1TNUA

Rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords geranylgeranyltransferase type I alpha subunit
publication title Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 130
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1tnuA00
3HXFA 1MZCA 1N4QA 3SFYA 2H6FA 4YDEA 1O5MA 1N4SA 1FPPA 3DPYA 3DSSA 3DRAA 3HXBA 1N95A 3Q78A 3KSQA 2IEJA 1TN8A 1KZOA 1LD7A 3HXCA 1NI1A 1D8DA 4GTRA 1SA5A 3EUVA 3E33A 3Q73A 4GTMA 4LNGA 3E30A 4LNBA 4MBGA 1TNOA 3Q75A 1TN6A 1D8EA 2H6HA 1JCQA 3Q7AA 3DSXA 1KZPA 1JCSA 1FT2A 4YDOA 1N9AA 1N4RA 1N94A 1TN7A 2F0YA 1N4PA 1FT1A 3Q79A 2ZISA 3HXEA 1DCEA 1NL4A 1SA4A 4GTVA 4GTTA 4GTQA 3Q7FA 2H6IA 1LTXA 3EU5A 1S63A 1O1TA 2ZIRA 3KSLA 3DSTA 3PZ4A 3DSUA 3PZ1A 1TNBA 1O1RA 3PZ2A 4L9PA 3E34A 3SFXA 1LD8A 1O1SA 1TNUA 1TNYA 2R2LA 1QBQA 1X81A 4GTPA 1TNZA 4GTSA 3DSVA 3HXDA 3E37A 1S64A 4GTOA 2BEDA 1JCRA 4EHMA 3E32A 2H6GA 3DSWA 3PZ3A 3C72A
chains in the Genus database with same CATH superfamily
1MZCA 3D3MA 3SFYA 2AXZA 3FTUA 5CCMA 3EJNA 5CEDB 3SGHA 4J0UA 5EYLA 5AYWD 2M63A 2XGSA 3TWSA 2J09A 3O48A 3CVXA 1DNPA 3DRAA 3JQ1A 5D0OD 3B95A 2WXIA 4Q94A 5FZQA 4TUUA 3D9PA 3D9HA 4CYMD 3Q73A 3FUMA 3APDA 3ZYMA 2VSOE 2IY0C 4HLEA 5G04C 2J4BA 3R7QA 4AJWA 3CEQA 2EIJE 3FH8A 3GYZA 4YDOA 1N94A 3UT8A 1AWCB 1OXJA 4KYOB 1HX8A 3NQPA 5T3RA 1U3CA 3IBEA 4Z68A 4XE0A 2R02A 1N11A 1XGWA 3T8MA 3CVNA 5KJNA 3PUJA 2QY7A 4AEZC 4N39A 3QC1A 1S63A 4BSZB 4I1MA 4AY5A 4C48B 3N71A 4JHRA 5ANRA 4DUIA 4BTBA 3VLFA 4H7XA 5JJ6A 1SZAA 5G2NA 2IQCA 3FH7A 2VGEA 1E96B 3JCKC 3PREA 3V31A 5BUZA 4K5CA 3FDHA 4GTOA 2LSUA 2KXPC 1EPUA 3MZLB 3CK9A 2FULA 2KATA 3SD5A 2XZTG 3UMVA 3AU5A 2GGFA 4UI9K 5EILA 2ZXWE 3MKRA 2AJAA 3BU8A 3C3OA 2Y1LE 1TJCA 3JQ0A 3UM2A 4ACLA 4AXHA 4GZCA 4B8CB 4RLYA 2I2OA 3RO3A 4U0SA 3TWVA 4KT6B 5B1AE 4ATGA 3IV0A 1FVFA 2MHKA 2VYIA 4HOQA 2R5SA 4YNDA 3ZKJA 4ILGA 5ANLA 2XCCA 2FBNA 3VLDA 3DWLG 1FT2A 3HVEA 2UY1B 4TXRA 2NYJA 4PS3A 4GA2A 4GAAA 4BERA 3C3QA 4DX6D 4ZHBA 1NL4A 3QWVA 4EZJA 2VGXB 4H7YA 5JMND 2IOLA 1OWMA 3EHNA 5HS0A 3PVLA 2IOSA 5CMYA 1BU9A 1IXVA 1OCRE 5FT9A 1N0QA 3PUKA 4B94A 4P29A 2A4ZA 1X5BA 1X81A 2XEVA 4FC8A 1S64A 3KEZA 1JCRA 3ZVVA 5AN8A 3D9IA 3PZ3A 3T9KA 3DEOA 3C72A 3JXJA 5G05C 4DX1A 1H6OA 1N0RA 4OAUC 2A5EA 3OAWA 2J08A 3E4BA 1N54A 3RJVA 3W9GA 3ISMC 3FUNA 1HFAA 4HRNA 2JABA 3MKQB 4Q69A 3PE4A 1SA5A 3I4GA 4DLOA 2WQ6A 4BFRA 1UG3A 4UWFA 3SY2A 3EHMA 3CV0A 4JPSA 4GTMA 4LNGA 3E30A 3LPZA 4GB9A 4HNAD 4KVMA 1BI7B 1BD8A 2XRZA 3ZRHA 3EHQA 4BT8A 3PEUB 3HXEA 2RFAA 2YNQA 4CDRA 4F53A 3ULYA 4EECA 3ZN3A 5FQ7A 3UX4A 5BV1A 1L5JA 3B13A 1MQSA 1OCCE 4DX5D 3ZEFA 3P2BA 3AU4A 4GZ5A 3QK0A 2V4HC 2OOEA 2F8YA 4FHJA 1MX4A 3BEEA 3SFXA 1O1SA 5BT1A 3NOGD 3IEGA 2WVIA 4L23A 1YMPA 3MJWA 4WNDA 3E32A 2B0OE 3L22A 3ZYKA 3CHSA 3WG7E 4XI9A 3BG1B 2OEVA 1UN8A 1OCZE 3UI2A 2R59A 3Q5MA 5ARFA 3IXEA 5EX3A 2WMOA 2V8SE 3B7BA 3I4RB 3W9FA 2BKKB 4AVXA 3ASHA 4ANXA 3TGOA 3NF1A 4L7TA 1UW4B 1HU3A 2EILE 4GA0A 3ESLA 5FQ8A 2XZDG 2WXKA 3G2TA 3UM1A 1PAQA 4XKBA 3RRUA 4HORA 3FUDA 3ZYQA 1E8XA 4TXPA 3WXXA 5BNWA 2P58C 2C2LA 4JL0A 1E7UA 5CMWA 1H6KA 3AAAC 2C0MA 3EHRA 1BLXB 1FT1A 4LNUD 2J4DA 1FCHA 2YINA 3KEAA 3MGBA 4O1PA 3UUXA 2DCPA 3J5QB 1SVXA 3FEYA 2RKKA 3MEKA 1IQRA 3QARA 2J49A 5CHEE 4ANUA 4I9CA 2P9UG 1TYQG 