBQA 3HXEA 1O1SA 2ZIRA 4GTVA 3PZ1A 1O1TA 3HXBA 3DSWA 1FT1A 4YDOA 4GTTA 1LD7A 2BEDA 3DSVA 1NL4A 3HXFA 3Q7AA 3EU5A 3Q73A 4GTRA 3E30A 3E32A 3Q79A 3KSQA 3HXCA 4LNBA 4GTOA 3DSTA 1FT2A 3Q78A 1N4RA 2H6HA 2F0YA 1N4QA 1TNYA 3DSXA 1NI1A 3Q7FA 3HXDA 3E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNZ A;  3PZ2 A;  2ZIS A;  3DSS A;  3E34 A;  3SFY A;  4L9P A;  4EHM A;  1LD8 A;  1SA4 A;  4GTM A;  1O1R A;  4GTS A;  1S63 A;  1TNB A;  3C72 A;  3DRA A;  3EUV A;  1KZO A;  1O5M A;  1N4S A;  3KSL A;  1D8E A;  1LTX A;  4GTQ A;  1JCQ A;  3SFX A;  1N9A A;  3E37 A;  1KZP A;  1SA5 A;  1TN8 A;  3PZ3 A;  3Q75 A;  1D8D A;  1DCE A;  1TN6 A;  4LNG A;  1TNO A;  3DPY A;  1S64 A;  2IEJ A;  3PZ4 A;  1N95 A;  1TNU A;  2R2L A;  2H6I A;  1JCR A;  1N94 A;  2H6G A;  3DSU A;  1TN7 A;  2H6F A;  1JCS A;  4YDE A;  1FPP A;  1MZC A;  4MBG A;  4GTP A;  1N4P A;  1X81 A;  1QBQ A;  3HXE A;  1O1S A;  2ZIR A;  4GTV A;  3PZ1 A;  1O1T A;  3HXB A;  3DSW A;  1FT1 A;  4YDO A;  4GTT A;  1LD7 A;  2BED A;  3DSV A;  1NL4 A;  3HXF A;  3Q7A A;  3EU5 A;  3Q73 A;  4GTR A;  3E30 A;  3E32 A;  3Q79 A;  3KSQ A;  3HXC A;  4LNB A;  4GTO A;  3DST A;  1FT2 A;  3Q78 A;  1N4R A;  2H6H A;  2F0Y A;  1N4Q A;  1TNY A;  3DSX A;  1NI1 A;  3Q7F A;  3HXD A;  3E33 A; 
#chains in the Genus database with same CATH topology
 4BES A;  2IOL A;  2A4Z A;  3N71 A;  3DXK G;  3ZHE A;  2GRQ B;  4P29 A;  3RAU A;  3T8M A;  4CGW A;  1HS6 A;  4BET A;  3R7Q A;  4J8F A;  3PRZ A;  4GPM A;  4XIF A;  4F6R D;  3B7T A;  4CDN A;  3V2O A;  4CDM A;  3U64 A;  4U8H A;  4FHK A;  5HQ8 A;  1Q2Z A;  2V8S E;  3CLJ A;  4J8E A;  3EDT B;  4RG6 A;  2KCL A;  2LO6 A;  5ITZ F;  1IQR A;  4JEU A;  4I9E A;  3SBT B;  3CVP A;  1NP7 A;  4K5B A;  1Y6I A;  3RJV A;  3FU0 A;  5ANR A;  1FVH A;  4KZ0 A;  2GRO B;  4GA1 A;  5JMN D;  5EYP F;  2XCB A;  1ELR A;  2I1K A;  3NB2 A;  4CCA A;  4EBA A;  4RLY A;  4HBD A;  4WAF A;  1A17 A;  3C98 A;  3VLE A;  3ZW3 A;  4IN3 B;  3MKR A;  2BED A;  1OXJ A;  4GTR A;  3CVU A;  1DC2 A;  3GZS A;  4JHR A;  3LJN A;  3PEU B;  4HOQ A;  2Y4U A;  5BUZ A;  1N4R A;  2KZT A;  2H6H A;  2OVB A;  5LP0 A;  3TWU A;  1TNY A;  1NI1 A;  1H6P A;  3ESL A;  2X3M A;  1YA0 A;  3EIQ C;  4EPZ A;  3IXE