1TO4A

Structure of the cytosolic cu,zn sod from s. mansoni
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
GSNMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAGGRLACGVVGLAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cytosolic Cu,Zn superoxide dismutase from Schistosoma mansoni.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 45
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1to4A00
1Q0EA 4FF9A 1F1GA 1HL5A 1PZSA 3KBEA 2JCWA 1SOSA 2WWOA 4L05A 4A7GF 2Z7UA 3H2QA 5KBKA 2ZKYA 1COBA 1E9OA 2V0AA 2ZKXA 1OZTG 2WZ5A 1XTMA 3QQDA 3KH4A 3L9YA 1SXCA 3CE1A 3GZOA 2LU5A 4MCMA 1IBDA 2C9SA 2C9VA 4N3TA 1Z9NA 3GZPA 4BCZA 5KBMA 3QQDB 1SPDA 3KM1A 1E9PB 1YAIA 1UXLA 2VR7A 1SXZA 3PU7A 1TO4A 5KBLA 3K91A 3ECWA 1QUPA 1FUNA 2GBTA 1XSOA 2C9UA 2XJKA 3L9EA 1E9PA 2Z7WA 1SDYA 4A7TA 1JK9B 1L3NA 1SXNA 2K4WA 2WYTA 2ZOWA 4B3EA 3T5WA 1BA9A 1ESOA 2AQTA 2VR6A 3H2PA 2APSA 3GTTA 2WZ0A 4A7UA 2AF2A 1OALA 1PU0A 1YAZA 1E9OB 1XTLA 2GBVA 1AZVA 4A7VA 2Z7YA 2XJLA 4BD4A 3KM2A 1IBFA 3SODB 3KBFA 2SODB 2WYZA 3HFFA 1SRDA 3RE0A 1P1VA 2ZKWA 2WZ6A 3HW7A 1F18A 1SXSA 3F7LA 2WKOF 3HOGA 2VR8A 1DSWA 2WWNA 2E46A 1SXBA 3ECUA 2WKOA 1F1AA 4A7GA 4N3UA 1N18A 1OZUA 5CU9A 2Q2LA 4U4IA 1RK7A 4OH2A 4OJAA 2R27A 1S4IA 1OAJA 2GBUA 3ECVA 2NNXA 1EJ8A 1IBHA 2AQSA 2AQPA 1EQWA 1TO5A 1B4LA 4A7QA 2AQQA 1PTZA 3KH3A 1HL4A 1DO5A 1U3NA 2JLPA 3LTVA 1SXAA 1MFMA 3GQFA 2AQRA 3GTVA 1SDAB 3CQQA 3S0PA 1CBJA 2Z7ZA 1UXMA 1YSOA 1JK9A 1IB5A 4BCYA 1E9QB 1N19A 2AEOA 3GZQA 1CB4A 4MCNA 3MKGA 4A7SA 1KMGA 1BZOA 3F7KA 1OEZW 1IBBA 2E47A 3CQPA 1F1DA 1B4TA 3MNDA 1Z9PA 1JCVA 2AQNA 1E9QA
chains in the Genus database with same CATH superfamily
1MSPA 1NGPL 1UYWH 1VJSA 2YPLB 3EJUA 4JPIB 3FNKA 4YAQA 1RURL 2DI8A 1KULA 1SOKA 1T0OA 5LAPA 4H8PA 5LBGA 4QHUB 4P5TA 2B1HL 1R5WB 3P9LB 5T1LD 4AQ1B 3P9LA 1OP3H 4AQ1A 4BRJA 3PL6B 4ABWA 2GKIA 5D1QA 2X6CA 4QHLB 1KIRA 5CP3H 1XGPB 2VDQH 3RKDC 3BGAA 5GRYA 1FH5H 2AEPH 3L2NA 1AG6A 5A2AA 5JYLA 5J3HD 4AUJA 4PFEA 2H41A 1J9SA 3POCA 3KPQA 2X1OA 2Z1PA 4Z7NF 4UZGA 1QBBA 4EDWH 2H2SC 1PZUB 2OMWA 4I2XA 4W9CC 1TEFA 5CR1A 3NJNA 3B43A 1WZAA 3FRPG 3MXVH 3ISWA 2VXUL 3ETTA 3KCPB 2XKUA 1AR2A 1GIGL 3QXDB 2F5AH 5CKAA 3V5HA 4L8DA 3QWRA 3DURA 4M6OH 2H2PD 1A9VA 4AQ8C 3MJGX 4H8QA 1J1XH 2WVVA 1OVZA 2YD1A 3LPPA 1OANA 3SEPA 5J6HA 4PJDF 5HVHB 2MFNA 3QC6X 5DHVA 2EH7L 1MUJA 4NZDA 1IC5L 5ADOH 1E7VA 4KVCL 4NWUH 1IFGA 4MKTA 5FYKD 5GISL 4RMUA 2VLKA 2ZKWA 3R0NA 5ICXB 1IGJA 5DEJA 1F8TL 3EYFA 4AMXA 1NIAA 3T2NL 5DJDB 1GHFL 2H1PL 3AAZA 5LWYL 4LNRA 2E76C 5GISH 2FQDA 3ESPA 1G9NH 4LDOB 5D1QB 3U7YL 1IC5H 3NRFA 4LCCC 4LCYA 5TPWH 1TJGL 5DEZA 4DN4L 4JN1H 4BRVA 1N8ZB 2BSSA 3IJSA 2AQPA 2H4EA 3LJ3A 5DZAA 1AKJB 2BXZA 3ARED 3WL9B 3E6FB 1P4BH 3MOBH 1XVSA 2CU9A 3LEYL 1N3NB 4P3CL 4M6OL 4F3FB 1GGBH 3M86A 1SHWA 4GO8A 2YUVA 2F5AL 2J20A 1UD5A 5EUKB 3A21A 4OGQC 1GSMA 4Y2OA 2VXUH 5AOJA 3LS4H 3TEUA 4C4KT 4JLRA 3KL5A 4WTZG 2A77L 1H8SA 3HUJB 1CDUA 1QEXA 3NIFF 4B95C 4DOHB 3RBSA 5KSUA 3K2UL 5DRZB 5IJKA 1L7TH 2Y24A 3RPIA 3GK8H 1ECZA 4K5MA 3IVKB 3HE7D 4Y1AB 5AZUA 1SMAA 1FP5A 5I9QB 1ZPUA 4FQJH 3S3DB 2Z65C 4KKAD 4NQED 3S37H 3VFTB 2ENSA 4O2FB 5SWSB 4I1RA 3CBJB 5C0EA 3MV7E 3SYQA 2CBQA 4XBPA 2PPFA 5BV7C 3PPEA 3JXAA 3RI5K 4M43L 4WV1C 1YN6A 4F1SA 5AOZA 5E9DA 1G7JB 1NCGA 5DXWA 4U6XB 4O9HL 3SDXF 1OAUH 1WBXB 4C55A 2UVEA 4TOYH 1RMFH 3SN6N 4GAJL 2FDBP 3E3QC 3HBZA 4JM2D 3UTPE 5EB9A 2ROXA 2AJVH 5DWPA 4FNQA 1GGCH 5CIPB 3SPVB 2MCPL 4M00A 3V4VH 3UZEA 2C3VA 2Y1YA 1SDDA 5CEZE 5GGTA 3VRLE 4JFFE 4L8BB 1F5WA 1CYXA 1DDHB 3O6KL 4A37A 5FOBB 2W07A 4R96B 1PQZB 2O30A 4YQXH 4APXB 3TYFA 4WHTB 2CKBA 3RG1C 3UZQB 3FU8A 1LLAA 5B39G 4AM0Q 5JA8B 5H4YA 4M7LH 1BM3L 3ZY7A 2XZQH 2HCZX 3HZYA 4P9HC 1FVDB 1MJUH 2NYKA 3DSFH 2V5MA 4AL8L 4Z78B 5DURB 1W16A 4QOKE 4G7VL 4CW1A 1KIPB 3EOTL 4O5LL 2XWJB 1YEEL 4JVWA 3VFTA 3BIKB 1AG0A 4P2OB 1ICTA 1KBPA 2PCFB 3NCWA 3MLTB 4R26H 5HJ3A 1ZSDA 3FOMA 4ZMAT 3AXLB 3FUFA 1NDMB 5CGBA 4WFHE 3O0RH 1ZAGA 2GT9A 3MRMB 3DSNA 4HIEB 4QXWA 3DTUB 1NCHA 4ZT1A 5ICYB 5IHZB 1A3LL 1CF8L 1QLEB 5JXEA 4ODUA 2VDLB 1O7SA 5GS0D 5D1XE 1MCKA 5CJQL 4PU2A 2NY2B 2ZCKH 2M1KA 3MRDB 4AKPA 2DWTA 1NCCH 3EUUA 4WFED 2X6BA 2CIIB 3QG6B 2QTEA 3WY2A 5HGAA 3WS3A 1KC5H 3VWJA 1EXUA 2CDFA 2D4DA 3O8XC 5E6YA 1FZJB 1YY8A 3CUPB 2Q0ZX 5DVOA 1WYJA 2G2PA 3WTSA 1ITBB 1MJ7H 1P4UA 1TIUA 4JO8A 3HI6L 1HJBC 5HXMA 3ELQA 5FDWA 3EO1A 4KMQA 1KNOA 5HPMB 3G7TA 3VI4F 3F5WB 1PCSA 1ZEAL 3L48A 2J2ZA 3CDGB 3L6FA 2IQAA 4U0RC 1BIIB 2VDRL 3MV7A 4LVEA 5HGHB 3L9RA 1GPOL 4CSPA 2VAAB 2RQEA 2KLRA 1BZ9A 1EXGA 4H25A 4YSDA 4Y2NA 1KYOJ 1JNNL 3GBML 3VXTB 3M17A 4IK6A 2YQBA 4UB0L 3UFIA 3IDNB 3L7EA 1I8IB 4FXGA 3RY6C 4MX7B 3VFWB 3GXIA 5C86A 4LSTH 4NHUB 1FQ9C 1TO4A 3QXDA 4HJSA 4NBYB 1JNJA 4J3UA 2LU7A 1T80A 2GBTA 4KHTH 43C9A 3HHMA 3CSBA 2JB6B 2XZCH 2KLTA 4YSOA 2V3EA 5BMFL 2VCOA 4KI1A 4W81A 1F90H 1VZIA 2WNGA 2DJMA 3BP5A 3MJ9A 4DETA 4ZPVA 4F57L 5C9JA 1FNHA 1X5AA 5KSAD 3US1A 3IAPA 3D4GA 4H20H 1WIOA 2XC8A 3BVVA 1HH9B 3SBQA 1ETA1 3BRDA 2QVIA 3H6JA 4QTIH 3ARBA 1QD0A 3WO3B 4AYDC 2CBOA 2B4CL 2HFEB 1CXEA 2FBRA 4NZUH 4HT1L 5HDRA 5TD4A 