3G2VA 3TXNA 4BT9A 4J8YA 3TL5A 4V3IA 4BX9A 2WM9A 4L2LA 1KT1A 3LVQE 3FTVA 3ZGQA 4UQXA 4C0EA 2IONA 3G2SA 4DI3A 5CCLA 4G26A 1HG5A 4U96D 3L54A 4U8VD 2PM7A 4XX5A 3FUKA 3CVLA 4U95D 2V5FA 1MX6A 3J5PA 3URZA 4FJYA 3PNTB 3K9IA 3L82A 4JZYA 3KSQA 3FU0A 3APFA 3CQGB 4EQFA 2WXFA 2J8SD 2XENA 4YVQC 2DVWA 2EIME 5G04J 4CDMA 3U4TA 2IO3C 4UUCA 4DK5A 4W9RA 3ABKE 4G8KA 4HQDA 5A6CA 3TWXA 1EYHA 4JHKA 3VTYA 5ENPD 1TN7A 3EIJA 2ZISA 3Q9NC 2NC9A 2WXPA 1NP7A 2I1KA 2IF4A 4G1TA 1JUQA 2FF4A 2VJ8A 4AIFA 4A1SA 2XS1A 3FULA 1K3ZD 3OXFA 5JJ7A 4ABNA 1O1RA 1XNFA 4WNEA 2Q7FA 1VDYA 5EX0A 5BXUA 1E7VA 3GW4A 3HHMA 4J8SA 1FVHA 4N3CA 3DSWA 3TWQA 3FY4A 4YDYA 4CGWA 1INZA 3PH0C 1QNFA 3CHPA 5J08A 3L9TA 4CGVA 2ZGDA 1E8WA 3L13A 5CBNA 3CHOA 4RSYA 4CDNA 3U3WA 2JEKA 2GRRB 3Q78A 4PH4B 3BG0B 4GYWA 3LJ3A 3FTWA 4FADA 4FULA 5M72A 4HI8A 2KZTB 1OY3D 4A1GA 1Y6IA 5AQ7A 1TR4A 1BI8B 2DYRE 3ZU7B 2GW1A 3CK8A 4LNBA 3V2OA 2CG3A 4UWGA 3CVWA 2GRNB 4GMLA 3ZNGA 3AS5A 4HBDA 2V0PA 2X38A 3L6AA 2CHWA 2XGOA 1OWLA 3IKOB 3TAXA 2VSXE 4TV3A 3LCAA 2LAIA 4U0UA 5ENNA 4G8LA 5CRUA 2ZIRA 4I17A 3DEPA 1TNBA 2P9SG 3UIOC 1HO8A 2LUHA 3FTZA 5G05J 2WXOA 5ENRD 2PM6A 2PQRA 5AAOA 3HYMB 4N2QA 3CQCB 4LERA 3RU0A 4K5AB 4F3VA 1SQMA 1IKND 3TG4A 5H7PA 2FO1E 4J8EA 1DC2A 3B7SA 5KWDA 5EIDA 3DPYA 4RQIA 5LX8A 4KBQA 3UKUG 1ZB1A 2RD0A 2F37A 3RKVA 3HXBA 2Y4UA 3D9OA 4UQYA 4A55A 4GZ6A 3O4ZA 2X6KA 2UY1A 3ASGA 3RRNB 4QFVA 5ENOD 4O1OA 2YQ8A 3QWWA 4MS6A 3RIBA 1N52A 3CSFA 1JWFA 4DJAA 3ZFWA 1JCQA 3DSXA 4JHJA 1QYMA 5T8IA 5IY5E 5ENTD 4JEUA 3Q15A 3CIAA 5FQ4A 3FU3A 4TRQA 2Y4TA 3HRAA 4K03A 2IO2C 2L0IA 3AS4A 4A63B 4K5BA 5KJKA 2FO7A 4OVVA 5ARGA 4DI4A 4JEHA 4F1SA 3G2WA 4L2YA 1O1TA 4FU3A 3PZ4A 4LCTA 5LCWJ 3Q49B 1UN9A 3ZUVB 4BTAA 3LY8A 5LFAA 1P5QA 4GTPA 4I1AA 2AXUA 4O6FA 2PL2A 4KZ0A 4AP2A 2H6IA 3MKQA 3S2AA 1WAO1 1KT0A 1MJ0A 1FPPA 4EBAG 4UWKA 5JHBA 2AWIA 4LSZE 3UKRG 1N95A 2R05A 2CHXA 2DZNA 3ABLE 5D0QD 3HXCA 4G25A 4B0ZA 2JLBA 3TWRA 4J6IA 2KCKA 4MLPA 4FLBA 1HXIA 3E33A 1RZ4A 4U8HA 1QQEA 1YYHA 1TNOA 2ZU6B 4JXTA 3JXIA 3D9JA 4HOUA 1Q2ZA 5C1DA 4G2VA 1SW6A 2ETCA 4G23A 3RK6A 3L16A 2WXRA 1SA4A 2WXGA 1MHQA 2MYOA 4BSXA 4XEIG 4GTQA 2OVFA 3UTMA 3AG1E 2WMNA 4IYPA 4APFA 5FTPA 3ASDA 3HIZA 3EU9A 2XPYA 3LDZA 4NURA 2I1JA 2R2LA 3UT4A 3T8KA 4LG6A 1A17A 3E37A 2VTBA 3V30A 3C3RA 3ULQA 5B3SE 2H6GA 4LUNU 2OVBA 2HM8A 5KNGA 1WY6A 1N4QA 2WXHA 4N5QA 5FWQA 2KCLA 3B7RL 2WXQA 2P9PG 3SZ7A 3FP3A 5HKPA 3CVYA 5T4YA 3QWPA 5A7DB 3RO2A 1IHGA 4U7EB 5G55A 2LXMA 1HH8A 1D9SA 5BXOA 4I2ZA 5LCWC 3UPVA 1WDYA 4AV7A 1EF1C 4UI9C 4BETA 4J7WA 2WXJA 4YVOA 4WWPA 3MYVA 3CHQA 2KC7A 4IN3B 4B89A 4ILHB 4A3TA 4DPRA 1E8YA 5AENA 2XPIA 4OVUA 3FUJA 3FUIA 3MV2B 3UM3A 3RSEG 5AQ9A 3MA5A 4I6EA 4JA9A 3TXMA 3LKUA 2F0YA 2QFCA 4BWRA 3NOCD 4KZCA 2MOWA 5KNHD 1QZ2A 4HRMB 3BQOA 3JUIA 3RRMB 3T5VA 4JB8P 4KMOA 4MKTA 2ILRA 5EIBE 3FUEA 4BX8A 3ASNE 3PE3A 4NIKA 1A5EA 4GYOA 3HG0D 4URKA 3PEVB 2AXVA 2C0LA 3CVPA 2X3MA 4E85A 1ELKA 2UWJG 3NZUA 4A3VA 1Y8MA 5BPPA 2KCVA 4GTSA 5HRYA 3ONLA 4EZLA 4PDXA 3ONKA 4HI9A 5FINA 1TJFA 2XPZA 1NFIE 2ONDA 2XEHA 2CHZA 1B89A 5JHAA 2BUGA 3LJNA 2IEJA 4I6JA 1H0AA 3CVUA 4NRHB 3MV3B 1TN8A 1UOHA 3TWTA 3CK7A 3QOUA 2GRMA 3Q9UC 3QAQA 5JJTA 3ZHEB 1NA3A 4JW1A 4WNFA 3UIPC 3F6QA 2IJGX 1AP7A 1TN6A 2L0TB 1IYGA 