1TOEA

Unliganded structure of hexamutant + a293d mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 140
structure length 395
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1toeA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1toeA01
1W23A 3BCAA 1PG8A 4JE5A 3DR7A 1N8PA 3OKSA 4XQ2A 2R2NA 4AZKA 8AATA 1GCKA 5EAVA 3HLMA 2W7JA 2DKJA 5D95A 3CQ5A 2VGTA 4IX8A 5EIGA 1YOOA 2VGZA 1S08A 1ELQA 2ZUKA 4W91A 4F5IA 1S09A 3LVMA 2G6WA 1BQDA 1AHFA 5FT4A 2JISA 4ZWMA 2X5DA 3JU7A 1DJ9A 1ZODA 1MDOA 3FFHA 3K28A 3KE3A 1KMJA 1AHGA 3UE8A 3TFTA 3NTJA 2OATA 4B98A 2EO5A 3P6KA 4XEWA 1BJ4A 1OHVA 2ZC0A 2QB2A 1LS3A 2BIEA 1Z3ZA 5JAYA 1I43A 1ARIA 3P1TA 1BJWA 1DJUA 3DRDA 3RCHB 2YKYA 3EI7A 4IW7A 2RFVA 2TPLA 1B4XA 4GDYA 1C7NA 1D7VA 1PMMA 1SZSA 2BWPA 2ZJGA 2D7YA 4TN4A 3VK2A 3A9XA 1MLYA 1M0QA 4TMRA 3EI9A 4M2KA 2D64A 1ASFA 2X3LA 4OCAA 1AY4A 1CQ8A 3WLXA 2CANA 1W7MA 4ZLVA 2EZ2A 2V0YA 1GEXA 1IBJA 1XEYA 1X29A 3FZ6A 1AHYA 3HVYA 3MAFB 3RUYA 1D7RA 3TQXA 3BWNC 1SF2A 3GBXA 4UHOA 1AHXA 3LVLB 2R5CA 5EFSA 4BA5A 1UKJA 3ACZA 4IYOB 2YKVA 1MGVA 2DOUA 3E2FA 4ITXA 4WLHA 4A6RA 2JJGA 2YKXA 2C81A 4WXFA 4WYCA 1WYTB 3I5TA 2C44A 3LG0A 3E9KA 4J8LA 3PDBB 4P7YA 4E1OA 1AHEA 1KL1A 2CINA 2BYJA 1UU2A 2WK7A 4WXBA 4JEYA 4GRXA 1W7NA 1G4VA 2AY3A 2VGWA 2VMUA 3B1CA 3DC1A 1QJ5A 1ARSA 1N2TA 1S06A 1SVVA 2Z9XA 2QMAA 3GZDA 1MDXA 4OBUA 3FRKA 4R2NA 4RKCA 1W3UA 4ZDLA 1GD9A 2VMWA 3ZRRA 4WB0A 2VLFA 1OHYA 2OKJA 1AAWA 1WYUB 1V2EA 5TF5A 4F5KA 2WKAA 3FQ8A 1ARTA 3BC8A 1ORDA 2HOZA 3BWNA 2O7CA 3DZZA 4WYEA 1C7OA 5M4DA 2Z9WA 1LC7A 3T32A 2DGMA 3LV2A 1BJOA 1TARA 2O0RA 3FD0A 4FFCA 3NNKA 3G8MA 4MQRA 4XJMA 3AENA 1C7GA 1CL1A 4IY7A 2CJGA 4PVFA 2VMXA 1KL2A 2E7UA 1AJSB 3GETA 4DQ6A 3FQAA 1MAQA 4WYGA 1X2AA 2BKWA 