1TNUA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
molecule keywords geranylgeranyltransferase type I alpha subunit
source organism Rattus norvegicus
molecule tags Transferase
total genus 130
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnuA00
3Q73A 4YDEA 3HXFA 3SFYA 1KZOA 3DSXA 1NI1A 3C72A 1N4RA 2H6HA 1FT2A 4LNGA 4LNBA 3Q75A 4EHMA 3DSWA 2H6GA 2R2LA 3E33A 1N9AA 1JCQA 3KSLA 3KSQA 1O1TA 3E32A 1N4QA 1N94A 1TN8A 1NL4A 1FPPA 4YDOA 3DSVA 3Q79A 1D8EA 1O1RA 2IEJA 1QBQA 3DRAA 1S63A 4GTOA 3DSSA 2H6IA 3DSUA 3Q78A 3EU5A 3PZ3A 4GTTA 1N95A 3Q7FA 3HXEA 3HXBA 1JCRA 3DPYA 1JCSA 4GTMA 1LD8A 1TNUA 3E30A 4GTPA 1TN7A 1TNZA 3PZ1A 3SFXA 4GTSA 2ZIRA 4GTRA 1S64A 2BEDA 1O1SA 3HXCA 1MZCA 3HXDA 1KZPA 3EUVA 4GTVA 1FT1A 1N4PA 1SA5A 2ZISA 3PZ4A 2F0YA 1LD7A 1X81A 3PZ2A 3DSTA 1TNYA 4L9PA 1DCEA 3Q7AA 1TNBA 1O5MA 1TN6A 2H6FA 3E37A 4MBGA 1TNOA 4GTQA 1LTXA 1N4SA 1SA4A 1D8DA 3E34A
chains in the Genus database with same CATH superfamily
5HRYA 4XIFA 2XPIA 3ASGA 4IN3B 2IFUA 2IJGX 1TEZA 4UI9J 4LSZE 4ZHBA 1NP7A 3FTXA 1S0PA 4TUMA 1HZ4A 3SO8A 5CCLA 2GRRB 4JPSA 3ZYQA 5FZQA 2DZNA 3FUKA 4WWOA 1IHBA 5KJMA 1U3CA 3FUNA 5BXUA 4DRXE 3TL5A 3NB2A 1KT0A 2WM9A 3NAWA 3FEYA 2JEKA 5CRVA 5ANRA 4G11A 3SQVA 4GTMA 3EHRA 3FUHA 4U0ZA 1JWFA 2KC7A 3CHSA 2I9CA 3PE3A 2ZGDA 4DPRA 3CQCB 2WXFA 2WVIA 3QK0A 3B7SA 4JW1A 4BTAA 4U63A 1H2UA 1SA5A 3ASFA 5EIDA 5ARFA 4HOSA 4U0SA 4HS2A 1AP7A 2NC9A 1ZBPA 3QARA 3ZYMA 3CQGB 3VTXA 3CHPA 3CLJA 3E37A 4O1OA 3TWUA 3C98A 2CHWA 4TXQA 3DWLG 2WXLA 5EN5D 5T8IA 1PY1A 2F37A 5T4YA 3FUDA 1H0AA 3MKQB 5FZSA 2LO6A 4ILHB 3RJVA 2GGFA 4UWLA 1OCOE 2MRIA 2NYJA 2Y0BG 1OT8A 3LCAA 2KZTA 3UTMA 1YMPA 1V54E 2HE0A 2HYZA 1XGWA 2IY0C 3OXLA 4O1PA 4URKA 4XKCA 4UWGA 4GA2A 2FO1E 3NBNB 3S2AA 4P29A 5JHBA 4APOA 3UT7A 4N3CA 2IEJA 1GW6A 2DBAA 3EHNA 1Z3YA 3CVNA 5CRUA 1TJFA 3FU3A 2R02A 2V0PA 3IXEA 4DX1A 4BT9A 3JUEA 3RAUA 1TN7A 2OVFA 1TNZA 2RG8A 3LJ3A 4FP7A 5E75A 5CECB 4I1MA 3ESLA 4A63B 2OOEA 2ETAA 1BPOA 1TNBA 3Q9NC 3BQOA 1IYGA 3AJIA 2FBNA 3Q4AB 5AENA 4AEZC 4BTBA 2X6FA 3DXMG 2KXPC 3RK6A 3TXMA 2PZIA 5JJ7A 4GPMA 3PUKA 3IHVA 2UWJG 3MZLB 2MHKA 4L7TA 4U8YD 3WXXA 1HFAA 4OVUA 2VSXE 3LEWA 1SW6A 3QJZA 4B94A 2WXRA 3L6AA 4GYOA 4XZ4A 3D9KA 1Y8MA 5HI7A 3S7BA 3ULYA 4TXRA 5CBNA 2ZXWE 4EZLA 1E8WA 1UW4B 4WAFA 1N11A 1O1RA 1BLXB 2H6IA 3DSSA 4M7CA 3ESKA 2L0TB 2WXQA 5EYLA 4N39A 3EU9A 4ILGA 2MYOA 5FQ7A 4G1TA 3ONKA 4W9RA 3AS8A 4LRZA 3MJWA 2WQ6A 3JCKC 2EILE 3ABME 3D9IA 1MZCA 5FIOA 3UT8A 3DSTA 4G2VA 5FZRA 2P9NG 3Q7AA 3UKRG 5G05C 5JJ6A 3FUFA 4F7AA 4GA1A 4MLPA 4C0MA 3E34A 4XI9A 3RRMB 4DX5D 4CEMA 1SZ9A 1H19A 3MEKA 2YHCA 3S7DA 3SD5A 3ABKE 3IEGA 5HKPA 1K1BA 2EINE 3HDXA 2GRNB 2BF0X 4FADA 3FTYA 4KZ0A 2XHEA 5B1AE 1Z3XA 3CKBA 4I9EA 1ZB1A 4NURA 4EHMA 5KNGA 4JC8A 4B0ZA 4J8YA 4XEIG 1B89A 3KSQA 5FQ8A 2ONDA 1QNFA 2FF4A 2VGXA 3EHQA 4BETA 2DZOA 1FPPA 2RFAA 4HBDA 2C2LA 1D8EA 4WUYA 3SGHA 3ZIMA 1P5QA 4CCAA 2JABA 5J90A 2QC9A 3HXEA 2WXKA 2QFCA 4BEPA 1MX2A 2Y4TA 3UINC 3U4TA 4JA7A 1E8XA 3HIZA 4L1BA 3PZ1A 3UIPC 3HG0D 3JUIA 3ML8A 4KYOB 2BEDA 5BV0A 1N54A 2XPYA 3JQ0A 1OWMA 3FU5A 3CGHA 2VSOE 3LVRE 1FVHA 3GZ2A 3C3RA 5C1DA 4G26A 3EIJA 4X8QA 3T5XA 3ABLE 2B0OE 4GYWA 5KNHD 2L9BA 1UOHA 4DX7D 3DEOA 5JMND 3TWQA 4NIKA 2I1KA 4MRUA 