1TNUA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords geranylgeranyltransferase type I alpha subunit
total genus 130
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnuA00
4MBGA 3DRAA 3PZ2A 1KZOA 1TNZA 1D8DA 1SA4A 1TNYA 3DSVA 3HXEA 1LD7A 4GTRA 3EUVA 1N94A 1N4QA 3SFXA 3Q79A 4GTSA 1TN8A 1S63A 3Q7AA 1X81A 4YDEA 3DSSA 1O1RA 1DCEA 3DSWA 4EHMA 4L9PA 1N4PA 1TN7A 1S64A 1LTXA 3DSUA 1D8EA 4GTMA 1N4RA 2H6HA 2H6GA 1FT2A 2F0YA 3Q73A 1JCRA 3C72A 4GTTA 2R2LA 2ZIRA 1FT1A 3HXFA 3Q78A 1O5MA 3KSLA 1QBQA 3DSTA 3KSQA 3DSXA 3E34A 3Q75A 3Q7FA 2H6IA 1N9AA 1SA5A 1N4SA 4LNBA 1TNOA 1O1SA 3E32A 3PZ3A 3E30A 4GTQA 1N95A 1LD8A 4GTVA 1TN6A 3HXCA 1KZPA 3PZ1A 2IEJA 3E33A 3HXBA 1MZCA 4GTPA 1JCQA 3EU5A 4GTOA 1FPPA 1JCSA 4LNGA 1TNUA 3DPYA 3PZ4A 3HXDA 3SFYA 2BEDA 1O1TA 3E37A 2H6FA 4YDOA 1NL4A 1NI1A 1TNBA 2ZISA
chains in the Genus database with same CATH superfamily
3CHOA 2BTDA 5CEAA 3B7SA 2CFUA 5T4YA 5FZQA 1BU9A 1TNZA 4IRUA 1K1AA 5E75A 3ABME 3HXEA 5BUZA 4J8FA 5AJDA 4A1GA 1L5JA 2LSUA 4WNGA 5ANRA 3CHMA 3PUKA 4ZHBA 3HYMB 3FTUA 4JA9A 1N4PA 4ANUA 3Q47B 3CGHA 3CVVA 4J8YA 2F8YA 2JABA 2BUGA 4AVXA 2WXFA 3AG1E 1UG3A 4BX8A 3QB2A 4K5AB 4XKCA 3D9OA 5AQBA 3UM2A 3B95A 3TWWA 5J08A 2ZIRA 2LXLA 4G24A 5FQ7A 2HYZA 3KSLA 4RSYA 5JHAA 3FEXA 1U3DA 4IULA 1YCSB 2HM8A 2WXGA 4U96D 5EILA 1TNOA 3FTXA 3TJPA 4YVOA 5CERB 3EIQC 2WXKA 1HE8A 4HBDA 1OWMA 4HI9A 3ZW3A 5D66A 3AJIA 4JW1A 3VLDA 3JQ1A 4KVOA 4GCOA 4FHJA 4PUCA 4PS8A 2XCBA 4DX1A 1UW4B 3Q49B 4M3OA 2YHCA 2XS8A 4EPZA 3MKQB 1TYQG 3CVLA 4N3AA 1NA3A 4AOFA 5FQ4A 3PZ2A 3LEWA 4PS7A 2ZGDA 2V4LA 1OWLA 3Q7AA 4G25A 5B1BE 1O1RA 4FHKA 5LFAA 3APCA 4L9PA 1S70B 4K03A 3LVQE 4N3BA 3CVPA 2DYRE 3HVEB 2HR2A 3RO2A 1EPUA 4CT0A 2GRLA 4TXPA 4CGVA 3ONKA 3MCXA 1SW6A 2F8XK 5ENQD 3RIBA 3DWLG 1H0AA 3B13A 3VLEA 5FJYA 2X6FA 4B93B 3PVLA 4I6EA 4GMJA 2OEWA 3D9HA 2WXPA 3UTMA 3D9NA 3UM1A 3DBSA 2FI7A 2AXZA 3AG4E 2UY1B 4OAUC 3TXMA 3KAEA 2IY0C 4NRHB 4F1PA 3RO3A 2ILRA 4G26A 4CRWA 1IKND 3OAWA 1ZU2A 3SD5A 4UWGA 4A3VA 3LVRE 4AP2A 4URKA 3CHRA 4XKBA 2X6KA 4UUCA 4HNAD 3DRAA 2ETAA 2C0LA 1HH8A 5ENPD 5DBKA 1YA0A 4N3CA 5A23A 3QWWA 4GPMA 1OUVA 1X81A 3BEEA 1N11A 3DSWA 4O6FA 4GA1A 3ZUVB 2FBNA 2V0PA 4N39A 4J8DA 4GMLA 3GZSA 3T9KA 3LY9A 3D9KA 4WUYA 3DSUA 3CVQA 5KBAA 3Q73A 1EF1C 3DEPA 3NZUA 4L23A 3NOCD 1SVXA 2P9PG 2WMOA 5EN5D 4BWRA 1N9AA 4LNBA 3L13A 1Z3XA 3JCKC 4Y6WA 3PEUB 1N0RA 4U0ZA 3BU8A 1ELRA 2IEJA 1S0PA 5A6CA 2PQRA 2HO1A 3EU5A 1H6OA 1RZ4A 3FULA 1JCSA 1IQRA 3FU5A 3SO8A 3ESLA 4RQIA 3S7FA 2RG8A 4BTAA 2R03A 4ZFHA 1HX8A 4KVMA 1N0QA 4L2YA 3UIPC 2VGYA 1A5EA 1FVHA 2I2OA 1D8DA 1X5BA 3DSVA 3RRMB 3I5PA 4B94A 3ZYQA 1KT0A 3AS5A 1H6KA 2R02A 2XGMA 4WNFA 3L08A 2VSXE 3ZHEA 2IONA 2P9NG 4LEUA 2A4ZA 5D0OD 3BUAA 4W9RA 4HOTA 1LTXA 4JB8P 3D9JA 4UI9K 4BX9A 1JWGA 1Y6IA 2YINA 4HLLA 2XRYA 4WWNA 2F0YA 4I9EA 4BY6A 3C72A 2YQ8A 1A17A 4DLOA 5A7DB 5EDSA 2OVBA 4LUNU 4F53A 2GRMA 4FC8A 3S7BA 3FUIA 2V5FA 1SZ9A 4HRMB 4JEUA 4UI9J 4A1SA 3RK6A 3G2WA 1H19A 3DEOA 4JPSA 2AWIA 3NBNB 1PAQA 3FTZA 2IU1A 3PE4A 2L9BA 3Q9UC 5FT9A 3ZFWA 3PZ4A 2QZAA 3FTYA 4AY5A 3HRAA 3D9MA 2XGOA 4FJYA 1MJ0A 4DLQA 5D0QD 4FADA 3J5PA 4O60A 1NI1A 1RW2A 5HKPA 4J7WA 2R59A 3FH8A 3UM3A 4OAVB 3LKUA 4HFGA 5CCMA 2HE0A 3EUVA 3UM0A 