2ZY3A 3FVXA 3E77A 4RJYA 3ZRQA 4JEVA 4K2BA 3H14A 1JS3A 3HMUA 4RITA 3VK4A 1MAPA 1B9HA 2Q7WA 3TCMA 3FVSA 2VMTA 5G2PA 4U1TA 2EH6A 2CB1A 3CBFA 3G0TA 1TOJA 3BV0A 1GC3A 2C0RA 3RBLA 3JWAA 4EMYA 1CQ7A 3FQ7A 1UU0A 1VJOA 4ISYA 2CFBA 4W1WA 3B1DA 1JG8A 1W7LA 1SFFA 3VAXA 1DGEA 1RV3A 3D6KA 3GSBA 2O1BA 1AJRA 5EUNA 2AY1A 5E4ZA 3WKSA 4E77A 1OHWA 1VEFA 4MSOA 3PD6A 4CXQA 3FDDA 4IXSA 3MC6C 2HP1A 3E2ZA 3USFA 1C4KA 4U2HA 2ZY2A 1X28A 5EIGB 4DGTA 3BN1A 3MKJA 4ATQA 1QZ9A 3DXWA 3DYDA 3COGA 1YJSA 1SZKA 3GJUA 2VMYA 3QGUA 2W7HA 2ZY4A 3NYSA 2HOYA 3PGYA 3CQ6A 1GDEA 2FN6A 1M7YA 3DXVA 2D7ZA 2HP2A 3W1IA 1LK9A 1MLZA 1Y4IA 1E5FA 2XH1A 1TASA 2CTZA 3EI5A 1ASDA 3LWSA 4FL0A 5F8VA 5C6UA 2HORA 3ASBA 4A6UA 3ELEA 2FQ6A 3AATA 1B8GA 3QBOA 2PB2A 3WZFA 2VI9A 3NU7A 5DJ9A 5DB5A 4A0HA 2VMQA 3OP7A 4E3QA 2VMNA 4OYTA 3B46A 3F9TA 4XAUA 2D66A 3EIAA 3MEBA 3I4JA 3VK3A 4AOAA 5J8QA 1UU1A 4WP0A 2AEUA 3HBXA 4CXRA 3MAUA 4Q31A 4ZAHA 1FG3A 3W1JA 4MKJA 1BKGA 2R5CB 2W8VA 1AKBA 1IVRA 2AY6A 1I41A 1AMSA 3PIUA 5G4IA 4BA4A 5E3KA 1B5OA 2W7GA 2VMRA 3LVJA 2D65A 1DJEA 2AY8A 4CVQA 1U08A 4Y0IA 3WGCA 2ZYJA 1EJIA 3LY1A 1AKAA 4IXOA 4ADCA 2GMSA 1IAYA 1JS6A 2EGYA 3N75A 2QBTA 2PB0A 3G7QA 3AEMC 4MGRA 4MQPA 1AIBA 3JTXA 2Z61A 5EQCA 4LNJA 4JEXA 1TOKA 2OGAA 1AMQA 1IUGA 4GEBA 4OMAA 4WYDA 4AO9A 3R9AA 4WB0B 3L8AA 3E6GA 4EB5A 1O61A 1WYVA 2HOXA 1WKHA 4WYAA 3VOMA 4BQ0A 4TV7A 4GE9A 3FFRA 2ZP7A 1RV4A 2X8UA 2JJHA 2OQXA 3DU4A 1BJOB 4WBTA 1IJIA 1H0CA 1S07A 1AICA 2AY4A 3AEJC 3AENB 4J5UA 4JEZA 3PJ0A 5F9SA 3BCXA 3FZ7A 2Z9UA 4F5GA 2BI2A 4IXZA 3F0HA 1D7SA 1M32A 2DGLA 4RM1A 4ZM3A 1ASAA 1WSTA 1V2FA 3CAIA 4ITGA 5FT5A 3TATA 1V72A 2AY7A 2X5FA 5EUEA 3MADA 3JWBA 3A9YA 2D63A 5FT6A 4AZJA 1YIYA 1ASLA 3NYUA 4ATPA 3NDNA 3AEOA 2V1PA 1WKGA 