3ZIMA 4TUMA 3Q7AA 3UXGA 3LEWA 1E90A 3Q47B 5AJDA 2WQHA 2LO6A 1OT8A 4FJZA 1BPOA 2KBXA 3CLJA 3UINC 3VLEA 4ANWA 2B6CA 3JYSA 3ASOE 4GCNA 1IHBA 4E6HA 2EQXA 3CVQA 3QB2A 4FA6A 4PUCA 3APCA 3TG5A 3FHEA 1H2UA 3SFZA 2LSVA 2J07A 4I43A 5FZRA 4AOFA 3ABME 1DCQA 3S7FA 2A5UA 3D9MA 1S0PA 3B7UX 1HF8A 4I2WA 4KXKB 2L6BA 3QJZA 2X6JA 3UQ3A 4AY6A 4B93B 2CG2A 2ETBA 3FUHA 1N4SA 4WNGA 4U07A 4L1BA 1NA0A 3DSSA 4K0RA 3KD7A 3B7TA 4ATZD 1V54E 2NSZA 2WPVA 4EPZA 3FU5A 2BF0X 1D8DA 3PNLB 2XEEA 2WB2A 1H19A 1D8EA 2PQNA 1H2VC 3SBTB 2VQ2A 4DX7D 5DIZA 3C98A 1DCEA 1DVPA 4IRUA 3AS8A 1GW6A 3CSTA 1HE8A 2OEWA 2DYSE 1NZNA 2IU1A 4YDWA 2XGMA 4HRLA 2CFZA 5FQ6A 3SQVA 3OTNA 2IFUA 4WAFA 4DX2A 1YA0A 2FEZA 3D9LA 4M7CA 4UQZA 3AG3E 2E0IA 3LXUX 2J9QA 1LD8A 4GA1A 5FZSA 5ENQD 2QZAA 5DBKA 4N2SA 4CRWA 3LS8A 4I6GA 1KPSB 2GRPB 5EN5D 3FFLA 1ZBPA 2X6HA 1OWOA 4FHKA 4U0ZA 3FTSA 2DIWA 5AJLA 3ZXPA 1G3NB 1LD7A 4N3AA 5LOZA 5BW8C 1PY1A 4CEMA 1E8ZA 3ENEA 3ZXSA 2EIKE 3GZ1A 2BKGA 3Q4AB 3EIQC 3DPDA 2VGYA 2XCBA 5AIJA 2H6HA 5CEAA 3CKCA 1N9AA 3PRZA 4PS8A 3OXGA 2GRLA 4GZDA 5B1BE 1MYOA 1EDUA 1IQUA 3Q7FA 3LY7A 3ZYLA 2VGXA 3EU5A 5KCMA 4G11A 3DSTA 3QNKA 4EZKA 4Y6CA 5BV0A 3NAWA 2WXMA 5AARA 3PZ2A 3E34A 1K1BA 1U3DA 1LF8A 4WWOA 4X8QA 2LNIA 4APOA 1YCSB 5JA4D 2VSNA 2PNNA 2H6FA 1ELWA 3PZDA 2HO1A 2QYUA 4HXIA 2QYJA 4F7AA 4UI9J 5CBOA 2R17C 4ILIA 4BEPA 3SNXA 1K1AA 3QDNA 5LP0A 2V5QC 3UM0A 1KZOA 3DXKG 5D2MC 4FLHA 2R03A 2GROB 4ANVA 3AG4E 3L08A 3ML9A 4MBGA 3Q75A 2DWZA 2F8XK 2OV8A 5E76A 3S7DA 4N3BA 1U2VG 4MRUA 3JUEA 2AVPA 3Q79A 2XS8A 2DZOA 5C2YA 4CZ2D 4GYYA 4JD2G 4RG6A 4QQIA 2P2CP 5AQBA 1OWPA 4G24A 1HZ4A 4DRXE 4WWNA 4CCAA 3HVEB 3U66A 3RAUA 5HQ8A 2NXPA 2ZGGA 4GMJA 3NBNB 4U8YD 3DSVA 2I9CA 2P9NG 2FI7A 4C0MA 1H6PA 2XQ0A 2V4LA 2MRIA 3R7RA 4OYSA 4UWLA 1MX2A 3GZ2A 3X2QE 5KJMA 2I6HA 3V79K 2QC9A 4HOSA 1HS6A 4ZFHA 5HI7A 2YHCA 4RVBA 4CT0A 2GRQB 3I3NA 4HOTA 1TEZA 3KS2A 4ACKA 3U64A 1Z3YA 1Z6TA 2HR2A 1PC2A 3SBSA 3V2XA 3QKYA 1WM5A 2LXLA 5A23A 4GTTA 4HFGA 3NZSA 3SI5A 4LRZA 3CHMA 4UWHA 2P9IG 3FEXA 4CT4A 1KLXA 3HDXA 3KSLA 3FU6A 4F6RD 4I1OB 3OXLA 3PZ1A 4IULA 4L9PA 2E2EA 3FWVA 3SHFA 1H2TC 1TNUA 3IHYA 3MX3A 4Q96A 2VTBB 1K8KG 3DXMG 4JA7A 3HXDA 4GZ3A 4PS7A 2WXLA 2XHEA 3ZPJA 3MCXA 5ITZF 4OAVB 2OCCE 4GMRA 4GPMA 3TWUA 4XKCA 1O5MA 1W3BA 3D9NA 3ZHEA 2RG8A 3P1UA 2Y0BG 2BTDA 2HE0A 1ELRA 4NACA 3CGHA 4GCOA 5AQAA 1NI1A 3IHVA 2KM4A 3S7JA 1JWGA 3AJIA 5EYPF 3EUVA 4HVBA 4GPKA 4HB5A 2EINE 4HLLA 4FP7A 3ML8A 2ETAA 5CECB 4J8FA 5CERB 2PZIA 4J8DA 2Y69E 3NB2A 4KVOA 3I5PA 1JCSA 1UJKA 3KAEA 1N4PA 3D9KA 5D66A 4B8AA 3PDNA 4GTVA 4I9EA 2RFMA 3FTYA 2VSYA 3AG2E 2DBAA 5E75A 1WG0A 3FTXA 5FJYA 3PS6A 4Y6WA 4EBAA 3G2UA 3R9AB 1OCOE 3CHRA 3SO8A 4D10C 2P9KG 3GZSA 4XIFA 1S70B 4ME2A 1TNZA 3BUAA 2X6IA 4TXQA 3T5XA 5KBAA 2LAHA 5CRVA 2BEDA 4DLQA 4BY6A 3SF4A 2HYZA 3R9MA 1Z5SC 1OUVA 3HXFA 3CR3A 4GU5A 3L17A 4YDEA 4XI0A 4N5CA 3CVVA 1RW2A 3U9WA 4AM9A 3LYAA 4XZ4A 3LVRE 2XRYA 1V55E 4F1PA 4HS2A 4GTRA 5EKQD 2X6FA 3EDTB 2KZTA 4O60A 2AW6A 1UJJA 2WXNA 1ZU2A 1OWNA 3ASFA 5J90A 4WUYA 3DBSA 3VTXA 3ULEG 2CFUA 4NQ0A 1KZPA 3UT7A 2P9LG 1N4RA 3S7BA 4BESA 2L6JA 4JVSA 4C9BB 3TJPA 3TWWA 5ENSD 4U04A 3FUFA 4RG9A 1SZ9A 3LY9A 1LTXA 5EDSA 5KJLA 2L9BA 3FH5A 2WQ7A 3ESKA 4LEUA 1HG2A 3DSUA 4U63A 1JPLA 5FIOA 1Z3XA 3CKBA 2YHEA 1TNYA 1QBQA 4R7LA 4M3OA 3C5RA 2Y3AA 4EHMA 4JC8A 3ZW3A