3TWVA 4KT6B 1DNPA 4HRLA 1YYHA 5AIJA 5FWQA 2DYSE 1E90A 1TN7A 2CFZA 1OCZE 3U66A 2H6GA 4C48B 5JHBA 4ANVA 2VSOE 1NFIE 1Z6TA 3LYAA 2KC7A 1TEZA 2GRPB 3HXFA 3WXXA 5C1DA 2I1JA 5IY5E 1EYHA 2WB2A 4CT4A 3CR3A 1INZA 1XNFA 4I17A 3RAUA 4KZ0A 1E8YA 5KNGA 2KCKA 3HXBA 3W9FA 2XENA 2CG2A 1HG5A 3ESKA 1HO8A 2A5UA 4GZ3A 3C3OA 4I2ZA 1OY3D 4XX5A 5AJLA 3FUJA 5E76A 3Q9NC 4N5QA 3QKYA 2P9IG 3SZ7A 3PH0C 2WMNA 3CSFA 1N94A 4UWLA 1N4QA 4B8CB 3Q79A 2GW1A 3FUKA 1S63A 4TUMA 1DCEA 4EHMA 5ARGA 3FFLA 2XS1A 3TWUA 4D10C 4I9CA 1H2TC 5G04C 4KYOB 4FJZA 2XPZA 1QQEA 4BSXA 2CG3A 4JHKA 4HRNA 2PL2A 4M7CA 5CEDB 2IF4A 1UN8A 1OXJA 3AS4A 1OCOE 2LUHA 3MA5A 5EX0A 1HFAA 3ML9A 3DSTA 5KJKA 4JEHA 3DSXA 1QYMA 3TGOA 2ETBA 5LP0A 3MZLB 3CHQA 2AXUA 3VTYA 4FULA 4LG6A 4FU3A 3ISMC 2QYUA 2DBAA 1N95A 5JA4D 1TN6A 3PUJA 4F6RD 3I4GA 4E6HA 3MKRA 1OWOA 3CKCA 1MZCA 1JCQA 4GTOA 2P9LG 3T8KA 4NIKA 4BETA 3GW4A 3CVXA 1E8ZA 3KEAA 4LCTA 4U8VD 3ZRHA 4G1TA 3MX3A 1K8KG 3E37A 5CBOA 3C3QA 5ANLA 2XEVA 2J4DA 5AAOA 3ZYMA 2XPIA 4IN3B 4MBGA 3V30A 2KATA 2VYIA 1WY6A 4WNEA 4BESA 3F6QA 3L82A 2WXNA 1TNYA 4XIFA 4NQ0A 1HU3A 3E4BA 5ENRD 3CVYA 3D9LA 1IHBA 2JLBA 5B1AE 3UKRG 3ASDA 3GZ1A 3AU5A 1QZ2A 2ZU6B 4Q96A 3IHYA 3CK7A 3ZN3A 1TJFA 2LNIA 1E7UA 3T5VA 3EDTB 4HOUA 2MYOA 1BI7B 1N4RA 3UINC 3P1UA 1Z3YA 2PQNA 5AYWD 3P2BA 3T8MA 3CQGB 4HOSA 2E2EA 3V2XA 4XEIG 5KCMA 4GB9A 2XZTG 4J8SA 4WAFA 3CVWA 4GYWA 2I6HA 2J49A 4GTQA 4ILGA 1IYGA 4F1SA 4JD2G 3V79K 4DPRA 3CHSA 3C3RA 4MKTA 3LDZA 3FU0A 3B7UX 1MYOA 1IQUA 2RKKA 5BXUA 3ULEG 3DPYA 2MOWA 4ABNA 3SBTB 2OVFA 5G04J 1Q2ZA 4BTBA 1ZBPA 2WQ6A 4LERA 3QNKA 4X8QA 3HG0D 4UQYA 3L16A 4I1AA 5DIZA 3UUXA 2XRZA 5ENNA 2WXMA 4N2QA 3APDA 1HXIA 4GZ5A 2WXIA 3VLFA 4JA7A 1IHGA 4XE0A 3JYSA 3R7RA 1N54A 3LPZA 4JHRA 5JJ7A 3L6AA 2IOLA 3B7RL 4U07A 5AN8A 4C0MA 1GW6A 3I4RB 3MJWA 3PREA 1KLXA 1B89A 3NAWA 1H2UA 4A55A 3Q4AB 4JVSA 2J8SD 1LF8A 4ATGA 4YVQC 3S7DA 3FTVA 5ARFA 2OV8A 3LY7A 4DX7D 4HORA 3J5QB 2DWZA 3E33A 1DVPA 4NACA 1FPPA 3FEYA 1U3CA 4LNGA 1P5QA 1TNUA 4CZ2D 4FP7A 4DX2A 3HXDA 4BERA 3SFYA 4O1OA 1V54E 3QOUA 4GAAA 1WDYA 4XZ4A 4I6JA 1G3NB 2ZISA 3EHMA 5FTPA 4AV7A 1K3ZD 4L1BA 4K0RA 4U7EB 4KXKB 4DX6D 2NYJA 2J07A 4MS6A 1OCCE 3EJNA 4TXRA 3NOGD 1E7VA 3PEVB 4P29A 1QNFA 5LCWJ 4G23A 3NQPA 3X2QE 4BT8A 3TXNA 1NP7A 2XGSA 1ELWA 4TUUA 3K9IA 3CEQA 3UI2A 4FLBA 3D3MA 4EBAA 4AY6A 4UWFA 3HDXA 4G2VA 3JXJA 3Q15A 3Q7FA 5BT1A 3R9MA 3CVNA 2BKGA 4Q94A 4O1PA 3ASNE 4DRXE 1E96B 5EKQD 5HRYA 3UKUG 5H7PA 3RRNB 5CRUA 4N2SA 4RLYA 1UJKA 3CKBA 3FHEA 3MEKA 2KZTB 3IHVA 1TR4A 2XEHA 3FY4A 2PZIA 2WXHA 4YDYA 1D9SA 3TAXA 4J8EA 2L0IA 2P58C 1W3BA 5BNWA 2BEDA 1MQSA 4YDOA 2Y69E 5CMYA 5AARA 3SGHA 2M63A 3T5XA 3FUNA 4DI4A 2Y3AA 2VGEA 2B6CA 2R05A 2DIWA 3RU0A 4DX5D 2VGXB 5CBNA 3PS6A 3VTXA 4DJAA 2KM4A 1TN8A 3O48A 4YDEA 4ACKA 3ZXPA 3RKVA 3SY2A 1S64A 5G2NA 4B0ZA 2QYJA 3KS2A 3FP3A 4U63A 2J09A 1YMPA 4OVUA 4BT9A 4CYMD 3OTNA 4QQIA 3PNLB 5BW8C 2IJGX 1QBQA 1H6PA 2BF0X 3MYVA 2I9CA 2I1KA 3UT8A 1LD8A 4GTVA 2C0MA 4FLHA 2PM6A 5ENSD 3I3NA 4ACLA 1DC2A 3FH7A 5HS0A 2L6BA 4EQFA 3ULQA 1ZB1A 3MGBA 3D9PA 3S2AA 3R7QA 1WAO1 3CQCB 5CHEE 5AQ9A 2UWJG 4DUIA 1O1TA 4QFVA 4JZYA 4OVVA 2GRNB 5AENA 1JWFA 3QC1A 4XI0A 2EINE 2FULA 3SF4A 1KZOA 1EDUA 3FUHA 3OXFA 4CDRA 5G05C 2IQCA 3FUMA 