1S2EA 1Y7VA 2NZIA 4IU3B 2QQNL 3DECA 4QHUA 2OMYA 1I7TA 4JFPB 2EYSB 3EDEA 1EZVX 2HSIA 3UJJH 1E5YA 2WHVA 2FQGA 2AXFA 4UYQA 5HHQA 2FUTA 1YYMH 2UWEF 3UBFA 4AT6A 1S7XA 3GM0A 3DGGB 4EIUA 1BQHB 4WEBL 4WY7H 2Y0SA 3KVPA 5C0IB 3IFNH 1S4IA 3HJ0A 4YWGH 3ECVA 4LSVL 2E8ZA 4U1HA 3ZDZB 4CSSA 1BIIA 5GGUB 1JAEA 1RIUH 1MIEL 3IGLA 4ZFFA 1HHKA 1CT8A 4PSPA 5FGBC 4NP9A 1OSEA 5C0BA 1AXSA 3RX5A 1Z5HA 3BPNC 3P3UA 1JYVA 1ERNA 3RUGB 5KZCD 4Z7OF 1CDGA 4LU5H 3FOLA 1UXMA 4YOKA 5IGXL 4X6DA 1KXVC 1AIFB 2DTSA 3A6CL 4KKLC 3DVGB 1KCLA 4P59L 4JANB 2EYRB 1LDPL 2E4TA 4TVPD 1EDYA 3MAWA 4FULA 1E43A 3DMMC 1FJ1B 2XT1B 2DQUL 5ETUA 3IKCB 2HFEA 4R5VA 3OAZH 3KDMB 1OWWA 2QPDB 3ES6B 3U1SH 1OE3A 4G5AA 4PJBB 3K8KA 4YDNA 5I6PA 4WI0B 3MRHB 5AAMC 3ZTJG 4Z7NB 1ZJBA 5HVGB 1AZBA 3FT4A 3U0WL 1PZCA 3QR2A 4TS6A 2C26A 1YEJL 5I5MA 1S7XB 4UOZA 2XN9A 3B6SA 3JBG7 1I8MB 3F58L 1R3IH 4JPKH 4KVNH 4FCAA 4WJG3 1E65A 1B0RA 5GSRB 5EF1A 3U0PB 4LAQH 2JJUA 4JKPL 4PLJD 3PGDA 4FQXC 4H8UA 1IEAB 4ZQTA 3ORJA 4FQCH 2A9MH 3W82A 4LVHB 3RGVD 2OTWB 2Y25A 3X1GA 3FQRB 3NTCH 5GPRA 4ECNA 1TYRA 1KDIA 2J43A 2VXTL 1RK0A 5JW5A 2Z7WA 3QDMD 3RRQA 1CIDA 3M1CA 1L3NA 4C83A 4XZUA 4MTMA 2WNXA 3HE6C 3HPJB 3TNNA 3OKLA 5GGVY 3B1TA 1TETH 4OZFH 5D2LA 3GO1H 2X3AA 3UPCA 3IJ9A 4L37B 4AM0B 1T2XA 1Z5LB 2VDKB 3JWOL 5MENE 3GBNH 3TEWA 5CUSH 4NI3A 1T3FB 3CDCA 1UENA 5I66A 1TUPA 2AJUH 4NIKB 1CL7I 3NQIA 3SO3C 1OD7A 4N0YH 1DE4B 2YBGA 4KQ4H 4DZ8A 2WXJA 1Z9LA 4KTYA 3QEUA 1QFWL 3L1FA 5DK2B 1AQDB 2QADD 5AYQA 2YJLA 3MRKA 1CFTA 2AK1L 5K39B 3V5DA 5ACZB 2ITCA 4YC2C 1QWNA 4AG4H 4FNPA 5C09D 3V79C 1ZTXE 1A2YA 4HHWA 2V3DA 3SKOA 2IPUK 4JFEE 4M5SA 4U4IA 4E9VA 4OFKA 1M71A 3S3CB 3L5XL 4M5ZL 1VGEL 1WBYA 5AW3B 4MB1A 3II2A 5IVXE 5ILTH 3KPNA 4E41B 1G1KA 2CK0L 3ALWA 4OSUH 2WLIA 1I1AA 3VGBA 4PJ8A 2IAMD 4OQ1A 3PJLA 1TLKA 3DVIA 1U2HA 4OCSL 1KN4H 1KJ3L 1JZ8A 3KXFD 4IBQA 5I8KL 1KZYA 2BP0B 2DYPA 2R0ZL 4LEXL 1UD2A 3GMLB 4J1UB 1PLBA 3S0PA 5J1TC 1D7CA 4PRAB 3HC0A 3KW8A 4JPWL 3GZQA 4GIPD 2D9QB 5DFVC 4AEIH 3IJYA 1E3ZA 3SB3A 1PFOA 3QDGA 4KO7A 4FQQA 5I18H 1NCAL 1UG9A 3RWJA 3FUHA 1KIQB 2DV6A 4MD0A 2Y2YA 2KZKA 3D9AH 4XVUD 5CJOL 1OLZA 1AI1H 5I71B 4ABUA 3S3SA 1QRNA 5GQBA 3RTLA 4MNQA 5I17A 5IW6A 4Q9QL 5JQIB 1MJ8L 5KBKA 2R0WL 2Y5TB 2P52A 4XVTL 3QG7L 4OV5A 2FL5B 5DHYA 4GG8B 3MRFB 3HRPA 4Z3EA 3EJYD 3J7HA 4XNZB 2L0DA 4EE2A 4N0FA 5EBLA 3IRCA 3UDWC 1PG7X 4MXWH 3FO1B 3O2WH 1KGCE 1UM5H 2NQCA 3CFEB 3QUMB 3HAEA 1T83C 1A2YB 2HN7A 4XVJL 1ZV5A 2KERA 3A22A 1U58A 4TQ8A 3VWKC 2EC8A 4WKXA 4AC2A 4JFOA 4MAYD 4H1LA 3VUAA 4NQVA 1QHQA 1A6PA 4PGCB 5A2CA 1OM9A 1SHXA 2V7HA 4R4BB 1A0QL 1DUYA 4RGMC 4CL7A 5I1EH 1RPKA 1J1OH 5FKAB 4U3XA 4FABH 2E0PA 5E7BA 4O58H 1QBMH 2XV6B 2K9UA 4QRRB 1FE8L 1L5GA 2WBKA 4XMLH 2NX5A 1LWHA 4X99A 1I9IH 3LD8B 1JHTA 1TJXA 2CLZA 1LP9A 3CVHB 3QIBA 4ZOEA 4FXKA 3STZA 3AWGA 4R7LA 4OLZL 3EG9A 5D7LD 4ZZFA 1A6AB 2CBTA 2H32H 3DETD 4RGND 3LCYA 1JZ3A 5EZJA 4L5FH 1UJ3C 3MRLA 4UM9B 1A02N 1JFHA 2CA4A 4NQXA 3VD7A 5AYTA 1ZV9A 4PJGE 1IAKB 2IBZY 4ENZA 2Y5TA 2HKHH 4FYSA 4LCUA 2H26B 2WLMA 1AP2B 4OCMC 1KGCD 1QSFE 3HUJE 2QELA 5DDHB 1FI8C 4LVOB 4PWKA 1R9FA 4GRWF 4MLSA 4H8WC 1RK1A 1YYLL 2WXLA 1FBIH 1IFRA 4N22A 4R84A 4QI3A 5KVEL 4OLUH 4Y1AE 2A9BA 2X87A 4UTAL 5E8NA 1EGJL 2Z93B 3W9DA 3JWOC 2CMRL 9CGTA 3ABMB 5IR1B 3B2UC 3KPPA 1CBVL 4G6JL 1ML0A 4MJIB 3GS0A 1QTSA 2WWMD 3BYTA 1IB5A 3GINA 3HR5B 1ADQA 4PW4A 3DIDA 1ZLWK 1DHKA 3FB7B 2AK4A 1UZGA 4HS3A 4JCLA 4JQIL 2E47A 5BS0A 2OZ4L 2VC2B 1KENL 2CLVA 3P3YA 3CH1A 1MI5A 3AABA 1MI5B 5DJ6A 1ID2A 1F42A 5F3HB 5C07D 4OZFG 3AGWA 1FFRA 4RNRB 1AJ7H 5F0PB 1M6OA 1IIKA 3GSUA 3BP6A 2B0SH 2VUKA 1D6EA 1SJHB 4JR9H 2K8MA 5JPMA 1WIPA 3P2BA 3ZDXF 1D5IL 5CLWA 1YDPB 3C09B 4FS0A 4NO0A 4Z0XB 5DZJA 5ANMA 1W0VA 5BUPA 1RZKC 4YHZH 2LU5A 4WO4A 4I89A 1R3JA 2JIXD 2VM4A 3HUJF 1AHWB 1ASOA 5HSFA 5D2LE 3VYNA 1YJDH 2X6VA 3OR6A 4TUUA 4XN5A 2NPLX 1X9RA 3O6FC 1M9SA 4CDHA 4LF3A 4XAKD 1A6TB 1I7RA 1IC7H 2BIHA 5D2LF 3OXRA 3QZWG 1QSED 4U0QB 1VFUA 3ARFA 3SDDD 3LKPA 3QCVL 1ODAA 1NAKL 2HYMA 1WO2A 2COVD 3DRQB 1ZXKA 3GFUA 5ICZB 3JV5A 2E7DA 1D5MA 1MAJA 4H2CA 4RAUB 1YNTB 4GT7A 3GPEA 4GI6A 2CO7B 3VFSA 4KUZL 4NUPA 3ARGB 1X5MA 4OLVL 5ECGA 1JZJA 3L3OB 4X6BA 3X14A 1CVSC 4EZMA 4ZUUA 2HT3C 3MRDA 4HX1B 4XPBL 4F7PA 1R19A 3SODB 1PDKB 5D6DC 4WHYG 5C2UB 5TFSH 2FD6L 3BUBA 5JIQA 3MLSH 2BY2A 2WN3A 4OGAD 1WGOA 3QJHB 4H8WH 1PYWA 4CNIB 3S36L 5IREA 4FG6C 1GOFA 2WTRA 4IGBA 3V6OE 2PN5A 5D1ZA 5CBAA 4N3UA 3MA9H 2JKWA 3QQ4A 4KV5F 2FBJH 2Z31D 4Z77A 1JGEA 1YECL 1BYNA 4QTHB 1JK8B 4NO3B 1QLFB 1RUKL 1AMYA 1S9YB 3DUUA 4PB0L 5B1KA 4YK4B 5KANG 3KEHA 3ARDB 1KTLA 3BD3A 4NJAH 5TE7L 2N01B 4UOW1 4UIKL 1UA3A 3IDYB 3A47A 5EDSA 4GEJA 4GRLB 1JFQH 2IG2L 2PO6B 5GS0L 2H8PB 5HGDB 2DYPD 2QVTA 5DQJB 5E2VL 2FE0A 2CO2A 3HCVB 1AGEB 1RU9H 4G71B 5DRZA 5IK3B 4MQXD 4LOUC 3MLYH 1YJDC 2CDGA 2COQA 2NNRA 1E9QB 2X4PB 3RGHA 4G6KH 2F2HA 1JMZA 4H1LG 4N2EA 4EZKA 4DIXA 2P44B 3V4PL 3NSYA 4M48L 2NY7H 4DEWA 1G1CA 4AQEB 1QG3A 3L3OA 4XN9A 1G6RL 3KJ6H 3S5YA 3JVFC 4AH2A 1BVLB 5G2NA 4L8SB 5I1IL 2ZZUT 3KLLA 1SUHA 2MJWA 3FN0L 3QQ3B 4HIHA 3VFSB 3MBXL 4XO8A 5DHDA 2BZDA 2YPKA 3AG1B 3QUZC 