1TO4A

Structure of the cytosolic cu,zn sod from s. mansoni
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
b'GSNMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGLAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structure of the cytosolic Cu,Zn superoxide dismutase from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 45
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1to4A00
1EJ8A 4N3UA 2WKOA 2JCWA 3MKGA 1UXLA 2AQTA 1F1GA 4MCMA 5KBMA 1PU0A 1SXBA 2C9SA 1F1AA 2AQPA 2GBVA 3ECWA 2E47A 1DO5A 1OALA 3L9EA 5KBLA 1E9OB 4A7GA 1IBBA 2WYTA 2VR7A 1KMGA 3H2QA 1PTZA 1E9PA 1TO5A 1RK7A 4BCZA 1OZTG 2WZ0A 2SODB 3GTVA 3SODB 4A7TA 4B3EA 1CBJA 2C9VA 2R27A 1S4IA 3GQFA 1L3NA 2VR8A 3KM1A 1F1DA 3LTVA 4BCYA 1E9QA 3QQDA 2WZ5A 2WZ6A 4OJAA 1XTLA 1Z9NA 1SXSA 4BD4A 2JLPA 1AZVA 3RE0A 3HW7A 2E46A 1E9OA 1OAJA 1JK9B 2GBUA 3KBEA 1ESOA 1SXAA 1PZSA 2Z7ZA 4A7SA 5KBKA 1YSOA 2GBTA 4MCNA 3F7KA 1N19A 1SRDA 1YAZA 3L9YA 3HFFA 3S0PA 4FF9A 3PU7A 2WWNA 1JCVA 2ZKWA 1FUNA 2AQRA 1N18A 1SXNA 2VR6A 2AQSA 4U4IA 2AQQA 1DSWA 1HL5A 2WKOF 1B4LA 3CQQA 1Z9PA 2V0AA 4OH2A 1SDAB 1UXMA 2ZKXA 1CB4A 1YAIA 1E9PB 1EQWA 1IBFA 1COBA 1XSOA 1HL4A 5CU9A 2ZKYA 3GZPA 4N3TA 1XTMA 1BA9A 1OEZW 1SDYA 1B4TA 3GZQA 2AF2A 3F7LA 1P1VA 2AQNA 1MFMA 1Q0EA 2C9UA 2Z7YA 3T5WA 1E9QB 3K91A 3GZOA 3KH3A 1BZOA 1IB5A 3GTTA 3QQDB 4A7VA 2XJLA 2Z7WA 2APSA 2NNXA 3ECVA 1TO4A 3CQPA 3KH4A 1F18A 4L05A 1SPDA 2WYZA 2LU5A 1QUPA 1SXZA 2K4WA 1SOSA 3ECUA 3H2PA 2AEOA 1IBHA 4A7UA 1SXCA 4A7GF 1JK9A 2XJKA 2Z7UA 1U3NA 1OZUA 3CE1A 4A7QA 3HOGA 2ZOWA 1IBDA 3KM2A 3MNDA 2WWOA 3KBFA 2Q2LA
chains in the Genus database with same CATH superfamily
3K6OA 1T1WB 3ZDXF 4JAMA 3GMQB 5TK4A 5FKAA 1UXSA 2XZCH 1AMXA 1AO7D 1B9ZA 4I0PB 4KV5E 4YOKA 4G8AC 5I8OH 1FH5H 4H1LB 4PR5A 4HXBH 5ETUB 4MJIB 4MA7L 1W2KT 2VR7A 2ZG1A 1NBQA 3KJ6L 3ATFA 3LYRA 5IB2A 4GQ9H 3L3GB 1OP3H 4A68A 1RZ8A 1GCYA 1IIKA 2CKBB 3F6JA 1H8SA 5HGDB 4NQEA 3LKPB 1LMIA 3VNZA 4BFIB 2V2TA 1J87A 1JRHH 3Q8FA 3RNQB 2QDVA 3TA3D 1BVZA 2A6DB 1DBKL 5KVEE 5C0GA 4MD5B 1D2PA 4K9JA 4LSTL 3CZGA 3STZB 4BQBA 3LTVA 1WA0X 2XPGB 5F0JB 2ZAHA 2ATKB 2I7OA 3AFLA 2N0MA 4HCRL 3QCVH 2ZCHL 4PG2A 1S7TA 2YPLA 2HMID 2WP3O 1GH7A 3TL5A 3GMNA 1FNEB 4YHNA 2NW3A 1JK9B 3NIFE 1SLWA 4PS4L 5LJYH 3P0YH 2XBDA 2JJSC 3RVTC 5I6XB 3ARFA 1G6RB 4S0TD 4L29B 4FXLA 1YAZA 4X6FA 5I17A 4POYA 1N0XL 4X0KB 4WWOA 5FV1L 2YD3A 5DFVD 2DLFL 4N2CA 2J1KA 3IFNL 4CUCA 1HESA 3VFWB 2DIJA 1BPLB 4G11A 3WEXB 3S36L 1L0PA 1AI1H 4M1GH 2I85A 3HUJE 4ZFGL 4JPWL 4NPYA 1RK0B 2OMVB 3RWCA 3PUUA 4MZIA 3PWPB 3PWVB 1NOFA 4WEMB 3TYFA 1WVZA 3TZVD 3SIKA 3WHXB 3NMEA 1EAJA 3L1OH 2OCCB 1BQKA 4RSVA 1BVLA 4JG1H 1ZXQA 3MX0B 4UQDA 3QDGE 1JK8B 4Y4KB 5T5FL 3SKJL 2O93L 5TDPB 1TMCB 4LDLB 5LXGL 4TTDC 5GGTA 3BAKA 4BA0A 4R7VA 3SPVA 4YIQA 2A1WL 3ENEA 3UZQB 1QFPA 2VAAB 4F20A 4X6DA 3LIZL 5F7NC 5AW8B 4G6KH 4JRXA 2WWMD 1JYVA 1D3CA 4Q7DA 3K4ZA 3APFA 3WG7B 3PAUA 1DQDL 3N50A 1G7JB 5HDQL 2OMYB 1AZZC 3Q9PA 2V5RA 3WLBA 3MNMA 1M2OA 3GK8H 5IB3B 1CYXA 3FUJA 2XXFA 1NKRA 4BSWB 2G4GA 3LNFA 1I8KA 4PJXF 1N2RA 4XX5A 3ZHLA 3L5WB 1MCOL 3KPQA 4KQ4H 4UDUB 2NSQA 4YK4C 1KC5L 3OMAB 2K6WA 5FWQA 1O0VA 1NMAL 1KWKA 4UDTB 4PRHB 4OLZH 1QKZH 4XB7A 5LWYH 4ZW3A 4IJ3B 3TYGH 4GUOA 3SYQA 1CG9A 4UILL 3VGAC 2APFA 2BDNH 5DVOA 2Y0SA 3GBML 2HVJB 1P4IL 5DZVA 5F44A 5HI4C 3WTWA 4CKQA 5E2JA 4N87A 2CJTA 4PJDA 4UIKH 4Z8FL 4JM2C 1XBRA 2X10A 5D2LF 5HTSA 1TYEB 4O00A 2D7TH 3NJJA 5TE4L 1NICA 5EHFA 1FFRA 4CDHA 1H3VA 4XHJD 3P3UA 1C1EL 3MUZ1 2WVSA 1ZV2A 1RVFL 4DO6A 3KW7A 1LO2H 2YJQA 2Y36H 4CADA 5IMKB 4JHAH 4U6YA 4XPBL 2ED6A 2W80C 3RGVC 3G3LA 3J27A 4NBYB 4U1GC 4Q4IA 5L2KE 2Z0BA 4POUB 5C6TL 1FE8H 2GIMA 5DHDA 1WEJL 2HG5A 4LHJB 3L4WA 5E8EB 3M86A 4XPGH 1MCWW 2EIZB 2BSEA 2ZXWB 4GKNB 4YDVA 1X7QB 4E42B 2ESVE 4Q6KA 3FUIA 4KH2A 32C2A 5C70A 1EDQA 2W9EL 4G9DB 4PJEE 1NIAA 4PUBH 5E2TH 3ARFC 1WICA 1EANA 3C6LB 4BKSC 1J9CT 4YUEH 5GJSH 2GK2A 2Z35A 3PNWB 5DZOA 3D3VA 5DQJA 1B0WA 2VJXA 3KLLA 1DQLL 5HHMB 1MWAA 3QI9D 4ALAH 1J0JA 4M8UA 2FBJL 2OMZB 3VFTB 2CA3A 4XWGH 5LCVH 1FNGB 1PFOA 4ZTPL 2AXFB 3CHSA 3HRZB 1OO2A 5C07A 3GB7A 2FO4A 3FFCB 5ESQB 2CUHA 1UD8A 1CYGA 5CWSB 2Z8RA 2DQEH 2CO2A 5DZAA 1BQLL 4H5SB 1B2YA 1KXQE 5DMJB 1S7QB 4FCAA 4IBYA 4F37F 3WEAA 5BVPL 4JB9L 5DUML 4B9ZA 3ARQA 3GSQB 3TPUA 4KJYA 2XJKA 1U0QA 2XTJB 5T1KA 2BSTB 3JUYA 3WY2A 1DVXA 2WKGA 3Q6FB 3VD5A 4QLWA 1JHTB 3R4DA 3KBHE 5E94A 1AGFB 4M6NL 1BF2A 1TTBA 4HFWB 3CN4A 4WU7B 5GS0D 1E6OL 3L4YA 2JCWA 3QQ9C 3KGTA 5GS1B 1CT8B 3WNKA 1W6LA 3NJGA 3QORA 1FLRH 3LD8C 3BP4B 3MCYA 3RVXD 1XGYH 4NZUL 5GGQL 3V4LA 4KHTL 3VMOA 1N5YH 2I5YH 1NJ9B 1G7MA 4M7LH 4KVCL 5JQIB 5CEYB 1MCDA 2GSMB 3LSOA 3V6OA 1JRHI 3ARBA 1GS6X 3PGFH 1W72A 2H2SC 1IGJB 2X4TB 2ICEB 2V3DA 3QPXH 3ZHDA 1GMIA 4TVPE 2EDQA 4NKQB 2VDRB 1DEEB 2QPDB 4U6VH 1B2WL 3A22A 4JFHE 3QORD 4ZFQA 5LAXB 1SY6H 1DLFH 1XF1A 1VFBB 2VIRA 1IO4C 2RAMA 1KJ3H 2VR4A 1PJ9A 1IQWL 1FL6B 1N5AA 1WWCA 2PWFA 3AU0A 4L1LA 5K9OA 1DUZB 2IBZY 4PRIB 3RY6A 2IADA 4PRDB 4JKLA 3RWGB 4D8OA 1FVCB 3PWJA 1UM5L 4BKLA 2Q7AA 4WWNA 1I9IL 3BH9B 5DJYA 5L0QB 2G2NA 2FDBP 5IUSA 1M7DB 5D1XE 