A;  4XZ4 A;  2EQX A;  3EU9 A;  5KWD A;  4MKT A;  2WPV A;  4C9B B;  1ZU2 A;  2P9U G;  1IYG A;  3FUN A;  4OVV A;  4WWO A;  3ISM C;  3UXG A;  1YYH A;  3R9M A;  1DCE A;  3LY9 A;  4FUL A;  3ZKJ A;  4FP7 A;  3CIA A;  1Z3Y A;  2YQ8 A;  2MHK A;  3AG2 E;  4GA2 A;  5BV0 A;  1N52 A;  5EYL A;  1OWN A;  4Q96 A;  3KD7 A;  2H6G A;  4NUR A;  3MV3 B;  4I9C A;  3KS2 A;  2R5S A;  5KNH D;  3HXE A;  4U0Z A;  4HXI A;  4HOR A;  3FH8 A;  3SFZ A;  4I43 A;  2OND A;  2IFU A;  4NAC A;  2CG3 A;  5JJ6 A;  2XPI A;  3HIZ A;  4GB9 A;  3T5X A;  5ENP D;  4DLQ A;  2R03 A;  2VTB A;  4LRZ A;  4TXQ A;  3BUA A;  3HVE B;  2M63 A;  1WM5 A;  1WDY A;  3HYM B;  4L7T A;  3SFY A;  1BLX B;  4KXK B;  1E7V A;  2EIN E;  3FTZ A;  4A55 A;  1S63 A;  4DI3 A;  5ARF A;  2WXJ A;  3EUV A;  4KZC A;  2GRL A;  2BKG A;  2LAH A;  5HRY A;  3W9F A;  3U66 A;  1LF8 A;  2ETA A;  4N2S A;  4ANU A;  2DWZ A;  2GRM A;  4ILI A;  4URK A;  1HG2 A;  1HH8 A;  4PDX A;  2VSO E;  2OOE A;  1OCR E;  3W9G A;  2GRR B;  3TGO A;  4CEM A;  2IO2 C;  1TNO A;  1UJK A;  2KAT A;  1MX2 A;  4GZ6 A;  3FUK A;  4O60 A;  4A3T A;  3D9I A;  4JW1 A;  3B7S A;  4ACK A;  3ABK E;  1FPP A;  3AJI A;  4OAU C;  4FLB A;  3MKQ A;  3PEV B;  4HLE A;  1EF1 C;  3S7D A;  3ZXS A;  3D9J A;  5CEC B;  4W9R A;  3D9P A;  1LD7 A;  4K5C A;  4OAV B;  2FO7 A;  4CYM D;  5CBO A;  3E32 A;  1WY6 A;  3NZS A;  5HKP A;  2AW6 A;  3HXC A;  3NQP A;  4LNB A;  4AV7 A;  2WVI A;  3Q78 A;  1DCQ A;  3PDN A;  5E75 A;  5BV1 A;  4UI9 K;  4TUU A;  1TNZ A;  5AIJ A;  2P9K G;  2P9N G;  2NXP A;  4G2V A;  3LKU A;  1U3D A;  3GZ1 A;  1QZ2 A;  4FA6 A;  2WXL A;  3ASF A;  4JA7 A;  4J0U A;  2J49 A;  4WUY A;  4UWG A;  3PE4 A;  5LOZ A;  1AP7 A;  3LCA A;  2E0I A;  3JYS A;  5ENO D;  3BG0 B;  2YHC A;  3DPY A;  2L9B A;  5JHA A;  5EX0 A;  4A3V A;  2BF0 X;  2WXF A;  1Z6T A;  4F53 A;  4BER A;  1IHB A;  4N3C A;  5B3S E;  2WXQ A;  4I2W A;  5C1D A;  4I6G A;  3KAE A;  4A1S A;  1MX4 A;  1E7U A;  3CVQ A;  2XQ0 A;  1NZN A;  4UWF A;  3D9K A;  3ZYQ A;  3FUH A;  4N3B A;  4F1P A;  3O4Z A;  4XI9 A;  3BQO A;  3L17 A;  4I6E A;  3Q73 A;  2AXV A;  1ELW A;  4HS2 A;  3MJW A;  3LS8 A;  4BTB A;  3TWQ A;  3RRM B;  3G2S A;  3ZFW A;  5AN8 A;  3JQ1 A;  2Y3A A;  