4NKDB 3WIHL 4DN3H 4L05A 4DK3A 5I1CL 3F12B 4PS8A 4TQEH 4RBPH 5F1OB 1NLDH 2EDBA 4TQEL 3TOPA 1A7PL 4TF4A 1WBXA 1TPXB 2EDEA 2HFGL 1RJZB 4ODUB 3QDJD 1DQMH 1W2KT 1TEYA 3S3JA 2EAEA 5DJDA 1PGRB 1WS8A 3T0AA 5DLLA 3GZPA 1L7IH 1KLUA 5KYWA 1OAYL 4NFCA 4BQCA 3CSGA 4A6YH 5FIEA 1ES0A 1NKRA 1MQKH 1XB8A 5CAYB 3AADB 4PV1C 4XP5H 2NY2D 4TTGA 3OKKB 5B3JE 4M03A 5AG8A 5I8CB 2JI2A 3BPCA 3U9UB 1TVBA 3KE0A 2C4XA 3IM1A 4RFNC 4XNUL 5IB1A 3X17A 1RUAH 4N5ED 3RGVA 3GLDA 1L5GB 3FQ2A 4M5YL 5EOCL 1A21A 1E67A 4N0UB 3UCRA 2PWEA 3HNSL 3QUXC 3WJLA 1YQVH 3HUJA 4IIQC 4DFIA 2AF2A 4X0KA 3RUGA 3TBBA 2K8QA 1LMKA 1UWXK 5IMOA 4ETQB 3D25B 2G5BA 3REVB 4KDTC 2YRLA 1IGTB 2YEZA 5IP4A 3EAKA 1D5XB 1E2ZA 3I9IA 1PD6A 3QEUB 3AQZA 2XG4A 4PYHA 3O0LA 2XKNA 1NCIA 5I66B 2QV4A 4FXTA 4JRXD 3TCTA 5IB2A 3IF1B 3FO9B 3UTPD 5TFSL 1EO8H 4HXBL 4PJ7A 1Q0XH 4WAFA 2JKXA 2GTZB 1AAJA 1WBYB 3OB0H 2Z0BA 3C9NA 1IV8A 3HNTL 5DURD 4U3SB 3FMGH 5FCSH 2R69L 5DUPL 4G9FD 3BZDA 5DWUL 4WFFE 1F4WH 1SFHA 4XCCH 3NDZE 3U2SB 4PJXA 3W37A 5C0ND 3SQBA 4W9FC 4NYLA 4IOIB 3QYMA 4IRZH 2MCMA 2VL5A 1SDAB 4JKMA 4L5FE 5I1GH 2EXYC 1YPZA 1EDQA 2ZUUA 1HOEA 1OSZA 2ADJA 2JELL 1DTUA 3O3EA 5ISZE 4MCNA 3EJJX 2ZCHH 1Q1JL 4FTVA 4DKAA 2VM3A 5EOQL 2H7WA 4OFVA 1I53A 3ZDXB 1E8XA 4L4TB 3QDJB 3RA7L 4UF7C 5IB1B 5LBSA 4XP1L 1RZJL 5PCYA 3HS0B 3ME0A 2FATH 1KF9B 2AV1B 1LO4H 1ZDQA 2X88A 4LASL 2ICEB 4PTUA 1MHEB 2VDLH 4IKKA 4KU1A 4HAFA 2JSFA 3B3BA 5TGBA 3TWCL 2J25A 1JZFA 4BFOA 5FHAH 4HJ1A 4L2LA 4E9WA 2KPWA 4BKLB 1BCIA 2WIIA 4RZCB 3TH3T 5A16A 2LTQC 1MXGA 3ZO0A 3PWJA 4ZXBB 1FYTB 2XPGA 4UILL 4HPYH 4LP8A 3QQDB 3BOVA 4NUMA 4QHMB 5L4MA 2NY5H 5TK4A 2I26N 4ZTEA 1G7QA 1T7YA 2DLIA 4JHWL 5FYJD 5ESVA 5KJ7E 4Y4HC 2J71A 1F4AA 2Z4QB 3ECWA 1F4WL 4XCCL 5I1DB 4CVZB 4XVUC 3DX4A 3TESA 3ZLQC 1SDYA 2WYIA 1SM3L 4AEHL 3K46A 5CIPA 4Y16A 1A64A 3IKCA 2FYVA 4HK3N 3G6JA 3FH7A 1CDCA 3WLWD 2XFXA 1QATA 2AZUA 5IB3A 2NUTA 5IHUL 1PD1A 5KG9A 1EEQA 1DQLH 1HHIB 1TZHB 3I85A 3NA9H 3OB0K 2J1KA 2ZAIA 1RZFL 3IE9A 5AVYB 4E41E 5HHQB 3ESOA 3GHEH 1RIHH 2OZ4A 4TUKL 1HSBB 3HC0B 3TO4A 1C16A 4B97A 3K80A 3NGBC 4JQIA 1MCJA 4R2GB 3MFGB 5LCVH 2AJSL 1E4JA 1FZMB 2FGWL 3SY0A 5D8JL 2NY3D 1ZA3B 2F74B 3VXRE 5T3ZE 3ULUD 1U8NB 1ZHLA 1HYRC 2IWKA 3BW9B 5TE6L 5TGBB 4NX0A 3BYYA 1PEWA 4EF3A 2A9NH 3R19A 5SWQA 3VXMD 1FIEA 2J73A 3NCJL 3FN3A 1JE6A 5D7IA 2YAQA 4ZDHB 4A6YB 1EEUA 1ANUA 4JFDE 1OSYA 3QIWD 1SBSL 4ONGL 4HQQL 4XNUH 2Q8BL 5AZ2H 2Z35A 3B7TA 4G1MB 3VFRB 1JUFA 4A7QA 4MX7A 4W4NA 3VFWA 1C7TA 1N0LA 4M7KH 4FNRA 3WELA 1IX2A 3PHQA 4IRSB 1EX0A 5I24A 3NMEA 1MQKL 1WFNA 4MQSB 3DOIA 4JL1A 4M93C 3NCCB 1CBJA 3O3AA 3WTWA 5EO1B 5ICUA 2O61B 1PBYA 3PCYA 5E94B 1I4FB 3B7UX 1L7IL 1BAFL 3L95B 4XVJH 1FNFA 4AJ0A 4LSPH 3JTSB 1RUMH 1WAAF 4XE0A 3IU3B 2FCBA 3HMXL 4MA3A 5BRZE 4F93B 1BM7A 2APWA 3GMRA 3HA0A 3VFGL 1SYSA 3I84A 2BNRA 32C2B 2VDOL 3CPUA 2V2XA 1TF4A 3HRZA 4H5SB 2F8VA 5DJXA 4XWOC 4HDIB 3WO4C 1Q38A 4Z7OE 5C2BL 5SX5H 4ENEC 1B6UA 4B50A 2YGQA 2V8MA 1KCUL 3MLRL 4MASA 3NFPB 2QKIB 5H37A 3KJ6L 2Q9OA 4Y2DB 3IDMB 5F88B 2HWZH 4DVBB 4IS6A 3FQUB 3PGDB 1HL9A 1SOXA 5DTFA 1MVYA 1QUNB 5GHWL 4DZBB 3QPXH 3PGFL 2BY1A 2KLSA 4KOCA 4Y9FA 5HY9A 1NCDH 5EOTA 3ILDA 1JGUL 1V3MA 2UXTA 4DKDC 3KPOA 1T5WB 5T1KD 3RB5A 4EIZC 1PJ9A 4Q9BA 3APFA 2C3XA 2HJFA 2YD0A 3AM8C 3GSQA 5IW3A 3RX9A 3RA7H 3QJVB 2WLKA 1TXKA 4PJ9B 3ZPDA 5B4MC 4FP8H 3F6IA 1Q1JH 2W60A 2YC1A 3QB7C 4P5KB 3BH9B 5AW6B 1AXIB 5GS2D 2VE6B 1BGXL 1JZIA 4FQIL 3LV3B 4U6HA 7PCYA 1GAFH 1A1MB 3LVTA 4NUQA 4ZMTA 1A6UH 2XJLA 5HYJB 2WLJA 3T6QC 2BSTA 2EXWC 5GJSH 3L1OL 2V4LA 4JO4L 3NA4A 1OOWA 2P43B 5DMIL 3RWHB 4BUHA 3MGAA 2YXFA 3CVCA 4PJAE 4NRZA 5D7KD 3T0EC 3K3QA 3DX3A 3KPSA 2BNUA 4I48A 4N0YL 2YR3A 4C56E 4MD4A 3GIVB 2A3TA 4S1SH 3LZFH 2DQCL 2AJ3B 2FJFA 2V8LA 4OZFB 5EO9B 3TBSA 2UXVA 3EJSA 2ADYA 3RTQD 4IBLT 1U8IB 2V9QA 3O6LL 1P1ZB 1AH1A 1XEUA 2BOLA 4EAEA 4FJYA 4BUQA 4W9DC 2GTQA 4R5XA 3LN5A 4PVMA 5ESAB 3AITA 5BW7A 4KY1L 4PJDB 5MI0C 5GGRY 4M7JH 1E0OB 2VXTH 1XL6A 2J5LB 3WFEL 4OGYH 5I74B 4DUWA 4PJ9D 4P99A 3VA6A 3VU1A 3WOVA 2HP4A 3BT2L 4MAYA 1T1YA 4IBTA 4UIMB 4G8IA 1CK0L 4NM4H 4RX4D 2DWEA 3S5LG 4ETYA 4U6VL 4J4PA 3MNZA 4TL5A 1SEQH 4OJCA 2QFRA 2DLGA 4XP5L 4Y7OC 2GJ6A 2NY3C 4ALAL 4EMZA 2IV9A 1IEBA 5FDYA 3AMKA 3PPSA 4GSRA 2XNAB 3QRGL 5KJ4A 3SPJA 3ZVVA 2VISB 1ECYA 1PLAA 2DQIL 3FTUA 3GWJA 4CKQA 3V4PB 4XPTL 4Y2DD 1HYSC 2EO7A 3PWVB 1IE5A 3CVDA 1J5OL 4YSPA 5I76A 1TSRA 1FLRH 2A74A 2ZYRA 3CFCH 1J0JA 3RDTD 4CU7A 3JWNE 2VXSL 4O2EB 4D3CH 5I1CH 1KCSH 3RUGF 4JQXA 4JGJA 3OM3B 4J6IA 5FHBL 4HSAC 4HS8L 5IJVA 1EHKB 3VFNB 4I88A 5GRZA 4JCWA 3NJKA 4JFUA 4Y89A 3DV4B 2VZVA 5IEHA 1U3HD 1T03L 1EGJH 1T2QL 5C0BD 2DQDL 3SO5A 3CH8A 4MSWB 4JKNA 5HYFA 3RGBA 5KVDL 4OFDA 5J5EA 5CCJA 1YEIL 5IFAL 1JERA 3BWUF 2QLYA 4FFTA 3UO1L 3F62A 1U33A 4MZ2A 3RIFF 5IG7A 2OTPA 2BS8A 4QRRA 1Y18A 1VESA 5DQJA 2QJDA 1CDJA 1AZVA 5CNHA 2NDFA 1U8KB 1UURA 3BW9A 1H3GA 2HH0H 3MRCA 3VFMA 3FRPA 4L5FL 1F18A 3LKQB 4UIMA 2BHZA 4KPHL 5KN5A 3U9PL 1NFDE 4HA1A 3GXNA 4LRIC 4MMXB 5F1SA 3HOGA 3L4WA 3QZWA 5E5UB 2VABA 5KS9B 4N8VA 4PJCF 4HGMA 4NOFA 3EGSA 1ACZA 4DPBX 4HT1H 4F9LA 3T2OA 2PYFA 4ZFZB 