3T6WA 1CZ8H 3DMMA 2D73A 4JDEB 1UFGA 3QDJB 1G7QA 3MRPB 4HHWA 4U2YA 4L8CB 2N01B 3QC6X 3QAZB 3JBG7 5KJ4A 3ZKMD 3K71B 4KO5A 2B3RA 5JUEL 2X4PA 2DWEB 1Z3RA 4PV1C 4LKCA 2HT3C 3DVIA 5HYJA 1DFBL 4WFFE 2R4RH 3SE3A 5TFSL 3F5WA 4FEIA 1AC0A 1IFGA 3BUPA 3LS4H 3PV6A 5I76A 2UZPA 3PG2A 3CUPA 2FEDD 2WLZA 3ZR5A 1IFRA 2WNWA 4EQ2A 1OGAB 4NX0A 4R6UA 2EVGA 5DFWH 1WPCA 4Z3EA 5BVJA 3P1VA 4XAWL 3VG0H 2AQNA 1KYFA 2VDQH 2Q76A 4OCSH 3BAEH 5D6CB 4AIZB 5KBDA 1IB5A 3O3BA 1NAMA 3WL9B 2CGZA 4OM0L 4BFKA 3MR9B 3MREA 3ECBA 5IVZA 3V5KA 3HE7A 5FYJU 1WWWX 4M6ML 3MV9A 1UWYA 4YHMH 5IFAH 2R2EA 4N68A 4UI2A 3T0EA 4QR7A 3GLAA 2H0JA 4OJCA 4OF6A 4L4VE 1WV7T 2UY6A 3AXIA 5D7SH 3RKDD 3LH2H 2WTRB 4OGAC 5T3ZE 1U8LB 3SKOA 1D6VL 4O9HH 4U2ZA 1KIPB 3KL0A 4FS0A 5CXPA 5L4FA 4Q89A 3ZT7A 2OXGA 3NESA 4HUXA 1CGVA 5I5IA 1JGUH 1JPTH 3T0BA 3T65B 3CK0H 4RQQA 2DQFA 4QTIH 4NRZA 1QRND 2CNZA 3SDXB 5J11C 2Z91B 3T0ED 4JO3L 4TUOA 5DD6B 1MG2C 3S4SB 5AW2B 2C1OB 4N0UE 3QFJA 2EYSA 2VR5A 5E8DL 3NSYA 4KNSA 3QP3A 4WTQA 1ZEAL 2ICWB 3U36B 1UWGL 4G5ZL 4IBLT 4XN9A 4PW9A 1S3KL 4L0PB 1U8QA 3QQ3B 3CN0A 4ABWA 4YZFE 4OZIB 2VZSA 2PTUA 3CZLA 4K7PL 1JNJA 4YHLL 2XI9A 2CUIA 4YVUA 3OKMA 1AZVA 3IRZA 5C0AA 1GYVA 3MJWA 4LCWD 3H7BA 4NUGL 1O9ZA 5IESH 3DETD 3AY4C 4G3YL 4N90D 4MAYB 1B0GA 1U3ZA 2VW6A 3TURA 1Y6MR 1HSBA 3EH4B 1QEXA 3EYQD 3IMRA 1WQVT 5BV7H 3D85D 4LLUB 1WA2X 2V9TA 4TXVB 2YA1A 3D8MA 3MUGB 5ACLA 4EDXB 4XN8A 3HC4L 1IKFL 3EZ8A 4X83A 4APXA 4KDTA 1XGQA 1RQ5A 2AEIT 3UCRA 5T33H 3L17A 3PE9A 1DVZA 2EUVA 3ETBF 5JHDA 2G9KA 3GWJA 2HFGL 4JFEB 3VG9B 2H6PA 2HFFB 4F2EA 4GXFA 1ZHKA 4WI6A 1CUOA 3N44B 4Y5XA 2JKSA 2A0LD 4WUKL 3L7FB 3PL6D 1LL1A 1NFDA 2HPOA 4N8CL 5DGRA 2X3BA 3C8KA 3FYIB 5C0BB 4ACPA 5D7JD 1JGLH 4DQOH 1BW8A 1MSPA 3E8UL 1G9NH 4ZNEA 5CLWA 4X5RA 4W93A 3D4CA 3KLAA 1HX0A 2YBRA 2QLVB 4QT5A 1KSRA 3U0PB 3MGTB 2CPCA 4NO2B 2JKWA 2F5BH 3LY6A 3PYCA 5C2UB 3A67H 1WFTA 2P9RA 5EEUA 2KDYA 3MNWB 1N12A 4GIAA 1CC3A 2XWJB 5DJDB 3SYAA 3KM2A 5T5NG 2W0PA 2MPVA 5MEND 1HYSC 2ORBH 4K7PY 3RTQA 5F1KC 1YQVH 3MXVL 1GZHC 4MSWB 2ZP8A 3AITA 4N0FB 2OJZL 1VZHA 1JVOA 3JTTB 4RAVA 3T9WA 1NBZA 3BFWA 4BH7A 1KB5H 5GGVH 4U49A 1YJDH 2XWEA 1AG6A 4J3OC 3FB8A 4TQPA 2CRYA 2DQHL 4UM9D 4JNXA 3VD3A 2WIIB 3BMVA 3BDYH 2AXGB 4X80H 3Q5TA 1KYOJ 1I7UA 1KIRA 3UBXI 2YAEA 4QDGA 5IMOA 4A7TA 1IC7H 1YECL 1Z0NA 2P5WE 4JFDE 4ELMB 4HK3J 4H26B 1UOLA 3UEZA 3ULUD 2GITA 4I0KA 4LASL 3NH7L 3X1EA 3X17A 4Q4EA 3PHSA 5IHHA 2OZ4L 3QG6B 4KK6C 5IROD 1D5MA 1S6NA 2GCYA 2R0WL 4NWTL 5CZRA 4O4YL 3WMSA 3F58H 5ABZA 2R1WA 5CBAA 5AWNH 4MDRA 4F92B 2ZSWA 5LGJB 2F58L 4PLJC 4NO3A 5DMGD 3EYOA 1WH0A 3UZVA 3PHAA 5FGSA 1GIGL 2AGJH 4N8VB 4FF9A 1ANUA 2XRAL 1AR2A 5C0IA 3C6SA 4Q0XL 2B7DT 1NFAA 1ZVSB 4HUKB 3QRGH 4C55A 3KYOB 5T1DL 4YDKH 2PYFB 4YHZH 4JJ5B 1EGJL 4RWYH 3FCSB 4BH8B 3QZOA 3DOSB 4JFXA 1HH9A 4FE9A 4KXAA 4NN5B 5G2NA 2LHAA 1DR9A 3VFGH 1VLXA 4Q52A 1IGCL 2YS4A 3QA3B 4G6AC 3GMPA 3T77A 2M2DA 1EJFA 4KQ0A 4PWJA 4W4OA 3N1MC 4GW5A 5ENWA 1GGBL 4R2GD 1HVXA 4O5LL 5EO9B 4IKNA 2AAVA 3ILPA 1I3VA 4TQEH 3RB7A 3KWVA 4P05A 3WTUA 4POZC 3X13B 1DQMH 4IDJL 1Z6JT 2WC7A 4PRPB 2EEDA 2YK1H 1GJUA 4NC0B 4OD2A 1CFQB 5INDB 2DWTA 3BH8B 2D03L 2A38A 3D1MC 1Z9SB 1EHLH 1SFHA 1TO4A 4M6AA 1JZ8A 3T8XB 3NEOA 4BIKA 5IQMA 2XYBA 1BLNA 2CA4A 4N24A 5DC0A 4DUXA 2HN7A 4MXVF 2VZUA 5MEPB 5CP7B 3B7RL 1SBSH 2VZ3A 1K8IB 4XOCA 2P28B 2NUPA 4XBPA 3RWIB 4X6CE 4IBQA 3VGGA 1AYOA 1QFUL 2O5ZH 3DIFB 4ODTL 1FO0H 3HZVB 5M94B 5FB8A 3SDCA 1JZ7A 1XAKA 3S3JA 3OXRA 2VUOA 4W9LC 3T0XA 2R29A 5A3IC 4MCMA 1BEYH 2CBOA 3EO9L 1M6OA 3GMMB 4B9IA 3VD4A 3O81A 5EDXA 1MDTA 1QFOA 5I9QB 1ECYA 2APTA 2E47A 2IFFH 5HVHC 2AC0A 4HEMA 2XHNA 3EYSH 3UTPE 5JXEC 3UH8A 2IH1B 5KYUA 2B1AL 3DO3A 4XPHH 3RTQC 5D2NB 5J3HC 3S37X 5TQ2H 2DWDA 3QJXA 4ZZKA 5I71B 3MV8B 1OCWH 3DOHA 2XV2A 4U1JB 3AREC 3EW3B 5CCGE 4NZFA 4K2UH 3MOQA 3BUIA 4PJCA 1QABA 4GUPA 1L3NA 3KM1A 3OSVA 2APXA 1FNLA 4NT6B 1YMME 4V11A 3FH8A 3UTSE 3OKLA 2OR7A 1Q1JL 2LTQC 2OFQA 1BGXH 1JHLL 4HIEA 4PWEA 2XN1A 4LSDA 5L6YH 2OX5B 4XP5L 4KI5C 4Y4HC 1T2QL 2R9HC 1INQA 1KXHA 1NGQH 1ACYL 5DJZA 5BRZB 3IF1B 2XWCA 5I73C 5F7BA 5JHMA 1BFVL 2GAZB 3IGUA 4B5ZA 2GABA 1AD0B 5CGTA 1NDGB 2XBTA 4FXKA 3P30H 4QRPB 4H8WL 4RA3A 2PW1A 3K7UA 1F4AA 3WENA 4RZCB 1H3PL 4DGYL 3ARYA 1RP8A 3KGRA 5F7DA 5KSUB 2EUXA 3Q1EA 4GSQA 5KYNA 1YN7B 1HL4A 5E1GA 4PJAB 3STLA 1C7SA 1Y07A 4OLWL 2FRGP 2MKWA 3ZPDA 2RA1A 2BVPA 2NR6D 3ZKNC 4MAYD 4ABVA 3QUXD 4ADJA 1PGRB 2DLEA 2JTYA 5CIPH 4XAKD 4RISL 2DJSA 3OLDA 4A66A 5HVWA 3GZQA 5D7IE 5ABDE 43C9B 5IFHL 2IWGA 4AC2A 5H8DA 4OGYH 2VC2L 2FH6A 2AS5M 4XZUA 2YRPA 2ZWYA 2L7UA 2VLJE 1NM4A 1Q72H 3GZOA 1VHPA 1CXHA 2EDLA 4NM4H 5CBEA 4AYGA 3DX9A 5KYXB 2ZOTA 1REIA 4ZUUA 1VA9A 4JPIB 3ZTNH 1JZ6A 2HRHA 3FMGL 3NJXA 4FQCH 2PWHA 6PCYA 2HVKB 4ESKA 3ISWA 1JN6A 3E3QC 1OM9A 2AJSL 2IAMA 5HDWA 1QI5A 4RFEB 4UZGA 1EHKB 3WY4A 2HKHH 1OHZA 1A7PL 3NIGF 2WKLA 4BHUI 5CGMA 1JTOA 4X50A 2X3AA 2YC1A 3SKNB 4WTZG 1SY6A 1T1XB 2IC2A 4JFWA 4JFFE 2PNDA 1CE6A 4NQVA 4EUPG 4FC3E 1JS4A 3DX4A 6TAAA 3K2MC 1UCTA 2BNQE 3R06A 5EIQA 4L3EB 4E9VA 1F11A 1X5GA 1AKJA 3QXAB 3OZ9H 3SDCC 1I1AA 5E0QA 1XH1A 1SMDA 