3TWWA 4ANWA 3FEXA 4K5AB 2A5UA 4YVOA 2VGYA 4RQIA 3ZW3A 3CVXA 4EQFA 2PL2A 3ZNGA 4I17A 1FVFA 2X6HA 3AAAC 1H6PA 1A17A 4RG6A 4XI0A 4RG9A 2UY1B 1TN8A 4Y6WA 4HLLA 2WQ7A 2A4ZA 2IU1A 3D9MA 4JHRA 4LNUD 2IOSA 3PZDA 2WB2A 5AARA 3URZA 3B7TA 3B13A 3I4RB 1E8YA 4U04A 2GRLA 4N2SA 4CGVA 1EDUA 3V79K 1OCZE 3AU5A 4A1GA 3CVUA 3FU6A 5CMWA 1WDYA 3KAEA 1UN9A 4XE0A 4AIFA 1NA0A 5LCWJ 4XX5A 3HVEB 3ZHEB 2AW6A 4U07A 3ZN3A 3PE4A 2EIKE 2EQXA 3GW4A 5AIJA 4DX2A 5BNWA 1W3BA 5G04C 3L82A 2ETBA 2V4LA 5D66A 2BKGA 5C2YA 2HM8A 4DLQA 2VTBB 4UI9C 3JYSA 1E90A 3TJPA 1Z6TA 3FUIA 2KCKA 4PH4B 2L6BA 1KPSB 4BY6A 3E33A 2R05A 1JCQA 5AN8A 4FULA 4LG6A 3ZYKA 3LY8A 3LKUA 4BSXA 3DRAA 3O4ZA 1MHQA 1OY3D 3FH5A 3ZYLA 3TG5A 4EECA 4ACLA 2P9SG 4O6FA 2VQ2A 2VYIA 3BEEA 3CHMA 4GU5A 2XRYA 3AS4A 3BG1B 3SFZA 4B93B 3DBSA 3PZ2A 3QB2A 5CBOA 3FTWA 2PNNA 5AQ7A 2MOWA 3R9MA 1SA4A 4AM9A 2DVWA 5KWDA 3IKOB 4FC8A 4GMLA 5ENTD 4GZCA 2P9LG 2WXIA 3KEZA 2XGOA 4JEHA 4ABNA 2R17C 2LAIA 3BUAA 2AJAA 5LFAA 1QZ2A 1NA3A 2P2CP 2B6CA 1HS6A 4HI8A 3APCA 4GZ5A 4APFA 1IXVA 2H6GA 2LSVA 3CK8A 3AU4A 2P9UG 1N4QA 2CG2A 3CSTA 2LUHA 3HVEA 3MYVA 4CRWA 2YHEA 2J07A 4U0UA 3L9TA 2R03A 3R7QA 3TWRA 4G8LA 4FLHA 4HRLA 2ILRA 4KVMA 4GTOA 3DSUA 2AXUA 4DUIA 4UWFA 3B7BA 1BI8B 3RO3A 3QOUA 4E85A 3CVYA 4F1SA 1E96B 4PS3A 4GTSA 3UI2A 4BWRA 4I6GA 4IULA 1E7UA 4HNAD 3HXDA 3NOCD 4CDNA 1FT1A 3QC1A 1N4PA 4EZKA 1X81A 4HFGA 4L9PA 5FTPA 1KLXA 1WM5A 3PS6A 3ZFWA 3LS8A 1MJ0A 4BESA 4LCTA 3Q73A 3LYAA 3LXUX 3FUEA 3AG1E 4ZFHA 1L5JA 4K03A 3X2QE 1UJKA 3MKRA 3BU8A 3T8KA 1V55E 3PEUB 4B89A 3V2XA 4A55A 3C3OA 3CK9A 2IOLA 4CDRA 3T9KA 1EPUA 4BT8A 3WG7E 4C9BB 3DSWA 2R2LA 4NACA 5EIBE 1ELWA 1U2VG 5ENQD 3ZVVA 3B7UX 3UQ3A 4WWNA 3N71A 3VLFA 4HOQA 3FTUA 1LF8A 5E76A 4ACKA 3DSVA 3UT4A 2X6IA 4TXPA 5EYPF 4G23A 3Q15A 2YINA 3ULQA 5G2NA 4J6IA 1JCRA 2F8XK 2XENA 4I1OB 3QKYA 4BFRA 3MV3B 4FJZA 2DYRE 5CHEE 4GTRA 3PREA 1H2VC 3HXCA 3ULEG 3RRUA 1OWNA 3UIOC 4GZDA 3EUVA 1H2TC 3CK7A 2KCVA 3UKUG 4YDWA 2M63A 2LXLA 1IQRA 5BV1A 4WWPA 1TNOA 3G2SA 3MKQA 5HS0A 3PVLA 3HXFA 5ENPD 2FULA 3CVQA 4AOFA 1OCRE 4OVVA 4J0UA 3DSXA 4L2LA 3GYZA 4ATZD 2J8SD 3HYMB 4Z68A 2WXHA 1HU3A 3UM3A 3EHMA 1YA0A 4BX8A 1MQSA 3FULA 3TWVA 4EBAG 3S7JA 3SF4A 4JD2G 3SBSA 3HRAA 4K5CA 3CV0A 4DI4A 2WXJA 5IY5E 3APDA 3U64A 4J8FA 4OAUC 2DIWA 4FU3A 2CFZA 3FHEA 4LUNU 4F6RD 5AAOA 4GTTA 5KJKA 1N95A 3L17A 3QWVA 4U8HA 4KXKB 4ILIA 4PS7A 3E30A 3L08A 2IO2C 4GTPA 2NXPA 3CHOA 3K9IA 1ZU2A 3J5QB 3IV0A 2NSZA 4I1AA 4A3TA 3LVQE 5ENSD 1OWPA 4KT6B 5JA4D 1IHGA 2OVBA 4G24A 2AWIA 3QAQA 5DBKA 4U8VD 4FHKA 4G25A 3TWSA 3NQPA 4I9CA 2L6JA 3LPZA 3J5PA 2L0IA 5J08A 5AJDA 3ENEA 3DPDA 1RZ4A 4GAAA 4I2WA 3G2WA 3U66A 4AV7A 3L54A 3TWXA 3GZ1A 2LAHA 5ENNA 2X38A 4V3IA 5BW8C 1O1TA 3ASDA 4HORA 2XGMA 4DI3A 2GRQB 2AVPA 4GMJA 4L23A 5AYWD 3SY2A 1NL4A 5BUZA 5D0QD 5ENOD 3EDTB 3OXFA 3DEPA 4U96D 2J4BA 1IKND 3FTSA 2I1JA 3MCXA 3PNTB 5AQBA 2ETCA 3EJNA 4QQIA 2CHZA 3UM2A 2XEHA 4ME2A 3G2TA 3KEAA 5A6CA 1Y6IA 1Z5SC 5LCWC 4A3VA 4MS6A 2ZIRA 4R7LA 2OEVA 3C5RA 5ARGA 2FO7A 3I5PA 2Y69E 2HO1A 5EKQD 2CHXA 4UI9K 5CEDB 2IO3C 3L13A 5B3SE 2GRPB 1TN6A 4UUCA 4LERA 4YNDA 1LTXA 2F8YA 4HB5A 2I2OA 1A5EA 1BD8A 3ZU7B 3U3WA 3P1UA 5CEAA 4AY5A 3CHQA 3VLDA 4N3BA 1HO8A 3ZXSA 2GROB 3L22A 4ANXA 5FT9A 3TGOA 