3QORC 2GT9B 3MRMA 5FLVA 4ORZC 4PLJC 4X4XA 3CHSA 2YGOA 1TVHB 2WLYA 3DKHA 3GEWB 3CVHH 3TTYA 2FLMA 4XCNB 5IOPA 5TDNA 3ZBMA 2VW4A 3HR5A 2YRPA 4G7YH 2XWDA 4GY4A 3BVNB 1RP9A 1XR9A 4KX9A 2XWXA 2EE6A 3K72A 3MJ8B 3W0WB 2HB0A 1YEDB 4CN4A 3K0YA 3Q3GA 1OB1B 3BSZH 4K5PA 1FORL 5JIMA 3QO1B 1FSKC 3A4DA 4OCXH 1M6UA 4PRNB 1VB9A 4BH7B 4JUSA 4OAWA 5C3IA 1I1FB 4ADIA 4F7MA 1PPIA 1MCNA 2OSXA 1BV8A 1NAKH 4K8RC 3OPZH 2F68X 1PD0A 3CSYA 1LE5B 3WXWL 1BLIA 5DMGD 3CU1A 1SLWA 2J44A 3PF2A 4I0PC 2ITDA 3HFML 4U1MA 4NO5B 3SDDB 1N8OE 2QZ5A 3U30B 3R1GH 1V7NH 2W81C 2XZAH 4F27A 2JJSC 4PYGA 1NDTA 3GSNB 3OMIB 1WQVT 4M62H 5I18L 1E5AA 1ROCA 4HLJA 1ZY9A 1IL1B 1HOCB 4FHJA 2P24B 3SCMC 1C5CL 3DOSA 2ENYA 3IETB 1T0NA 2B0SL 3FCTA 4JR9L 2QR0B 3NG5A 1DJYA 1O9ZA 1P5UC 1BFTA 4NHUA 4BFFA 5IFAH 2WTPA 1KC5L 3U6RA 3CFTA 3EBAA 4R97C 1VADB 5L6YH 4ZPTA 3EYUH 3G6AA 5C07A 1UM4H 5EU4A 1IJNA 1T1ZA 5HDWA 2XXCB 2RHEA 2MKLC 4OSUL 3TLRA 1I8LC 5FHBH 4I9XA 3V7AG 3VA2C 3UAJC 3UYPA 2VXSH 2GITA 3EO0B 4NEHB 5JHLH 1NGXB 4HULB 3QNFA 5KVGE 3K4DA 4TQHA 2WCPA 2V2XB 5DCCA 2DLTA 1PYWB 1B0IA 4LL1A 4CNIA 3PDDA 2AVGA 5JOPD 1KG0B 1FBIL 2WSKA 1EAPB 1KYUA 3QAZB 4RFOH 1MW1A 2JKNA 1KTDB 3B2DC 3TBWA 1FZJA 2UZIL 2XKSA 5DS8A 3F7LA 3QRGH 4U1MB 2MPVA 2OW6A 4YLCA 1EHLL 4GFTB 1XCWA 2UY7A 4QHNB 4ZUSB 3O3UN 4KZCA 5F6HI 5IVNA 3NIFE 5AW1B 1P69B 2VLLA 2VLLB 3ABZA 4M62L 4U6VH 1I75A 2QPFA 2J1ZA 2XZQL 1N3NA 4RAHA 1E5UI 1GZQB 1OPOA 1PS3A 5DJ2B 3ZMRA 1MIML 3ZDXE 2CGRH 4L3EB 2DQJL 4GO9A 3H56A 1SN2A 5B7EA 2J3SA 4D9QD 1MZZA 2IIJA 5K1JA 5EIIG 3U6XA 1JF6A 3UXFA 4AV4A 1JDDA 1AO7B 1TQCB 1FE8H 2B8OT 1OAZH 2ILLA 3UGUA 3WEXB 4L1TA 1EBPA 3OPZL 4EXKA 4Y5XB 1F45A 5HTSA 1ZD6A 3ARZA 3CZLA 5EUOE 3WEOA 1FL6A 4K3HA 1ZHKB 4Y5XC 3BP5B 3BSZL 3F8UB 2NUPA 4GAJH 4YBLC 1UEYA 3UTZB 1MCOL 3MLWH 4MQ7B 2R0KL 2K9FB 3ZDWA 4O9HH 3ALPA 4N0RA 3NQKA 4KGLA 2A6JA 2BC4B 4MCZA 1Q0EA 4IQHA 5E8DL 1CFTB 5HJBA 3V5DB 2WWOA 2ZOKA 2YS4A 1ZJAA 3PWLA 4JY5H 4QRSA 3TO4C 3H55A 3H2QA 2IH1A 3FULA 3V0HA 4I0PA 5JDJA 2DQUH 4H44C 5SWZB 3D52A 3G5VA 2NOYA 4B60A 5BVPH 2WQVA 4JPSA 1KY7A 4P59H 3MZGB 4NC1E 5D2NE 4B9ZA 1GAFL 4DO4A 1ZT7B 2IH9A 5EU6A 3MI6A 3O45A 5AL0A 5IGXH 3CZKA 2YSSA 2C4FU 3QAZC 3RVUC 4WKZA 3G9AB 3I6LE 3UC2A 5JHDB 5FW7A 1EDHA 3KAAA 2A77H 1M9WA 5IT2L 3LS4L 5JW5B 3PIQA 2O5ZH 5H4ZA 4CRPA 4Y19A 4LDCA 4C83B 3N9GL 35C8H 5F7NC 1KB5B 4WWKC 4PJBE 1NQBA 1AFVL 2P5WA 3KGRA 3ZKXB 3IDGA 1R3KB 4CBZA 3CN3A 5JQ6L 5CZXD 2A1WL 2KL6A 4R97B 4OZGF 4FQ1L 1MFBL 1W0YT 4ODTL 1KCUH 2VISA 3MLRH 1CYGA 4PJIF 1PKOA 2GFBA 3OPUA 4HKBB 1Q9LA 3L1EA 4M5ZH 3U4EB 1C5BH 5B1AB 4LCVA 1M3IA 2CGZA 4Z3FA 2XWCA 5DJCA 4IEFA 1RZ7H 1T2JA 3BFWA 4NWUL 4G8FA 1OCRB 3L8QA 4OZHF 5JORB 1WWBX 3BIBX 3U30C 1ZLDA 4JFOB 3ZTEA 5A1AA 2HTKD 2MQGA 1YEGH 4Z7UE 2ADFL 2J8UE 2WP3O 2EIEA 1PY0A 4L8CA 4YDMA 4WZ9A 3BUDA 1LD9A 4M3HA 3NFSH 4NQCA 1WT5A 3FO2B 4Z7WE 2V17L 4U1GB 3RPBA 4PW9A 4UM8B 1BZDA 1VENA 1N5YL 2QQLL 5DUBB 5G4OA 2QEJA 5H2BA 1HHGB 1CK0H 1R75A 3ECBB 3FZUD 1FSKB 4ZUTA 1R0AH 2AAAA 1IFHH 4KBPA 1L6ZA 3HPJA 3TNNB 3DO7A 2JB5H 4N2KA 3WFEH 1I1YB 3CX5J 1NGYA 3P4NB 2Q7AA 1SEBA 2IPTL 3VFPA 4UBDD 4KY1H 1QR1A 2GHZA 4AIOA 1RH8A 2A9NL 5GZNA 3T8MA 3X1EA 1KELH 2EXWD 5AFAA 2KDYA 4LAQL 5DEFA 4UDUA 3HE6D 3TEYA 1IBGH 5E70A 4KOBA 5C7XL 1CI5A 1SFDA 3K81A 3QORB 1S46A 2FH8A 2ZUYA 1N6QL 5JHDD 1R3IL 4JPKL 4KVNL 2CO4A 3MLZH 4JB9L 5LG1A 5E9DD 2DYRB 2HLEB 2YD8A 4PAZA 3KYMA 4JFDA 1CR9L 1RZFH 5I6OA 4OIIL 4AYID 4MMXC 3PNRB 4CC1A 4ZAKB 4PPTA 1HCFX 3K74B 1DQLL 4B6ZA 2PWGA 4V1DD 1JF5A 2UZYB 2ATPA 2WD0A 3CHXA 5GJSL 3KPRA 3O6FA 3SQOL 1JVLA 1JGDA 3S5LA 1W8NA 3ZYIA 3QXUA 2KMWA 1E9PA 3BCDA 1HILA 1HZHL 3F6LA 1AS6A 4HLEA 1FZOA 3FTGA 5ESQB 1HKLH 4JG1L 5I15H 4ZFOL 2CKNA 4PJAB 5CCHE 3FUKA 3TH4T 1K5NB 1AANA 2MTAA 4UDTB 1UM6L 1XGZA 4FQ2L 1MH5B 3N1MC 1I9RH 5K1NA 2E86A 4HPYL 4G3YL 1K8DA 4XXWA 4NQEE 4I8DA 4MS8C 4DGVL 4PWEA 1KB3A 4PM1A 5DYOB 4JM2C 5CHNB 3AQXA 4Y2OB 2WIMA 4A7VA 2XWBB 5E8OA 4GEIA 5F88A 3TBYB 2EIZB 3D18B 4N0CC 3QIWB 3TFKC 1LEGA 1MNUH 2UY7B 3AREA 3OJDB 3WSQL 2ODIA 3EOTH 1CYWA 4L1SA 4O5LH 2FRGP 3CDGA 3L6FB 3TWCH 4IBWA 3OB8A 4LSVH 2P8LA 5A3IC 1JGUH 4AZ8A 4LHJB 2KYIA 4FG0A 4JRYD 5HHXH 2B9BA 2BCKB 1U3HC 3LKNA 3HKFA 5F2FA 5IQMA 4XP1H 2ZOLA 4RESB 4Q4EA 5FA4A 4NKOA 1XF1A 4BEIA 4XCYB 1DQDH 1OAJA 5EN2B 5LGHL 3EDFA 5DFWH 2PYEE 2ZF9A 3RL2B 1J0HA 5BUGA 2NYZA 5EU3B 2E7BA 4W4OA 1T5KA 2NY3B 4BQ8A 3RFZB 4I18B 2LAAA 1F0LA 4LSRL 5DJZB 5ID0B 3FSAA 1MLCB 2VDOH 2O6FA 2XOTA 3LSOB 3DLQR 3VMNA 1A1OA 4YHLL 3UERA 4J12A 2CO7A 4WTZA 2WXKA 2V2WB 3LNGA 5I74C 1TMQA 3FU7A 5C09E 3CLEH 2WZPD 3WNKA 3CFEA 3NSDA 2WGNB 2J5LC 4KH2A 1GY2A 1JPGB 5MI0B 1O6SB 1AGBB 3D0LB 5EIIA 4TN9A 1NC2A 1S7UB 3UZVB 2CRYA 3LZOA 3BKYL 3BUTA 3LRMA 3OAWA 3FT4B 5KOVC 3Q6FB 4DKFH 1OF0A 1RZKL 1N68A 1LE9B 1S7VA 1QSFB 2E75C 4TNVF 4L2YA 2NNAA 1DYZA 4J3OG 4KJPC 3D0AA 5LAXB 3DX9A 3B8SA 1XCTB 2P5EE 4HPOH 4HALA 1AZNA 3D6GA 4FA7B 2AGJH 4I4WA 3IU4H 4IS6B 3T0EB 3AWEA 5KYYB 3JV0A 1BJ8A 4QAMB 4TUJA 2ZXGA 4Y9BA 5E5RB 1EAOA 3BUQA 3WJJC 3O4LD 4NENA 4G43B 2DOCA 4AXWB 2BSRB 2HX7A 5FYKL 3FUDA 3HLAB 2B2XH 5CU5A 2DD8H 1KN2L 4N8CL 5F9AC 3PY9A 