5ALBH 4LLYA 1WSST 3VRJB 3CQFA 2X4QA 5ITFB 3RA7L 3JVGC 3TT1L 3K80A 1E6JH 3UJJH 3BN9D 3CU1A 3VXSB 4OJDH 1ASQA 1FRGL 4QHNA 2OMTA 4R3SA 1QSFB 3NIDB 4QYOA 4NO5B 3SDAB 1JZIA 2FIKB 2A74C 3GEWB 3MRIB 8FABA 3T0DA 4G5AA 4OF7A 3Q13A 4NSKB 4DK6A 3LDBB 1V7NH 5KS9E 1NCDL 1ZWIA 3KPSD 1MCPH 1S7RA 1HE8A 3LQAC 3UL4A 4DEUA 2X53A 5F7EH 3WFCH 4XMPH 1PG7X 5AB2A 3WU1A 2R59A 4FTVD 4GAYA 1IEBB 4QRRE 3TJPA 2J3SA 3MUUA 4Y2OB 1UWEH 4QRAA 4NQDD 2X1PA 1B4LA 4JZOB 2I24N 3O6FC 2DZEA 5HJDA 2H6UA 3F7YB 2GSIB 2GYSA 2JJTA 4QOKE 1CFSA 2FBRA 2P8PB 5EWIL 1T20B 4XCCL 3SE4A 3VFMB 5IWLC 3WDIA 1G7LA 1D5BA 1FNHA 3MGAA 4P2QD 4R4BA 3SCMC 3FQXB 1KY7A 4X7EC 3TV8A 4EBQL 2YD4A 3QAQA 4JG0H 4Z7VB 4H2CA 4XO4A 1P5VA 4WW2A 4QLRA 3MSPA 1EEQA 3BPCB 4DVRH 4DZ8B 2CU9A 3I2CL 2XOTA 1Q94A 1AR1C 3EBAA 3AXHA 2EDNA 1ZT7A 2YPLE 4NKIL 2ARJB 1WP6A 5CU5A 1PIGA 4BFJA 4ZAKC 2YBGA 4UT9L 3DURB 1OT1A 4E41A 1RFDH 3MBWA 2FHCA 4PJ9A 3ZMEA 5A2IH 5AEAA 1KCLA 5IV2A 4PJHB 5L9DL 4FXGA 3TVMD 4PRPD 1JVKA 3UTZA 5K93A 3MCKB 1DDTA 3O9WB 3CHRA 5I6LA 1QNIA 1LO4H 4PJFF 5DZPA 3BD4A 1RJZB 2R51A 4XP1H 4S1DC 3GGWA 2C26A 4PJIA 2H2PD 4JANA 1DBJH 4LLVB 3FTUA 4HBCH 4H8VA 1F58H 2WB7A 2GT9A 1UZ8B 2MQ0A 5TGBB 4YNYA 1T80A 3EADA 4PTUA 3ZSTA 5KSBB 1SFDA 5PCYA 3JWNH 3BZFA 2WGNB 4MD0A 2EEBA 3U4EA 3SDYH 1I7TA 1P7QA 3MLVH 2VDKB 3O2VL 3ZE2B 4FQQA 2X4SA 3LKOA 4PW3A 1OB1A 4WIQA 3WNPA 4R0LA 1FF5A 4J3OG 4ZI8A 5A43C 4ENED 1UA6H 4EN3B 1K85A 3UMTA 1XF4A 1IV8A 5AB0A 2JKNA 2VR8A 4I3RL 1YNTB 3ME0B 3KPOB 5IHLB 3ZDZB 1MVFA 4JRXE 1UM4H 2Z4QB 5EC1A 4DZBB 1T03L 2BO0A 4Z7NE 4U1LB 3Q6GL 5E2WH 3CG8A 4AJWA 3X1BA 4XPTL 1S9YA 1HOEA 1YHPA 2ZXEB 1KBGH 3QZNA 5ID1B 1M57B 1AXTL 3CSGA 3MJ9A 3W1ZA 4IIQB 4N2KA 2JB6B 2E7LC 1DVYA 3SQRA 3FB5A 5DU7A 3ZTJG 1X5MA 4KITB 1FN4A 4LCVA 5CMAB 1RURL 4F2MB 3P3TA 3UG5A 1DSFH 5C08B 4B9YA 5D7LB 3U25A 5J1SC 3PGDB 5H4ZA 1O7VA 3IN2A 4HSCX 1IBGL 1RL1A 2FATH 3WFZA 3B4NA 3V8CA 3BKYL 4ORGB 3OMZA 5DEGA 4BHUA 1UQSA 3HG1A 1MRCL 1I3GL 2APBA 4PJDE 5EZOL 2VDPB 2CAKA 4PB9H 2X4OA 4QGTA 3P9MB 2GTQA 4WWKA 4OJEH 2MPAH 3Q1SH 4PS3A 3FN0L 3STBA 4C56A 3T4AC 4HS8L 4R5XA 5FYKL 2BP8B 1YEIL 2EH7L 2PCFB 3VSTA 2OK0L 2ZZUT 1PKQA 1TJMA 1AJ7L 4DO5A 4HF5L 3QO1A 4LHUA 3L5XH 4CBZA 3HG5A 2XWXA 4NZTH 5J4MA 1AVAA 2VDLH 3KYAA 2NXZB 4MS8C 3LEVH 2R69H 1LHZA 2Z7UA 1U3NA 1QQDA 3LPOA 1J1PL 2BNRA 4HKJB 4Y1TA 3QR2A 1PDKA 4NQCA 3C08L 3LKQA 1JPEA 4DTGL 1QACA 4X9IA 3HPLA 4YFLF 4Q6IA 4WWKD 5F7MC 2BIPA 3Q7JA 4IHBA 1A7OL 1JV5B 4K3DL 5K59F 4JPVH 1UVQA 3EYVB 1V10A 3H9ZA 4PJ7F 3N9GH 7FABH 1EH9A 2IGTA 3ZQXA 5T1LB 5CFAA 5EU5B 1EV2E 4PYHA 5CEZE 5KSAB 1UH4A 3ULVE 1AS6A 1OSYA 2BVOA 3NA9L 4ZMAT 3U2SB 2X1OA 2EQDA 5B1BB 4P5MA 3O0RL 3VMNA 2IANA 1QR4A 4JFPB 4HW6A 5HYQB 4XCEB 4JZNB 4ZUVA 5IB4B 4GINA 1HXMB 1S9WB 5FO2A 1PAZA 3GBNH 1TZ8A 5DJCA 3U2IA 4G7YL 1JOIA 1C5DA 3GQFA 5HI5C 2VW4A 4OB5H 3A6BL 2Z6FA 3CDGB 1XGZA 4N1CA 5E8PA 4G70B 12E8L 2XZQL 1U42A 1IQDA 3KL5A 4PWIA 1MKFA 1PYWB 2H26B 5F96L 4F7TA 4BK4A 4OF8A 1AD9A 2WVVB 1TQSA 4Y7MA 2J88L 1EEZA 1ZS2A 4L9LC 1I85A 5DURD 5JZ7C 1D5ZB 3PU7A 4J2XA 3CX2A 1MPAL 2YLHA 1SHWA 3IMSA 5IMLA 4M5ZH 3AT8A 4AEHL 2AQQA 3HKZA 5ESVA 2IDQA 3DO4A 3K8LA 1R6VA 1XGPA 3GJFH 5FIEA 2DDQH 1IGMH 2XQYA 1PIFA 3DUSA 1S5IL 3QULB 3TA4D 1D7BA 1A4KA 1D9KA 1P9MC 3ET9F 1ZTXH 4LVHC 4AEIH 4BSVA 4HMEA 4LBEA 1JP5A 4U1NB 2ITCB 4TULH 1F90H 3O6ML 4UV4H 4X7FC 5EU6A 4CSSA 3UG4A 3U6XA 3VWKB 5EUOB 1NCWH 3IDJB 2VSCA 5EIIB 4J6RH 1KFGA 2BZ7A 3KJ4C 2F54D 2Y5QA 4ZUWB 4XMKH 1JNLH 1Z9OA 4BWTA 5J12B 4LARH 2GY5A 5IB5B 3BUYB 3BN3B 1BZDA 1RXLA 5E00B 1XB6A 3QO0A 1R24B 1BD2D 2YRBA 2Q10A 1D5XB 1S5HB 1S9VA 2XNAA 5DR5H 1BIIB 3OKDA 3UTTA 1A6PA 2WWKT 3BVXA 2W9DL 4K8RC 1KCRH 3LRSB 1ZXKA 4FLOA 3NK3A 2UX7A 3PHOA 4NRYB 5SX5K 5DJ6B 5AOMA 5I1LA 2EVFA 4M56A 4WNQA 4XWOC 5I66A 4ONHA 4FP8L 2Y1VA 4LCIL 5CJ8A 3PJSB 1P53A 4PGBB 4N3UA 3CVBA 1DANU 2PPAA 1UM6H 3BRFA 1J9TA 3GMRA 5AALA 1IE5A 2NQ3A 5KN5B 3V0VB 1MRDH 1YEDA 4JO4L 5HYJE 5IVNA 2WPGA 4BUQA 5F3FA 3VAEA 5L88H 4OUUA 1ZVNA 5B22A 4XNZC 4HK0A 3MQIA 4ZK8A 2WB1A 4GSXA 4E9QA 4CU7A 3TF4A 2XN9E 1MJUH 2NW2B 4NIKB 5HHVL 1MJ8L 2UZYA 1S7UB 2CGRH 2IO5A 5T8IA 2Q1EA 3DX8B 1TTGA 4FA7B 2JF1A 5GGTL 2XKNB 2BFVH 1ZVYA 1FGVH 1HI6A 3R7QA 1G7HB 3DTXA 5B38B 2B59A 2XWTB 4W9IC 2FWOA 2XG5B 3KWTA 4M43L 4LKXA 5AYQA 5CIPA 3AAZB 4UZSA 5CGYD 3DX3A 3OR7B 3LN5A 4ONFH 4XNUH 1BJ1J 5D5MF 5AKRA 2IDCA 5EN2B 1VACB 1CXIA 1FL5A 1KCSH 3NPSC 1H6TA 1KIUB 5DI8A 2I9TB 2YGNA 5CZXD 2ISDA 4AQEB 2F2HA 5F97E 2VSKB 1MJJB 4X7TB 3GI9L 3UJIL 4MMZB 4CSTA 3M17A 2ADJB 1RAMA 4NN7C 2FX8H 5IHWA 2WKOF 1PVHA 4HIJA 1ZS8A 4HJ0D 4MA1C 2UX6A 3ES6B 3TO2B 1KPVA 3EO0A 4AUJA 3ARGB 2ZSVA 3BZ4B 5DA4A 1KB9J 2WJ5A 5IB1A 5TDOA 2UZXB 1PCXA 4LBAA 3ZE0F 2UXGA 3NDYE 4LPYA 4QXVA 2DLIA 4N0CC 1LP9E 4O58H 2ZUQC 3QFJE 1PSKL 3TEXA 1BQHA 3G04B 3JV0A 4IRJD 4K4KA 5J56B 1D9KC 4LCCC 5EC2A 2PO6D 4RGNC 2VLKE 1E8XA 3D33A 4N26A 2WXRA 3T3PE 3UOAB 2DQ6A 3L3KB 4P23A 5IREA 1YDPA 5K9KB 1KG0B 3MLRH 4Y4FB 2P8MB 4U3HA 1Y18A 4MNQD 4UAOC 3V9CA 2X7LB 2WN2A 1I75A 5IGXL 5JLZA 2IWEA 1RZKL 3IDNA 5F9OL 3LOWA 3TBTB 4QTHB 4GP5B 3VCLB 4Q97A 3I6LE 5CJ5A 3I9IA 4IHOB 2BMKB 