2IO2C 3TWTA 2VSNA 3RRUA 5JJTA 2OCCE 2XCCA 5KJMA 3U4TA 2DCPA 5KWDA 2KCLA 4NURA 2FO7A 4J0UA 4A3TA 5BV1A 3IXEA 1BI8B 3V31A 3ASGA 3UPVA 3AS8A 4HLEA 1U2VG 3SI5A 1SQMA 3N71A 2H6HA 2UY1A 2B0OE 3LJ3A 5EYPF 2R2LA 2LXMA 3Q78A 2AVPA 4U04A 3E34A 3ZYLA 4F3VA 3GZ2A 3TWSA 4Y6CA 3O4ZA 2GROB 3UX4A 4CEMA 1O1SA 4XI9A 3L17A 1HS6A 5ITZF 3DXMG 5M72A 4WWPA 1Y8MA 3PE3A 1E8XA 3CV0A 3NF1A 2P9KG 3V2OA 2QFCA 5B3SE 2WQ7A 5FZRA 2QC9A 4PS3A 1NZNA 4IYPA 1KPSB 2Y4UA 1FCHA 2EQXA 1JPLA 3ULYA 2XQ0A 2AXVA 4DI3A 2VSYA 3L54A 2R17C 2J9QA 2E0IA 2XEEA 4RG6A 2IO3C 4EECA 3ZU7B 3ONLA 5KJNA 3CK9A 3DPDA 1SZAA 4UWHA 4DK5A 2NSZA 4KZCA 2KBXA 3SFXA 3ASFA 4JC8A 1WG0A 1PY1A 2LO6A 3GYZA 1FVFA 3TWQA 4B89A 5T3RA 5LOZA 4ANXA 2DVWA 3AU4A 5EIBE 2OEVA 1MX6A 3HHMA 3ZKJA 4GCNA 4WNDA 2NC9A 1O5MA 2CHXA 3KSQA 2GRQB 3U3WA 4EZLA 2VGXA 4BEPA 4TV3A 5FZSA 3UT7A 3U64A 2PM7A 1KZPA 3PZ1A 3ML8A 3G2UA 2WXJA 3EIJA 3ABLE 2XPYA 3BG1B 4GTPA 3ZGQA 2V5QC 4PDXA 5AQAA 3TWXA 3JUEA 5BPPA 3QDNA 3UXGA 1E8WA 2IFUA 3SQVA 2RFAA 3ZHEB 5HI7A 2OOEA 3FUDA 4U8HA 3QWVA 2X3MA 2H6FA 2WXOA 1N52A 4L2LA 3MV2B 3LCAA 4J6IA 5C2YA 3TWRA 3FU3A 2YHEA 3ENEA 3UQ3A 4HI8A 4APFA 3LXUX 3AG2E 4JHJA 4UWKA 4G8LA 5KJLA 4OYSA 4I6GA 3HIZA 1UN9A 2EILE 1UJJA 2P9UG 4CCAA 3APFA 1HF8A 3Q5MA 2GGFA 4BFRA 3ASHA 1V55E 4APOA 2MHKA 2V4HC 1D8EA 2EIME 3TL5A 2DZOA 1FT1A 3EHRA 4GZDA 4HVBA 2VQ2A 5FQ8A 2Y0BG 2LSVA 3MV3B 4H7XA 4AIFA 2DZNA 3AG3E 2VTBA 2H6IA 4GA2A 1OCRE 4ILIA 4U95D 1MHQA 5CMWA 2A5EA 4AXHA 1PC2A 3HXCA 4HQDA 5FQ6A 3CLJA 4G8KA 5D2MC 2V8SE 2PNNA 3R9AB 2QY7A 4AJWA 1ELKA 1BLXB 1JUQA 4GZCA 2ZXWE 3UIOC 3ZVVA 4FA6A 3DXKG 3D9IA 5KNHD 3ZXSA 1BD8A 3G2VA 2CHZA 5LX8A 4MRUA 3NB2A 2WM9A 2MRIA 3JUIA 3KEZA 3JXIA 4ANWA 2FO1E 3AAAC 4UQZA 2GRRB 1Z5SC 4GTRA 4CDNA 2F37A 5J90A 4G11A 2WXQA 3DSSA 3FU6A 4I2WA 3WG7E 3ZIMA 4H7YA 3EHQA 5EX3A 4JL0A 1OWPA 2FF4A 3SNXA 4N5CA 3BQOA 3C98A 4ME2A 4I1MA 5BV0A 3LJNA 3W9GA 2X6HA 3Q75A 3CHPA 4AM9A 4KBQA 1N4SA 2CHWA 3URZA 1BPOA 2XHEA 2ETCA 3ABKE 3CK8A 3CVUA 3SFZA 5T8IA 3QAQA 3FH5A 4KMOA 2WXRA 2P9SG 5BXOA 4V3IA 3B7BA 2IOSA 2XZDG 2FEZA 3TG4A 4U0UA 4L7TA 2JEKA 2VJ8A 1TNBA 5CCLA 4HS2A 4R7LA 4C0EA 3UT4A 4C9BB 1WM5A 5JMND 3EHNA 2KZTA 3SHFA 3B7TA 4LRZA 1LD7A 4I43A 2AW6A 5ENTD 4UI9C 1OT8A 3BG0B 5EIDA 2X6JA 5G55A 3EU9A 3QWPA 2LAHA 3FUFA 4RVBA 2WXLA 2X6IA 4AEZC 2Y1LE 1VDYA 2KCVA 4GTMA 2ZGGA 2L0TB 1FT2A 2J08A 4GTTA 4JXTA 2Y4TA 4BSZB 3ASOE 3RJVA 1HG2A 4GYOA 3MKQA 4EZJA 1AWCB 3PZDA 4E85A 2EIJE 4B8AA 3IBEA 3E32A 2AJAA 3ZPJA 3CIAA 3E30A 5ENOD 3CSTA 4Q69A 5AQ7A 2J4BA 4HXIA 1H2VC 4HB5A 4CGWA 2WVIA 1NA0A 1OWNA 4UQXA 3TG5A 3SBSA 4GU5A 4ILHB 3IEGA 3S7JA 4WWOA 4Z68A 4GMRA 4MLPA 2LAIA 2ONDA 5FIOA 3PDNA 4GYYA 4I1OB 1NL4A 4TRQA 3FTWA 2EIKE 4PH4B 4GZ6A 4EZKA 4RG9A 4A63B 4U0SA 1K1BA 3LY8A 1SA4A 3QJZA 1MX4A 3ZEFA 4GA0A 3JQ0A 3U9WA 3OXLA 5CECB 4YNDA 4GTSA 5HQ8A 1IXVA 2Q7FA 3L9TA 3C5RA 5FINA 1DCQA 4HOQA 2R5SA 3L22A 5EYLA 2RFMA 3ZNGA 3G2TA 3LS8A 3ZYKA 4LNUD 1XGWA 2L6JA 4YDWA 3FDHA 2NXPA 1JCRA 1KT1A 1MX2A 3QK0A 1UOHA 3QARA 5CRVA 4EBAG 3PNTB 2YNQA 4K5CA 1SA5A 5LCWC 3PZ3A 1HZ4A 3KD7A 3FUEA 4CDMA 4LSZE 4ATZD 2P2CP 2C2LA 4GPKA 2VTBB 5G05J 3FWVA 3NZSA 1AP7A 4F7AA 2KXPC 2RD0A 2X38A 5JJ6A 3IKOB 3PRZA 2WPVA 2WQHA 3HVEA 3UMVA 4TXQA 3RSEG 2BKKB 3IV0A 3FTSA 4U8YD 4K5BA 3OXGA 1TJCA 3G2SA