1N7ML 3TA3B 3FZUC 4OTXH 3QFJB 4WHCA 1J8HB 3MR9A 3NCFB 4HXAL 1ZK5A 3P9MA 4ZK8A 2WYTA 5IKCA 5EO0B 1NFDB 1OGAB 1WF5A 2Q7NA 3OKNA 3OMAB 3T5WA 4C4BA 2WSPA 3VTTA 1MI5E 4A6YL 4YSQA 3KLDA 2OSLA 1WTLA 3H2PA 3N43B 3H3BC 3IFOB 4Q7DA 1E5CA 1GHFH 2H1PH 1KGWA 5IROC 1HT6A 1G7IB 4D0BB 2BCMA 4U1LA 1LWJA 1EPFA 1HIMH 1L9QA 2EE9A 2LR4A 3APMA 5F6IC 4U6XA 1IM9A 2OMYB 4MD5B 5J11B 5F3BB 3VI3F 5DD5L 4GNKB 2NY5L 2EH7H 3TVMC 3UMTA 1IEHA 1V5JA 3GJFB 1Q0YL 3CFNA 2UXFA 4PLKD 4RMQA 3W0WE 2ZSWA 4KROC 1FFNA 3JTTB 3MMEA 2AFNA 4QYOA 1JTOA 5I1IH 5D93C 4Z77B 3TBWB 5JTWA 3LZQA 4BCXA 3N42F 1U8NA 4K2UL 5HHVH 3OHMB 1PKQB 2CR0A 3LHPH 5FHAL 4D9QE 2YD5A 5DD1L 3WO4B 4YDIL 1CFVL 4NHCH 5I6KA 5C0CD 3HN5A 4KXZH 2XSKA 5FK9B 4TSCL 4KI5F 5C0DB 4KNUA 2ZUVA 1JD9A 1DVSA 4PCYA 3FONB 1RLWA 1UCBL 4W4OC 4RETB 3G08A 4G8GD 1KGUA 2X12A 4UT7L 1I8IA 1RL1A 2Q3XA 8FABB 4GI8A 4BH8A 4JZJA 3PWPA 2P5WB 1C08A 3NJGA 5EOQH 4K55A 1CB4A 2N3JA 4M93B 4QCIA 1CMOA 3RI5F 1V3LA 3SCMD 5KAQF 4IBYA 2IADB 1ONQA 5GZOD 1OW0C 1S3KL 4DKEL 2DLFH 4JDEB 3CN0A 1Z9PA 3AY4C 2R2EB 5SWZD 3EBGA 2QHRH 3FO9A 4K7PL 3WUZA 1ODUA 4KMTL 4JRWA 4YPGA 3TFKD 4KAQL 1OARH 1RMFL 2BWDA 4XMKH 4XC1H 3RZWA 2R69H 1A7NH 2OJEB 4HUUB 2JXMA 2ZKXA 3KDMA 3HC2A 3MRRB 2QPEB 3QS3A 4XCFL 2VDNL 1N59B 1XSJA 1YVLA 1GZHC 3QUHA 4JQVA 1SQMA 3KW7A 1UACH 3C8DA 2P47B 4H26A 4FA6A 3OHXB 4KUZH 3NGBB 4R2GC 2FH6A 3EJZC 3L7FA 4ZUWB 4FKKA 4HV8A 3WHXB 4PV9A 4CJ0A 3P0VL 3GK8L 5CM1A 3BPCB 5E24E 2HVJA 3K2UH 3QDJA 3EZJB 3T6VA 4DKTA 4DTGL 4I2XB 3DX8A 3P54A 1MAMH 4FEMA 2YAFA 3W57A 3V4UH 4HJGA 3WN6A 3NIFB 1IM3D 5D7JD 4GUPB 4GUPA 4Z7IA 1USZA 4WI2A 3ZE0F 1R3KA 1VFMA 5AENA 1YJDL 1A3ZA 2DMGA 4KKPA 1T66D 1QRNB 4NDMB 4N9OB 4Y4HB 4JVPA 4J3BA 4YHZL 1NMBH 2EVJA 1TEGA 2AJXL 1MY5A 2A4EA 4V33A 3S37X 5C0FB 1TJGH 2FSEA 4FERA 5F3FA 4GW1B 3I9GH 2VLJB 3MGOA 1HEZA 4ZXBC 4ZNEA 5JPNC 4Y5YA 2Y36L 3ARXA 3HZKB 4M6NH 1E40A 4ORGA 1UH4A 1AQDA 4ZSOB 2YPKB 4KKLD 5IUCA 3HB3D 2FLBT 3QNZA 1GKEA 1MZYA 2ICEC 1WS7A 4DGYL 1GYCA 1BP3B 1LJMA 1F11B 5ADOL 1CGTA 2ZNWA 1OTTD 4X9IA 4AK2A 1EEZA 3LIZH 2Y22A 1N0XL 1CBVH 3E2HC 1S5HB 5H37G 5HD8D 3H53A 3T65A 3C6LA 3KPNB 1CO1A 1CXHA 1A6ZA 4LAJH 5EC1B 4BM7A 1E8WA 1U8CA 1ZCRA 4M48H 4RIRB 4Z1PA 1HEHC 3SYCA 4UTAH 5LVEA 2R2HB 2DM2A 2H1XA 5SWZE 2CJUH 2JK5B 3ZQWA 3RDTA 3WDIA 3BQUD 1J8KA 1YYLH 2E9WA 1BZOA 2CPUA 5I6NA 4N24A 4X80H 5E6UB 2EIDA 4PIBA 3MXVL 1PAZA 4LOEA 1NOFA 1Y07A 3L3HB 4TULH 2P28B 3QWQB 4RFEB 1JZ6A 1A65A 3Q7JA 1NICA 5DHVH 4AW4A 4F2MB 4YVNA 3C8KB 3ARWA 4YUEH 3FUEA 1OE1A 1AY1L 3MJ7A 2AS5M 4L48A 4JZNB 2Z34A 3C6EA 4HKXA 3CSPA 1OZTG 4R7DA 3TN0D 1DVFA 2UXGA 3UDWA 4TNWK 2ICWI 1TQSA 3O3BA 5TQ0L 4DGUA 1YUHB 4N0FB 5EBLB 4DERA 1CLOL 5FM5M 2IDFA 4AWJC 4BQ6A 3I9PA 4YZFF 1RURH 3TBCA 3GMNA 2YEQA 5SV4A 5FYLD 1ZLWH 4LEOB 2FD6H 1D5MB 1MFVA 5FS5A 3PNWA 1P2CB 3TONA 2P8MA 3WNLA 2EUVA 3DHUA 3D12B 2C9UA 3F64A 4MA7L 3QDJE 3VFOB 1D9KA 1RUPH 3TT1H 3ZHKA 1H3PH 1DBMH 1NDGB 1Y1DA 3QUXB 3ARQA 5AVQB 1JD7A 4PUBL 1X9QA 4HGWA 3DRTB 3OWEA 4XODA 2VLJD 2ZOOA 4MXWL 4RFNB 1LK2B 3NJJA 4I3RL 4QJ5B 4I7ZC 4OFYD 5INCA 1WEJL 1PU0A 4J1UA 3NBNA 3WAJA 1UB5B 4JRYB 2J8UB 4ESKA 3P3TA 3PDOA 4F1ZA 3S2CA 1AKJD 1P4LB 3AREB 2X1QA 3QCVH 1ACYH 1CD8A 1DBJL 3ZR6A 5JUEH 2BSED 4ONHA 7TAAA 3AT0A 3QUML 3FO0H 2C3WA 4DCQB 3KWWA 3LQZB 3N2JA 4QTHA 5JLZA 4L3CB 3N42B 1SXBA 3WIFB 4OJFH 3ASOB 1C1EH 2O5XL 1BD2B 5J6SA 1TZIB 1TPXC 3BI9X 3SKNB 4M1DH 1CGSH 4FYTA 1TNNA 4PG9B 3O4LE 3ZT7A 2VC2H 3QEQD 2BWIA 2AJZA 3T2QA 3SDCB 3IETA 2ZJSH 3FJTA 1IM9D 2MCG1 4JM4L 2YKLH 3QUZB 3SYAA 3VFVB 1J0ZA 5E2UH 1MDTA 3EBIA 4ZFFB 5T5FL 4GG8A 2AQQA 1M4KA 4H1LH 4L8SC 4QO1B 5HHPB 1DVUA 1B90A 2XG5A 1U3NA 3BKCH 4GAFB 3B9KA 3MUGA 5IIEB 4AQOA 1T1WA 2OZ4H 1D7BA 2CIKB 4Y8AA 1AD9B 3EYSH 1J5DA 3SDCC 3ZYJA 3P4MB 1X4XA 2UZXB 1KYFA 5AKVA 5FOJA 1FVCB 2ZP8A 5T1MB 3S5ZA 1XGYH 4M8VA 1P5VA 5AW7B 1LEIA 5BV7H 1BVNT 2F1EA 2PO6C 3QIBD 3QZBA 4GRLC 2YD7A 1LK3H 3GSOA 4X5WB 3IDYC 4LSSH 4YEEA 1FNEA 2WLLB 4EDXB 3UTOA 5FYLL 4FI6A 1DBAH 4XVOA 5C0GB 2GABA 4HJIA 4EZLA 2F5BL 3AREC 4F91B 3X2QB 4G9DA 4HMDA 4ZTPL 1B0RB 3KD4A 5GSRA 3L3DA 1EZVY 1MRDL 3SKUD 5AL8A 4Y9CA 4EIBA 2DWXA 3WKMH 3F05A 3F85A 4XPHL 1TCRB 1KCWA 1B4JH 4Y7MA 2QLVB 2A73B 4IU2A 5KBMA 1KBGL 4XVTH 4HSQA 2UY6B 4KI5C 1P53A 2OFQA 2F54D 1UTDA 1T5WA 4PS3A 3C87A 4Z5RB 1DJWA 2YPVH 1F58H 4MNGA 4AI7A 4LHUD 1W8OA 3ATBA 4GG6B 5CINH 5IQLA 5FFLA 3V0IA 4NQDB 2XVLA 3ZL4H 2J88H 5CD3B 1KPVB 1KPVA 2O5YH 2OMVA 4XPHH 5A2FA 1W72B 3ZZQA 3EDDA 3W39B 1MWAB 2ESVB 3GRBA 5MEQA 1JN6A 2H3XC 2HVKB 2KKQA 3CAFA 3KG5A 4WGKA 1KTBA 2NX5E 4Z7QB 4FZ8L 3FTSA 4ZS6D 1UH2A 2I07A 1KGJA 1H3VA 1RHHB 1QSVA 2G60L 5I0WA 2QGBA 4UCFA 4QWWD 3MRQA 4IKIA 3MJ6A 1CL7L 4XVSH 2YZ8A 1TZ8A 3MZTA 4ZW3A 1SRDA 5AWNH 2VN4A 1NKOA 3UEZA 3GMQB 4MA3B 2CHNA 2J8HA 2W1NA 3FQNB 4ENED 5HYJD 1AHWC 4ICXA 2I69A 2BWQA 2QKSA 1P7QB 3C09C 1GZPA 4B9JA 3B2MA 2Q8AH 3LQMA 4U3HA 4MDRA 5AUMA 1WFIA 5B1BB 4XNDA 3MV8E 1A7RL 3U1QA 1CFSA 2GIXA 2OL3A 5D9SA 1CFSB 1H6UA 4DESA 2CJ3A 3CBKB 2V5TA 3I50L 4JFQA 1F13A 2VXQL 2CKBB 5B39B 1ADQL 1AI1L 2VZTA 3E2HB 3IRZA 3GUTA 4N2LA 1O9VA 1Y0LA 4O4YL 5DSCA 3L1GA 5E4AA 4E2OA 