2ZIS A;  2A5E A;  5EKQ D;  3C3R A;  4JXT A;  4XX5 A;  5EID A;  3RIB A;  4DK5 A;  5KCM A;  3C72 A;  2V0P A;  2IQC A;  5JA4 D;  2R05 A;  1HO8 A;  3SD5 A;  3FTS A;  3TJP A;  4NQ0 A;  5CRU A;  5AJD A;  2GW1 A;  1KZP A;  4HI9 A;  1OCO E;  4EQF A;  4AXH A;  5BNW A;  2AXU A;  5BXO A;  1OT8 A;  2VSX E;  3U9W A;  4TXP A;  3L54 A;  2X6I A;  3K9I A;  4O6F A;  4JB8 P;  5B1A E;  4J8Y A;  3AG3 E;  4I17 A;  3FTV A;  4XKB A;  4NIK A;  5CBN A;  1XGW A;  3SGH A;  3DPD A;  4GPK A;  4UI9 J;  2B6C A;  2DVW A;  3NAW A;  3PS6 A;  2X6K A;  4TRQ A;  1HF8 A;  2RFM A;  5KJM A;  2F37 A;  4PS7 A;  4YDO A;  2IU1 A;  4I1A A;  4UWK A;  1BI7 B;  2OEW A;  3D9N A;  5LFA A;  1L5J A;  2V4H C;  2BKK B;  2Q7F A;  2ETB A;  3JXI A;  3TXN A;  4N2Q A;  3T8K A;  4XEI G;  5ENR D;  3TWW A;  3RSE G;  3CHQ A;  2EIK E;  4MRU A;  3MKQ B;  4UQX A;  5A7D B;  2VQ2 A;  1LD8 A;  3MZL B;  4G23 A;  2LSV A;  2I9C A;  4RQI A;  3HDX A;  3MGB A;  4FHJ A;  2L6B A;  1ELK A;  4KVO A;  3IHV A;  4JD2 G;  4LNU D;  1D9S A;  1HU3 A;  3EHM A;  4GTQ A;  3RRU A;  4EBA G;  1IXV A;  2XZT G;  4ANV A;  3HHM A;  3ULE G;  3MCX A;  2XGO A;  4CT4 A;  1TN6 A;  4LNG A;  4HVB A;  3PUJ A;  1UJJ A;  4R7L A;  4AEZ C;  4KMO A;  1N54 A;  3L6A A;  3PRE A;  3TAX A;  3D9M A;  3QAR A;  1N0R A;  3R9A B;  3QWV A;  2H6F A;  1JCS A;  3NOC D;  3TWR A;  4BEP A;  1HZ4 A;  3QAQ A;  2VTB B;  3AS8 A;  4FJZ A;  2R02 A;  1O1T A;  4JPS A;  3HVE A;  5KNG A;  5EDS A;  3ABM E;  4U0S A;  3CK7 A;  2KC7 A;  4ILG A;  2BUG A;  5BT1 A;  4GYO A;  3RK6 A;  4BT9 A;  1E96 B;  2LNI A;  3JUI A;  4GTO A;  3GW4 A;  4DPR A;  1U2V G;  5D0O D;  5FZQ A;  2AXZ A;  3OXF A;  3OXG A;  4N5Q A;  3ZYK A;  5FZS A;  4GA0 A;  3L13 A;  2HO1 A;  2EIL E;  3APC A;  4RG9 A;  2OCC E;  1O1R A;  2UWJ G;  3ML9 A;  3S7J A;  3B13 A;  1IKN D;  2PQN A;  4M7C A;  3QKY A;  3VLF A;  4XKC A;  4AY5 A;  4HQD A;  3WG7 E;  3DEP A;  3B7R L;  3ZUV B;  2YHE A;  2ZGG A;  1D8D A;  4N5C A;  4XI0 A;  4KVM A;  2V5F A;  3FHE A;  3U4T A;  3CVN A;  3Q47 B;  3AG1 E;  1G3N B;  3FDH A;  3L9T A;  3ZN3 A;  2X6J A;  3D9H A;  3ZYM A;  4HI8 A;  2P9P G;  3DSU A;  3SF4 A;  3GZ2 A;  1PC2 A;  3FU5 A;  3AU4 A;  2XEN A;  4APO A;  3IHY A;  2WM9 A;  3LVR E;  4TXR A;  3UM0 A;  5CMY A;  4GZ3 A;  2J4D A;  3PVL A;  3EHQ A;  4LG6 A;  3UKR G;  4IRU A;  2L0T B;  4G11 A;  3ULQ A;  2JEK A;  4Q94 A;  2E2E A;  3TWV A;  3KSQ A;  3I4G A;  3SBS A;  3TL5 A;  2PM6 A;  2R59 A;  2LSU A;  4AJW A;  3ML8 A;  3UIO C;  4EHM A;  1SA4 A;  4GTS A;  3KEA A;  4N3A A;  3Q9U C;  5C2Y A;  1JWG A;  1INZ A;  2VSY A;  4C48 B;  1N4S A;  2IO3 C;  3SY2 A;  2DCP A;  3QB2 A;  3NBN B;  4AY6 A;  1OWO A;  3EHN A;  2RD0 A;  4GML A;  1SA5 A;  3BEE A;  3MYV A;  4FLH A;  3NF1 A;  4I6J A;  1BU9 A;  2PNN A;  4GU5 A;  2X38 A;  3RRN B;  2XHE A;  4J6I A;  1WAO 1;  4OVU A;  1PAQ A;  5KJL A;  2PM7 A;  5A6C A;  2FI7 A;  4YVQ C;  4HNA D;  5JJ7 A;  4QQI A;  2WXR A;  3UQ3 A;  1E8Z A;  5CCL A;  4LEU A;  5G05 J;  4J8D A;  1BD8 A;  4JZY A;  1P5Q A;  3F6Q A;  2FBN A;  1JCR A;  4Z68 A;  4IYP A;  4U63 A;  3CVW A;  3D9O A;  1N4P A;  3JXJ A;  1S0P A;  1A5E A;  2EIM E;  3C3Q A;  4DUI A;  2XS1 A;  4G25 A;  3PZ1 A;  3UT8 A;  3OAW A;  2J08 A;  5BXU A;  4GTT A;  3DBS A;  3FUL A;  3ZVV A;  4O1O A;  1MQS A;  2XEV A;  4DI4 A;  3KEZ A;  4GMR A;  4BFR A;  5ENN A;  3LJ3 A;  4DX5 D;  4DX2 A;  3Q7F A;  3HXD A;  3NZU A;  2YIN A;  5D66 A;  1KLX A;  4BX8 A;  2MOW A;  3U3W A;  1DNP A;  2VGY A;  4M3O A;  4HOS A;  3HRA A;  1OCC E;  4HRM B;  2ZGD A;  3WXX A;  4CDR A;  3D3M A;  1OWM A;  3FUF A;  4UQY A;  3FU6 A;  4F3V A;  3SFX A;  3UM3 A;  1N9A A;  5ENS D;  3J5P A;  1PY1 A;  2NSZ A;  3Q75 A;  5BW8 C;  4PH4 B;  3QOU A;  2WMN A;  3V31 A;  4WNE A;  3CQG B;  2CHX A;  1QYM A;  2Y1L E;  5DBK A;  3G2T A;  4F1S A;  5AYW D;  2OVF A;  2CHZ A;  3LDZ A;  4JC8 A;  4GMJ A;  2XRY A;  4I1M A;  5D0Q D;  3E4B A;  2WXH A;  3AS5 A;  2ZU6 B;  3ENE A;  4I2Z A;  2JAB A;  1EYH A;  2FO1 E;  1N0Q A;  4DX1 A;  2DYS E;  3MV2 B;  3Q15 A;  4BSX A;  4ACL A;  4V3I A;  1E8Y A;  5A23 A;  2I1J A;  3QC1 A;  5H7P A;  3ESK A;  4WNG A;  2P9S G;  3PH0 C;  5DIZ A;  3FTW A;  2HR2 A;  3Q79 A;  3AS4 A;  1KT1 A;  1K1A A;  3ZEF A;  3FEY A;  2WXO A;  1N4Q A;  4DX6 D;  3L16 A;  4GCN A;  2DIW A;  4Q69 A;  2C0M A;  4YVO A;  2C2L A;  1SQM A;  4BY6 A;  4B89 A;  1JUQ A;  4E6H A;  4UWL A;  1Z3X A;  1SW6 A;  2QYJ A;  3TG5 A;  5B1B E;  1UN8 A;  1JCQ A;  2FUL A;  3FY4 A;  