chains in the Genus database with same CATH topology
4MBGA 3DRAA 3PZ2A 1KZOA 1TNZA 1D8DA 1SA4A 1TNYA 3DSVA 3HXEA 1LD7A 4GTRA 3EUVA 1N94A 1N4QA 3SFXA 3Q79A 4GTSA 1TN8A 1S63A 3Q7AA 1X81A 4YDEA 3DSSA 1O1RA 1DCEA 3DSWA 4EHMA 4L9PA 1N4PA 1TN7A 1S64A 1LTXA 3DSUA 1D8EA 4GTMA 1N4RA 2H6HA 2H6GA 1FT2A 2F0YA 3Q73A 1JCRA 3C72A 4GTTA 2R2LA 2ZIRA 1FT1A 3HXFA 3Q78A 1O5MA 3KSLA 1QBQA 3DSTA 3KSQA 3DSXA 3E34A 3Q75A 3Q7FA 2H6IA 1N9AA 1SA5A 1N4SA 4LNBA 1TNOA 1O1SA 3E32A 3PZ3A 3E30A 4GTQA 1N95A 1LD8A 4GTVA 1TN6A 3HXCA 1KZPA 3PZ1A 2IEJA 3E33A 3HXBA 1MZCA 4GTPA 1JCQA 3EU5A 4GTOA 1FPPA 1JCSA 4LNGA 1TNUA 3DPYA 3PZ4A 3HXDA 3SFYA 2BEDA 1O1TA 3E37A 2H6FA 4YDOA 1NL4A 1NI1A 1TNBA 2ZISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBG A;  3DRA A;  3PZ2 A;  1KZO A;  1TNZ A;  1D8D A;  1SA4 A;  1TNY A;  3DSV A;  3HXE A;  1LD7 A;  4GTR A;  3EUV A;  1N94 A;  1N4Q A;  3SFX A;  3Q79 A;  4GTS A;  1TN8 A;  1S63 A;  3Q7A A;  1X81 A;  4YDE A;  3DSS A;  1O1R A;  1DCE A;  3DSW A;  4EHM A;  4L9P A;  1N4P A;  1TN7 A;  1S64 A;  1LTX A;  3DSU A;  1D8E A;  4GTM A;  1N4R A;  2H6H A;  2H6G A;  1FT2 A;  2F0Y A;  3Q73 A;  1JCR A;  3C72 A;  4GTT A;  2R2L A;  2ZIR A;  1FT1 A;  3HXF A;  3Q78 A;  1O5M A;  3KSL A;  1QBQ A;  3DST A;  3KSQ A;  3DSX A;  3E34 A;  3Q75 A;  3Q7F A;  2H6I A;  1N9A A;  1SA5 A;  1N4S A;  4LNB A;  1TNO A;  1O1S A;  3E32 A;  3PZ3 A;  3E30 A;  4GTQ A;  1N95 A;  1LD8 A;  4GTV A;  1TN6 A;  3HXC A;  1KZP A;  3PZ1 A;  2IEJ A;  3E33 A;  3HXB A;  1MZC A;  4GTP A;  1JCQ A;  3EU5 A;  4GTO A;  1FPP A;  1JCS A;  4LNG A;  1TNU A;  3DPY A;  3PZ4 A;  3HXD A;  3SFY A;  2BED A;  1O1T A;  3E37 A;  2H6F A;  4YDO A;  1NL4 A;  1NI1 A;  1TNB A;  2ZIS A; 
#chains in the Genus database with same CATH topology
 3CHO A;  2BTD A;  5CEA A;  3B7S A;  2CFU A;  5T4Y A;  5FZQ A;  1BU9 A;  1TNZ A;  4IRU A;  1K1A A;  5E75 A;  3ABM E;  3HXE A;  5BUZ A;  4J8F A;  5AJD A;  4A1G A;  1L5J A;  2LSU A;  4WNG A;  5ANR A;  3CHM A;  3PUK A;  4ZHB A;  3HYM B;  3FTU A;  4JA9 A;  1N4P A;  4ANU A;  3Q47 B;  3CGH A;  3CVV A;  4J8Y A;  2F8Y A;  2JAB A;  2BUG A;  4AVX A;  2WXF A;  3AG1 E;  1UG3 A;  4BX8 A;  3QB2 A;  4K5A B;  4XKC A;  3D9O A;  5AQB A;  3UM2 A;  3B95 A;  3TWW A;  5J08 A;  2ZIR A;  2LXL A;  4G24 A;  5FQ7 A;  2HYZ A;  3KSL A;  4RSY A;  5JHA A;  3FEX A;  1U3D A;  4IUL A;  1YCS B;  2HM8 A;  2WXG A;  4U96 D;  5EIL A;  1TNO A;  3FTX A;  3TJP A;  4YVO A;  5CER B;  3EIQ C;  2WXK A;  1HE8 A;  4HBD A;  1OWM A;  4HI9 A;  3ZW3 A;  5D66 A;  3AJI A;  4JW1 A;  3VLD A;  3JQ1 A;  4KVO A;  4GCO A;  4FHJ A;  4PUC A;  4PS8 A;  2XCB A;  4DX1 A;  1UW4 B;  3Q49 B;  4M3O A;  2YHC A;  2XS8 A;  4EPZ A;  3MKQ B;  1TYQ G;  3CVL A;  4N3A A;  1NA3 A;  4AOF A;  5FQ4 A;  3PZ2 A;  3LEW A;  4PS7 A;  2ZGD A;  2V4L A;  1OWL A;  3Q7A A;  4G25 A;  5B1B E;  1O1R A;  4FHK A;  5LFA A;  3APC A;  4L9P A;  1S70 B;  4K03 A;  3LVQ E;  4N3B A;  3CVP A;  2DYR E;  3HVE B;  2HR2 A;  3RO2 A;  1EPU A;  4CT0 A;  2GRL A;  4TXP A;  4CGV A;  3ONK A;  3MCX A;  1SW6 A;  2F8X K;  5ENQ D;  3RIB A;  3DWL G;  1H0A A;  3B13 A;  3VLE A;  5FJY A;  2X6F A;  4B93 B;  3PVL A;  4I6E A;  4GMJ A;  2OEW A;  3D9H A;  2WXP A;  3UTM A;  3D9N A;  3UM1 A;  3DBS A;  2FI7 A;  2AXZ A;  3AG4 E;  2UY1 B;  4OAU C;  3TXM A;  3KAE A;  2IY0 C;  4NRH B;  4F1P A;  3RO3 A;  2ILR A;  4G26 A;  4CRW A;  1IKN D;  3OAW A;  1ZU2 A;  3SD5 A;  4UWG A;  4A3V A;  3LVR E;  4AP2 A;  4URK A;  3CHR A;  4XKB A;  2X6K A;  4UUC A;  4HNA D;  3DRA A;  2ETA A;  2C0L A;  1HH8 A;  5ENP D;  5DBK A;  1YA0 A;  4N3C A;  5A23 A;  3QWW A;  4GPM A;  1OUV A;  1X81 A;  3BEE A;  1N11 A;  3DSW A;  4O6F A;  4GA1 A;  3ZUV B;  2FBN A;  2V0P A;  4N39 A;  4J8D A;  4GML A;  3GZS A;  3T9K A;  3LY9 A;  3D9K A;  4WUY A;  3DSU A;  3CVQ A;  5KBA A;  3Q73 A;  1EF1 C;  3DEP A;  3NZU A;  4L23 A;  3NOC D;  1SVX A;  2P9P G;  2WMO A;  5EN5 D;  4BWR A;  1N9A A;  4LNB A;  3L13 A;  1Z3X A;  3JCK C;  4Y6W A;  3PEU B;  1N0R A;  4U0Z A;  3BU8 A;  1ELR A;  2IEJ A;  1S0P A;  5A6C A;  2PQR A;  2HO1 A;  3EU5 A;  1H6O A;  1RZ4 A;  3FUL A;  1JCS A;  1IQR A;  3FU5 A;  3SO8 A;  3ESL A;  4RQI A;  3S7F A;  2RG8 A;  4BTA A;  2R03 A;  4ZFH A;  1HX8 A;  4KVM A;  1N0Q A;  4L2Y A;  3UIP C;  2VGY A;  1A5E A;  1FVH A;  2I2O A;  1D8D A;  1X5B A;  3DSV A;  3RRM B;  3I5P A;  4B94 A;  3ZYQ A;  1KT0 A;  3AS5 A;  1H6K A;  2R02 A;  2XGM A;  4WNF A;  3L08 A;  2VSX E;  3ZHE A;  2ION A;  2P9N G;  4LEU A;  2A4Z A;  5D0O D;  3BUA A;  4W9R A;  4HOT A;  1LTX A;  4JB8 P;  3D9J A;  4UI9 K;  4BX9 A;  1JWG A;  1Y6I A;  2YIN A;  4HLL A;  2XRY A;  4WWN A;  2F0Y A;  4I9E A;  4BY6 A;  3C72 A;  2YQ8 A;  1A17 A;  4DLO A;  5A7D B;  5EDS A;  2OVB A;  4LUN U;  4F53 A;  2GRM A;  4FC8 A;  3S7B A;  3FUI A;  2V5F A;  1SZ9 A;  4HRM B;  4JEU A;  4UI9 J;  4A1S A;  3RK6 A;  3G2W A;  1H19 A;  3DEO A;  4JPS A;  2AWI A;  3NBN B;  1PAQ A;  3FTZ A;  2IU1 A;  3PE4 A;  2L9B A;  3Q9U C;  5FT9 A;  3ZFW A;  3PZ4 A;  2QZA A;  3FTY A;  4AY5 A;  3HRA A;  3D9M A;  2XGO A;  4FJY A;  1MJ0 A;  4DLQ A;  5D0Q D;  4FAD A;  3J5P A;  4O60 A;  1NI1 A;  1RW2 A;  5HKP A;  4J7W A;  2R59 A;  3FH8 A;  3UM3 A;  4OAV B;  3LKU A;  4HFG A;  5CCM A;  2HE0 A;  3EUV A;  3UM0 A;  3TWV A;  4KT6 B;  1DNP A;  4HRL A;  1YYH A;  5AIJ A;  5FWQ A;  2DYS E;  1E90 A;  1TN7 A;  2CFZ A;  1OCZ E;  3U66 A;  2H6G A;  4C48 B;  5JHB A;  4ANV A;  2VSO E;  1NFI E;  1Z6T A;  3LYA A;  2KC7 A;  1TEZ A;  2GRP B;  3HXF A;  3WXX A;  5C1D A;  2I1J A;  5IY5 E;  1EYH A;  2WB2 A;  4CT4 A;  3CR3 A;  1INZ A;  1XNF A;  4I17 A;  3RAU A;  4KZ0 A;  1E8Y A;  5KNG A;  2KCK A;  3HXB A;  3W9F A;  2XEN A;  2CG2 A;  1HG5 A;  3ESK A;  1HO8 A;  2A5U A;  4GZ3 A;  3C3O A;  4I2Z A;  1OY3 D;  4XX5 A;  5AJL A;  3FUJ A;  5E76 A;  3Q9N C;  4N5Q A;  3QKY A;  2P9I G;  3SZ7 A;  3PH0 C;  2WMN A;  3CSF A;  1N94 A;  4UWL A;  1N4Q A;  4B8C B;  3Q79 A;  2GW1 A;  3FUK A;  1S63 A;  4TUM A;  1DCE A;  4EHM A;  5ARG A;  3FFL A;  2XS1 A;  3TWU A;  4D10 C;  4I9C A;  1H2T C;  5G04 C;  4KYO B;  4FJZ A;  2XPZ A;  1QQE A;  4BSX A;  2CG3 A;  4JHK A;  4HRN A;  2PL2 A;  4M7C A;  5CED B;  2IF4 A;  1UN8 A;  1OXJ A;  3AS4 A;  1OCO E;  2LUH A;  3MA5 A;  5EX0 A;  1HFA A;  3ML9 A;  3DST A;  5KJK A;  4JEH A;  3DSX A;  1QYM A;  3TGO A;  2ETB A;  5LP0 A;  3MZL B;  3CHQ A;  2AXU A;  3VTY A;  4FUL A;  4LG6 A;  4FU3 A;  3ISM