1TQTA 1NBVH 4PGEB 4M1DL 1BPLB 3KL3A 3MV9B 4ALAC 4TV3A 5HYJE 2DBJA 3UAJD 3BVWA 2CLRB 5EDXA 4HJEA 3W5NA 4OJDH 4U05A 4ES8A 1UFUA 5AOMA 2DWEB 2GK2A 4G8IB 1S9XB 4MXVF 3GTNA 4N87A 5D7LE 3O6FD 5JPNB 2VDPH 3FUNA 5I8KH 1QFWI 1XXDC 4HKZB 2UV3A 2P9RA 2YOCA 4ZO9A 1J11A 1NC4B 4FJ6A 3MBWA 2XQYG 3N1FC 3MNWA 3QFJE 2QVMA 4EOWL 2IFFH 1KB5L 4LVOC 5DK2A 5ILTL 4HIHB 5FO7A 4FN0A 4MCYA 1OGAE 4P4KD 5EMYA 1NLBH 2B4CH 2G2RA 3EFFA 1ZVHA 5GRJL 1QNZH 3LXCA 2GI0A 5BRQA 3HI5L 1J12A 2B77A 2XPZA 3HG3A 1M7IB 4ZTOL 5JIPA 2X4UA 4NFDA 4PGZA 1CU4H 3UJTL 4I5BB 5GZND 3MUUA 4PGJA 5F96L 2ZP0T 4NQCB 3GBNL 4GRWB 2D7NA 3OHXC 4JHAL 1RZGB 1KUMA 2XTLA 2YAOA 4K7PY 5F89B 4FLSA 1CN4A 4BUGA 4GFXA 1R46A 3EYVA 4K3DL 1BXAA 2YPVL 3G6DH 4J5VA 3LNFA 2K0RA 3HG4A 4P2QA 1SMDA 1PKQE 2Q87A 3VWKB 3INUL 4NIYE 4G80B 4PJFA 1KBGH 1QX1A 1HQ4B 2XWEA 3HHRB 3I6SA 3NTCL 2VLME 2BW4A 2F1BA 4Y1SA 5DZOA 1KTRL 3IVKA 1D9KD 5J6GB 3RE0A 2YSTA 4HKXB 2ZOLB 4NDMA 5B7FA 2SEBA 4OJYA 1I7RB 4X80L 5G4MA 3HI6H 2WKOA 4A7GA 4LGRB 4JDVA 2GAZA 1QO3B 2P5WE 3Q5YA 1G9MH 4AV0A 3U4KA 4FDWA 5E6ZA 2HKFH 4QO1A 5HHPA 4OFPA 3DI3B 5E4OA 4YLBA 3DARA 1F2QA 1ZA6A 3V6BR 1SF5A 1TTCA 4PRBB 4AEEA 1TO5A 1EEYB 3TCXA 3OV6A 1MCQA 3R4DA 4XCEB 4LL9A 3CFKA 1CD1B 4XP9H 3PAYA 5IMMA 4C56A 4DP1X 4PSRA 3T8XB 1D3CA 1KPRA 3DBSA 1AQHA 1UQSB 4FA8A 3W5MA 2VXVH 5CZKA 4QRQA 1VDGA 1S5HA 2OQJA 2XICA 1WHOA 2X4UB 4ZQKB 1FPTL 1MLBA 5KG9B 1A3LH 3V9CA 4X7CC 1TU2B 1QYGL 1XO8A 5FOBA 5D93B 4R8WH 3CUPA 4KROB 4Z7UA 2J8UA 4HFUH 4L1BA 2R23A 2MOVA 1K85A 4HWBL 3X3FH 3TVMB 1Y18B 3BZ4A 3N85H 2BVYA 2XWBA 4FF9A 2PCPB 1TTBA 2VC2L 4J8RA 2AXFB 2FQEA 2KPNA 3ARUA 4O02L 5F6IB 5J11C 3CCHA 4H40A 4GAGL 4HIIA 4H0IA 2IWEA 1BQLH 1SJMA 2ROYA 4X5XB 4X5XA 3H9SA 1MJUL 3DSFL 2P80A 4I2XE 3GLAA 4L9LA 4NRYB 3ZL2A 5HHOB 2W9DH 4BWUA 3QORA 1NSNL 4PJHB 3BZFA 1RZ8A 5L4FA 4G1EA 4YC2B 5I0ZA 4PP2B 1ACYL 1WFOA 3DETC 1RULH 2EECA 5IQ7H 4G82A 4HP5A 4YHKL 1MCCA 1X44A 5E5MA 3MKKA 3VFUA 5FAAA 2RCSL 3MV8A 5FW8A 4R4ND 2L8AA 3IT8D 5CZRA 5HDBB 3TS8A 1XF4A 3TA3C 3I6KA 2JJTA 1NCOA 5IVZB 43C9B 4JDZB 1JNLL 3LQAC 4PUBH 1WA1X 1AQ8A 4BHUA 4MA7H 4PRHA 2ARJB 4OLXL 4PCKA 4FTDA 3VMOA 3OKEB 3X3GH 2J6EH 3UYPB 4I87A 3DTXB 4UTBA 5AB2A 1BREA 5BMFH 2ZSVA 3AY2A 4QRUB 4XMKL 3UO8B 1G43A 2CHDA 2AABL 1OARL 2R1WA 1T7ZA 3F3HA 3FT2A 2DICA 5JOEA 5JO5A 1XGTA 3CLWA 3BLKA 1CTNA 2WM0A 5IVOA 2IXQB 5DS1A 4XB7A 3UCQA 5IBTL 1N2RA 3BXNB 4JO3L 4XTRD 1MCWM 1U21A 3O8XD 4TLSA 4GLRI 5EZPA 3ULUF 2UX6A 3HG1A 1AGDA 2UYLA 4OY9A 5FDWB 1WC7B 4N2BA 1P9MC 5GJTL 3RHWF 3WENA 3S34H 3LRSB 1EHNA 1QFWM 3KYOA 5ELIA 1LO3H 2H8PA 2VWEE 1BQUA 4KTEH 1SJVA 3UBXA 2JQZA 4K8RD 3C12A 3CTTA 4NS0A 4KH9A 5C0JA 3RJOA 2RAMA 2R2CA 3H7BA 2VSCA 3DMMB 3ULSA 5LGYA 5BJTA 4DGIL 4I18C 3EJTA 3RFZC 4TRPL 5EEVA 1BQSA 2AEWA 3EUDA 3T9WA 4ETQA 1B9KA 2PPAA 2BIPA 1YEHL 5AQ0A 4FD0A 2ZPKH 4YBHA 3RZCA 2Y4SA 4Y1AA 1FF5A 4KXBA 4NNYB 3IDXL 4FMVA 4PJAF 2A6KA 2OMXA 1U3HB 1W9XA 4MYPA 3VXQA 3MVSA 2W0FA 1K6QL 2EC9U 3PQYA 3X12A 1E42A 4JO2H 4MNQE 1PZSA 2QZQA 2NY5C 2WXOA 3QIWC 3I74A 1KXQA 1U95A 4IDLA 1E4KC 1H19A 2AI0L 4QXVA 4JFFA 4KVCH 5KYWB 4JM2B 4WW2A 3MRPB 4EN2A 2DWYA 2GTWB 2R9HD 4RX4A 4U6YA 5C08A 3GSUB 5AVWB 3WLWC 1C9SA 1GYAA 2PP9A 2FLRT 4HV8B 3WHXA 1S78C 3GGWA 3WKPA 4R26L 3PL6A 1SLUA 2WWMC 3MV9D 2VYRE 4H26B 1YEEH 3ATDA 2GEQA 4AE0A 4RDBA 2GY7B 1QUNA 5ANME 1UFGA 4P2YA 3K6IA 2VB5A 4K94H 2DYPB 3O41B 3BWSA 3L3IA 5GGVH 3ZX1A 3O2DA 4YX2L 2WXGA 4F9PA 3CLFH 4M8QA 1S7QA 3VI3E 3GSXA 2JJTC 2V9TA 3OQRA 3OL2A 2ZX6A 4ZAKC 2YXWA 2GSIA 4N2DA 2WV3A 4YXHL 2RD0A 2ZOUA 2BNQA 1P7QD 1NBYB 3LH2L 2NLJA 4NO2A 4TSAL 3ELAT 4PTTB 2H3NA 2DQTH 4KX8A 2WWKT 1ZHNB 4PJIA 4OR1A 3KBFA 4PGBA 2VR3A 2HT2D 4R5TA 1ETJA 3IJHA 4XHJC 5E56A 5T3XE 1M7DA 4ODSL 1NMAL 2NUPB 1MWAL 1D2PA 4FYRA 3B5HA 3UBHA 2VDNH 5HP5A 1NCNA 2ICWB 2NNCA 3ZRSA 4AENA 1MCWW 2N4IA 2G0KA 4KVPA 1EA9C 1XB6A 4S1QL 4CC4A 1O7DC 2Q2LA 3LOWA 3DPDA 3CLEL 3HE6A 4HWBA 4C58B 2CPCA 5CGYC 2DH3A 4HHAA 3GKWL 1ITCA 3EW3B 4KMTH 1KIUB 4MRBA 1FZOB 5CEYB 2QHRL 3TIDB 2EDTA 3NJFA 1BFOB 1TJIL 2K78A 4DUVA 5K59F 5C08E 3O2VL 5E9DE 3QULB 3S88L 2F0CA 4U1GC 2DQTL 1JNLH 3LEVH 1BLNB 3MV8D 3S37L 5BW7C 4KNQA 3A6BH 2J72A 2C3GA 2FYYA 4PJ7E 4XXDA 2DWDA 4WFHD 1JRHI 4FZEH 1MCFA 4FRWA 1MAKA 2V7HB 4JFZL 4R4BA 5CGTA 3ULAB 1VFBB 4YHKH 5IZ7A 5L7XL 2Z9TA 1TLMA 1RULL 1UCBH 1R5VB 3NN8A 1IC1A 2XWZA 1UKQA 3S35X 1NSNH 4YX2H 5DC0A 4Y4FA 4XMZA 5GGVL 1FFPA 3FQWA 3D39B 3M8OL 1EAQA 3RLSA 4FFWC 4DT2A 3POHA 3U0TB 2WBXA 3KBEA 2CO3A 1D5BB 1RVFL 1DBKH 4ODXA 4HMCA 1JRHH 1YNLL 1E9OA 1QPXA 3BSHA 5C0RH 1IQWH 4M1GL 4XMPL 1ZVSB 3ZKXC 1BHGA 4KRMB 4WWKB 4X6EA 4QUOA 4P2OC 5ESVB 3H42L 1OP9A 4LSQL 5DR5L 5AYUH 4AOFA 4PVNA 1N64L 2O6EA 2WO3B 2BHFA 5LKNA 1SLXA 1HHHB 2AZAA 2BOCA 1LD9B 1MF2H 1NUGA 1O9WA 3R4RA 3B2UD 3QDGE 5D1QD 5HVWA 3SZ6A 3DXAE 3N44F 4YHOH 1P1ZA 3GMLA 5C3TA 3K5SA 5C71A 4DGWC 2YMOA 2DIBA 5CEXB 4J3OF 2X6AA 4POZC 4QRFA 2AQ1A 4KXCA 5LNGA 4XNXH 4N8CH 1J9CT 3GTTA 2NDGA 3GUTB 1OAQH 2MPAL 3Q5TA 3S7GA 4DGIH 4HZAA 5DYFA 4YXKL 2GBVA 2QHLA 4KKQA 2C9QA 3TJHC 1V54B 1XAKA 3ULVE 4RRPM 4LGPB 1HSBA 3TO4B 5ACMA 3SE4A 4K8RL 4D0DA 2VKWA 4K15A 