chains in the Genus database with same CATH topology
3HXFA 1MZCA 1N4QA 3SFYA 2H6FA 4YDEA 1O5MA 1N4SA 1FPPA 3DPYA 3DSSA 3DRAA 3HXBA 1N95A 3Q78A 3KSQA 2IEJA 1TN8A 1KZOA 1LD7A 3HXCA 1NI1A 1D8DA 4GTRA 1SA5A 3EUVA 3E33A 3Q73A 4GTMA 4LNGA 3E30A 4LNBA 4MBGA 1TNOA 3Q75A 1TN6A 1D8EA 2H6HA 1JCQA 3Q7AA 3DSXA 1KZPA 1JCSA 1FT2A 4YDOA 1N9AA 1N4RA 1N94A 1TN7A 2F0YA 1N4PA 1FT1A 3Q79A 2ZISA 3HXEA 1DCEA 1NL4A 1SA4A 4GTVA 4GTTA 4GTQA 3Q7FA 2H6IA 1LTXA 3EU5A 1S63A 1O1TA 2ZIRA 3KSLA 3DSTA 3PZ4A 3DSUA 3PZ1A 1TNBA 1O1RA 3PZ2A 4L9PA 3E34A 3SFXA 1LD8A 1O1SA 1TNUA 1TNYA 2R2LA 1QBQA 1X81A 4GTPA 1TNZA 4GTSA 3DSVA 3HXDA 3E37A 1S64A 4GTOA 2BEDA 1JCRA 4EHMA 3E32A 2H6GA 3DSWA 3PZ3A 3C72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXF A;  1MZC A;  1N4Q A;  3SFY A;  2H6F A;  4YDE A;  1O5M A;  1N4S A;  1FPP A;  3DPY A;  3DSS A;  3DRA A;  3HXB A;  1N95 A;  3Q78 A;  3KSQ A;  2IEJ A;  1TN8 A;  1KZO A;  1LD7 A;  3HXC A;  1NI1 A;  1D8D A;  4GTR A;  1SA5 A;  3EUV A;  3E33 A;  3Q73 A;  4GTM A;  4LNG A;  3E30 A;  4LNB A;  4MBG A;  1TNO A;  3Q75 A;  1TN6 A;  1D8E A;  2H6H A;  1JCQ A;  3Q7A A;  3DSX A;  1KZP A;  1JCS A;  1FT2 A;  4YDO A;  1N9A A;  1N4R A;  1N94 A;  1TN7 A;  2F0Y A;  1N4P A;  1FT1 A;  3Q79 A;  2ZIS A;  3HXE A;  1DCE A;  1NL4 A;  1SA4 A;  4GTV A;  4GTT A;  4GTQ A;  3Q7F A;  2H6I A;  1LTX A;  3EU5 A;  1S63 A;  1O1T A;  2ZIR A;  3KSL A;  3DST A;  3PZ4 A;  3DSU A;  3PZ1 A;  1TNB A;  1O1R A;  3PZ2 A;  4L9P A;  3E34 A;  3SFX A;  1LD8 A;  1O1S A;  1TNU A;  1TNY A;  2R2L A;  1QBQ A;  1X81 A;  4GTP A;  1TNZ A;  4GTS A;  3DSV A;  3HXD A;  3E37 A;  1S64 A;  4GTO A;  2BED A;  1JCR A;  4EHM A;  3E32 A;  2H6G A;  3DSW A;  3PZ3 A;  3C72 A; 
#chains in the Genus database with same CATH topology
 1MZC A;  3D3M A;  3SFY A;  2AXZ A;  3FTU A;  5CCM A;  3EJN A;  5CED B;  3SGH A;  4J0U A;  5EYL A;  5AYW D;  2M63 A;  2XGS A;  3TWS A;  2J09 A;  3O48 A;  3CVX A;  1DNP A;  3DRA A;  3JQ1 A;  5D0O D;  3B95 A;  2WXI A;  4Q94 A;  5FZQ A;  4TUU A;  3D9P A;  3D9H A;  4CYM D;  3Q73 A;  3FUM A;  3APD A;  3ZYM A;  2VSO E;  2IY0 C;  4HLE A;  5G04 C;  2J4B A;  3R7Q A;  4AJW A;  3CEQ A;  2EIJ E;  3FH8 A;  3GYZ A;  4YDO A;  1N94 A;  3UT8 A;  1AWC B;  1OXJ A;  4KYO B;  1HX8 A;  3NQP A;  5T3R A;  1U3C A;  3IBE A;  4Z68 A;  4XE0 A;  2R02 A;  1N11 A;  1XGW A;  3T8M A;  3CVN A;  5KJN A;  3PUJ A;  2QY7 A;  4AEZ C;  4N39 A;  3QC1 A;  1S63 A;  4BSZ B;  4I1M A;  4AY5 A;  4C48 B;  3N71 A;  4JHR A;  5ANR A;  4DUI A;  4BTB A;  3VLF A;  4H7X A;  5JJ6 A;  1SZA A;  5G2N A;  2IQC A;  3FH7 A;  2VGE A;  1E96 B;  3JCK C;  3PRE A;  3V31 A;  5BUZ A;  4K5C A;  3FDH A;  4GTO A;  2LSU A;  2KXP C;  1EPU A;  3MZL B;  3CK9 A;  2FUL A;  2KAT A;  3SD5 A;  2XZT G;  3UMV A;  3AU5 A;  2GGF A;  4UI9 K;  5EIL A;  2ZXW E;  3MKR A;  2AJA A;  3BU8 A;  3C3O A;  2Y1L E;  1TJC A;  3JQ0 A;  3UM2 A;  4ACL A;  4AXH A;  4GZC A;  4B8C B;  4RLY A;  2I2O A;  3RO3 A;  4U0S A;  3TWV A;  4KT6 B;  5B1A E;  4ATG A;  3IV0 A;  1FVF A;  2MHK A;  2VYI A;  4HOQ A;  2R5S A;  4YND A;  3ZKJ A;  4ILG A;  5ANL A;  2XCC A;  2FBN A;  3VLD A;  3DWL G;  