4UQXA 1N9AA 1OXJA 2IONA 5EX0A 3MX3A 3VTYA 3ZUVB 1K8KG 2KZTB 4NRHB 4AP2A 5CCMA 3ZXPA 2XS8A 4HOUA 4GMRA 3PDNA 2J08A 3ZRHA 2OEWA 3F6QA 5LX8A 3DPYA 1OWOA 1JCSA 1TR4A 1E7VA 2WXGA 1INZA 2J9QA 3EIQC 3U9WA 1YYHA 2AXVA 2CFUA 3PEVB 4FHJA 3CEQA 4RSYA 1HG5A 3V2OA 2ZGGA 5BXOA 3CVLA 3PRZA 3QNKA 5EDSA 4OYSA 4J8SA 4B8CB 1O1SA 3PNLB 4AJWA 3Q49B 1QYMA 2E2EA 2FI7A 3AG2E 4GZ6A 4KZCA 4AVXA 1TNYA 4ATGA 5ANLA 1DNPA 3HHMA 5LP0A 4WNFA 5AQAA 3SI5A 3KS2A 4TV3A 3ZPJA 4HI9A 1DC2A 1UJJA 2KCLA 4UWKA 1QQEA 4YDYA 4AY6A 3ZGQA 2QYJA 4AXHA 4HRNA 3TG4A 3NOGD 1N4RA 4I6EA 4N3AA 2C0LA 1FCHA 2UY1A 3T5VA 1HX8A 4DK5A 4H7YA 3KSLA 5ITZF 4DLOA 1EF1C 3O48A 2WXOA 2LXMA 5DIZA 2WXNA 2WMOA 4IRUA 1DVPA 3RKVA 4CZ2D 4U95D 3R7RA 5FINA 5AJLA 3MV2B 2QZAA 5B1BE 3EU5A 4I2ZA 3LDZA 1VDYA 2CG3A 2WXMA 3FUJA 4LEUA 5KBAA 4DJAA 3ZHEA 3VLEA 3SBTB 2XEEA 2ZU6B 1H6OA 3W9GA 4HOTA 2GW1A 2PQRA 3FTVA 4WNEA 3D3MA 3D9NA 3FY4A 3PH0C 1UG3A 2WQHA 3S7FA 1HF8A 1LD7A 5FQ6A 1JWGA 2R5SA 1XNFA 4PUCA 2VTBA 1HE8A 1UN8A 2H6FA 4MBGA 2XQ0A 3TWTA 1MYOA 4Y6CA 4I43A 3FWVA 3W9FA 2PQNA 2VSYA 4YDEA 2IF4A 3CSFA 2V8SE 5KCMA 3SFYA 3PUJA 4OAVB 2QY7A 3B95A 2WPVA 2C0MA 3NZUA 4K0RA 2XEVA 2RKKA 4UQZA 4LNBA 4EZJA 3B7RL 1BI7B 3ASNE 2Y4UA 2XGSA 2R59A 3ASHA 3E32A 1OWLA 1N94A 3CIAA 5JHAA 4D10C 3FU0A 3DXKG 3TXNA 5T3RA 2KATA 3RO2A 4PS8A 1DCQA 3LJNA 1SQMA 4DX6D 1EYHA 5D0OD 2X3MA 1S63A 2VGXB 3IBEA 3PZ3A 1HXIA 4TUUA 4C0EA 1K3ZD 2BKKB 3ONLA 5KJLA 2YQ8A 4N5CA 4WNDA 4E6HA 4YVQC 4B8AA 1S64A 2P58C 5KJNA 1N52A 3C3QA 3FUMA 3JXJA 4TRQA 2ZISA 3PZ4A 2EIJE 1ELKA 1TJCA 3CVWA 2X6JA 4HLEA 1E8ZA 1N0QA 5H7PA 2PM6A 3QWPA 4RLYA 5CMYA 5A23A 3AS5A 1YCSB 2BTDA 1H6KA 4I6JA 3P2BA 3ZEFA 5HQ8A 3FDHA 4J7WA 1NI1A 3RIBA 3JQ1A 3I3NA 4FA6A 2DYSE 1FT2A 4QFVA 2PM7A 2OCCE 3APFA 4ANVA 4EPZA 3UXGA 5M72A 3D9HA 4JEUA 2XZTG 2BUGA 4JHKA 3RU0A 4NQ0A 5FQ4A 3OAWA 2P9IG 2XCBA 3Q79A 4CT0A 1U3DA 3AG3E 3V30A 2Y1LE 3D9JA 3Q7FA 3MA5A 2V5QC 3GZSA 3HXBA 1G3NB 1TNUA 4GYYA 3LY7A 4Q69A 4L2YA 4GB9A 1K1AA 4Q96A 5G55A 4GZ3A 4JZYA 3E4BA 1KT1A 3MGBA 4JL0A 2WXPA 4GA0A 4JB8P 2P9PG 3UUXA 4XKBA 3UM1A 4CYMD 2RD0A 3SNXA 4F1PA 4M3OA 4KVOA 4RVBA 4HXIA 3NF1A 4GTQA 3ZKJA 4F3VA 1OCCE 5JJTA 2V5FA 2KBXA 2Y3AA 2IQCA 5G05J 3FFLA 4BX9A 2P9KG 5BT1A 1MX6A 4IYPA 2A5EA 4N5QA 1NFIE 1MX4A 4JHJA 4HQDA 5A7DB 2KM4A 5BPPA 3CHRA 4EBAA 4J8EA 3C72A 4KBQA 1SZAA 4K5BA 3CVPA 3ISMC 2YNQA 4O60A 2XZDG 4HRMB 1AWCB 4GCNA 3Q75A 2XRZA 1HG2A 4G8KA 3Q47B 3UPVA 2HR2A 2Q7FA 5EILA 1WAO1 1D9SA 2DWZA 1RW2A 4BSZB 4U7EB 4N2QA 4YDOA 1IQUA 3LY9A 5CERB 1QBQA 1NZNA 2WMNA 1OUVA 2GRMA 3Q78A 4J8DA 1BU9A 4C48B 3SZ7A 5LOZA 1TYQG 1LD8A 3KD7A 5FWQA 2V4HC 4JA9A 3UX4A 4FLBA 1X5BA 2J09A 3D9LA 1KZPA 4GTVA 3IHYA 3R9AB 2F0YA 2X6KA 5EX3A 4FJYA 2XCCA 3OTNA 2LSUA 1DCEA 1PAQA 4A1SA 2OV8A 3FH8A 3FH7A 4Q94A 4F53A 2QYUA 1Q2ZA 1N4SA 3G2UA 3BG0B 1D8DA 2E0IA 2I6HA 4BERA 1KZOA 1ELRA 3ML9A 3V31A 2J49A 1N0RA 3TAXA 3NZSA 3D9OA 4PDXA 3CR3A 4GCOA 4HVBA 3I4GA 2H6HA 1HH8A 1JPLA 3QWWA 4LNGA 2DCPA 4MKTA 2XPZA 3L16A 2VSNA 4JVSA 3Q5MA 4UWHA 4KMOA 3Q9UC 2FEZA 2AXZA 4GPKA 5FJYA 3QDNA 3SHFA 3CVVA 3JXIA 1PC2A 1SVXA 3ASOE 1WG0A 3CKCA 2XS1A 2VJ8A 3FTZA 4UQYA 3OXGA 5D2MC 4CDMA 1WY6A 4JXTA 1JUQA 2RFMA 3RRNB 2EIME 4ANUA 3FP3A 3SFXA 3UM0A 5AQ9A 4WNGA 3D9PA 3G2VA 5ENRD 1O5MA 2LNIA 2VGEA 4H7XA 4CGWA 3RSEG 3UMVA 3T8MA 4CT4A 1S70B 2J4DA 2JLBA 3AG4E 5G04J