4RSVA 1NJ9B 3DJRA 3DK0A 4RMBA 4TPRH 3SKNA 1A6VH 5F1IA 5E00A 1XMWA 3QZWB 3CDZB 4PJEA 4YBLB 3TBTA 4GOSA 4AVJA 3VXTA 2WVTA 1TTAA 3MV9E 4EI6A 3VD3A 5BV7B 4KKNA 5SV3A 2CM5A 3D1MC 2FHFA 2LQRA 5TDOB 4DKFL 3B9AA 4Z7UF 5TDPA 1MFUA 4YXLH 4A55A 4HWEH 3BSZA 2FJGA 2YUZA 1O0VA 1EQWA 3BEVA 5D7LB 3TA3A 2QGEA 4AEFA 1FV1A 1RFDH 1YY9D 1CCZA 1TQCC 3NZ8B 1RUQL 1JVKA 1GJUA 5A6IA 1NBZA 4YHNB 3II3A 2W65B 2KS0A 2IDTA 3QJTB 1K8IB 4Y5VA 1QLRA 5CJ8A 3C6SB 4J2QA 2Q6WA 3VI4E 4W9KC 1CD1A 1Z9SA 4OLXH 4XWGL 1V7ML 4GIOA 3U46B 3PL6D 5GRJH 1UD8A 4PG2A 1X7SA 2GQHA 4CMMB 3TFBA 1DEEA 3JTSA 3V7AE 3DV4A 1G7MA 1IBBA 2L7QA 4OB5L 2I60L 4F7TA 1QZ1A 4YDVA 1RI8A 1U91A 1VPOL 1U91B 3SOBL 1UCTA 2DI9A 2XV2A 1S7RB 3ATFA 1Q4NX 3JZYA 4NLAA 3H3PL 1LE9A 1EZSA 1BIHA 2CXGA 5MEND 3ULVF 1PZAA 3KPSE 1Q94B 4A7GF 2NCMA 4ZMYA 4ZX3A 4FQPA 4LCCB 2PYEB 3CX5K 1K4CB 4WW1B 4XHJD 4Y19E 4XNYH 5EBMA 3BGMB 4A68A 4QHLA 1DEDA 4TVSa 5I2IB 4JZNA 3QZLA 4ZFQA 5JNYA 4MHHI 3D69B 2YA2A 3D3VE 1NBCA 4V2BA 4ZFOB 1G6VK 3FUJA 1FN4A 3ZGIA 1MN4A 4UU9B 3K2KA 2PCFA 4FFZA 3CDZA 2JKTM 1XR8A 1HAWA 1UEMA 4ZMXA 1XR8B 1GXEA 4DSYA 5HVHC 2LAGB 5CF3A 1UM6H 4M8RA 1NINA 3MACH 4R8WL 1P5UB 1G94A 5ITFB 2C9XA 5T3XD 1SXNA 2H32A 2X4NB 3FT3A 5GRUH 2KQNA 2WXQA 1MFDH 2MIZA 1A7RH 2NLJB 2W80C 3BAWA 2P5PA 2EUWA 2C7UB 2FO4B 2K6WA 3U1PA 1AOZA 4NKDA 3SCMB 3S88H 1YLBB 3LEXA 4LPYA 2VR6A 4JHVA 4P2QE 3S8GB 3QHFL 4L8SA 3ZE2E 2N7BA 4XOCA 1X7QA 5FF6B 2R7EA 2R7EB 2OMZB 4NGHH 1KFAL 5IBLC 3SDDC 4M61B 2AK4E 1EAPA 2ZWSA 4GYBA 3WNIA 1CTMA 4OIIH 4I0PB 5I5JA 4QRUA 3MHZA 3N55A 3DX7B 3Q9QA 4ADJA 3MTRA 1C16B 5I1JH 1NAMB 4ATTA 2AEQL 1X5FA 1YN7B 4A2HA 2E5EA 1YN7A 3GRWH 2VL4A 5EBWB 3GGWB 5JR1H 3PL6C 2XYBA 1IBGL 2R0LL 3FB8A 4AQ1C 4DCQA 3T0EA 1S7TA 1Y6MR 4P9HL 2PW2A 1IMHC 2VN7A 1V3JA 1KLFB 1BOGA 1G1OA 1F4YL 4YLQT 3J07A 2OJZL 3BDYH 3TJEH 1G7PB 2JB5L 4I0PD 1XCXA 3WEMA 5FYJU 3GT6A 3QFJA 2HT4C 2YWYA 1R0AL 4AYFB 3U4BH 2W94A 3EOYG 3C08L 2BVOA 4P3WA 2V17H 2FTAA 2A9CA 3AJ7A 4TNWF 5HDLA 1CE6B 3CSTA 4WTQA 2EIBA 5FM5O 5D4IA 2PXYC 4HK0A 1KBBA 3L45A 3QH3A 3QQ3A 3VYPA 4FCHA 5GSVA 1XF2A 3LPGA 5GSVB 2RH0A 2G3NA 5HDBE 3B5TA 4X7TB 2MNWA 5CSZB 4X5WA 4OD3H 1RZ7L 3EOAB 1XAUA 1XCQB 1NIBA 3CJJA 4UAHA 5BV7L 3UYRL 5E6IA 4Z9KB 2XN9B 3B6SB 5J7CC 4G70B 5DZVA 3TIDA 5L8KB 2IFFL 4GRMA 4HJ0C 1EHXA 3V6OC 4PBDA 1U2CA 3BXNA 5DFVD 2EIKB 1JPTL 3CZSA 1AFVH 1OHQA 2BK8A 1PEZA 4BSWA 4U1NB 1XH3A 3CXDL 4U1NA 1TQUA 1JGVH 1JK8A 4NO3A 5AVXB 5J1AB 2W9EH 5F44A 4WI5A 5DYOA 1W15A 3U7AA 1UUNA 4LESA 4NCC1 2ED7A 4KROD 2BOBB 5F0JB 4B5ZA 1VEPA 5AW8B 1MFCH 3X1BA 3EHBD 4GMSH 2ZKHL 2R15A 2D0HA 1ADQH 3V5HB 4EI0A 5FFOA 3I50H 4Z7AA 1XF5A 2BVEA 3HFMH 1X5JA 1KCKA 5KVEE 1GTNA 5E7FA 1E28A 1QFHA 4ELKB 2CRZA 1NDMA 4WEMB 2FWOA 4JO3H 1J5CA 4F58L 1CGUA 4X7TA 5D71L 4OZIE 4DNLA 2I24N 3SDYL 4NNPL 3CMOH 4KK6C 1GH7A 3EOAA 4P57B 4G59C 1SGKA 4JY5L 3S8FB 4WEUD 3EHBB 4LFHD 4ANUA 5E8DH 2D7QA 3QEGH 5AWNL 1D9KB 4G7YL 2DMHA 1ZXQA 4OKVB 3P2DA 4XR8C 2E7MA 3T3PE 3TGXA 3VD2A 1KGXA 3NIDE 1SJXA 3I75B 3Q3GB 4FMFA 2YD6A 1HHIA 1TZHA 3KL0A 4UQ2B 5DFAA 4LBAA 4OD2A 5ENWA 2C1PA 1P7KA 3ZQXA 4ZXBD 4F92B 2NW3A 2VGLM 3O45B 2GUYA 3QFGA 4QXTB 2I5YH 3HN3A 5J56B 4ABVA 1CLVA 1QRNE 1FZKB 2J4WH 1ES0B 4KK9D 1MVUA 4D8OA 1ZMYA 1NPNA 5E8EB 2FEEI 4MDJA 4JFXB 3QAQA 4JY6A 3CPLA 5IQ7L 3VG0H 1X5ZA 4QRPB 3V10A 1BD2A 4GP8B 1LNUA 4MB5A 3NEEA 3HZYB 3FU5A 4Y4FB 4FHBD 1CGYA 5LG6A 3T77B 1KLGB 4JN2B 3QEHB 2FX9L 1IT9L 3P4OB 1NBYA 3MFFB 3DO3A 3QXAB 3UGXA 4ZMWA 4D2NA 3L3JA 2OK0L 1CT8B 4YNYA 2A5UA 3I6GA 3MYJB 3S97C 5SWSA 2IANA 1LYQA 2HKAA 3D08A 4NUJA 1NFKA 3U6RB 2GAZB 2CJUL 5I1AA 1S5IL 3GSNL 5D5ME 4GUOA 3ULVL 1DBAL 3C6LD 5BVJA 4BZYA 4XOAA 1S7WB 4PJ9C 5ALBL 3UTTA 2HRLA 1NBZB 1NUNB 1LK3L 5JHLL 4K4KA 1CFNA 3BEWA 2VR9A 1N0XH 3FCUB 2ZG2A 3DVFA 4LPCA 2QV2A 4P2RB 3QUXA 4KJQC 2CZNA 4BZ2A 3D39D 2W0PA 5D4JA 4ZUUB 5LDUA 5AD0B 4F2ME 3Q43A 1UM4L 4KDWA 4CAGA 3OMZA 2WGXA 4FQXA 5IBUG 4Z3TA 1S6NA 2DQIH 3BKCL 3T1FB 3GSOB 4Y2DC 1U8JA 5F71A 2VLRD 4JFTA 2QKIC 1L3WA 3QDHA 3DX0A 5EZIH 3TV3L 2WTRB 2FJHA 1Q9WA 4MWFA 3SE9L 3BKMH 2PYEA 3ATEA 4UTBH 1Y6KR 5M94B 3JV4A 1MXDA 1FL5A 2VW7A 1S7SB 3BGMA 3JWDH 5HYSG 1A4KB 3RTQB 4B0MB 1N18A 4P3DA 2NY1B 3EJZD 2ZF8A 5FGCE 4MAZA 4M7JL 1BVOA 4G1EB 5AW2B 2A4ZA 1G5GA 4XO4A 3VFVA 5KYXA 1OGAD 3GRGA 5AW0B 2N0KA 3ZKQD 4HH9A 3EGDA 4NKMA 1C12A 2HFFA 4IRSC 2F7QA 4PV8A 3HPLA 5FWQA 2PABA 3HPLB 4IOFC 3RIAF 3DXAA 5DRWB 1QHOA 4MGXA 4HOZA 5AB1A 3AU0A 4JRYE 1YEKH 2YBRA 5DO2C 5BZDB 3HNVL 43CAA 1M42A 2W65A 3L16A 3RVVD 2EEAA 3Q6GL 5HHME 5BRZD 2YUWA 4G72B 3SD5A 3WY4A 5C0AA 5FEBA 2W0LA 4AW7A 5C0AB 1G5AA 2FJSA 1HH6B 2B59B 4BYHA 2UX7A 4BWTA 5IJBC 1NM4A 4NSKB 3CC1A 2BNUB 4I48B 4U1IA 5FYJL 3AU1B 3GHPA 3OKOA 2DJSA 2R1WB 4XB3A 3RGVC 5ES4B 5BZZA 3BRFA 3ZTNL 2G3MA 1M6OB 2GW5A 3H85A 1DQKA 1MHPH 1WV7T 3DX6B 4K7PH 5IW1B 4YFLF 2XN2A 4YHMH 3BLPX 3QC5X 4NFBA 4OGXL 4YR6A 3U9PH 3QDGD 2ITEA 2CHZA 4F7CA 2QT6A 4D0DB 3ZXAC 4FP8L 4WRLA 4ZJ9A 3P4LA 3N0PB 2CUIA 3U0PA 1URZA 1FO0B 3BHBB 1MJJB 3TH2T 1P84K 4Q4IA 3WNNA 3FONA 3ULUE 2FX7H 1FFOB 4PGDB 4LL4A 1NCDL 1NBVL 1RQ5A 4LKXA 1YEFH 4ZDHA 1FCCA 2I85A 2H47C 5GS0C 4ANXA 