5FYLE 3LH8A 4OR1A 2H3XC 5ILTL 1SZNA 4YBQC 3BEWB 3IVKB 4GFXA 4FYTA 3TIDB 4X42A 5JW3H 4YBLB 3MV7E 4QXTB 2RD0A 5ISZD 3UO1L 2PR4L 2YQBA 3FTYA 1MAMH 3TS8A 1SOQA 1YN6A 4MWFA 3B2PA 2YGOA 2IALA 1M7IA 1KT2A 1XH2A 1UC6A 2H0PA 5CEZL 3ULVL 1M71A 5LVEA 5JHDE 3TO4D 1URZA 2WUBL 4N2OA 1VADA 1EO8H 4N2MA 1PTZA 2A6JA 5J6GB 3GEFA 1IGIL 4LLQB 1ACZA 1T7VA 2DQIH 4PTTB 2A73A 1MWAL 3UBXG 3WNJA 3THML 3HTLX 1XGRB 2DLTA 2P4AB 4ZS7H 2QZ5A 2R83A 1CR9H 5E5UB 1R5IB 5IUCA 3MLWL 1FFPB 1ZHBB 2E6PA 1RI8A 5GS0L 2WXHA 5AKSA 3E0GA 3U2JA 4YHYC 4HKBA 1UB5B 4NPJA 4ZNEE 2I9LA 3RFZA 4BQ9A 1KXVA 1SJMA 4L48A 5E6SB 5JPNB 4F7PB 2AK4D 1IAKA 4P2OB 4NXKA 5J89A 3QIBA 3ABMB 1GMEA 1CDUA 1FZKA 1S7SB 4B41A 4LSSL 1DVFB 1YPZE 1B4RA 3MOAH 2HFEB 2EEXA 3LKNB 1VZIA 3RWJA 3VNYA 4IU2B 3IPFA 3HR6A 5C0FB 1Q0XL 1PNCA 1GVIA 4JUTA 4O2CB 4YDIH 4DW2H 4UMGA 1KGCD 3AACA 2OTPA 4K3JH 1EFQA 3SQBA 5JIDA 2AJZB 3MRHB 4QAMB 4FQXC 4LF3B 1FVEA 3C5SA 5CEXA 3LEYL 2NY3D 3FQRB 1U4FA 3NN8A 2ZOKB 1AY1H 1MQKH 1LO5A 4JKPH 3NCYS 2WYHA 4XP9H 1URLA 4U0QB 1W72L 4Y16C 3VSVA 3ZE1F 5EG6C 5BS0B 1CE1H 1OEZW 2V5TA 3ZYIA 4YZWA 2IMMA 1MREL 3F7LA 3KYMA 3T2OA 4B7IA 4G8GB 1BQUA 3FT2B 4KFZC 4KI5E 5DJ0B 3R19A 3A4EA 4E5XA 5E2UL 1U9KA 4NLAA 2W91A 3GDBA 3B5GA 4KRPC 3TT3H 3ZOAA 4MB4A 5BJTB 2R56H 5DHYB 1J18A 4AKPA 4N0UB 2F8OA 1XO8A 3TN0D 3MLTA 4WNJA 1L0XA 4WI4A 3HG2A 3KYKL 3U48A 1J1XL 1QG3A 2XFXB 1RZJC 3ASOB 1U3HA 3IXAB 3Q9QA 2FECI 4ZMTA 4KWUA 3LKSA 1YNKL 3FH7A 4LGPB 4GW4B 3N5AA 4PV8B 4IS6B 4Y19D 5FYJD 3D2UB 5CNHA 2VDMH 3HA0A 4ATTA 2EE6A 1B3IA 3IBOA 5GGSY 3MCLL 3P9LA 2O5YL 4LVNB 5EULV 2XWDA 4WO4B 5AVZB 4WV1C 1S9KC 1TQVA 3APDA 2VDRH 3ARRA 1DJZA 3TH2T 1KMGA 4KJQC 5TF1L 4I3SL 1A7QH 3V4VB 5TJWK 4KZDL 3OL2A 2QGCA 4EI5C 3FQTB 1RIUH 1GGCL 1MFAH 4JRYA 2EVIA 5A2KH 3O4LD 4D9RE 1FIEA 3LQZB 4WEBH 5FO8A 4QI3A 4V1DB 2R0ZL 4YDJA 1Z5LA 2TRYA 3ZKXB 5HHOD 4Z23A 3E3QE 4NQQA 5E6ID 1N6QH 1NAML 4YXHL 3B9DA 1I8IA 1OAZL 2ZPKH 3FTXA 3PUCA 5KVFH 3GSRB 5D4IA 2XBZA 2QPUA 3I75B 1SHMA 3NACL 1T1YB 4XNMA 1JF6A 3BRGC 1JUFB 4JRYD 4OLXL 3AMLA 4ZUSB 4DGIL 2PWDA 1TF4A 2ZKWA 2JWYA 3D69B 3KXFA 2Z31A 4S0SD 3SDDD 3QNXA 1KN2H 3RDTA 2X1QA 1INEL 1OSZA 1RIHH 4Z7OF 2Z0UA 3MJ8A 2B20A 4HH8A 4LEXH 3V7MA 3ZZ1A 4BK5C 4P8QA 1O6TA 4FI8A 4LP4A 3OHMB 4PVBA 1FL3A 4LPCA 1AHWB 5I2IA 2DMCA 4HEME 2R69A 2OW7A 4MBOA 4FZ8L 3T3MB 1WITA 4O51A 4YSOA 2H3NA 2W92A 4P4RB 3IDMA 4JCLA 4FFYA 2VXSL 4PSPA 4GMSH 2D3NA 4HKXA 1SGKA 5HI3D 4F80A 1WRFA 4ZJ9A 4PJCE 2HMIC 2Z7YA 1ETZB 1ZT1A 3MODH 1QSEE 1ITBB 4OCRH 4ZFZB 4KNQA 3L4TA 5C8JA 5EEXA 4DEWA 4HJEA 1FFOA 2YUVA 4P2RE 5IHZB 3W57A 1SJEA 1NBVL 4HT1L 1TKWB 3E9UA 3TBCA 3QUMB 5C0EA 4JO2H 4NNXB 4JFDB 3VE0B 5LGHH 3TNMB 5DFVC 1E3ZA 2APWA 2FX9H 3BEVA 4AM0Q 4TS6A 2I32A 5ADPL 4MAUL 3WN5B 4XNXH 1E5AA 2YPKA 1IC5H 1OXYA 3QUKA 3TJHD 5J6HB 2GY7B 5JW4N 3MRGA 4KVPA 4HUWA 2Q7YB 2V2WB 2E6QA 2XIBA 4PB0H 5DVPA 1EEYA 5CN2A 3PQYA 1JNHB 4PIRF 1KLUB 4TNWF 4NHCH 1NINA 1NC2D 1KTCA 4PYGA 4R7DB 4AG4L 4J1UA 3L7EB 3EUDA 3ZR6A 4RIRB 2IGLA 3OAUH 2VO5A 2BC4A 2R2BA 3LQMA 4NZRH 3HS9A 3ZW3A 5JW4R 2DQUH 3ZDYF 2NY0D 3CGTA 3GJFA 5HD8D 1OK0A 1FH5L 5GZOA 3T1WA 3K6DA 4NQUA 2WWMC 3PRZA 1U58B 2WLLB 4HXBL 3VYNA 2EDKA 3FO9B 1R3KA 4GQ9L 3E1ZA 5J1AA 4MGXA 3U0TA 4DFIA 1YC7A 2Z4TA 3Q2WA 1U8KA 4F33B 4F58L 3V5HA 3C12A 1JRHL 2NOYA 3LRKA 4GO6B 4MMXB 1H5BA 5INCB 5I1AB 1NGXA 3U4AA 1VAHA 3N85L 4MJ6A 1YQ2A 2VT0A 4YGVB 3MA7A 2FR4B 1QASA 1FGNH 3KHOA 3LPFA 1FYTB 3CCHB 4HUVA 4L5FE 5A2LH 1T1WA 2HJKB 5AKVA 2PLTA 2FT7A 3GMQA 1N3NB 3H0TB 4L2YA 5E1AB 3VXMB 2BIIA 4FCHA 1X9RA 1FAIH 2ALWA 2DI7A 4XE0A 3P0YL 4R97C 2YRLA 1CLYL 3LRLA 4I0PA 2J6EH 5EOQL 3DV4B 2RBLA 1TZHB 4XCNB 5ETUA 1SM3H 2AXJA 4MJIA 4HETA 4M7ZC 4TUJB 3L3GA 1CN4A 3JVFC 1IAOB 2VZTA 3CSFA 3GS7A 5HGDA 1AI1L 3LKPA 4ZXBD 5IKCB 4XHJC 4BFIA 3NGBB 1P4BH 3RNQA 3FO2B 1QSZA 1Q9WB 3HNTL 1CLCA 1VFUA 3VU2A 2A6DA 5FR3A 3RJOA 2F7QA 2RACA 2XV0A 4MD5A 3MNVB 3L1FA 5CD5D 1GYWA 3STZA 2XPGA 4ZTOH 1JXJA 2VJ8A 2ATKA 4JG1L 4WWPA 5AQ0A 4DGIH 4IBWA 1A6ZB 5I30H 3OMIB 2H45A 3HJEA 4GQRA 1FNEA 3C5ZD 5G55A 1JK9A 5EOCH 2OSLB 3HOGA 1UGKA 4QHUB 4AE1A 5GRZA 3MNDA 5KJRH 1G6RA 3H9SE 4L29A 2QFRA 4MZ2A 3V4PB 3MAWA 2PW2B 2K4AA 4X0KA 4G6KL 3UTSB 4TSCH 3G5VB 4MQSB 3VFWA 3WEXA 2A4CA 4Z7VF 3FQWB 1WE5A 3DX7B 2RCSL 4H8UA 4X98B 4GEJA 5ADOL 1RK0A 1E3FA 1E9OB 1F6LL 5ACZB 3HCVB 2KHAA 1NIFA 3IFPB 3PWPA 3PWVA 3PS6A 3QI9C 5EBGA 5A7EA 5BMFH 3WHXA 1KTDB 4LZKA 3CVIH 1O7DC 2ARWA 2XIIA 4RRPM 3MX0A 3PCYA 1JK8A 4JKKA 4KQ4L 4Y4KA 1VCAA 3O6LH 2VDNH 1TZGH 1U36A 2K7PA 4XBGA 5TDPA 1CGXA 3QUHA 1F1DA 1LD9B 4M7LT 4Q9QH 3HZMB 1KUMA 2FB4L 4CJ1A 2FEEL 2P52A 2JQAA 1QKZL 4K73A 5LWYL 3TYGL 3FONA 1BDYA 2VAAA 3UZQA 3ZRCC 5JW4Q 4YL9A 3VW3H 1YZZA 3CHXA 4L1BA 4JN2B 2GFBB 2CE6A 4OZGE 1F2QA 1BAFL 1SJHB 3ECQA 1R3HB 4IBUA 1G7JA 4ZMQA 2IQ9H 2O6CA 2OMYA 1KYUA 3FOLB 4JFZH 2CRMA 5D7IB 5GS0C 3F7KA 1HOCB 3WELA 1XBDA 5AVVB 4GT7A 3QQNA 4J4PD 2IPUK 5HVGB 3WD5H 5IB3A 4JRWA 1FG2B 2R29L 5D1ZB 3RVXC 2VDOH 4BSWA 1BVKB 1LO2L 4NNYB 3L5WA 1GOGA 1KN4H 3FAWA 4UDUA 4EO5A 1SDAB 4JHAL 4PJIE 4OV5B 1UT2A 1B4JH 1AG0A 5IVXF 1RULH 1DVTA 1QAWA 3SE9H 1U8NB 4UDTA 