chains in the Genus database with same CATH topology
3Q73A 4YDEA 3HXFA 3SFYA 1KZOA 3DSXA 1NI1A 3C72A 1N4RA 2H6HA 1FT2A 4LNGA 4LNBA 3Q75A 4EHMA 3DSWA 2H6GA 2R2LA 3E33A 1N9AA 1JCQA 3KSLA 3KSQA 1O1TA 3E32A 1N4QA 1N94A 1TN8A 1NL4A 1FPPA 4YDOA 3DSVA 3Q79A 1D8EA 1O1RA 2IEJA 1QBQA 3DRAA 1S63A 4GTOA 3DSSA 2H6IA 3DSUA 3Q78A 3EU5A 3PZ3A 4GTTA 1N95A 3Q7FA 3HXEA 3HXBA 1JCRA 3DPYA 1JCSA 4GTMA 1LD8A 1TNUA 3E30A 4GTPA 1TN7A 1TNZA 3PZ1A 3SFXA 4GTSA 2ZIRA 4GTRA 1S64A 2BEDA 1O1SA 3HXCA 1MZCA 3HXDA 1KZPA 3EUVA 4GTVA 1FT1A 1N4PA 1SA5A 2ZISA 3PZ4A 2F0YA 1LD7A 1X81A 3PZ2A 3DSTA 1TNYA 4L9PA 1DCEA 3Q7AA 1TNBA 1O5MA 1TN6A 2H6FA 3E37A 4MBGA 1TNOA 4GTQA 1LTXA 1N4SA 1SA4A 1D8DA 3E34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q73 A;  4YDE A;  3HXF A;  3SFY A;  1KZO A;  3DSX A;  1NI1 A;  3C72 A;  1N4R A;  2H6H A;  1FT2 A;  4LNG A;  4LNB A;  3Q75 A;  4EHM A;  3DSW A;  2H6G A;  2R2L A;  3E33 A;  1N9A A;  1JCQ A;  3KSL A;  3KSQ A;  1O1T A;  3E32 A;  1N4Q A;  1N94 A;  1TN8 A;  1NL4 A;  1FPP A;  4YDO A;  3DSV A;  3Q79 A;  1D8E A;  1O1R A;  2IEJ A;  1QBQ A;  3DRA A;  1S63 A;  4GTO A;  3DSS A;  2H6I A;  3DSU A;  3Q78 A;  3EU5 A;  3PZ3 A;  4GTT A;  1N95 A;  3Q7F A;  3HXE A;  3HXB A;  1JCR A;  3DPY A;  1JCS A;  4GTM A;  1LD8 A;  1TNU A;  3E30 A;  4GTP A;  1TN7 A;  1TNZ A;  3PZ1 A;  3SFX A;  4GTS A;  2ZIR A;  4GTR A;  1S64 A;  2BED A;  1O1S A;  3HXC A;  1MZC A;  3HXD A;  1KZP A;  3EUV A;  4GTV A;  1FT1 A;  1N4P A;  1SA5 A;  2ZIS A;  3PZ4 A;  2F0Y A;  1LD7 A;  1X81 A;  3PZ2 A;  3DST A;  1TNY A;  4L9P A;  1DCE A;  3Q7A A;  1TNB A;  1O5M A;  1TN6 A;  2H6F A;  3E37 A;  4MBG A;  1TNO A;  4GTQ A;  1LTX A;  1N4S A;  1SA4 A;  1D8D A;  3E34 A; 
#chains in the Genus database with same CATH topology
 5HRY A;  4XIF A;  2XPI A;  3ASG A;  4IN3 B;  2IFU A;  2IJG X;  1TEZ A;  4UI9 J;  4LSZ E;  4ZHB A;  1NP7 A;  3FTX A;  1S0P A;  4TUM A;  1HZ4 A;  3SO8 A;  5CCL A;  2GRR B;  4JPS A;  3ZYQ A;  5FZQ A;  2DZN A;  3FUK A;  4WWO A;  1IHB A;  5KJM A;  1U3C A;  3FUN A;  5BXU A;  4DRX E;  3TL5 A;  3NB2 A;  1KT0 A;  2WM9 A;  3NAW A;  3FEY A;  2JEK A;  5CRV A;  5ANR A;  4G11 A;  3SQV A;  4GTM A;  3EHR A;  3FUH A;  4U0Z A;  1JWF A;  2KC7 A;  3CHS A;  2I9C A;  3PE3 A;  2ZGD A;  4DPR A;  3CQC B;  2WXF A;  2WVI A;  3QK0 A;  3B7S A;  4JW1 A;  4BTA A;  4U63 A;  1H2U A;  1SA5 A;  3ASF A;  5EID A;  5ARF A;  4HOS A;  4U0S A;  4HS2 A;  1AP7 A;  2NC9 A;  1ZBP A;  3QAR A;  3ZYM A;  3CQG B;  3VTX A;  3CHP A;  3CLJ A;  3E37 A;  4O1O A;  3TWU A;  3C98 A;  2CHW A;  4TXQ A;  3DWL G;  2WXL A;  5EN5 D;  5T8I A;  1PY1 A;  2F37 A;  5T4Y A;  3FUD A;  1H0A A;  3MKQ B;  5FZS A;  2LO6 A;  4ILH B;  3RJV A;  2GGF A;  4UWL A;  1OCO E;  2MRI A;  2NYJ A;  2Y0B G;  1OT8 A;  3LCA A;  2KZT A;  3UTM A;  1YMP A;  1V54 E;  2HE0 A;  2HYZ A;  1XGW A;  2IY0 C;  3OXL A;  4O1P A;  4URK A;  4XKC A;  4UWG A;  4GA2 A;  2FO1 E;  3NBN B;  3S2A A;  4P29 A;  5JHB A;  4APO A;  3UT7 A;  4N3C A;  2IEJ A;  1GW6 A;  2DBA A;  3EHN A;  1Z3Y A;  3CVN A;  5CRU A;  1TJF A;  3FU3 A;  2R02 A;  2V0P A;  3IXE A;  4DX1 A;  4BT9 A;  3JUE A;  