3T9K A;  3UTM A;  2WXN A;  3P2B A;  4ATZ D;  1NFI E;  2Y69 E;  4U8V D;  3ASO E;  2V5Q C;  4X8Q A;  3VTY A;  3BG1 B;  5FZR A;  3CKC A;  4ZHB A;  2DYR E;  2HE0 A;  1EPU A;  1TNU A;  4ZFH A;  1JPL A;  1N94 A;  4BTA A;  2WQ7 A;  4E85 A;  3UM1 A;  4YDE A;  4MBG A;  4UQZ A;  5KJN A;  5BPP A;  4K5A B;  4HRL A;  3L22 A;  3TWS A;  2YNQ A;  3I3N A;  2CG2 A;  4AOF A;  4GTV A;  3PNL B;  4Y6C A;  3LEW A;  4LUN U;  1H2U A;  5J90 A;  3ONL A;  3I5P A;  4LER A;  4DX7 D;  2MYO A;  3ZU7 B;  1NL4 A;  4ANW A;  5EIB E;  3QDN A;  5EN5 D;  2DZO A;  2IOS A;  3C3O A;  3LPZ A;  3RO3 A;  4G8K A;  4U7E B;  3CHM A;  1IHG A;  4WWP A;  3DSX A;  4L2L A;  4B94 A;  3Q5M A;  2CFZ A;  3DSS A;  4APF A;  5HI7 A;  1UW4 B;  3CHO A;  3DRA A;  3MEK A;  1TYQ G;  4U0U A;  4JHJ A;  3CHP A;  2WXK A;  2MRI A;  2F8Y A;  2WXI A;  4XE0 A;  4H7X A;  4G8L A;  4C0M A;  4CZ2 D;  3IBE A;  3JCK C;  5EX3 A;  2J09 A;  2A5U A;  2IY0 C;  1MX6 A;  5ENQ D;  5G04 J;  3PZ4 A;  4HLL A;  4J8S A;  4B93 B;  3P1U A;  2H6I A;  4HOU A;  3ZIM A;  5G04 C;  5T3R A;  1OCZ E;  2CFU A;  3FEX A;  4UI9 C;  2QZA A;  3ZGQ A;  1E8X A;  1E8W A;  1X81 A;  1Y8M A;  3I4R B;  5HS0 A;  3PUK A;  3EJN A;  4JVS A;  4AVX A;  2OEV A;  2Y0B G;  3CVY A;  3E30 A;  2RG8 A;  4NRH B;  4ANX A;  1SZA A;  2L6J A;  2EIJ E;  3FTU A;  1DVP A;  2LUH A;  5ANL A;  3CK9 A;  4L23 A;  2IJG X;  3EHR A;  4GTM A;  3FFL A;  1NA0 A;  4ABN A;  4RSY A;  1D8E A;  4O1P A;  4HOT A;  1LTX A;  3LVQ E;  2KZT B;  3UPV A;  3CGH A;  4EEC A;  3FH7 A;  1TN8 A;  3PZ3 A;  3SQV A;  2QYU A;  2GRP B;  3DXM G;  3G2U A;  4YDW A;  3ZYL A;  2IEJ A;  1H0A A;  4LSZ E;  1UN9 A;  1TR4 A;  5FJY A;  2FF4 A;  3LXU X;  3UI2 A;  5FIN A;  2WXP A;  5LCW C;  3SHF A;  1MZC A;  1OUV A;  4GTP A;  3OTN A;  2J07 A;  4GZ5 A;  2WQH A;  2WXM A;  2NC9 A;  3TWX A;  4BWR A;  2JLB A;  3ASG A;  2ZIR A;  5CMW A;  2AVP A;  5G2N A;  4F7A A;  3LY8 A;  3CST A;  4K0R A;  3DSW A;  5CCM A;  4GZD A;  3MX3 A;  4DLO A;  3JQ0 A;  4K03 A;  3HXF A;  1OY3 D;  5T8I A;  3QNK A;  2QY7 A;  4MLP A;  4D10 C;  2P58 C;  4G1T A;  2F0Y A;  3RKV A;  2J8S D;  1MHQ A;  1K1B A;  1ZBP A;  3PZ2 A;  4A1G A;  3L82 A;  5FTP A;  2XEH A;  4RVB A;  4HRN A;  1KZO A;  3FUE A;  