1X5IA 1R5IA 5J06A 5F1KC 2LTQB 3QJUB 1OM3L 2IAMC 1LQBC 3QFDB 4HW6A 3WXVH 1OPGL 1DJXA 3L17A 1QEWA 2MCAA 3EDJA 5TH2A 1T0MB 2ED6A 1JYWA 3R18A 4M61A 4XBMA 1IM9B 3IXAB 1J5OH 2H9GA 4K9EH 4QPEA 3ARRA 3PABB 4U1LB 3HS0C 1HH6A 3GZKA 1VEOA 2LABA 2B7DT 4F33B 2AKRB 2VLRB 5JXAL 1ETZB 2A83A 2BNRB 2Y36H 3QIBC 3VCLB 4MNGE 5LBSL 4HDIA 2R27A 1JXFA 5F0MB 1DQQB 5KSVA 1BD2D 2PW1B 2HG5B 1DANT 3LDBB 3D7PA 2NZ9C 2WVUA 1QSEB 4G9DB 4HF5H 4NPYA 2VAJA 5HYSB 3WE1A 4AJWA 3QDMB 4M9PA 1HL4A 2ESVE 1IEAA 1DFBH 4HQQH 4ZOBA 3K71B 3LTVA 5J1AA 3PJSB 2ZXQA 4Z7QE 1SXAA 4WK4B 2MOGA 5DGRA 4AZUA 1FN4B 1I8LA 1BMGA 2JIXB 4Q8BA 4ZS7L 3RNKB 2IALA 4OZ4B 3F7RA 3AS2A 4WHYH 3U7WH 4Y19B 1RZIB 3M7FB 5CINL 1X6NA 2R56H 3DURB 2QPUA 4OLEA 2HFTA 5EEZA 4Y4HA 3P02A 3H3KA 2AGJL 2LLGA 3QJFB 2IPKA 1ZT4B 2FL5A 3QNYB 4ZYKB 2H6PB 1RIHL 4ZYKA 2VE6A 1MRDH 2FT7A 1Q72H 3VACA 2DB8A 2YOAA 2OAAA 1T20B 5EU5B 4HBCH 1TVHA 5DT1H 4EIGB 3BAJA 3VX0A 1XF2B 1KT2A 5IHUH 3ZKMC 3KH4A 5C0NC 3VW3H 4GXVH 3HC4L 4LPXA 2K4AA 3V8CA 4IIQB 4CBPA 1NFIB 4XAWH 1KJVA 1I8UA 3PQYE 4JO4H 4JY4B 3T8XA 5AZEL 1CVRA 2PNDA 3SKOB 4WNSA 3VXSA 1MREH 5KBNC 2MTPA 1FC1A 4NZRH 4WTWA 2WQUA 1XD0A 4IOSA 5JIKA 3T65B 1A9BB 4LNRB 3K91A 3CN1A 4JHWH 1WCBA 4QD2E 1MCDA 2AK4B 2BO0A 1IKNA 4HS3B 1EXHA 4LMQE 5IHHA 3QEQB 2MQCA 2LE9A 4LLYB 4CJ1A 4GBXB 1BF8A 1XV8A 1MCBA 3CVIL 5C97A 3V0JA 5BRPA 4UT7H 4GKNA 4EKJA 2BRRH 3P0GB 3BP6B 5B8CC 1A1NB 1UWEH 1BAWA 4JM4H 3HAEG 3PP3H 4CMHB 4B9IA 3MCLH 4M02A 4BD4A 2ICWJ 3GMOB 1LO4L 2WLHA 1AS7A 3W2DH 3TPUB 4BQBA 3MC0A 1FVEB 5FV1L 1CJYA 1FDLH 5K9JH 1MNUL 1GMEA 1NWOA 4K2UH 3N40P 2HWZL 2WINB 2WKOF 3C60B 3NEOA 5J9PA 2X44D 4DP6X 3ASNB 3L3KA 3S3PA 5ERWB 4UQ9A 4E9TA 5C2BH 3CMGA 3P1VA 5FO9B 2J7LA 5E08H 4JUTA 4HCGA 4BDVB 4FQ2H 2VZOA 3VFRA 3PWVA 4D9RD 5I1GL 1A6WL 4WI7A 2GYSA 4W9IC 3WE6A 5ICYA 5IHZA 1AZUA 5G5DB 2ARWA 5BQ7A 5JW3H 5C08D 4ODBD 4I3RH 5K9KA 3UPRB 2PTUA 2F61A 1M05B 3BKJH 4CU8A 3MRJA 4JAMA 3FU7B 4J3TA 1HQRB 1C5DA 4LSPL 2L3BA 1FYTD 1CE1H 4NYLB 2O6PA 4OM0H 3N91A 2ZWNA 3VGGA 3HMWH 2O5NA 3ARDC 2NSMA 1KTJA 1S9WA 3FU0A 3L4XA 3RDTC 4YK4C 3FCBA 3D07A 3NUKA 4NAMA 3VXNB 3FBKA 1MFEH 5G4NA 4BCYA 3NYKA 4MD5A 2VUYA 4YSAA 4WGWB 3EYQC 3WFBH 4X8XA 3IMTA 5BXFB 2D7TH 3TIEB 2R2HA 2AQNA 1NAMA 4YHYB 4PJIE 3S9DB 3UAAA 1DQVA 3LXUX 1HI6A 2QBWA 4HUNB 5IESL 1RZJC 2PCPA 4J8RB 3NVQA 5FYKH 1E4HA 3FUIA 2CSPA 1MVFA 2F7RA 4FNSA 4BA0A 4KTGA 1M2OA 2H0FA 5DJ0A 1IARB 4DPCX 1VGKA 1PZ2A 4NQTA 1JPFB 2EDMA 12E8H 4LEBA 5FUOH 2R2BB 4QXUL 1NAMH 2A74C 2HX8A 2JQMA 5D8JH 2YEZB 2W9LA 3JWNC 3L3OC 1IBDA 3ARGC 1A5FL 2W38A 3BE1H 4HPOL 3U48A 4NQSB 5FUCE 4OF6A 4P9ML 3L3JB 3STLA 1AGEA 2X4TB 4A38A 1FL3B 4XP4L 1N0LB 3E38A 2ZUQC 4JMXA 4BV1A 3MREB 5KBLA 3D2UB 1XH1A 2BW5A 2DL2A 4GT0A 5DI8B 2EXTA 1JXJA 1WWAX 3HB3B 2ZUSA 3UTZA 1MKFA 3DSNB 3IGAB 4YHNA 1G0YR 2K4WA 4OM0L 2I9TA 3SQRA 3O6FB 1SM3H 2F08A 3WS6A 1YEGL 2Z8VC 4HZLB 1RIVL 2OXHA 4QHKJ 5FF6A 2I32A 5F6HJ 4E68A 3VGHA 1MELA 3FN9A 1LK2A 1KYOK 5EA0L 1ACCA 2PTVA 5I8EB 2W0FB 3O11B 5CCKL 4HGWB 5KYNA 2VQ1B 4YHIA 2VN6A 2QFPA 2MHAA 1OCZB 5HHOE 1SYVA 4CSTA 1WJ3A 3NOIA 1MFBH 4C4KO 2PO6D 3KEDA 3T08A 4YR6B 1DANU 3LZLA 3V4PH 3PGCA 1AMXA 2FK9A 2EDXA 4G6ML 5DQ9B 2OW7A 5CU9A 2VR4A 4QDGA 4TMPA 1K3ZA 2YJQA 2VH5H 2N0MA 1CF1A 5GZOC 3D69A 1VGKB 4Q6IA 3LVEA 2IGFH 5D6DA 1WBZB 35C8L 2D31A 4BXSV 1AZRA 1DJHA 3D30A 3WSQH 2QQQA 2QSCH 2HJLB 2XA8L 3C60D 3I02B 4YH6A 3UTTD 4NM8L 1A7QH 2VDKL 4DW2H 5IT2H 4D8PB 2JH2A 1URIA 2YD2A 3VQLA 4MB4A 2Y6TE 3OLGA 1XIWD 1L9NA 2VUOA 3SDXB 3LXBA 3C75A 4ZW8A 1A3RH 1YSOA 5BO1H 4NLHA 2IGLA 4QCIB 1HZHH 2CNYA 4U4BA 2O1AA 1DVZA 4FQHB 4NZRL 3S48A 4FQHA 1CC3A 3S36H 3R8QA 3TA3D 3MNDA 1SZNA 4FFYH 5K9QI 3Q8BA 1M7DB 3X12B 3PWNB 1G7MB 3GXFA 3A24A 2OMZA 3FBQA 3OKEA 1JWUA 1UJ3B 3M7OA 4XPBH 1SOSA 3VRJB 5A6LA 5DT1L 3HJEA 4BFKA 4EUPG 4G6FD 3NPZB 4XCFH 3RWEB 1XSKA 1W72H 1DDTA 4Z7WF 3LD8C 1RAMA 1BFVH 3Q1SL 1UKSA 4XC1L 1IZKA 3V0GA 4IMKC 4UQ3B 3FAWA 3MCKB 1T22A 5KVDE 4JG5A 2F15A 2JF1A 3X11B 4WWKD 3C5SA 2BH0A 1FG9C 2EYTA 4RGMB 2FAUA 1INQA 1OSPH 3L3DB 4QXTA 1QSFD 3A67H 4K3JL 1T5XA 2Y07L 3C2SA 4F3FA 2VMCA 2DMKA 4PJFE 5L2KA 3MOAH 3O9WA 2Y6SD 3V95A 1T04A 2N7SA 3CU7A 4UU9A 2V2TA 1DCEA 3KYOB 1SUJA 3VMPA 1TT6A 2Y72A 3FRUA 3V7MA 1MIMH 1SHSA 1NEZB 1DFBL 2BVTA 4KK9C 3N3EA 3DRQA 4S1DD 5JHLA 3TBVB 3TO2B 4P2QD 4XNZC 1U3ZA 3QPQD 3U36B 5F8QC 2BXYA 2DBLL 3BISA 2FVNA 3TF4A 1E4WL 4X8JB 1NCWH 3BAXA 1B0GB 2G75A 3W11C 2YK1H 1LO2H 2FWOB 1OQXA 2LV4A 3KM2A 4A1RA 4NN7B 1AS8A 1GGYA 2CCLA 8CGTA 5ETUB 4U49A 1IU1A 1FGNH 5IJCC 1G6RB 2D03H 4NUJB 1B3IA 4WWNA 5K33A 2X28A 2X9ZA 4WCYH 1J88A 5I71C 4WU7B 2HFGH 2ZOKB 3VXQB 1VLXA 3P77B 1HYSD 4JY4A 4KK5C 4JFVA 4MXQC 4PRID 2OYLA 3PUCA 3WJLC 2VO8A 1OE2A 2D8KA 1INEH 3EH5B 1SVZA 1FFQA 4MKMA 2XXMB 3G5ZB 4N6QA 4UMSA 3QCUL 1W80A 3ARSA 3IJEA 3LKSA 4MNHA 1MRCL 4IJTA 3COOA 3I3BA 2Y9RT 1UXSA 4MMYA 4FG2A 4ELMF 4XI5D 3ZSSA 4MJ5A 4R4FL 3VI3B 4P4KA 5IY5B 2B1AH 4F5CE 4XGZA 2FYYB 2GVYA 1AHMA 2C9RA 5KVEH 2WJ5A 1TSHA 3SJVD 4NPYB 3HBPA 3UL4A 2ORBH 1UB5A 3CQQA 1QFOA 3W81A 4PGEA 5IG7B 4WWID 3PAUA 2FX7L 4LK4A 3M6DA 4A7SA 1J0YA 2Y06L 2HKHL 3RU8H 3AB0B