C;  2QYU A;  2DBA A;  1N95 A;  5JA4 D;  1TN6 A;  3PUJ A;  4F6R D;  3I4G A;  4E6H A;  3MKR A;  1OWO A;  3CKC A;  1MZC A;  1JCQ A;  4GTO A;  2P9L G;  3T8K A;  4NIK A;  4BET A;  3GW4 A;  3CVX A;  1E8Z A;  3KEA A;  4LCT A;  4U8V D;  3ZRH A;  4G1T A;  3MX3 A;  1K8K G;  3E37 A;  5CBO A;  3C3Q A;  5ANL A;  2XEV A;  2J4D A;  5AAO A;  3ZYM A;  2XPI A;  4IN3 B;  4MBG A;  3V30 A;  2KAT A;  2VYI A;  1WY6 A;  4WNE A;  4BES A;  3F6Q A;  3L82 A;  2WXN A;  1TNY A;  4XIF A;  4NQ0 A;  1HU3 A;  3E4B A;  5ENR D;  3CVY A;  3D9L A;  1IHB A;  2JLB A;  5B1A E;  3UKR G;  3ASD A;  3GZ1 A;  3AU5 A;  1QZ2 A;  2ZU6 B;  4Q96 A;  3IHY A;  3CK7 A;  3ZN3 A;  1TJF A;  2LNI A;  1E7U A;  3T5V A;  3EDT B;  4HOU A;  2MYO A;  1BI7 B;  1N4R A;  3UIN C;  3P1U A;  1Z3Y A;  2PQN A;  5AYW D;  3P2B A;  3T8M A;  3CQG B;  4HOS A;  2E2E A;  3V2X A;  4XEI G;  5KCM A;  4GB9 A;  2XZT G;  4J8S A;  4WAF A;  3CVW A;  4GYW A;  2I6H A;  2J49 A;  4GTQ A;  4ILG A;  1IYG A;  4F1S A;  4JD2 G;  3V79 K;  4DPR A;  3CHS A;  3C3R A;  4MKT A;  3LDZ A;  3FU0 A;  3B7U X;  1MYO A;  1IQU A;  2RKK A;  5BXU A;  3ULE G;  3DPY A;  2MOW A;  4ABN A;  3SBT B;  2OVF A;  5G04 J;  1Q2Z A;  4BTB A;  1ZBP A;  2WQ6 A;  4LER A;  3QNK A;  4X8Q A;  3HG0 D;  4UQY A;  3L16 A;  4I1A A;  5DIZ A;  3UUX A;  2XRZ A;  5ENN A;  2WXM A;  4N2Q A;  3APD A;  1HXI A;  4GZ5 A;  2WXI A;  3VLF A;  4JA7 A;  1IHG A;  4XE0 A;  3JYS A;  3R7R A;  1N54 A;  3LPZ A;  4JHR A;  5JJ7 A;  3L6A A;  2IOL A;  3B7R L;  4U07 A;  5AN8 A;  4C0M A;  1GW6 A;  3I4R B;  3MJW A;  3PRE A;  1KLX A;  1B89 A;  3NAW A;  1H2U A;  4A55 A;  3Q4A B;  4JVS A;  2J8S D;  1LF8 A;  4ATG A;  4YVQ C;  3S7D A;  3FTV A;  5ARF A;  2OV8 A;  3LY7 A;  4DX7 D;  4HOR A;  3J5Q B;  2DWZ A;  3E33 A;  1DVP A;  4NAC A;  1FPP A;  3FEY A;  1U3C A;  4LNG A;  1P5Q A;  1TNU A;  4CZ2 D;  4FP7 A;  4DX2 A;  3HXD A;  4BER A;  3SFY A;  4O1O A;  1V54 E;  3QOU A;  4GAA A;  1WDY A;  4XZ4 A;  4I6J A;  1G3N B;  2ZIS A;  3EHM A;  5FTP A;  4AV7 A;  1K3Z D;  4L1B A;  4K0R A;  4U7E B;  4KXK B;  4DX6 D;  2NYJ A;  2J07 A;  4MS6 A;  1OCC E;  3EJN A;  4TXR A;  3NOG D;  1E7V A;  3PEV B;  4P29 A;  1QNF A;  5LCW J;  4G23 A;  3NQP A;  3X2Q E;  4BT8 A;  3TXN A;  1NP7 A;  2XGS A;  1ELW A;  4TUU A;  3K9I A;  3CEQ A;  3UI2 A;  4FLB A;  3D3M A;  4EBA A;  4AY6 A;  4UWF A;  3HDX A;  4G2V A;  3JXJ A;  3Q15 A;  3Q7F A;  5BT1 A;  3R9M A;  3CVN A;  2BKG A;  4Q94 A;  4O1P A;  3ASN E;  4DRX E;  1E96 B;  5EKQ D;  5HRY A;  3UKU G;  5H7P A;  3RRN B;  5CRU A;  4N2S A;  4RLY A;  1UJK A;  3CKB A;  3FHE A;  3MEK A;  2KZT B;  3IHV A;  1TR4 A;  2XEH A;  3FY4 A;  2PZI A;  2WXH A;  4YDY A;  1D9S A;  3TAX A;  4J8E A;  2L0I A;  2P58 C;  1W3B A;  5BNW A;  2BED A;  1MQS A;  4YDO A;  2Y69 E;  5CMY A;  5AAR A;  3SGH A;  2M63 A;  3T5X A;  3FUN A;  4DI4 A;  2Y3A A;  2VGE A;  2B6C A;  2R05 A;  2DIW A;  3RU0 A;  4DX5 D;  2VGX B;  5CBN A;  3PS6 A;  3VTX A;  4DJA A;  2KM4 A;  1TN8 A;  3O48 A;  4YDE A;  4ACK A;  3ZXP A;  3RKV A;  3SY2 A;  1S64 A;  5G2N A;  4B0Z A;  2QYJ A;  3KS2 A;  3FP3 A;  4U63 A;  2J09 A;  1YMP A;  4OVU A;  4BT9 A;  4CYM D;  3OTN A;  4QQI A;  3PNL B;  5BW8 C;  2IJG X;  1QBQ A;  1H6P A;  2BF0 