3CV0 A;  3FH5 A;  3CEQ A;  2AWI A;  2ETC A;  4YND A;  2QFC A;  3E37 A;  2B0O E;  3AU5 A;  1K3Z D;  3FU3 A;  2KXP C;  2FEZ A;  1V54 E;  2XPY A;  2HYZ A;  2UY1 A;  3MA5 A;  4N39 A;  3NOG D;  2P9L G;  5AAR A;  4U95 D;  4PS3 A;  4FU3 A;  5AQB A;  2OV8 A;  3TXM A;  2XEE A;  2R2L A;  5IY5 E;  2XZD G;  2NYJ A;  3UMV A;  3Q9N C;  1HXI A;  4GAA A;  3CKB A;  4BT8 A;  2LAI A;  1YMP A;  3C5R A;  3ZRH A;  4C0E A;  1RZ4 A;  1U3C A;  3QK0 A;  3PZD A;  5CEA A;  1EDU A;  4PUC A;  5ARG A;  3LY7 A;  2ILR A;  1SVX A;  2VYI A;  3R7R A;  1TJC A;  5FIO A;  5FWQ A;  2J4B A;  4I1O B;  2DBA A;  3CK8 A;  4JA9 A;  1HFA A;  1VDY A;  2GGF A;  3V79 K;  4Y6W A;  2VGE A;  3FP3 A;  1H19 A;  3DST A;  5AQA A;  1FCH A;  3HG0 D;  3FUD A;  3S7B A;  5T4Y A;  3E33 A;  3E34 A;  2LXL A;  3IEG A;  4TV3 A;  2XRZ A;  2WQ6 A;  2L0I A;  1TNB A;  3PE3 A;  1O5M A;  4U8Y D;  4CRW A;  3UKU G;  3G2W A;  3ASH A;  2WB2 A;  3GYZ A;  3VLD A;  4KBQ A;  4UWH A;  1K8K G;  3B95 A;  4HFG A;  4PS8 A;  4GYW A;  2Y4T A;  2X6H A;  3EIJ A;  5FQ7 A;  3L08 A;  3SO8 A;  3APD A;  1S64 A;  1HE8 A;  2KBX A;  5E76 A;  5CED B;  3FUJ A;  2RKK A;  2CHW A;  1WG0 A;  3TG4 A;  4GCO A;  2XGM A;  3UIP C;  1JWF A;  2R17 C;  3B7U X;  4J7W A;  2P9I G;  2KCV A;  3SNX A;  2VGX A;  2GRN B;  3APF A;  4LCT A;  1Z5S C;  4WND A;  2VSN A;  2F8X K;  4H7Y A;  4CGV A;  1NA3 A;  3ASD A;  4FAD A;  2X6F A;  5AJL A;  4U96 D;  3FTY A;  2QC9 A;  3Q7A A;  3EU5 A;  1H2V C;  3PNT B;  3FUM A;  3UX4 A;  2WMO A;  4KT6 B;  2BTD A;  1N11 A;  1X5B A;  1SZ9 A;  3Q4A B;  3S2A A;  3AG4 E;  1MYO A;  4TUM A;  5CHE E;  4DRX E;  4L9P A;  3J5Q B;  3IV0 A;  5JHB A;  1BI8 B;  4YDY A;  2HM8 A;  3OXL A;  3VTX A;  5FQ6 A;  5AAO A;  3SZ7 A;  4AIF A;  5M72 A;  3Q49 B;  3KSL A;  5FQ8 A;  5JJT A;  2ION A;  3DEO A;  4B0Z A;  5LX8 A;  3CVV A;  4ATG A;  1XNF A;  4AP2 A;  3B7B A;  2VJ8 A;  1S70 B;  2RFA A;  4QFV A;  4GZC A;  1UOH A;  1QNF A;  5CER B;  3QWP A;  4HB5 A;  2I2O A;  2XCC A;  3UUX A;  4KYO B;  5AQ9 A;  1OWP A;  1TEZ A;  3UT4 A;  3CQC B;  5AEN A;  2WXG A;  2C0L A;  1TN7 A;  4MS6 A;  2DZN A;  1IQU A;  5G55 A;  2PQR A;  5KBA A;  3T5V A;  3RU0 A;  1QBQ A;  4FC8 A;  4BX9 A;  4CT0 A;  2PL2 A;  4GYY