4PRHA 2H7WA 5HGAB 1NC4B 5K33A 2WZPD 5AFAA 1T21B 1VEOA 4XPGL 3MFFB 1HCZA 2BXYA 2YSTA 4ILDA 5FGCB 2DICA 4IMLB 2WXPA 2HVJA 1CQKA 3CWGA 4IKLA 4I0PC 4PUBL 5E2TL 1HH6B 1JV2B 5I8KL 4PJGB 4YUEL 4XNAA 5GJSL 1KNOB 5E5LA 1IKOP 3B2XA 3G9AB 2EDXA 2P5EB 5AVWB 4ALAL 1SOSA 4HWBH 1E28B 1EFXD 3SGDH 4XWGL 3WKMH 3T1FB 1VSCA 2HTLD 5LCVL 3ZZLA 2D3VA 4ODWB 4L8SC 5IMKA 1IAII 3ZKMC 5I1KH 2CO3A 2CHWA 2WWOA 3CFBB 2DQEL 2PETA 1H9DA 2FNBA 5E8EA 4AE0A 3II3A 2ICWI 1DBML 2ZP0T 4RDQF 2EIZA 2ZX7A 4GKNA 3FCUB 4JFOB 1SXBA 1FFTB 1X7QA 4AV5A 4E42A 2CGYA 2MQ3A 4GXUM 3IMWA 2F53D 4BXVA 6PAZA 4UT6H 4G9DA 4YK4B 4KV5F 2FEDC 3C6LA 2Q3XA 2V17H 3PNWA 5CHNB 4UQIM 1E67A 4G80B 3OKEA 4L8BB 3VXRB 4Z7WE 3WE1A 1DQVA 4QRRB 3VGAB 3RUGB 3S5ZA 4LSUH 2OMZA 1MH5B 3VFTA 4XZ4A 1FLRL 1NGWB 4OQTH 3ELQA 4MXWH 1XGYL 3CSBA 4JHBA 3T4YB 3T2QA 1N5YL 1ZK9A 4MKTA 1FNGA 2I5YL 3OQ3B 2AXFA 3HRZA 2OJEA 1CDCA 4C56E 2XZZA 1BMGA 4JM2B 2KDGA 3UO8B 1UJ3A 5CWSA 1E27B 4QOKB 3K2IA 3S3DB 4TSBH 3ZRFC 1SXSA 4MB1A 2YXFA 4H5SA 3MBXH 1S7QA 3PGFL 1UD4A 1MHPH 1F3RB 5GRVK 1HDMB 3VTAA 3IFOB 3GSQA 3QPXL 2QQQA 1UD6A 2CNYA 4Z78B 3NIFF 5E5MB 1OPGH 4EXKA 2W81C 4U6VL 3OAZH 4NQCE 4HMDA 5ID0B 2BSTA 4RFNB 4KGJA 3NFPB 1WBYB 2PCPB 3P2DA 1MOEA 3Q6FA 1SY6L 1DLFL 1JHTA 3ESVF 4XXDB 3RGVB 1AGFA 1KJ3L 3LN4B 3LXBA 4H2AA 4WU7A 1FH2A 1LTXA 1VB9A 4HFWA 4XTRD 2BCMA 2KZBA 1DQIA 3HHSB 1Z7JA 4KY1H 5FO7B 1W91A 5GS1A 1CT8A 3IDGB 4ZSOE 2PR9A 1SVCP 3AW5A 1BAWA 5DRWB 3HUJF 4LLWB 3BP4A 2EXSA 4ABQA 4XP6H 5DC9B 3DHUA 4YSAA 4C4BA 3IGAB 1ILSA 2EEAA 1EVTC 2V8MA 1WISA 1CZ8L 3FU9A 3WS6C 3B1TA 4MA7H 5CEYA 3KJ6H 5DS1A 3DVGB 3LX9A 1UT1A 3IU3A 2E7HA 1USZA 2XPYA 1PZ5B 2Y2TA 4OZHE 3U0WL 2OZNA 2DOCA 1QO3B 3VA6A 4HLZG 2CHNA 1IGJA 2X4TA 4L23A 2ICEA 2LU7A 4KXZH 4PAZA 4QD2E 1DEEA 1CI3M 5FGBA 3LS4L 1EJOH 1ZIAA 2D8KA 3VXUD 4G8EB 1MI5D 2G75B 4GRWB 5ES4B 4A6YB 4JK0D 4DP4X 3FTSA 1IBYA 1FL6A 2CR0A 1S8DA 3I3BA 2A9MH 3EYQC 4RGOL 4KK9D 1DUZA 1ZPLA 4PRIA 2X4NB 4PRDA 3RWGA 4M7JL 1B88A 1FVCA 2VDQL 5DCCA 3VI4B 4OCSL 1MCHA 4AL8C 3BAEL 4PS4H 5FW6A 2ZWSA 3BH9A 2CO4A 1M7DA 3GXPA 1Q9KB 3UC0L 3FFDB 1N4XH 4JDEA 4PGDB 1RUMH 1L0YA 3QDJA 2WQ8A 3MRPA 3UPAA 1A1MB 2HUHA 5D1QD 2OMBA 2DWEA 3IRCA 4Z7NB 5IQLA 4YHML 5IFAL 2FQGA 2GG1A 3MVSA 4JDVB 4Z9KB 4ZFGH 5EU6E 1W16A 5KANI 3EHBD 2A0LC 1SN0A 2J8UE 3LD8B 3OPUA 2YUXA 3L3DB 3LH2L 3LRGA 3PL6C 5D7SL 1VCBC 4FKKA 4CVUA 3N1GC 2UY7B 2DH3A 4O9HL 3DLQR 2VOTA 1ZSDB 4G82A 1LNUB 5BQ7B 2DKUA 3FL7A 1I9JH 2UVEA 5D7JC 1WGOA 3VWJA 1MNNA 4KTEL 2IVFC 1OGAA 5T5FH 1JGUL 1JPTL 2BNUB 3C6LC 1UZ6E 4FJ6A 3UG3A 4WTWA 3SKJH 4FXTA 1TXKA 4R90H 3BXNB 3VSUA 3W9DA 5IFJB 3OLIA 2D4DA 4QTIL 4AIZA 3ULAB 3F2LA 3NTCH 3WL9A 4KDVA 2DI9A 1FCCA 4KKLC 3UTTE 2JLPA 3MR9A 4LIQE 2Y5TB 3D6GA 3I6GB 4OZFH 5HDBE 4C8XA 4F91B 2HPTA 4R26L 1DQDH 1EXUB 3FTGA 3QZLA 3L9YA 2DF3A 3RX7A 2GJZB 5EO0B 4NO0B 2WTRA 2XN2A 5MEOB 2JK5B 2RJMA 4PVMA 4I13B 5EU3B 4EIZC 1KIPA 3DHJA 3S35X 3VXPB 5KUMA 2E9JA 2L7QA 3AT0A 3X2QB 1HWWA 5DO8A 1L5GB 1RZQA 1TEFA 1O5PA 4G9FE 4X7SH 1R17A 2XTJC 2ZXCA 3T65A 4PJEF 3QBTB 3H1ZA 1NMAH 4P04A 2I69A 4RH4A 5BV7L 1JDCA 1UD5A 2Z91A 1JWSB 3SDXA 4GUQA 4M62H 5DD6A 3ULUC 5GS1C 3OKOB 4V33A 1X5AA 1SVBA 3S4SA 1Y6NR 2C1OA 2ZWNA 2OR8A 4P07A 5FM5M 4AH2B 2E7MA 3DBXB 3GBMH 3QNFA 4W9HC 3UBGA 5T33L 3SPJA 1JNNL 2ICWA 4P46B 3V9EA 1KIQB 4IIZA 4RMUA 3U36A 5IROC 5CP3H 1ADWA 3L6FB 3QQ3A 1J11A 4DP1X 5DD3H 3NSDA 2Q3ZA 3KH4A 4OV6F 5FS5A 4OZIA 4WENB 2AITA 1U92B 2J72A 2ZG3A 3SGDI 1C1EH 4Z0XB 1YMHB 5DMGC 2O4EA 2QV2A 3HZYB 4YFEA 3NSFA 4I88A 4FYRA 3F6IA 3BGAA 3VO0A 4M48L 4DQOL 5CUSH 1JGLL 2NT1A 3VB9A 4MLIA 1G9NL 5ERWB 1A7NH 3REWB 4BZ2H 4PJ5D 4EUPB 5C6TH 4LLUA 3ULSB 3QDMB 3CX5J 3MUGA 3SBWA 3E7JA 4EDXA 5ICYB 1X4XA 4OI9A 4TQIA 3N06B 2C9SA 2F5BL 5CCHE 3A67L 3HAEG 1IBBA 4R2GC 5FUZH 1J8HB 2W9EH 3ZYJA 5H2BB 1OTTD 4GYBA 1JGEB 1IKNA 4HGWB 4OFPA 5L0QC 1JZ3A 1P6FA 1OAYH 4X0NA 4CBPA 2IQAB 1JHKH 4DNLA 1YQVL 2H32B 1BF5A 5J11B 3KCPB 5C09D 4M3JA 1DQLH 3L7FA 2A77L 4FX5A 2P80A 6FABL 5HP5A 5GGVL 3AWEA 3RWEB 1M05B 1YJDL 5C0BA 2J6EA 5B3NA 1AP2B 4ZTPH 4EE2A 1WGVA 4X8CA 3NZUA 4X80L 4MNHB 4KH9A 4WGVB 4HVBA 2ADFL 5HYFA 1BQLH 4X8JB 3KDMB 3VGBA 3DROB 3U0PA 4NO2A 3PPEA 3VSQA 2Q8BL 2GHZA 3ILEA 1P1ZB 3KS0H 4GKSB 3MNWA 2DIBA 3E1F1 2XWJA 5DJDA 2VERN 4FNSA 2WXQA 4V2BA 2YPVA 4RRPG 4M6NH 1H0DB 1RZFL 4IK6A 1EA9C 1E6OH 4MSWA 4AOFA 4HD5A 4BFOA 3F58L 4MNGB 4P48A 4N0FA 5AWNL 1MFNA 3VFSB 5DD0H 3JTTA 3FTWA 4XO8A 1L9QA 2FSDA 4AWJC 5EFIB 2W0KA 4KHTH 3JT0A 2WBJD 3WTSA 2WIIA 1K5NB 4YDKL 1UWXK 3V4UL 2AXGA 2EE9A 4YHZL 3CFQA 4XHQA 4HMCA 4RWYL 5LGYA 3ARDA 2WM0A 4LSRL 4W6YB 3P4LA 4B9KC 4ELMA 4JX0A 1AFVL 5KZCD 3QQDB 1UACH 5KVEH 3VFGL 3K6FA 5DJ8B 2XYCA 4C47A 2XN9B 3AQZA 3GNML 3J7HA 2EDYA 3Q2NA 3ZTDC 5HY9B 1OCOB 4H1LG 3H56A 3OMNB 2HXAA 4TQEL 2WV3A 3AABA 2GTWB 3FZUD 1HJBC 1WFOA 1DUYB 2BIHA 4NGHL 5LGJA 5GGVY 2YK1L 1NKOA 2FNWA 3ARDD 1EHLL 4IQHA 4XVJH 4N8VA 3IMVA 3I84A 2AEPL 5E7BA 4YSDA 3QUGA 4PMEA 3KYOA 1JPSL 3QSKB 2PYFA 1CXEA 4JJ5A 1ZLUK 2GC7C 1SBSL 2V4LA 4BH8A 1K2DB 4MAYC 3QUXC 4UWQB 3DOSA 2ZXQA 4HKZB 3UYRH 5BQDA 3OJVC 2O5ZL 4HJIA 1TO5A 1FO0L 2CLRB 1P5UC 3W3BA 