X;  3MYV A;  2I9C A;  2I1K A;  3UT8 A;  1LD8 A;  4GTV A;  2C0M A;  4FLH A;  2PM6 A;  5ENS D;  3I3N A;  4ACL A;  1DC2 A;  3FH7 A;  5HS0 A;  2L6B A;  4EQF A;  3ULQ A;  1ZB1 A;  3MGB A;  3D9P A;  3S2A A;  3R7Q A;  1WAO 1;  3CQC B;  5CHE E;  5AQ9 A;  2UWJ G;  4DUI A;  1O1T A;  4QFV A;  4JZY A;  4OVV A;  2GRN B;  5AEN A;  1JWF A;  3QC1 A;  4XI0 A;  2EIN E;  2FUL A;  3SF4 A;  1KZO A;  1EDU A;  3FUH A;  3OXF A;  4CDR A;  5G05 C;  2IQC A;  3FUM A;  2IO2 C;  3TWT A;  2VSN A;  3RRU A;  5JJT A;  2OCC E;  2XCC A;  5KJM A;  3U4T A;  2DCP A;  5KWD A;  2KCL A;  4NUR A;  2FO7 A;  4J0U A;  4A3T A;  5BV1 A;  3IXE A;  1BI8 B;  3V31 A;  3ASG A;  3UPV A;  3AS8 A;  4HLE A;  1U2V G;  3SI5 A;  1SQM A;  3N71 A;  2H6H A;  2UY1 A;  2B0O E;  3LJ3 A;  5EYP F;  2R2L A;  2LXM A;  3Q78 A;  2AVP A;  4U04 A;  3E34 A;  3ZYL A;  4F3V A;  3GZ2 A;  3TWS A;  4Y6C A;  3O4Z A;  2GRO B;  3UX4 A;  4CEM A;  1O1S A;  4XI9 A;  3L17 A;  1HS6 A;  5ITZ F;  3DXM G;  5M72 A;  4WWP A;  1Y8M A;  3PE3 A;  1E8X A;  3CV0 A;  3NF1 A;  2P9K G;  3V2O A;  2QFC A;  5B3S E;  2WQ7 A;  5FZR A;  2QC9 A;  4PS3 A;  1NZN A;  4IYP A;  1KPS B;  2Y4U A;  1FCH A;  2EQX A;  1JPL A;  3ULY A;  2XQ0 A;  2AXV A;  4DI3 A;  2VSY A;  3L54 A;  2R17 C;  2J9Q A;  2E0I A;  2XEE A;  4RG6 A;  2IO3 C;  4EEC A;  3ZU7 B;  3ONL A;  5KJN A;  3CK9 A;  3DPD A;  1SZA A;  4UWH A;  4DK5 A;  2NSZ A;  4KZC A;  2KBX A;  3SFX A;  3ASF A;  4JC8 A;  1WG0 A;  1PY1 A;  2LO6 A;  3GYZ A;  1FVF A;  3TWQ A;  4B89 A;  5T3R A;  5LOZ A;  4ANX A;  2DVW A;  3AU4 A;  5EIB E;  2OEV A;  1MX6 A;  3HHM A;  3ZKJ A;  4GCN A;  4WND A;  2NC9 A;  1O5M A;  2CHX A;  3KSQ A;  2GRQ B;  3U3W A;  4EZL A;  2VGX A;  4BEP A;  4TV3 A;  5FZS A;  3UT7 A;  3U64 A;  2PM7 A;  1KZP A;  3PZ1 A;  3ML8 A;  3G2U A;  2WXJ A;  3EIJ A;  3ABL E;  2XPY A;  3BG1 B;  4GTP A;  3ZGQ A;  2V5Q C;  4PDX A;  5AQA A;  3TWX A;  3JUE A;  5BPP A;  3QDN A;  3UXG A;  1E8W A;  2IFU A;  3SQV A;  2RFA A;  3ZHE B;  5HI7 A;  2OOE A;  3FUD A;  4U8H A;  3QWV A;  2X3M A;  2H6F A;  2WXO A;  1N52 A;  4L2L A;  3MV2 B;  3LCA A;  4J6I A;  5C2Y A;  3TWR A;  3FU3 A;  2YHE A;  3ENE A;  3UQ3 A;  4HI8 A;  4APF A;  3LXU X;  3AG2 E;  4JHJ A;  4UWK A;  4G8L A;  5KJL A;  4OYS A;  4I6G A;  3HIZ A;  1UN9 A;  2EIL E;  1UJJ A;  2P9U G;  4CCA A;  3APF A;  1HF8 A;  3Q5M A;  2GGF A;  4BFR A;  3ASH A;  1V55 E;  4APO A;  2MHK A;  2V4H C;  1D8E A;  2EIM E;  3TL5 A;  2DZO A;  1FT1 A;  3EHR A;  4GZD A;  4HVB A;  2VQ2 A;  5FQ8 A;  2Y0B G;  2LSV A;  3MV3 B;  4H7X A;  4AIF A;  2DZN A;  3AG3 E;  2VTB A;  2H6I A;  4GA2 A;  1OCR E;  4ILI A;  4U95 D;  1MHQ A;  5CMW A;  2A5E A;  4AXH A;  1PC2 A;  3HXC A;  4HQD A;  5FQ6 A;  3CLJ A;  4G8K A;  5D2M C;  2V8S E;  2PNN A;  3R9A B;  2QY7 A;  4AJW A;  1ELK A;  1BLX B;  1JUQ A;  4GZC A;  2ZXW E;  3UIO C;  3ZVV A;  4FA6 A;  3DXK G;  3D9I A;  5KNH D;  3ZXS A;  1BD8 A;  3G2V A;  2CHZ A;  5LX8 A;  4MRU A;  3NB2 A;  2WM9 A;  2MRI A;  3JUI A;  3KEZ A;  3JXI A;  4ANW A;  2FO1 E;  3AAA C;  4UQZ A;  2GRR B;  1Z5S C;  4GTR A;  4CDN A;  2F37 A;  5J90 A;  4G11 A;  2WXQ A;  3DSS A;  3FU6 A;  4I2W A;  3WG7 E;  3ZIM A;  4H7Y A;  3EHQ A;  5EX3 A;  4JL0 A;  1OWP A;  2FF4 