A;  3ZPJ A;  3CVL A;  2PZI A;  2VGX B;  2J9Q A;  4DJA A;  3BU8 A;  3UM2 A;  3V30 A;  3CHS A;  3G2V A;  1FT1 A;  1H6K A;  3LYA A;  2LXM A;  3S7F A;  3ZXP A;  4G24 A;  3V2X A;  3TWT A;  4EZJ A;  2V4L A;  4A63 B;  3ONK A;  1W3B A;  3QJZ A;  1UG3 A;  5ENT D;  1BPO A;  1FVF A;  1TJF A;  3FWV A;  4G26 A;  5G05 C;  1OWL A;  1GW6 A;  1ZB1 A;  3CSF A;  1MJ0 A;  4JEH A;  3ULY A;  4AM9 A;  1YCS B;  3AAA C;  3ZHE B;  5LCW J;  3CHR A;  4WNF A;  4L2Y A;  3ABL E;  3DWL G;  3CR3 A;  3UT7 A;  1HG5 A;  1H2T C;  1B89 A;  1AWC B;  2IF4 A;  3SI5 A;  2AJA A;  1E90 A;  4B8C B;  2P2C P;  2XS8 A;  4L1B A;  4OYS A;  3RO2 A;  4JL0 A;  5CRV A;  1N95 A;  2I6H A;  5AQ7 A;  4U04 A;  3ZNG A;  2XGS A;  5KJK A;  3JUE A;  3URZ A;  1RW2 A;  5D2M C;  1KT0 A;  1HX8 A;  4ME2 A;  4FJY A;  4B8A A;  1O1S A;  1QQE A;  4WWN A;  1V55 E;  4ILH B;  5EIL A;  5FT9 A;  3HXB A;  4EZL A;  3FUI A;  1KPS B;  3IKO B;  3X2Q E;  2ZXW E;  4BSZ B;  3DSV A;  3QWW A;  2UY1 B;  4UUC A;  3UIN C;  2XPZ A;  2KCK A;  3D9L A;  4IUL A;  3O48 A;  1H6O A;  4JHK A;  5J08 A;  3ASN E;  4EZK A;  1FT2 A;  2KM4 A;  3CVX A;  3FTX A;  5FQ4 A;  4U07 A; 
#chains in the Genus database with same CATH homology
 1TNZ A;  3PZ2 A;  2ZIS A;  3DSS A;  3E34 A;  3SFY A;  4L9P A;  4EHM A;  1LD8 A;  1SA4 A;  4GTM A;  1O1R A;  4GTS A;  1S63 A;  1TNB A;  3C72 A;  3DRA A;  3EUV A;  1KZO A;  1O5M A;  1N4S A;  3KSL A;  1D8E A;  1LTX A;  4GTQ A;  1JCQ A;  3SFX A;  1N9A A;  3E37 A;  1KZP A;  1SA5 A;  1TN8 A;  3PZ3 A;  3Q75 A;  1D8D A;  1DCE A;  1TN6 A;  4LNG A;  1TNO A;  3DPY A;  1S64 A;  2IEJ A;  3PZ4 A;  1N95 A;  1TNU A;  2R2L A;  2H6I A;  1JCR A;  1N94 A;  2H6G A;  3DSU A;  1TN7 A;  2H6F A;  1JCS A;  4YDE A;  1FPP A;  1MZC A;  4MBG A;  4GTP A;  1N4P A;  1X81 A;  1QBQ A;  3HXE A;  1O1S A;  2ZIR A;  4GTV A;  3PZ1 A;  1O1T A;  3HXB A;  3DSW A;  1FT1 A;  4YDO A;  4GTT A;  1LD7 A;  2BED A;  3DSV A;  1NL4 A;  3HXF A;  3Q7A A;  3EU5 A;  3Q73 A;  4GTR A;  3E30 A;  3E32 A;  3Q79 A;  3KSQ A;  3HXC A;  4LNB A;  4GTO A;  3DST A;  1FT2 A;  3Q78 A;  1N4R A;  2H6H A;  2F0Y A;  1N4Q A;  1TNY A;  3DSX A;  1NI1 A;  3Q7F A;  3HXD A;  3E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...