4DVBB 3ATAA 3M1OA 4FNRA 3QA3A 2QKIC 1OZTG 1QPXA 3IKCB 3CSYB 1BEYL 4GBXC 4D9QD 5DVKA 2EO9A 4IRSD 3BQUD 5EO9A 4F8NA 5JIHA 1N8ZB 2IFFL 3X13A 3EYSL 1L0QA 3F7PC 1KLFB 4XAWH 4BBWA 5INDA 2G0LA 1CFQA 3BH8A 1Z9SA 4YZFF 4PGCB 2EYRB 5TQ2L 4A38A 4AIXA 1DCEA 4LIQL 1LWHA 1A6UL 3NEEA 2DYPD 5TPWL 3T8XA 1LP9B 4M5SA 5EEWA 1A5FH 4JPSA 2QLYA 1AHKA 1HEHC 1Q9OB 2Z7ZA 3L1GA 4JO1H 1R3LB 2G5BB 4K2UL 4M6MH 5CP7A 1XZWA 3HR5B 4WUUD 1K8IA 4B7LA 2VLKB 1GHFH 2OMNA 3RWIA 1C8PA 1BM7A 3DIFA 3DJTA 1YEKH 1E42A 3N1PC 3EXLA 3HZVA 1TQUA 5DLLA 4Z7QB 1BGXL 1D6VH 4XXCC 4HYTB 3JWDL 4FRWA 4JR9L 4HWBA 1IGFH 4YH6A 4CSPA 4HS3B 2YAQA 3GMMA 1W8OA 2QQKH 2JQMA 1A4CA 5FM4A 3DSFH 1NGQL 4ZODA 2IH1A 3AS3A 3BN9C 5D2NA 1HXKA 1OIOA 3N42F 1KYAA 2CMRL 3P30L 2NY6B 4KX9A 3GLEA 2ROXA 3VFUB 2F8XC 3MV8A 4OU3A 5ABAA 4U1JA 5E8DH 2YEQA 1JPGB 3SBPA 3T5WA 2TAAA 1CTMA 2WXOA 5EF0A 1HZHH 4UT6A 1UWGH 4BZ1A 4XPFH 3A6OA 4JJHA 3K81A 4NT6A 4WHTB 2OCJA 3LNEA 4ODXB 5DDHA 3ZDWA 5BOJA 1ZJBA 4JM4H 5JPMC 5CJQL 2ATPB 1QA9B 2Y07H 2HTKD 5I82A 4QRQB 4I18B 4OGYL 4OQTA 4UT7H 2OV0A 2OX5A 2XT1B 1MRFH 2YSSB 5LGKA 3D50A 1ZAGA 3FQUB 4K94L 4Y88A 3CFNA 5BRZA 4XN2A 1HNGA 1KWGA 3KXFE 3ZTNL 3MKGA 3O3EA 3F64A 5JYLA 1SNRA 4FQCL 1AD0A 1NDGA 4QRPA 1SMOA 6CGTA 3L81A 3LMJL 2ITEA 4WY7L 4RZCA 1IGYB 1THAA 1U95B 2EXTA 4PVNA 5C3IA 5BZXA 1A25A 4GG6E 1BFOB 3PV7A 5KSUA 3IAGC 1H8NA 2QPEB 5FX3A 4Y1AD 2VQTA 1YPZB 1RZGB 5HVHB 2GUOA 4PJAA 3NCMA 5FYKU 3ETSA 3VFOB 5IJDC 5K5YA 1N67A 4QCIB 4MYPA 5B39G 5JHLH 4GAGH 5LAPA 3AQXA 1SLUA 1SQ2N 5IF0B 5FHBH 1B6DA 1E43A 4G42B 43C9A 3ETBJ 3DJZA 5C97A 1NANI 3BC9A 2F7OA 3FQ4A 1J5HA 1HC1A 1P2CB 4KNTA 2YD7A 3FN3A 3OZ9L 1GJWA 3HPJB 5TDNB 5KYXA 4PGZA 2KUTA 3E8UH 3BJLA 5ALBL 3FU6A 1SF5A 4JPIA 1J8HD 2E46A 4R9HA 1DO6A 5F21B 3VU1A 1P7BA 1CTOA 3KR3L 1T3FA 1T5XB 2E9IA 2LTQB 3CXDL 4JO5A 2C4XA 3EDDA 3WUWG 3TVMC 1SRDA 1XGUB 4RFEA 1RPKA 4AXWB 1J5IA 2Q0ZX 4Y4HB 2E5EA 2XTLA 5BW7A 1I3UA 3AU1A 3LH9A 1AAJA 5I73B 1O7DE 3O41B 3SKNA 3DDFA 1R5VB 1AE6H 1T1XA 2Y2YA 3EOTL 3PQYE 4CNIB 4HZAA 2F9BT 3OF6D 5D9SA 4RX4D 1J9QA 2OLDA 1COBA 3FUKA 3KEHA 4L3EA 5F7EL 5IBUG 3WFCL 3QXAA 4CC4C 4XMPL 4PV9B 2Y25A 4H8PA 4ENEC 4TM9A 1CTNA 3DRTB 1IM3D 2DQHH 4XOAA 3CFUA 3QUZB 1QX1A 1UWEL 2GJ6A 3VRJA 5ICZB 5ITFA 1JCKA 3VD1A 3FAXA 4MTMA 2V9UA 4P4KD 3VXSA 3MTXA 2IOOA 5ICXB 2Y6SD 1SOXA 4TVPH 3RWFA 1QSFA 4NO5A 1XDTT 5B7MA 3SDAA 4OCMC 4ZNCD 2K3HA 1MXGA 2FIKA 1YEFL 2Y1YA 2K4WA 2JFCA 3LNIA 4BELD 3MRIA 5F9DC 2OZ4H 4NSKA 1L9SA 1BZ8A 3L3OC 4DGUA 4JFYB 4A7QA 4B9FA 1WZ1L 1FCGA 2ILLA 4PJBF 4ZYKB 3IJHB 1AZRA 2DEWX 4X6CF 4ONOA 1IZJA 3QWQB 2CJSA 1IEBA 4F8LA 5K69A 4Y2OA 5FECB 1GW6A 3DRQB 5LNEA 4UYQA 4ZX6A 5J9PB 5T1DH 3P4MB 1U2HA 1JAEA 4OZFA 1L9TA 4JZOA 1RFDL 1EGJH 4O02B 5DWPA 1LO0L 1WCQA 2WYTA 1KYOK 3F7YA 1CU4H 1UEYA 2GSIA 3OKKB 3NABH 4UOJA 5AOLA 1ETA1 4MJIE 4QF1B 5EF1A 2P8PA 3AT9A 3CD4A 2JKTM 1T20A 1ZANH 2DB8A 3KDPB 3VFMA 1IGCH 3ROOB 4F5CE 2NNFA 3DV6A 3N91A 4PP1D 2LVEA 3RYMA 3KPPB 3FQXA 4APQD 3P40A 1CBJA 1RLWA 3F05A 1ORSB 2A6KB 3IXTB 2QMJA 2HVBA 4O5LH 1NBYA 4Z7VA 1NZRA 2MRYA 2AW2A 3UYPB 1DBJL 1OOWA 4HBCL 2DQJL 1F58L 2VL4A 4E9LA 2A6IB 4I48A 3BPCA 3QIWD 5F7YC 4DZ8A 3FN9A 4N0RA 3SDYL 3MLVL 2D03H 2VYRE 3FDWA 5I74C 1JF1B 1XF2A 2ARJA 1F6AB 2YQGA 3IDYB 3QJRB 1XIWB 2A74B 3PP3H 5IVOA 3DURA 3L4UA 3RZCA 4CN6A 3ESNA 3CSTA 5E23A 3CDZB 3Q5OA 4X2UA 1W8NA 2XWBB 3K72B 4TNGA 3JWOC 5CP3A 3OVUB 2AZUA 5F9WC 5FF6B 2JI1A 1T0PB 3H85A 4JG9A 2PF6A 2VR6A 3PXHA 1UM4L 1Q90A 4NN6C 5FFOA 5T3ZH 4PJHA 3VTTA 4D94A 3DXAD 3K74B 3RU8H 3HKFA 1G9ML 3MCKA 4KNUA 3O9WA 4P2RB 1F8TL 1RJZA 3CZKA 3EO9H 3KPRB 3HG0A 3ZGIA 5AD0B 3T09A 3PWPE 3O6FB 4LLVA 2H1LM 3DBSA 1M9WA 5TGBA 1UZ8A 1A0QH 1MHHB 5GGRY 4X6BB 3RIAF 5KSBA 3RZCD 2ETWA 2WLJA 2B1AH 4BZ2A 4AJYV 3BQVA 3FUEA 2NX5D 3OWEA 4QJ3B 3K1DA 3SCMB 2YGVA 1OP9A 4AMXA 1I8AA 3D39B 1DSFL 3BGFC 3DX6B 3RI5F 4EN3A 1SLVA 3GTTA 5A2FA 3QEQB 1YNTA 3ME0A 3KPOA 3P54A 5IW3A 1ZLVH 3CFKB 2JV6A 4ZTEA 2FATL 4YE4H 4YQXL 4DGVL 1WTLA 2X38A 2Z4QA 4LP8A 3SPHA 1AR1B 2FHBA 1Q1JH 3FJTA 1QRNE 3KPTA 4PB9L 4QJ4B 1SF3A 5I15L 2NY6D 4ANKA 2MPAL 5ID1A 3Q1SL 1QFWH 5KYYB 3FT1A 2LLLA 3DYPA 1T2QH 5DD5H 1ACYH 5C9JB 5GZNA 4KJPD 4FADA 3LV3B 4IIQA 4AW7A 1BFVH 2JB6A 4AK2A 2HAZA 4M5TA 2DM4A 2BY1A 3HE6D 3L5XL 4H8WH 1TJXA 2VDLL 3E2HC 1NEUA 3LEVL 2R69L 4WGKA 4F1ZA 5CMAA 1M4KA 1H3PH 1X6LA 3GMLB 4L4TB 4PRHE 5C08A 5D7LA 3EDEA 1IVTA 3PGDA 4AZUA 3W5NA 4GRMB 4FFYL 5GHWH 1W80A 2H8PB 4JPVL 3DX2A 1MCKA 4ORGA 2DJUA 3N9GL 7FABL 4FG6D 5T5NF 3B2DC 3RNKB 3ZGHA 3W0WB 5IFHH 1TIUA 3P9MA 3APMA 4MRCA 5H94B 1J0ZA 2VC2H 4AYBA 1VESA 3AB0C 1E5UI 2BP8A 2PCFA 2EKJA 3DSNB 3P02A 1OV8A 1FNSH 4GQZA 3GBNL 1OGPA 1T66D 2J44A 5C0CB 3V0WH 4OCXL 3RJQB 5AKTA 1RZ7L 4OB5L 5KS9F 2X40A 3J07A 1CICD 3DYOA 3X3FH 4Z7IA 1FZJB 4HKJA 4P5TD 2R1XB 5EN3A 1CLVA 1ZE3H 3G5ZB 3AVEA 1JI2A 4U4IA 5B1AB 2HLEB 3RURA 1J0IA 2MJWA 4FQIL 4RAUB 1JV5A 3TIEB 3LRMA 1P84J 1Z9PA 2KS0A 3EYVA 3NQKA 4YLCA 3CMGA 5T1LA 5EU5A 4LSVH 2Y2WA 4KK5D 2P3YA 3E80A 5KSAA 1AYRA 2DPKA 4LOEA 1MFEL 3BWZA 4N3TA 5A16B 1RH8A 3U2SA 3H9SB 1C9SA 4P9HL 3CVCA 1PAMA 4JFPA 5HHME 3C60D 5HYQA 3QUMH 4XCEA 