A;  3SNX A;  4N5C A;  3BQO A;  3C98 A;  4ME2 A;  4I1M A;  5BV0 A;  3LJN A;  3W9G A;  2X6H A;  3Q75 A;  3CHP A;  4AM9 A;  4KBQ A;  1N4S A;  2CHW A;  3URZ A;  1BPO A;  2XHE A;  2ETC A;  3ABK E;  3CK8 A;  3CVU A;  3SFZ A;  5T8I A;  3QAQ A;  3FH5 A;  4KMO A;  2WXR A;  2P9S G;  5BXO A;  4V3I A;  3B7B A;  2IOS A;  2XZD G;  2FEZ A;  3TG4 A;  4U0U A;  4L7T A;  2JEK A;  2VJ8 A;  1TNB A;  5CCL A;  4HS2 A;  4R7L A;  4C0E A;  3UT4 A;  4C9B B;  1WM5 A;  5JMN D;  3EHN A;  2KZT A;  3SHF A;  3B7T A;  4LRZ A;  1LD7 A;  4I43 A;  2AW6 A;  5ENT D;  4UI9 C;  1OT8 A;  3BG0 B;  5EID A;  2X6J A;  5G55 A;  3EU9 A;  3QWP A;  2LAH A;  3FUF A;  4RVB A;  2WXL A;  2X6I A;  4AEZ C;  2Y1L E;  1VDY A;  2KCV A;  4GTM A;  2ZGG A;  2L0T B;  1FT2 A;  2J08 A;  4GTT A;  4JXT A;  2Y4T A;  4BSZ B;  3ASO E;  3RJV A;  1HG2 A;  4GYO A;  3MKQ A;  4EZJ A;  1AWC B;  3PZD A;  4E85 A;  2EIJ E;  4B8A A;  3IBE A;  3E32 A;  2AJA A;  3ZPJ A;  3CIA A;  3E30 A;  5ENO D;  3CST A;  4Q69 A;  5AQ7 A;  2J4B A;  4HXI A;  1H2V C;  4HB5 A;  4CGW A;  2WVI A;  1NA0 A;  1OWN A;  4UQX A;  3TG5 A;  3SBS A;  4GU5 A;  4ILH B;  3IEG A;  3S7J A;  4WWO A;  4Z68 A;  4GMR A;  4MLP A;  2LAI A;  2OND A;  5FIO A;  3PDN A;  4GYY A;  4I1O B;  1NL4 A;  4TRQ A;  3FTW A;  2EIK E;  4PH4 B;  4GZ6 A;  4EZK A;  4RG9 A;  4A63 B;  4U0S A;  1K1B A;  3LY8 A;  1SA4 A;  3QJZ A;  1MX4 A;  3ZEF A;  4GA0 A;  3JQ0 A;  3U9W A;  3OXL A;  5CEC B;  4YND A;  4GTS A;  5HQ8 A;  1IXV A;  2Q7F A;  3L9T A;  3C5R A;  5FIN A;  1DCQ A;  4HOQ A;  2R5S A;  3L22 A;  5EYL A;  2RFM A;  3ZNG A;  3G2T A;  3LS8 A;  3ZYK A;  4LNU D;  1XGW A;  2L6J A;  4YDW A;  3FDH A;  2NXP A;  1JCR A;  1KT1 A;  1MX2 A;  3QK0 A;  1UOH A;  3QAR A;  5CRV A;  4EBA G;  3PNT B;  2YNQ A;  4K5C A;  1SA5 A;  5LCW C;  3PZ3 A;  1HZ4 A;  3KD7 A;  3FUE A;  4CDM A;  4LSZ E;  4ATZ D;  2P2C P;  2C2L A;  4GPK A;  2VTB B;  5G05 J;  3FWV A;  3NZS A;  1AP7 A;  4F7A A;  2KXP C;  2RD0 A;  2X38 A;  5JJ6 A;  3IKO B;  3PRZ A;  2WPV A;  2WQH A;  3HVE A;  3UMV A;  4TXQ A;  3RSE G;  2BKK B;  3IV0 A;  3FTS A;  4U8Y D;  4K5B A;  3OXG A;  1TJC A;  3G2S A; 
#chains in the Genus database with same CATH homology
 4MBG A;  3DRA A;  3PZ2 A;  1KZO A;  1TNZ A;  1D8D A;  1SA4 A;  1TNY A;  3DSV A;  3HXE A;  1LD7 A;  4GTR A;  3EUV A;  1N94 A;  1N4Q A;  3SFX A;  3Q79 A;  4GTS A;  1TN8 A;  1S63 A;  3Q7A A;  1X81 A;  4YDE A;  3DSS A;  1O1R A;  1DCE A;  3DSW A;  4EHM A;  4L9P A;  1N4P A;  1TN7 A;  1S64 A;  1LTX A;  3DSU A;  1D8E A;  4GTM A;  1N4R A;  2H6H A;  2H6G A;  1FT2 A;  2F0Y A;  3Q73 A;  1JCR A;  3C72 A;  4GTT A;  2R2L A;  2ZIR A;  1FT1 A;  3HXF A;  3Q78 A;  1O5M A;  3KSL A;  1QBQ A;  3DST A;  3KSQ A;  3DSX A;  3E34 A;  3Q75 A;  3Q7F A;  2H6I A;  1N9A A;  1SA5 A;  1N4S A;  4LNB A;  1TNO A;  1O1S A;  3E32 A;  3PZ3 A;  3E30 A;  4GTQ A;  1N95 A;  1LD8 A;  4GTV A;  1TN6 A;  3HXC A;  1KZP A;  3PZ1 A;  2IEJ A;  3E33 A;  3HXB A;  1MZC A;  4GTP A;  1JCQ A;  3EU5 A;  4GTO A;  1FPP A;  1JCS A;  4LNG A;  1TNU A;  3DPY A;  3PZ4 A;  3HXD A;  3SFY A;  2BED A;  1O1T A;  3E37 A;  2H6F A;  4YDO A;  1NL4 A;  1NI1 A;  1TNB A;  2ZIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...