3RAU A;  1TN7 A;  2OVF A;  1TNZ A;  2RG8 A;  3LJ3 A;  4FP7 A;  5E75 A;  5CEC B;  4I1M A;  3ESL A;  4A63 B;  2OOE A;  2ETA A;  1BPO A;  1TNB A;  3Q9N C;  3BQO A;  1IYG A;  3AJI A;  2FBN A;  3Q4A B;  5AEN A;  4AEZ C;  4BTB A;  2X6F A;  3DXM G;  2KXP C;  3RK6 A;  3TXM A;  2PZI A;  5JJ7 A;  4GPM A;  3PUK A;  3IHV A;  2UWJ G;  3MZL B;  2MHK A;  4L7T A;  4U8Y D;  3WXX A;  1HFA A;  4OVU A;  2VSX E;  3LEW A;  1SW6 A;  3QJZ A;  4B94 A;  2WXR A;  3L6A A;  4GYO A;  4XZ4 A;  3D9K A;  1Y8M A;  5HI7 A;  3S7B A;  3ULY A;  4TXR A;  5CBN A;  2ZXW E;  4EZL A;  1E8W A;  1UW4 B;  4WAF A;  1N11 A;  1O1R A;  1BLX B;  2H6I A;  3DSS A;  4M7C A;  3ESK A;  2L0T B;  2WXQ A;  5EYL A;  4N39 A;  3EU9 A;  4ILG A;  2MYO A;  5FQ7 A;  4G1T A;  3ONK A;  4W9R A;  3AS8 A;  4LRZ A;  3MJW A;  2WQ6 A;  3JCK C;  2EIL E;  3ABM E;  3D9I A;  1MZC A;  5FIO A;  3UT8 A;  3DST A;  4G2V A;  5FZR A;  2P9N G;  3Q7A A;  3UKR G;  5G05 C;  5JJ6 A;  3FUF A;  4F7A A;  4GA1 A;  4MLP A;  4C0M A;  3E34 A;  4XI9 A;  3RRM B;  4DX5 D;  4CEM A;  1SZ9 A;  1H19 A;  3MEK A;  2YHC A;  3S7D A;  3SD5 A;  3ABK E;  3IEG A;  5HKP A;  1K1B A;  2EIN E;  3HDX A;  2GRN B;  2BF0 X;  4FAD A;  3FTY A;  4KZ0 A;  2XHE A;  5B1A E;  1Z3X A;  3CKB A;  4I9E A;  1ZB1 A;  4NUR A;  4EHM A;  5KNG A;  4JC8 A;  4B0Z A;  4J8Y A;  4XEI G;  1B89 A;  3KSQ A;  5FQ8 A;  2OND A;  1QNF A;  2FF4 A;  2VGX A;  3EHQ A;  4BET A;  2DZO A;  1FPP A;  2RFA A;  4HBD A;  2C2L A;  1D8E A;  4WUY A;  3SGH A;  3ZIM A;  1P5Q A;  4CCA A;  2JAB A;  5J90 A;  2QC9 A;  3HXE A;  2WXK A;  2QFC A;  4BEP A;  1MX2 A;  2Y4T A;  3UIN C;  3U4T A;  4JA7 A;  1E8X A;  3HIZ A;  4L1B A;  3PZ1 A;  3UIP C;  3HG0 D;  3JUI A;  3ML8 A;  4KYO B;  2BED A;  5BV0 A;  1N54 A;  2XPY A;  3JQ0 A;  1OWM A;  3FU5 A;  3CGH A;  2VSO E;  3LVR E;  1FVH A;  3GZ2 A;  3C3R A;  5C1D A;  4G26 A;  3EIJ A;  4X8Q A;  3T5X A;  3ABL E;  2B0O E;  4GYW A;  5KNH D;  2L9B A;  1UOH A;  4DX7 D;  3DEO A;  5JMN D;  3TWQ A;  4NIK A;  2I1K A;  4MRU A;  3TWW A;  4ANW A;  3FEX A;  4K5A B;  2A5U A;  4YVO A;  2VGY A;  4RQI A;  3ZW3 A;  3CVX A;  4EQF A;  2PL2 A;  3ZNG A;  4I17 A;  1FVF A;  2X6H A;  3AAA C;  1H6P A;  1A17 A;  4RG6 A;  4XI0 A;  4RG9 A;  2UY1 B;  1TN8 A;  4Y6W A;  4HLL A;  2WQ7 A;  2A4Z A;  2IU1 A;  3D9M A;  4JHR A;  4LNU D;  2IOS A;  3PZD A;  2WB2 A;  5AAR A;  3URZ A;  3B7T A;  3B13 A;  3I4R B;  1E8Y A;  4U04 A;  2GRL A;  4N2S A;  4CGV A;  1EDU A;  3V79 K;  1OCZ E;  3AU5 A;  4A1G A;  3CVU A;  3FU6 A;  5CMW A;  1WDY A;  3KAE A;  1UN9 A;  4XE0 A;  4AIF A;  1NA0 A;  5LCW J;  4XX5 A;  3HVE B;  3ZHE B;  2AW6 A;  4U07 A;  3ZN3 A;  3PE4 A;  2EIK E;  2EQX A;  3GW4 A;  5AIJ A;  4DX2 A;  5BNW A;  1W3B A;  5G04 C;  3L82 A;  2ETB A;  2V4L A;  5D66 A;  2BKG A;  5C2Y A;  2HM8 A;  4DLQ A;  2VTB B;  4UI9 C;  3JYS A;  1E90 A;  3TJP A;  1Z6T A;  3FUI A;  2KCK A;  4PH4 B;  2L6B A;  1KPS B;  4BY6 A;  3E33 A;  2R05 A;  1JCQ A;  5AN8 A;  4FUL A;  4LG6 A;  3ZYK A;  3LY8 A;  3LKU A;  4BSX A;  3DRA A;  3O4Z A;  1MHQ A;  1OY3 D;  3FH5 A;  3ZYL A;  3TG5 A;  4EEC A;  4ACL A;  2P9S G;  4O6F A;  2VQ2 A;  2VYI A;  3BEE A;  3CHM A;  4GU5 A;  2XRY A;  3AS4 A;  3BG1 B;  3SFZ A;  4B93 B;  3DBS A;  3PZ2 