1FT2 A;  3HVE A;  2UY1 B;  4TXR A;  2NYJ A;  4PS3 A;  4GA2 A;  4GAA A;  4BER A;  3C3Q A;  4DX6 D;  4ZHB A;  1NL4 A;  3QWV A;  4EZJ A;  2VGX B;  4H7Y A;  5JMN D;  2IOL A;  1OWM A;  3EHN A;  5HS0 A;  3PVL A;  2IOS A;  5CMY A;  1BU9 A;  1IXV A;  1OCR E;  5FT9 A;  1N0Q A;  3PUK A;  4B94 A;  4P29 A;  2A4Z A;  1X5B A;  1X81 A;  2XEV A;  4FC8 A;  1S64 A;  3KEZ A;  1JCR A;  3ZVV A;  5AN8 A;  3D9I A;  3PZ3 A;  3T9K A;  3DEO A;  3C72 A;  3JXJ A;  5G05 C;  4DX1 A;  1H6O A;  1N0R A;  4OAU C;  2A5E A;  3OAW A;  2J08 A;  3E4B A;  1N54 A;  3RJV A;  3W9G A;  3ISM C;  3FUN A;  1HFA A;  4HRN A;  2JAB A;  3MKQ B;  4Q69 A;  3PE4 A;  1SA5 A;  3I4G A;  4DLO A;  2WQ6 A;  4BFR A;  1UG3 A;  4UWF A;  3SY2 A;  3EHM A;  3CV0 A;  4JPS A;  4GTM A;  4LNG A;  3E30 A;  3LPZ A;  4GB9 A;  4HNA D;  4KVM A;  1BI7 B;  1BD8 A;  2XRZ A;  3ZRH A;  3EHQ A;  4BT8 A;  3PEU B;  3HXE A;  2RFA A;  2YNQ A;  4CDR A;  4F53 A;  3ULY A;  4EEC A;  3ZN3 A;  5FQ7 A;  3UX4 A;  5BV1 A;  1L5J A;  3B13 A;  1MQS A;  1OCC E;  4DX5 D;  3ZEF A;  3P2B A;  3AU4 A;  4GZ5 A;  3QK0 A;  2V4H C;  2OOE A;  2F8Y A;  4FHJ A;  1MX4 A;  3BEE A;  3SFX A;  1O1S A;  5BT1 A;  3NOG D;  3IEG A;  2WVI A;  4L23 A;  1YMP A;  3MJW A;  4WND A;  3E32 A;  2B0O E;  3L22 A;  3ZYK A;  3CHS A;  3WG7 E;  4XI9 A;  3BG1 B;  2OEV A;  1UN8 A;  1OCZ E;  3UI2 A;  2R59 A;  3Q5M A;  5ARF A;  3IXE A;  5EX3 A;  2WMO A;  2V8S E;  3B7B A;  3I4R B;  3W9F A;  2BKK B;  4AVX A;  3ASH A;  4ANX A;  3TGO A;  3NF1 A;  4L7T A;  1UW4 B;  1HU3 A;  2EIL E;  4GA0 A;  3ESL A;  5FQ8 A;  2XZD G;  2WXK A;  3G2T A;  3UM1 A;  1PAQ A;  4XKB A;  3RRU A;  4HOR A;  3FUD A;  3ZYQ A;  1E8X A;  4TXP A;  3WXX A;  5BNW A;  2P58 C;  2C2L A;  4JL0 A;  1E7U A;  5CMW A;  1H6K A;  3AAA C;  2C0M A;  3EHR A;  1BLX B;  1FT1 A;  4LNU D;  2J4D A;  1FCH A;  2YIN A;  3KEA A;  3MGB A;  4O1P A;  3UUX A;  2DCP A;  3J5Q B;  1SVX A;  3FEY A;  2RKK A;  3MEK A;  1IQR A;  3QAR A;  2J49 A;  5CHE E;  4ANU A;  4I9C A;  2P9U G;  1TYQ G;  3G2V A;  3TXN A;  4BT9 A;  4J8Y A;  3TL5 A;  4V3I A;  4BX9 A;  2WM9 A;  4L2L A;  1KT1 A;  3LVQ E;  3FTV A;  3ZGQ A;  4UQX A;  4C0E A;  2ION A;  3G2S A;  4DI3 A;  5CCL A;  4G26 A;  1HG5 A;  4U96 D;  3L54 A;  4U8V D;  2PM7 A;  4XX5 A;  3FUK A;  3CVL A;  4U95 D;  2V5F A;  1MX6 A;  3J5P A;  3URZ A;  4FJY A;  3PNT B;  3K9I A;  3L82 A;  4JZY A;  3KSQ A;  3FU0 A;  3APF A;  3CQG B;  4EQF A;  2WXF A;  2J8S D;  2XEN A;  4YVQ C;  2DVW A;  2EIM E;  5G04 J;  4CDM A;  3U4T A;  2IO3 C;  4UUC A;  4DK5 A;  4W9R A;  3ABK E;  4G8K A;  4HQD A;  5A6C A;  3TWX A;  1EYH A;  4JHK A;  3VTY A;  5ENP D;  1TN7 A;  3EIJ A;  2ZIS A;  3Q9N C;  2NC9 A;  2WXP A;  1NP7 A;  2I1K A;  2IF4 A;  4G1T A;  1JUQ A;  2FF4 A;  2VJ8 A;  4AIF A;  4A1S A;  2XS1 A;  3FUL A;  1K3Z D;  3OXF A;  5JJ7 A;  4ABN A;  1O1R A;  1XNF A;  4WNE A;  2Q7F A;  1VDY A;  5EX0 A;  5BXU A;  1E7V A;  3GW4 A;  3HHM A;  4J8S A;  1FVH A;  4N3C A;  3DSW A;  3TWQ A;  3FY4 A;  4YDY A;  4CGW A;  1INZ A;  3PH0 C;  1QNF A;  3CHP A;  5J08 A;  3L9T A;  4CGV A;  2ZGD A;  1E8W A;  3L13 A;  5CBN A;  3CHO A;  4RSY A;  4CDN A;  3U3W A;  2JEK A;  2GRR B;  3Q78 A;  4PH4 B;  3BG0 B;  4GYW A;  3LJ3 A;  3FTW A;  