2DDQL 4JZNA 4MHHI 5E99H 2BSSA 1HXMA 1S9WA 5IB4A 2D0GA 1DN0A 4UZUA 4B95C 1QBBA 2HT2D 3QHFH 4KFMA 4TULL 1C5CL 1F90L 1GY1A 3FFCE 2AVGA 1FRGH 1JERA 5CGYC 5D4QA 5CFHA 7PCYA 2GKIA 2WYZA 5MP6L 4J6RL 5G4OA 5F0LB 2H26A 3T4AB 2YJLA 4YHIA 3B9KA 3VUAA 1QWNA 5B1JA 5A2AA 5IEKB 4XMKL 2WO4A 1JNLL 1F13A 5CZXC 2WVVA 3T2NH 3UAJA 4LARL 4AV4A 3DX1A 1TENA 4XNBA 3CE1A 4WI5A 4NKMB 1OP5K 1NCDH 2XTJE 1HE7A 1I4FA 3C5JB 1E8YA 4HJ0C 4I8DA 1ZCRA 1PQZB 1D5ZA 2W07B 1BZ7B 1JVLA 1J1OH 5HSFA 4W9EC 4F8OA 1KCRL 3ULUE 2P8LB 1TYRA 5E4OA 4JDZB 2VR9A 2CO6B 3QULA 4JLRB 4OZGB 4AKQA 4C83B 2OMXB 4AEEA 4PLKD 3EYUL 3OHXA 3BKML 5GGUB 1RSFA 2CM6A 1F56A 4U1NA 2ITCA 3VM5A 5A7BA 3QDGD 1OARH 2PO6C 3VWKA 5EUOA 2HSIA 4IIQC 1HTYA 3IDJA 1UM6L 5EIIA 1RV6X 2FECL 4WDIB 2PCXA 3S37L 2FUQA 3PABB 3AZUA 4ZUWA 3K8MA 2WHVA 3F7RA 4XC3H 5FA4B 2RTTA 4LOFA 3BUYA 5IB5A 4HCIA 4I2XB 3OPZH 2WNKA 3QS3A 1EAQA 2ZAIA 5E00A 4K15A 5DS8B 1MJUL 1R24A 4N9GB 2WBXA 1D5XA 1S5HA 4KKCD 4X6DF 1TSRA 1BIIA 1BPVA 3I2CH 1K3ZA 4LRIA 2CGRL 2QKSA 2UUDH 3LRSA 4PRIE 2ZUTA 4MCNA 4NRYA 1TVBB 2E59A 5DJ6A 5J6SA 2OP4L 2BFVL 2VWEC 4OT1L 1FGVL 1G6RL 1FVDA 1A6TB 1JCVA 3EIFA 1T89A 4HEPA 5DC2A 5EORH 1TOXA 2FLMA 4L9LB 4OLYL 3DI3B 5CLXA 1ED3B 3PJSA 4PGBA 4JQIH 3GIVB 3TO4C 2B4CC 3MPCA 1VDGA 5D8JL 2ATAA 5KN5A 4ONFL 4XNUL 1S7VB 4HA1A 4AUYA 2AVFA 4DAGH 5F7HA 3BVWA 1KCSL 3IETB 1IFHL 3TEUA 2L7JA 4N5ED 2YZ1A 4LVHB 2NW2A 2WXNA 2NY4D 2X4RB 5I1CH 3ML9A 3MRNB 3GF8A 3EJSA 2FX8L 3S36X 3O2VH 4RMTA 1HHKB 1OGAE 1S7UA 4JVPA 1EDHA 4F7CB 1UOWA 3KJ4B 4JEGB 4PJDF 5KSAC 2G2RB 1BZOA 1P69B 2IPKB 5FM5O 2XKNA 1NPJA 5SWZB 2O6DA 3ESUF 2EKSB 3KWUA 1G7HA 5B38A 4I3RH 4NOFA 3V4PH 2QSCH 3O8XB 2XWTA 5H37G 2YRZA 4AK1A 2Y7LA 4O58L 1IM9B 1OB0A 2W95A 2EDRA 1N7MH 2XG5A 4W9KC 2HKAA 5E6YA 4Z7WB 5JHLA 4GXUN 3AAZA 3ELAT 5L2KD 4Z95H 3OR7A 4R5TA 3Q6GH 4GLRH 5AAWA 2QHRH 1WAAA 3ZO0A 4WK4B 2XA8H 4WEUD 5EN2A 1VACA 4ZDHB 1KIUA 2I9TA 4HWEH 3MLRL 1G43A 4OCYH 3N1FC 4QRSB 2ESVD 2YN3A 4AQEA 3BE1H 4YR6B 3WJLC 1MJJA 4X7TA 5B1JC 2X2IA 3RILA 2VAJA 4MMZA 4GT0A 2XXCB 3OB0K 2ADJA 2NY3C 1KXQA 2AQPA 5C6WH 2XTSA 1P4LB 3ES6A 3TO2A 1FWXA 5SV4A 3FT4B 1WBZB 2LU4A 3ARGA 3BZ4A 4A2FA 5E9DD 3ULVF 5AZUA 5JW3L 2UZXA 3NJKA 4Z18A 4FA6A 1PX8A 5AYTA 4LU5L 4P49A 1MN4A 1HU8A 3G04A 5DUPL 2B9AA 2GBAA 2L3BA 3DGGB 4ZSOB 4ZQTA 1MRCH 2ZOOA 2D7PA 1CDGA 4WSKA 1RUQL 3L3KA 3TN0C 4OZIE 5K9KA 4JQXA 1KG0A 4Y4FA 2DQIL 4BD4A 3FN0H 2KYIA 2P8MA 3SJVB 4E9RA 4ZS7L 2HJLA 2X7LA 3MJ7B 4NEHB 3VCLA 2WOBA 5J12C 3TBTA 4QTHA 1B3JA 4OZHB 5GIRB 4IHOA 2BMKA 4GO8A 1BBJB 1EUUA 1S78D 3Q2VA 3PXJA 3BEWA 4W6WB 3QJFB 3IVKA 1MCFA 3HC3H 4F2FA 3EJZD 3L3HB 1GR7A 2QSTA 4JCWA 3QWRD 1XMWA 3NPSB 3TIDA 3GRBA 4JY5H 4QXTA 4DESA 1F97A 2HYMA 2QMKA 3UPCA 4GKLA 1CWVA 2FGWH 3EFOB 2IV8A 4M9PA 4NYLB 1ZTMA 4DHLA 1YNLH 1A9EB 2FLRT 4K3DH 3B8YA 4AJ0A 4NN7B 5CSBA 1CDIA 4MA1B 4K5OA 3MOAL 4KUCF 4RAHA 1T89C 4TL4A 4JFEE 2WSPA 3W56A 5C0CD 3JV6B 2J43A 5F3BB 5J6GA 1EMTL 3NA9H 4LLQA 4DW2L 1E4HA 4PTTA 5L4MA 4YDIL 5FFLA 1JG9A 5D1XA 5E6IC 1BYNA 4K3JL 1XGRA 3O0RH 3WDJA 3MBED 2HLAB 1R5IA 2AJYL 1FFPA 1ZHBA 5E24E 3O6KH 5IQOA 2WCGA 3ALXA 4G7YH 4RGNB 5IBLD 4A7VA 1PKOA 4N20A 3M7OA 4YJZL 5HYSG 3SY0B 1AY1L 1MQKL 3BISA 2J8UB 2ZNWA 2EILB 1M9SA 2XN0A 4JKPL 3BZEB 5F6IB 5TE7H 1CE1L 5JPNA 4Y2DD 2IBZX 4F7PA 2KPNA 4P2OA 1TTCA 2GEEA 3SDDC 3INUH 2M8XA 5D1XD 1OP4A 3OWRA 2ENSA 1KJMB 1NCAH 1S7SA 2E0PA 1DVFA 3QWOB 3D5OF 2HFEA 4R7NB 4TN9A 3WIIH 3LKNA 2DQMA 1MCWM 3QJQB 5IHUL 2AJXH 4IU2A 4GUCA 5C0FA 4O2CA 5KVDE 3IJ8A 4B97A 5KBLA 2UWEB 4HCFA 2OQJB 2AJZA 3MRHA 4XNYH 4QJ5B 2N1KA 4LF3A 1UENA 1CXLA 3CLEH 1GSKA 3D48R 1JDAA 3FQRA 1Y1UA 3O6MH 2M83A 5HI3C 4MMZC 4EOWL 4HUNB 3LNDA 1BEXA 5BS0A 4RCAA 4ZMPA 1U8MA 1JFHA 3RPIB 1NMCB 2Z8VC 5EH1A 2VDRL 3FU0A 4G9FB 1F4HA 3FT2A 1PZUB 4L0YA 3L54A 5DJ0A 2VLLB 3CXHJ 5G5DB 3CZEA 2WZ5A 1ASOA 2J5LC 4YHYB 1A7QL 2OSYA 1RIUL 4UB0H 4X8XA 1MFAL 3ZJAA 1JWUB 5BJTA 1J9RA 3WNLA 5DHYA 1PW3A 4Z5RA 4L4VD 4QHLB 4NERA 1XF5B 4N0UA 5E03A 1HL8A 1N19A 1GA2A 4HZ1A 3VXTB 3UEQA 4P2QE 25C8H 3MU3A 1G0XA 2LFGA 4Y4FC 2ZPKL 1UFUA 3IXAA 4J3OF 4FP8H 1R4XA 4GW4A 4PV8A 4IS6A 4LCIH 3D2UA 3S9DB 1FNAA 4YSSA 3RJDA 2X12A 3CXFA 4K9EC 2FYVA 1CLOH 1CB4A 3NP3A 4WO4A 2ADIA 1XSOA 1CDJA 5FXCH 1QWHA 4LFHD 4UQEA 4FQXB 5SWSD 1OAQH 1GZPB 4YBLC 2JCCB 2NY0C 5HD8C 5AOIA 3UERA 1RIHL 5DK2B 2Y7NA 2G5RA 4OQ1A 1CGYA 3FQNB 3FQTA 5HHVH 3ZIYA 4LEXL 4B27A 1NLDL 4XB8A 4DQAA 3LQZA 4S10A 4V1DA 4Y16B 2B08A 3IJEB 4F7EB 2HJFB 1XSKA 4PRPE 3T3PF 5GGTH 5I18H 2A4EA 5L8JB 1WFMA 2CG9X 4HUUB 5DWUH 3V0JA 3HG4A 3ROLB 3GJEB 2LOEA 3SYPA 1MLBB 1AOHA 3GSRA 2SEBB 1QW8A 3TM6A 4GLRI 3I75A 4GMSL 4KRPB 3P3SA 3ASNB 4TQHA 1KOAA 4GRLD 1G9HA 1T1YA 5BRQA 2VN4A 1E4KC 4FTDA 4N6RB 5AAMC 5IR1B 2FJHB 3KBFA 2KQMA 4OVVA 4ZZFA 4ZUSA 5EPMB 4LL4A 2IV9A 4TF4A 3D69A 5JPNC 1ZRUA 1QZ1A 1ODAA 1XCWA 3LHPH 3GI9H 3UJIH 2WIMA 3O8XD 4JO2L 1N59B 1D7CA 4H4NA 1GC1C 2RH0A 5LGHL 1DVFC 3BD3A 1AHWA 4WV1B 4ETYA 2VN5A 3D25B 3KE0A 1MCCA 4CVZB 4F15B 5T3XE 5KAQG 4BFFA 4XNXL 4IGBB 5D2NE 3N41B 5CZVH 5I6NA 2QADD 1NUFA 4NUPA 4P4RA 1S7XB 5DD1L 1I1CA 2PCYA 2YOCA 3FS9A 4EI5B 3NJVA 3IGKA 5CD5C 