A;  3QB2 A;  5CBO A;  3FTW A;  2PNN A;  5AQ7 A;  2MOW A;  3R9M A;  1SA4 A;  4AM9 A;  2DVW A;  5KWD A;  3IKO B;  4FC8 A;  4GML A;  5ENT D;  4GZC A;  2P9L G;  2WXI A;  3KEZ A;  2XGO A;  4JEH A;  4ABN A;  2R17 C;  2LAI A;  3BUA A;  2AJA A;  5LFA A;  1QZ2 A;  1NA3 A;  2P2C P;  2B6C A;  1HS6 A;  4HI8 A;  3APC A;  4GZ5 A;  4APF A;  1IXV A;  2H6G A;  2LSV A;  3CK8 A;  3AU4 A;  2P9U G;  1N4Q A;  2CG2 A;  3CST A;  2LUH A;  3HVE A;  3MYV A;  4CRW A;  2YHE A;  2J07 A;  4U0U A;  3L9T A;  2R03 A;  3R7Q A;  3TWR A;  4G8L A;  4FLH A;  4HRL A;  2ILR A;  4KVM A;  4GTO A;  3DSU A;  2AXU A;  4DUI A;  4UWF A;  3B7B A;  1BI8 B;  3RO3 A;  3QOU A;  4E85 A;  3CVY A;  4F1S A;  1E96 B;  4PS3 A;  4GTS A;  3UI2 A;  4BWR A;  4I6G A;  4IUL A;  1E7U A;  4HNA D;  3HXD A;  3NOC D;  4CDN A;  1FT1 A;  3QC1 A;  1N4P A;  4EZK A;  1X81 A;  4HFG A;  4L9P A;  5FTP A;  1KLX A;  1WM5 A;  3PS6 A;  3ZFW A;  3LS8 A;  1MJ0 A;  4BES A;  4LCT A;  3Q73 A;  3LYA A;  3LXU X;  3FUE A;  3AG1 E;  4ZFH A;  1L5J A;  4K03 A;  3X2Q E;  1UJK A;  3MKR A;  3BU8 A;  3T8K A;  1V55 E;  3PEU B;  4B89 A;  3V2X A;  4A55 A;  3C3O A;  3CK9 A;  2IOL A;  4CDR A;  3T9K A;  1EPU A;  4BT8 A;  3WG7 E;  4C9B B;  3DSW A;  2R2L A;  4NAC A;  5EIB E;  1ELW A;  1U2V G;  5ENQ D;  3ZVV A;  3B7U X;  3UQ3 A;  4WWN A;  3N71 A;  3VLF A;  4HOQ A;  3FTU A;  1LF8 A;  5E76 A;  4ACK A;  3DSV A;  3UT4 A;  2X6I A;  4TXP A;  5EYP F;  4G23 A;  3Q15 A;  2YIN A;  3ULQ A;  5G2N A;  4J6I A;  1JCR A;  2F8X K;  2XEN A;  4I1O B;  3QKY A;  4BFR A;  3MV3 B;  4FJZ A;  2DYR E;  5CHE E;  4GTR A;  3PRE A;  1H2V C;  3HXC A;  3ULE G;  3RRU A;  1OWN A;  3UIO C;  4GZD A;  3EUV A;  1H2T C;  3CK7 A;  2KCV A;  3UKU G;  4YDW A;  2M63 A;  2LXL A;  1IQR A;  5BV1 A;  4WWP A;  1TNO A;  3G2S A;  3MKQ A;  5HS0 A;  3PVL A;  3HXF A;  5ENP D;  2FUL A;  3CVQ A;  4AOF A;  1OCR E;  4OVV A;  4J0U A;  3DSX A;  4L2L A;  3GYZ A;  4ATZ D;  2J8S D;  3HYM B;  4Z68 A;  2WXH A;  1HU3 A;  3UM3 A;  3EHM A;  1YA0 A;  4BX8 A;  1MQS A;  3FUL A;  3TWV A;  4EBA G;  3S7J A;  3SF4 A;  4JD2 G;  3SBS A;  3HRA A;  4K5C A;  3CV0 A;  4DI4 A;  2WXJ A;  5IY5 E;  3APD A;  3U64 A;  4J8F A;  4OAU C;  2DIW A;  4FU3 A;  2CFZ A;  3FHE A;  4LUN U;  4F6R D;  5AAO A;  4GTT A;  5KJK A;  1N95 A;  3L17 A;  3QWV A;  4U8H A;  4KXK B;  4ILI A;  4PS7 A;  3E30 A;  3L08 A;  2IO2 C;  4GTP A;  2NXP A;  3CHO A;  3K9I A;  1ZU2 A;  3J5Q B;  3IV0 A;  2NSZ A;  4I1A A;  4A3T A;  3LVQ E;  5ENS D;  1OWP A;  4KT6 B;  5JA4 D;  1IHG A;  2OVB A;  4G24 A;  2AWI A;  3QAQ A;  5DBK A;  4U8V D;  4FHK A;  4G25 A;  3TWS A;  3NQP A;  4I9C A;  2L6J A;  3LPZ A;  3J5P A;  2L0I A;  5J08 A;  5AJD A;  3ENE A;  3DPD A;  1RZ4 A;  4GAA A;  4I2W A;  3G2W A;  3U66 A;  4AV7 A;  3L54 A;  3TWX A;  3GZ1 A;  2LAH A;  5ENN A;  2X38 A;  4V3I A;  5BW8 C;  1O1T A;  3ASD A;  4HOR A;  2XGM A;  4DI3 A;  2GRQ B;  2AVP A;  4GMJ A;  4L23 A;  5AYW D;  3SY2 A;  1NL4 A;  5BUZ A;  5D0Q D;  5ENO D;  3EDT B;  3OXF A;  3DEP A;  4U96 D;  2J4B A;  1IKN D;  3FTS A;  2I1J A;  3MCX A;  3PNT B;  5AQB A;  2ETC A;  3EJN A;  4QQI A;  2CHZ A;  3UM2 A;  2XEH A;  4ME2 A;  3G2T A;  3KEA A;  5A6C A;  1Y6I A;  1Z5S C;  5LCW C;  4A3V A;  4MS6 