4FAD A;  4FUL A;  5M72 A;  4HI8 A;  2KZT B;  1OY3 D;  4A1G A;  1Y6I A;  5AQ7 A;  1TR4 A;  1BI8 B;  2DYR E;  3ZU7 B;  2GW1 A;  3CK8 A;  4LNB A;  3V2O A;  2CG3 A;  4UWG A;  3CVW A;  2GRN B;  4GML A;  3ZNG A;  3AS5 A;  4HBD A;  2V0P A;  2X38 A;  3L6A A;  2CHW A;  2XGO A;  1OWL A;  3IKO B;  3TAX A;  2VSX E;  4TV3 A;  3LCA A;  2LAI A;  4U0U A;  5ENN A;  4G8L A;  5CRU A;  2ZIR A;  4I17 A;  3DEP A;  1TNB A;  2P9S G;  3UIO C;  1HO8 A;  2LUH A;  3FTZ A;  5G05 J;  2WXO A;  5ENR D;  2PM6 A;  2PQR A;  5AAO A;  3HYM B;  4N2Q A;  3CQC B;  4LER A;  3RU0 A;  4K5A B;  4F3V A;  1SQM A;  1IKN D;  3TG4 A;  5H7P A;  2FO1 E;  4J8E A;  1DC2 A;  3B7S A;  5KWD A;  5EID A;  3DPY A;  4RQI A;  5LX8 A;  4KBQ A;  3UKU G;  1ZB1 A;  2RD0 A;  2F37 A;  3RKV A;  3HXB A;  2Y4U A;  3D9O A;  4UQY A;  4A55 A;  4GZ6 A;  3O4Z A;  2X6K A;  2UY1 A;  3ASG A;  3RRN B;  4QFV A;  5ENO D;  4O1O A;  2YQ8 A;  3QWW A;  4MS6 A;  3RIB A;  1N52 A;  3CSF A;  1JWF A;  4DJA A;  3ZFW A;  1JCQ A;  3DSX A;  4JHJ A;  1QYM A;  5T8I A;  5IY5 E;  5ENT D;  4JEU A;  3Q15 A;  3CIA A;  5FQ4 A;  3FU3 A;  4TRQ A;  2Y4T A;  3HRA A;  4K03 A;  2IO2 C;  2L0I A;  3AS4 A;  4A63 B;  4K5B A;  5KJK A;  2FO7 A;  4OVV A;  5ARG A;  4DI4 A;  4JEH A;  4F1S A;  3G2W A;  4L2Y A;  1O1T A;  4FU3 A;  3PZ4 A;  4LCT A;  5LCW J;  3Q49 B;  1UN9 A;  3ZUV B;  4BTA A;  3LY8 A;  5LFA A;  1P5Q A;  4GTP A;  4I1A A;  2AXU A;  4O6F A;  2PL2 A;  4KZ0 A;  4AP2 A;  2H6I A;  3MKQ A;  3S2A A;  1WAO 1;  1KT0 A;  1MJ0 A;  1FPP A;  4EBA G;  4UWK A;  5JHB A;  2AWI A;  4LSZ E;  3UKR G;  1N95 A;  2R05 A;  2CHX A;  2DZN A;  3ABL E;  5D0Q D;  3HXC A;  4G25 A;  4B0Z A;  2JLB A;  3TWR A;  4J6I A;  2KCK A;  4MLP A;  4FLB A;  1HXI A;  3E33 A;  1RZ4 A;  4U8H A;  1QQE A;  1YYH A;  1TNO A;  2ZU6 B;  4JXT A;  3JXI A;  3D9J A;  4HOU A;  1Q2Z A;  5C1D A;  4G2V A;  1SW6 A;  2ETC A;  4G23 A;  3RK6 A;  3L16 A;  2WXR A;  1SA4 A;  2WXG A;  1MHQ A;  2MYO A;  4BSX A;  4XEI G;  4GTQ A;  2OVF A;  3UTM A;  3AG1 E;  2WMN A;  4IYP A;  4APF A;  5FTP A;  3ASD A;  3HIZ A;  3EU9 A;  2XPY A;  3LDZ A;  4NUR A;  2I1J A;  2R2L A;  3UT4 A;  3T8K A;  4LG6 A;  1A17 A;  3E37 A;  2VTB A;  3V30 A;  3C3R A;  3ULQ A;  5B3S E;  2H6G A;  4LUN U;  2OVB A;  2HM8 A;  5KNG A;  1WY6 A;  1N4Q A;  2WXH A;  4N5Q A;  5FWQ A;  2KCL A;  3B7R L;  2WXQ A;  2P9P G;  3SZ7 A;  3FP3 A;  5HKP A;  3CVY A;  5T4Y A;  3QWP A;  5A7D B;  3RO2 A;  1IHG A;  4U7E B;  5G55 A;  2LXM A;  1HH8 A;  1D9S A;  5BXO A;  4I2Z A;  5LCW C;  3UPV A;  1WDY A;  4AV7 A;  1EF1 C;  4UI9 C;  4BET A;  4J7W A;  2WXJ A;  4YVO A;  4WWP A;  3MYV A;  3CHQ A;  2KC7 A;  4IN3 B;  4B89 A;  4ILH B;  4A3T A;  4DPR A;  1E8Y A;  5AEN A;  2XPI A;  4OVU A;  3FUJ A;  3FUI A;  3MV2 B;  3UM3 A;  3RSE G;  5AQ9 A;  3MA5 A;  4I6E A;  4JA9 A;  3TXM A;  3LKU A;  2F0Y A;  2QFC A;  4BWR A;  3NOC D;  4KZC A;  2MOW A;  5KNH D;  1QZ2 A;  4HRM B;  3BQO A;  3JUI A;  3RRM B;  3T5V A;  4JB8 P;  4KMO A;  4MKT A;  2ILR A;  5EIB E;  3FUE A;  4BX8 A;  3ASN E;  3PE3 A;  4NIK A;  1A5E A;  4GYO A;  3HG0 D;  4URK A;  3PEV B;  2AXV A;  2C0L A;  3CVP A;  2X3M A;  4E85 A;  1ELK A;  2UWJ G;  3NZU A;  4A3V A;  1Y8M A;  5BPP A;  2KCV A;  4GTS A;  