3GUFA 4XMUA 1NFDF 1I8LC 2VB5A 4NHCL 1W6WA 5D1ZI 1TJIL 1ETZA 5AW7B 3OAUL 4ZFZA 4WLCA 1WUZA 4LT7A 2A5UA 3U9UB 1DANT 2DQUL 3QFDB 2UXFA 3CFTA 5IHZA 1ESOA 3ABZA 3QIUA 1TKWA 4MDJB 4BCXA 3QUMA 3VXNB 3PHQB 2DTMH 1GS7A 4NNXA 4JFDA 4U7KA 3PJNA 3VE0A 3TNMA 3CTTA 1YPZF 4DKTA 5E8OB 1ET5A 5ILTH 3WN5A 5FHAH 4K7PX 1ZSHA 2OKMA 2YXMA 3EBHA 4QRPE 1OW0A 2JJVA 5J6HA 2YFNA 2N7AA 4N0YH 3S3SA 1AO7B 1G0YR 2DEXX 2PR4H 2Q7YA 2V2WA 1UCBL 1G1OA 1AQMA 2B5IC 3V10A 1KXTB 3TJEH 1JNHA 3II2A 1KLUA 4G43B 1ACCA 3QIUD 4R7DA 4JREC 3GZPA 4EJ1C 5CEZH 1FGNL 3ULVH 1G84A 3L7EA 4PJAE 2O26U 4RIRA 2BSBA 3SO3C 4JG5A 3K3QA 1CFMA 2P5WD 3QS2A 3CZSA 3KLKA 5HJBA 3TA3B 43CAA 1JD7A 4UV7H 2R0KH 1FAIL 2BP0B 2DEYX 5FKAB 3MLWH 1RHFA 1XVSA 2J6EL 4U1HB 5C9KA 2EH8H 3TCLB 3P4OB 1U58A 2WLLA 1SM3L 4PJ8D 3FO9A 4EUPH 4WQOA 4DFHA 5C0ND 4FFTA 4MJ5A 3WJJA 3RHWF 1UGNA 5FEBA 1Q4NX 4J4PC 5BO0D 3HLKA 4FFZA 4F33A 5I23A 2PYED 5INCA 3N43B 5I1AA 5L4IA 1WT5A 4YGVA 3V6FB 1ZLWK 2FR4A 1QI4A 4NCC1 2YPVL 1FYTA 1UURA 3CCHA 3H9HB 4ZTOL 1J7VR 5KVDL 3UIZA 2W5PA 4P5SA 1KLGB 2HJKA 3GHPA 3LS5H 1N3NA 3H0TA 5E1AA 5GRWA 5EOCJ 3COOA 3VXMA 3TZVB 3GFUA 5E6ZA 4WHDA 4L3EE 1DQJB 4HDIB 2HLFD 3BP7B 1JTTA 3U6XS 3FKUS 3WNIA 1TZHA 4I7ZC 4XCNA 2CR3A 1ES0B 1SEBB 4KOCA 2A9CA 4TUJA 4DEPC 4TSCL 3A3YB 4JQIA 1PD0A 1A4BA 2AP2A 1IAOA 1UXWA 3VI3B 5IKCA 2X09A 1AHWC 3FO2A 1R3JB 1Q9WA 2JI3A 2YIHA 4L4JA 4NPYB 4MQ7B 3T08A 1QSFE 3NIDE 2NDFA 3CAFA 4F7KA 3MNVA 2K9UA 3SGEH 2HTLC 4MCZB 1CFNB 1OY3B 4MQXD 4PY8I 4WEEA 4OGXH 4B50A 5B3JE 4DP8X 5BOPA 1A6ZA 1HILB 1H3XA 2YZ8A 5I0DA 3O6LL 4PU2A 1TZGL 4U05A 5KEZA 1ZPUA 5EIIG 1WD8A 4UANA 4Q9QL 3CVHB 2OSLA 1NIEA 1HN1A 2IXQB 1XH0A 4QHUA 1J1XH 3Q8EA 1AMYA 4YFDB 2WAHA 1IEHA 1RUPH 2NY2D 3V4PA 3VW3L 5DGQA 1QUNB 3BP5B 3REVB 4AYMC 1QVOB 4N2BA 3R18A 3FSWA 3UTSA 4PS8A 3G5VA 4I3GA 2H0EA 3D4ZA 4FQ2H 5DJXB 4CA4A 3UTPD 1DZ0A 1HWGB 1BD2E 2IQ9L 4JFZL 3FQWA 4NJAH 3DX7A 1DTUA 1BECA 1A6WH 5D93C 5AW0B 4X98A 5ESAB 4LOUC 2J1XA 4EN2A 4F8QA 5ACZA 1KGYE 3HCVA 3IFPA 4WSGA 4R97B 3WD5L 3NRPA 4YO0B 3HS0C 4K7FB 4KQ3H 3WFDH 1KTDA 1OW0C 4G72B 3C6EA 1MEXH 2VDOL 1ET8A 3BGMA 5AW6B 2X42A 4KZDH 3DK2A 4M7ZB 1GGCH 1KN4L 3UROR 4ANXA 2VLRD 1IGTB 4OFYD 4EZLA 1RULL 1WZMA 2R0ZH 4S1SL 1YMMD 1EZSA 3FB7A 4W81A 4PJCF 3WXVH 1LD9A 3EH2A 3HZMA 4Z76B 1JPFB 5L8LB 4XPAH 3AM8C 1NAMH 1MW1A 5LHDA 4HPYH 4MKMA 4IOSD 1M7XA 1CG9B 2HX8A 4UUJA 2MNUA 4JN2A 2GFBA 4JFVA 4YXKH 4A7GF 3QUYD 4DJMA 2CHXA 1SJHA 1KACB 1R3HA 4HH9B 3FOLA 1CJYA 5D7IA 2VMCA 4M03A 3CHOA 1HOCA 3DK0A 3M45A 1FFQA 4CGUB 1U8IA 3GXUB 4J3OH 2JJSA 3L3IB 4PJHE 4U6HB 4HD9A 5D1ZA 4GSDH 4HWBL 5E9NA 1KGJA 3D12B 3QZWG 3ZSSA 1BVKA 3HAEB 4NNYA 4MMXC 3WKML 1XSIA 4Y9CA 2CWRA 2B1HH 3RVWC 2AQ2A 4OV5A 5C0DB 5I1HH 2K70A 1NCGA 4ZX5A 2EABA 5I1KL 1U8NA 3BO8B 1NH6A 4K3GA 5KSBE 5HGAA 1NC4A 4L8DB 1UEMA 3QI9B 1T21A 3ZE2E 5EEYA 2I60H 3ABLB 3MFFA 5F7AA 4IMLA 1FLTX 2VLJD 1CGUA 3RVTD 2O6PA 4UT6L 4KXBA 1HH6A 1JV2A 2WQRA 5FYKD 4HJSA 3FFOA 4PJGA 2O6FA 1KNOA 2V17L 3BVNB 3M6DA 4KK9C 4P5RA 3ZDZE 2KMWA 1BVNP 3ZTJH 4Y0GA 4ZO7A 3ZYOA 4EI6B 3N1QC 1TQBC 2C7UB 2P5EA 2IH3B 3CC5B 2YD1A 2EVHA 4LSUL 2C9RA 4OQTL 4MXWL 3Q3GB 3T1FA 2JIXD 4FZEL 5AAPA 5FYLH 4ODWA 3H42H 4NNPL 3KLHD 4RESB 5DK0B 2R0LL 5F7FA 4IM8A 3I9GH 1HIML 1YO4A 4JFFD 4TSBL 2P46B 4MAUH 3MBXL 1BMWA 2BNQD 2PXYD 3CFMA 1MHPL 3EHBC 2VQ1B 1VGEH 2JXMB 1N26A 3MLUH 2NTSP 4JFOA 1X5HA 4TTDD 5GGSB 3NCFB 3KYNB 3CPLA 4R8WH 4F2ME 5KWYC 3K4AA 2H3KA 1OPGL 2LU3A 1TCMA 4NUQA 4UOQA 3QCTH 4JKNA 5C08E 4ONGL 2WSKA 2YN5A 4OCNC 3W39B 2XV3A 3C2AH 5CHNA 5HHQB 2F1BA 4L8BA 5J5EA 3VXRA 4KY1L 3WMQA 4R4NC 4QRRA 3RUGA 1MH5A 3FBKA 1NGWA 4B9PA 4HG4J 2OS7A 3QORB 4QHKI 4XP6L 3T4YA 5ISZE 2VWEE 2QZQA 4JM2A 3CMOH 1E27A 1U21A 4QOKA 1VGKB 3OZKA 5I1IH 3HB3B 1XL4A 3A21A 3L16A 1TJGH 2F5AH 2OL3B 5C0RH 1HDMA 1K5WA 3IFOA 4WFGE 5DRXB 4F58H 5J7CC 4LO9A 2D3JA 3WNMA 1MVYA 4Z78A 5E5MA 4HX1B 3N85H 2FX7H 1EJOL 4L8SB 3FT9A 5ID0A 2D7OA 3WYRA 3NFPA 2ZYSA 3RGVA 4XXDA 3V7AG 4LQFL 4XN1A 3LN4A 1A64A 4QAWA 2J56A 1MHCB 2BW5A 3HHSA 4FQHB 2CHZA 5FO7A 2A9ML 2E6JA 3IDGA 2E74C 1NCHA 3SKMB 2BY3A 5DRWA 1E40A 1HJCA 3WTYA 4LLWA 2A9BA 1RK7A 1CLYH 3DVNB 4NQED 3IGAA 2MHAB 2PPFA 5AL0A 1T83C 5EOQH 5D1ZC 4GAFB 4IEFB 1N4XL 1RUML 3GXMA 3E8VA 4TLTA 2C9VA 3DVGA 2EXYD 3UCQA 3TFKC 4ZG1A 4S2SB 5K9JH 2DM3A 1TTUA 1PZ5A 1C8QA 1QO3A 1OP3K 2X4PB 2EIKB 1NLBH 1FFNB 5KVMC 3SGEI 1WWBX 3H3KA 2YPLD 1KGCE 3HNTH 4PS7A 3Q8BA 4WW2F 1AGBB 4D0DB 5DEFB 4GIPD 4G8EA 2YXVA 2G75A 4B3VA 4YSEA 5I76B 4A6YA 1ILUA 1I9JL 5EZLB 3GBLA 4AI7A 3ARFD 1QLEB 2H1XA 1U6AH 5BUGA 4Q8BA 4Z0BH 3AQYA 4ZPTB 4R90L 5JOFB 5AOJA 5F7LB 4HIIB 2Q76B 4LPXA 3NTCL 4BJLA 1OSEA 5CN1A 5B21A 1Q9KA 4PGDA 3ECBB 2CXGA 1OTTC 5IVZB 2FT8A 1QTSA 1RJCA 2E27L 3BX7C 1E9PB 1RJYB 1IUZA 3V95A 1QRNB 4PJIF 3T0EB 2RCSH 5EF3A 4N2HA 5ADOH 5KVGE 2X1WL 4D7BA 3L3DA 5EUOE 3MROB 1LO3H 1L6ZA 2EIJB 4FQLH 3ARXA 1ZSDA 1LNUA 4CSZA 5BQ7A 2AF2A 4PBXA 3ARSA 2C9QA 4RWHA 3OX8A 4XCFL 4QWWD 2AJVH 3S3CB 3AXLB 4X7SL 1NCUA 4N8PA 5FYJE 4HUXB 1ZHLB 4Y19E 4JRXD 1FBIH 4X4YB 1OK8A 1KBKA 3BXNA 3O11B 5IFJA 4YDZA 1ZGLM 1DBAH 1JD9A 2FB4H 4Z3TA 4M62L 4LCWB 1S7WB