A;  2ZIR A;  4R7L A;  2OEV A;  3C5R A;  5ARG A;  2FO7 A;  3I5P A;  2Y69 E;  2HO1 A;  5EKQ D;  2CHX A;  4UI9 K;  5CED B;  2IO3 C;  3L13 A;  5B3S E;  2GRP B;  1TN6 A;  4UUC A;  4LER A;  4YND A;  1LTX A;  2F8Y A;  4HB5 A;  2I2O A;  1A5E A;  1BD8 A;  3ZU7 B;  3U3W A;  3P1U A;  5CEA A;  4AY5 A;  3CHQ A;  3VLD A;  4N3B A;  1HO8 A;  3ZXS A;  2GRO B;  3L22 A;  4ANX A;  5FT9 A;  3TGO A;  4UQX A;  1N9A A;  1OXJ A;  2ION A;  5EX0 A;  3MX3 A;  3VTY A;  3ZUV B;  1K8K G;  2KZT B;  4NRH B;  4AP2 A;  5CCM A;  3ZXP A;  2XS8 A;  4HOU A;  4GMR A;  3PDN A;  2J08 A;  3ZRH A;  2OEW A;  3F6Q A;  5LX8 A;  3DPY A;  1OWO A;  1JCS A;  1TR4 A;  1E7V A;  2WXG A;  1INZ A;  2J9Q A;  3EIQ C;  3U9W A;  1YYH A;  2AXV A;  2CFU A;  3PEV B;  4FHJ A;  3CEQ A;  4RSY A;  1HG5 A;  3V2O A;  2ZGG A;  5BXO A;  3CVL A;  3PRZ A;  3QNK A;  5EDS A;  4OYS A;  4J8S A;  4B8C B;  1O1S A;  3PNL B;  4AJW A;  3Q49 B;  1QYM A;  2E2E A;  2FI7 A;  3AG2 E;  4GZ6 A;  4KZC A;  4AVX A;  1TNY A;  4ATG A;  5ANL A;  1DNP A;  3HHM A;  5LP0 A;  4WNF A;  5AQA A;  3SI5 A;  3KS2 A;  4TV3 A;  3ZPJ A;  4HI9 A;  1DC2 A;  1UJJ A;  2KCL A;  4UWK A;  1QQE A;  4YDY A;  4AY6 A;  3ZGQ A;  2QYJ A;  4AXH A;  4HRN A;  3TG4 A;  3NOG D;  1N4R A;  4I6E A;  4N3A A;  2C0L A;  1FCH A;  2UY1 A;  3T5V A;  1HX8 A;  4DK5 A;  4H7Y A;  3KSL A;  5ITZ F;  4DLO A;  1EF1 C;  3O48 A;  2WXO A;  2LXM A;  5DIZ A;  2WXN A;  2WMO A;  4IRU A;  1DVP A;  3RKV A;  4CZ2 D;  4U95 D;  3R7R A;  5FIN A;  5AJL A;  3MV2 B;  2QZA A;  5B1B E;  3EU5 A;  4I2Z A;  3LDZ A;  1VDY A;  2CG3 A;  2WXM A;  3FUJ A;  4LEU A;  5KBA A;  4DJA A;  3ZHE A;  3VLE A;  3SBT B;  2XEE A;  2ZU6 B;  1H6O A;  3W9G A;  4HOT A;  2GW1 A;  2PQR A;  3FTV A;  4WNE A;  3D3M A;  3D9N A;  3FY4 A;  3PH0 C;  1UG3 A;  2WQH A;  3S7F A;  1HF8 A;  1LD7 A;  5FQ6 A;  1JWG A;  2R5S A;  1XNF A;  4PUC A;  2VTB A;  1HE8 A;  1UN8 A;  2H6F A;  4MBG A;  2XQ0 A;  3TWT A;  1MYO A;  4Y6C A;  4I43 A;  3FWV A;  3W9F A;  2PQN A;  2VSY A;  4YDE A;  2IF4 A;  3CSF A;  2V8S E;  5KCM A;  3SFY A;  3PUJ A;  4OAV B;  2QY7 A;  3B95 A;  2WPV A;  2C0M A;  3NZU A;  4K0R A;  2XEV A;  2RKK A;  4UQZ A;  4LNB A;  4EZJ A;  3B7R L;  1BI7 B;  3ASN E;  2Y4U A;  2XGS A;  2R59 A;  3ASH A;  3E32 A;  1OWL A;  1N94 A;  3CIA A;  5JHA A;  4D10 C;  3FU0 A;  3DXK G;  3TXN A;  5T3R A;  2KAT A;  3RO2 A;  4PS8 A;  1DCQ A;  3LJN A;  1SQM A;  4DX6 D;  1EYH A;  5D0O D;  2X3M A;  1S63 A;  2VGX B;  3IBE A;  3PZ3 A;  1HXI A;  4TUU A;  4C0E A;  1K3Z D;  2BKK B;  3ONL A;  5KJL A;  2YQ8 A;  4N5C A;  4WND A;  4E6H A;  4YVQ C;  4B8A A;  1S64 A;  2P58 C;  5KJN A;  1N52 A;  3C3Q A;  3FUM A;  3JXJ A;  4TRQ A;  2ZIS A;  3PZ4 A;  2EIJ E;  1ELK A;  1TJC A;  3CVW A;  2X6J A;  4HLE A;  1E8Z A;  1N0Q A;  5H7P A;  2PM6 A;  3QWP A;  4RLY A;  5CMY A;  5A23 A;  3AS5 A;  1YCS B;  2BTD A;  1H6K A;  4I6J A;  3P2B A;  3ZEF A;  5HQ8 A;  3FDH A;  4J7W A;  1NI1 A;  3RIB A;  3JQ1 A;  3I3N A;  4FA6 A;  2DYS E;  1FT2 A;  4QFV A;  2PM7 A;  2OCC E;  3APF A;  4ANV A;  4EPZ A;  3UXG A;  5M72 A;  3D9H A;  4JEU A;  2XZT G;  2BUG A;  4JHK A;  3RU0 A;  4NQ0 A;  5FQ4 A;  3OAW A;  2P9I G;  2XCB A;  3Q79 A;  4CT0 A;  1U3D A;  3AG3 E;  3V30 A;  2Y1L