5HRY A;  3ONL A;  4EZL A;  4PDX A;  3ONK A;  4HI9 A;  5FIN A;  1TJF A;  2XPZ A;  1NFI E;  2OND A;  2XEH A;  2CHZ A;  1B89 A;  5JHA A;  2BUG A;  3LJN A;  2IEJ A;  4I6J A;  1H0A A;  3CVU A;  4NRH B;  3MV3 B;  1TN8 A;  1UOH A;  3TWT A;  3CK7 A;  3QOU A;  2GRM A;  3Q9U C;  3QAQ A;  5JJT A;  3ZHE B;  1NA3 A;  4JW1 A;  4WNF A;  3UIP C;  3F6Q A;  2IJG X;  1AP7 A;  1TN6 A;  2L0T B;  1IYG A;  3ZIM A;  4TUM A;  3Q7A A;  3UXG A;  3LEW A;  1E90 A;  3Q47 B;  5AJD A;  2WQH A;  2LO6 A;  1OT8 A;  4FJZ A;  1BPO A;  2KBX A;  3CLJ A;  3UIN C;  3VLE A;  4ANW A;  2B6C A;  3JYS A;  3ASO E;  4GCN A;  1IHB A;  4E6H A;  2EQX A;  3CVQ A;  3QB2 A;  4FA6 A;  4PUC A;  3APC A;  3TG5 A;  3FHE A;  1H2U A;  3SFZ A;  2LSV A;  2J07 A;  4I43 A;  5FZR A;  4AOF A;  3ABM E;  1DCQ A;  3S7F A;  2A5U A;  3D9M A;  1S0P A;  3B7U X;  1HF8 A;  4I2W A;  4KXK B;  2L6B A;  3QJZ A;  2X6J A;  3UQ3 A;  4AY6 A;  4B93 B;  2CG2 A;  2ETB A;  3FUH A;  1N4S A;  4WNG A;  4U07 A;  4L1B A;  1NA0 A;  3DSS A;  4K0R A;  3KD7 A;  3B7T A;  4ATZ D;  1V54 E;  2NSZ A;  2WPV A;  4EPZ A;  3FU5 A;  2BF0 X;  1D8D A;  3PNL B;  2XEE A;  2WB2 A;  1H19 A;  1D8E A;  2PQN A;  1H2V C;  3SBT B;  2VQ2 A;  4DX7 D;  5DIZ A;  3C98 A;  1DCE A;  1DVP A;  4IRU A;  3AS8 A;  1GW6 A;  3CST A;  1HE8 A;  2OEW A;  2DYS E;  1NZN A;  2IU1 A;  4YDW A;  2XGM A;  4HRL A;  2CFZ A;  5FQ6 A;  3SQV A;  3OTN A;  2IFU A;  4WAF A;  4DX2 A;  1YA0 A;  2FEZ A;  3D9L A;  4M7C A;  4UQZ A;  3AG3 E;  2E0I A;  3LXU X;  2J9Q A;  1LD8 A;  4GA1 A;  5FZS A;  5ENQ D;  2QZA A;  5DBK A;  4N2S A;  4CRW A;  3LS8 A;  4I6G A;  1KPS B;  2GRP B;  5EN5 D;  3FFL A;  1ZBP A;  2X6H A;  1OWO A;  4FHK A;  4U0Z A;  3FTS A;  2DIW A;  5AJL A;  3ZXP A;  1G3N B;  1LD7 A;  4N3A A;  5LOZ A;  5BW8 C;  1PY1 A;  4CEM A;  1E8Z A;  3ENE A;  3ZXS A;  2EIK E;  3GZ1 A;  2BKG A;  3Q4A B;  3EIQ C;  3DPD A;  2VGY A;  2XCB A;  5AIJ A;  2H6H A;  5CEA A;  3CKC A;  1N9A A;  3PRZ A;  4PS8 A;  3OXG A;  2GRL A;  4GZD A;  5B1B E;  1MYO A;  1EDU A;  1IQU A;  3Q7F A;  3LY7 A;  3ZYL A;  2VGX A;  3EU5 A;  5KCM A;  4G11 A;  3DST A;  3QNK A;  4EZK A;  4Y6C A;  5BV0 A;  3NAW A;  2WXM A;  5AAR A;  3PZ2 A;  3E34 A;  1K1B A;  1U3D A;  1LF8 A;  4WWO A;  4X8Q A;  2LNI A;  4APO A;  1YCS B;  5JA4 D;  2VSN A;  2PNN A;  2H6F A;  1ELW A;  3PZD A;  2HO1 A;  2QYU A;  4HXI A;  2QYJ A;  4F7A A;  4UI9 J;  5CBO A;  2R17 C;  4ILI A;  4BEP A;  3SNX A;  1K1A A;  3QDN A;  5LP0 A;  2V5Q C;  3UM0 A;  1KZO A;  3DXK G;  5D2M C;  4FLH A;  2R03 A;  2GRO B;  4ANV A;  3AG4 E;  3L08 A;  3ML9 A;  4MBG A;  3Q75 A;  2DWZ A;  2F8X K;  2OV8 A;  5E76 A;  3S7D A;  4N3B A;  1U2V G;  4MRU A;  3JUE A;  2AVP A;  3Q79 A;  2XS8 A;  2DZO A;  5C2Y A;  4CZ2 D;  4GYY A;  4JD2 G;  4RG6 A;  4QQI A;  2P2C P;  5AQB A;  1OWP A;  4G24 A;  1HZ4 A;  4DRX E;  4WWN A;  4CCA A;  3HVE B;  3U66 A;  3RAU A;  5HQ8 A;  2NXP A;  2ZGG A;  4GMJ A;  3NBN B;  4U8Y D;  3DSV A;  2I9C A;  2P9N G;  2FI7 A;  4C0M A;  1H6P A;  2XQ0 A;  2V4L A;  2MRI A;  3R7R A;  4OYS A;  4UWL A;  1MX2 A;  3GZ2 A;  3X2Q E;  5KJM A;  2I6H A;  3V79 K;  2QC9 A;  4HOS A;  1HS6 A;  4ZFH A;  5HI7 A;  2YHC A;  4RVB A;  4CT0 A;  2GRQ B;  3I3N A;  4HOT A;  1TEZ A;  