E;  3D9J A;  3Q7F A;  3MA5 A;  2V5Q C;  3GZS A;  3HXB A;  1G3N B;  1TNU A;  4GYY A;  3LY7 A;  4Q69 A;  4L2Y A;  4GB9 A;  1K1A A;  4Q96 A;  5G55 A;  4GZ3 A;  4JZY A;  3E4B A;  1KT1 A;  3MGB A;  4JL0 A;  2WXP A;  4GA0 A;  4JB8 P;  2P9P G;  3UUX A;  4XKB A;  3UM1 A;  4CYM D;  2RD0 A;  3SNX A;  4F1P A;  4M3O A;  4KVO A;  4RVB A;  4HXI A;  3NF1 A;  4GTQ A;  3ZKJ A;  4F3V A;  1OCC E;  5JJT A;  2V5F A;  2KBX A;  2Y3A A;  2IQC A;  5G05 J;  3FFL A;  4BX9 A;  2P9K G;  5BT1 A;  1MX6 A;  4IYP A;  2A5E A;  4N5Q A;  1NFI E;  1MX4 A;  4JHJ A;  4HQD A;  5A7D B;  2KM4 A;  5BPP A;  3CHR A;  4EBA A;  4J8E A;  3C72 A;  4KBQ A;  1SZA A;  4K5B A;  3CVP A;  3ISM C;  2YNQ A;  4O60 A;  2XZD G;  4HRM B;  1AWC B;  4GCN A;  3Q75 A;  2XRZ A;  1HG2 A;  4G8K A;  3Q47 B;  3UPV A;  2HR2 A;  2Q7F A;  5EIL A;  1WAO 1;  1D9S A;  2DWZ A;  1RW2 A;  4BSZ B;  4U7E B;  4N2Q A;  4YDO A;  1IQU A;  3LY9 A;  5CER B;  1QBQ A;  1NZN A;  2WMN A;  1OUV A;  2GRM A;  3Q78 A;  4J8D A;  1BU9 A;  4C48 B;  3SZ7 A;  5LOZ A;  1TYQ G;  1LD8 A;  3KD7 A;  5FWQ A;  2V4H C;  4JA9 A;  3UX4 A;  4FLB A;  1X5B A;  2J09 A;  3D9L A;  1KZP A;  4GTV A;  3IHY A;  3R9A B;  2F0Y A;  2X6K A;  5EX3 A;  4FJY A;  2XCC A;  3OTN A;  2LSU A;  1DCE A;  1PAQ A;  4A1S A;  2OV8 A;  3FH8 A;  3FH7 A;  4Q94 A;  4F53 A;  2QYU A;  1Q2Z A;  1N4S A;  3G2U A;  3BG0 B;  1D8D A;  2E0I A;  2I6H A;  4BER A;  1KZO A;  1ELR A;  3ML9 A;  3V31 A;  2J49 A;  1N0R A;  3TAX A;  3NZS A;  3D9O A;  4PDX A;  3CR3 A;  4GCO A;  4HVB A;  3I4G A;  2H6H A;  1HH8 A;  1JPL A;  3QWW A;  4LNG A;  2DCP A;  4MKT A;  2XPZ A;  3L16 A;  2VSN A;  4JVS A;  3Q5M A;  4UWH A;  4KMO A;  3Q9U C;  2FEZ A;  2AXZ A;  4GPK A;  5FJY A;  3QDN A;  3SHF A;  3CVV A;  3JXI A;  1PC2 A;  1SVX A;  3ASO E;  1WG0 A;  3CKC A;  2XS1 A;  2VJ8 A;  3FTZ A;  4UQY A;  3OXG A;  5D2M C;  4CDM A;  1WY6 A;  4JXT A;  1JUQ A;  2RFM A;  3RRN B;  2EIM E;  4ANU A;  3FP3 A;  3SFX A;  3UM0 A;  5AQ9 A;  4WNG A;  3D9P A;  3G2V A;  5ENR D;  1O5M A;  2LNI A;  2VGE A;  4H7X A;  4CGW A;  3RSE G;  3UMV A;  3T8M A;  4CT4 A;  1S70 B;  2J4D A;  2JLB A;  3AG4 E;  5G04 J; 
#chains in the Genus database with same CATH homology
 3Q73 A;  4YDE A;  3HXF A;  3SFY A;  1KZO A;  3DSX A;  1NI1 A;  3C72 A;  1N4R A;  2H6H A;  1FT2 A;  4LNG A;  4LNB A;  3Q75 A;  4EHM A;  3DSW A;  2H6G A;  2R2L A;  3E33 A;  1N9A A;  1JCQ A;  3KSL A;  3KSQ A;  1O1T A;  3E32 A;  1N4Q A;  1N94 A;  1TN8 A;  1NL4 A;  1FPP A;  4YDO A;  3DSV A;  3Q79 A;  1D8E A;  1O1R A;  2IEJ A;  1QBQ A;  3DRA A;  1S63 A;  4GTO A;  3DSS A;  2H6I A;  3DSU A;  3Q78 A;  3EU5 A;  3PZ3 A;  4GTT A;  1N95 A;  3Q7F A;  3HXE A;  3HXB A;  1JCR A;  3DPY A;  1JCS A;  4GTM A;  1LD8 A;  1TNU A;  3E30 A;  4GTP A;  1TN7 A;  1TNZ A;  3PZ1 A;  3SFX A;  4GTS A;  2ZIR A;  4GTR A;  1S64 A;  2BED A;  1O1S A;  3HXC A;  1MZC A;  3HXD A;  1KZP A;  3EUV A;  4GTV A;  1FT1 A;  1N4P A;  1SA5 A;  2ZIS A;  3PZ4 A;  2F0Y A;  1LD7 A;  1X81 A;  3PZ2 A;  3DST A;  1TNY A;  4L9P A;  1DCE A;  3Q7A A;  1TNB A;  1O5M A;  1TN6 A;  2H6F A;  3E37 A;  4MBG A;  1TNO A;  4GTQ A;  1LTX A;  1N4S A;  1SA4 A;  1D8D A;  3E34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...