3KS2 A;  4ACK A;  3U64 A;  1Z3Y A;  1Z6T A;  2HR2 A;  1PC2 A;  3SBS A;  3V2X A;  3QKY A;  1WM5 A;  2LXL A;  5A23 A;  4GTT A;  4HFG A;  3NZS A;  3SI5 A;  4LRZ A;  3CHM A;  4UWH A;  2P9I G;  3FEX A;  4CT4 A;  1KLX A;  3HDX A;  3KSL A;  3FU6 A;  4F6R D;  4I1O B;  3OXL A;  3PZ1 A;  4IUL A;  4L9P A;  2E2E A;  3FWV A;  3SHF A;  1H2T C;  1TNU A;  3IHY A;  3MX3 A;  4Q96 A;  2VTB B;  1K8K G;  3DXM G;  4JA7 A;  3HXD A;  4GZ3 A;  4PS7 A;  2WXL A;  2XHE A;  3ZPJ A;  3MCX A;  5ITZ F;  4OAV B;  2OCC E;  4GMR A;  4GPM A;  3TWU A;  4XKC A;  1O5M A;  1W3B A;  3D9N A;  3ZHE A;  2RG8 A;  3P1U A;  2Y0B G;  2BTD A;  2HE0 A;  1ELR A;  4NAC A;  3CGH A;  4GCO A;  5AQA A;  1NI1 A;  3IHV A;  2KM4 A;  3S7J A;  1JWG A;  3AJI A;  5EYP F;  3EUV A;  4HVB A;  4GPK A;  4HB5 A;  2EIN E;  4HLL A;  4FP7 A;  3ML8 A;  2ETA A;  5CEC B;  4J8F A;  5CER B;  2PZI A;  4J8D A;  2Y69 E;  3NB2 A;  4KVO A;  3I5P A;  1JCS A;  1UJK A;  3KAE A;  1N4P A;  3D9K A;  5D66 A;  4B8A A;  3PDN A;  4GTV A;  4I9E A;  2RFM A;  3FTY A;  2VSY A;  3AG2 E;  2DBA A;  5E75 A;  1WG0 A;  3FTX A;  5FJY A;  3PS6 A;  4Y6W A;  4EBA A;  3G2U A;  3R9A B;  1OCO E;  3CHR A;  3SO8 A;  4D10 C;  2P9K G;  3GZS A;  4XIF A;  1S70 B;  4ME2 A;  1TNZ A;  3BUA A;  2X6I A;  4TXQ A;  3T5X A;  5KBA A;  2LAH A;  5CRV A;  2BED A;  4DLQ A;  4BY6 A;  3SF4 A;  2HYZ A;  3R9M A;  1Z5S C;  1OUV A;  3HXF A;  3CR3 A;  4GU5 A;  3L17 A;  4YDE A;  4XI0 A;  4N5C A;  3CVV A;  1RW2 A;  3U9W A;  4AM9 A;  3LYA A;  4XZ4 A;  3LVR E;  2XRY A;  1V55 E;  4F1P A;  4HS2 A;  4GTR A;  5EKQ D;  2X6F A;  3EDT B;  2KZT A;  4O60 A;  2AW6 A;  1UJJ A;  2WXN A;  1ZU2 A;  1OWN A;  3ASF A;  5J90 A;  4WUY A;  3DBS A;  3VTX A;  3ULE G;  2CFU A;  4NQ0 A;  1KZP A;  3UT7 A;  2P9L G;  1N4R A;  3S7B A;  4BES A;  2L6J A;  4JVS A;  4C9B B;  3TJP A;  3TWW A;  5ENS D;  4U04 A;  3FUF A;  4RG9 A;  1SZ9 A;  3LY9 A;  1LTX A;  5EDS A;  5KJL A;  2L9B A;  3FH5 A;  2WQ7 A;  3ESK A;  4LEU A;  1HG2 A;  3DSU A;  4U63 A;  1JPL A;  5FIO A;  1Z3X A;  3CKB A;  2YHE A;  1TNY A;  1QBQ A;  4R7L A;  4M3O A;  3C5R A;  2Y3A A;  4EHM A;  4JC8 A;  3ZW3 A; 
#chains in the Genus database with same CATH homology
 3HXF A;  1MZC A;  1N4Q A;  3SFY A;  2H6F A;  4YDE A;  1O5M A;  1N4S A;  1FPP A;  3DPY A;  3DSS A;  3DRA A;  3HXB A;  1N95 A;  3Q78 A;  3KSQ A;  2IEJ A;  1TN8 A;  1KZO A;  1LD7 A;  3HXC A;  1NI1 A;  1D8D A;  4GTR A;  1SA5 A;  3EUV A;  3E33 A;  3Q73 A;  4GTM A;  4LNG A;  3E30 A;  4LNB A;  4MBG A;  1TNO A;  3Q75 A;  1TN6 A;  1D8E A;  2H6H A;  1JCQ A;  3Q7A A;  3DSX A;  1KZP A;  1JCS A;  1FT2 A;  4YDO A;  1N9A A;  1N4R A;  1N94 A;  1TN7 A;  2F0Y A;  1N4P A;  1FT1 A;  3Q79 A;  2ZIS A;  3HXE A;  1DCE A;  1NL4 A;  1SA4 A;  4GTV A;  4GTT A;  4GTQ A;  3Q7F A;  2H6I A;  1LTX A;  3EU5 A;  1S63 A;  1O1T A;  2ZIR A;  3KSL A;  3DST A;  3PZ4 A;  3DSU A;  3PZ1 A;  1TNB A;  1O1R A;  3PZ2 A;  4L9P A;  3E34 A;  3SFX A;  1LD8 A;  1O1S A;  1TNU A;  1TNY A;  2R2L A;  1QBQ A;  1X81 A;  4GTP A;  1TNZ A;  4GTS A;  3DSV A;  3HXD A;  3E37 A;  1S64 A;  4GTO A;  2BED A;  1JCR A;  4EHM A;  3E32 A;  2H6G A;  3DSW A;  3PZ3 A;  3C72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...