3F6TA 7AATA 3JW9A 2YRRA 3HDOA 4UOYA 4BMKA 4OTLA 3FZ8A 2VGVA 3ZZJA 2VLHA 4UHMA 1N31A 1YAAA 3A9ZA 5G0AA 2VMSA 5E5IA 1YJYA 1CZCA 4JEWA 4A00A 1YJZA 1DKAA 1ELUA 1J32A 1V2DA 3JZLA 4H51A 2BWOA 4E3RA 4A72A 3PD6B 3WCOA 4PIWA 1CS1A 1G7WA 1AKCA 2VMOA 4W5KA 5I92A 3FVUA 2W7EA 3H7FA 2VIBA 3E2ZB 4F4EA 4UHNA 3AOWA 3A8UX 2Z9VA 1TOGA 1GC2A 4B9BA 4ZM4A 2JJFA 2AY9A 4A0FA 3B8XA 1QGNA 4JE5D 1TPLA 2W8TA 2BWNA 4RJ0A 5AX8A 1VP4A 1ASGA 1H1CA 4WD2A 2W7FA 4Q75A 1TATA 5IWQA 4F5FA 3KGXA 4N0BA 5G4JA 5HXXA 5LH9A 2WK8A 2YCPA 2Z67A 1ARHA 3WGBA 4ZDPA 5M4BA 4GE4A 2BIGA 1M6SA 3WKRA 4RIZA 2FNUA 4ADBA 4ADDA 3UWCA 1I48A 1XI9A 2GQNA 4K2IA 4ZDOA 3PPLA 2HUIA 2QLRA 2AY2A 4P3MA 4UQVA 2BI9A 2YCTA 3EIBA 5BJ3A 4KYOA 2R5EA 3BWOA 3RBFA 2W7DA 3N5MA 2ZSLA 2W7MA 5FT8A 1M4NA 5G09A 1M0PA 1B5PA 4Q76A 4OT8A 4WXGA 1G7XA 2HUUA 1RVUA 3QHXA 3MC6A 3E2YA 1AY8A 2BI5A 2ORDA 1O69A 3NUIA 1ZOBA 3MBBA 4M2MA 3IHJA 1J04A 4HF8A 2W8WA 1LW5A 1CL2A 2GMUA 4LW4A 4KXKA 4RKDA 4RLGA 2CH2A 1B9IA 4Q6RA 5HHYA 1TOIA 5K8BA 1MDZA 2W7KA 2CY8A 1S0AA 3QN6A 3ZRPA 3EI6A 1EQBA 4XJOA 4A0RA 4RAEA 3AELA 4PFNA 4W8IA 3AV7A 5EUDA 3FDBA 3FKDA 4MKKA 2W7LA 1E5EA 4WLJA 4ZSWA 1M0NA 3N0LA 3EUCA 2BI1A 2D61A 2JG2A 1BJNA 1I29A 3HT4A 1ASNA 3II0A 2BHXA 3GZDC 3KKIA 2W7IA 3WY7A 1ASMA 2EZ1A 3DODA 2E7JA 3UAKA 2VMVA 2YOBA 2YRIA 2EPJA 3IF2A 2VMZA 1WYVB 1CJ0A 1OXOA 3M5UA 4XK1A 3W1HA 5EAAA 1D7UA 3RCHA 4JF1A 2FNIA 1O4SA 3R4TA 2XBNA 3L44A 1PMOA 4EFFA 4OC9A 4Y0DA 2AEVA 1EG5A 4HVKA 1YNUA 4PFFA 4N0WA 3ATHA 4A6TA 1ASCA 1C9CA 2BIAA 4XJPA 2ZY5A 2YKUA 1DGDA 3ASAA 4R8DA 1QIRA 4AH3A 1KKPA 1TOEA 3KGWA 3PA9A 1AAMA 1IX6A 1GEYA 2Z1YA 1ASBA 4F5LA 4LNMA 1KKJA 3MAFA 1ASEA 4R5FA 3TFUA 1RVYA 3AEPA 3EZ1A 4XJLA 2GSAA 1P3WA 1YIZA 3K7YA 4LW2A 2BYLA 3PAAA 1AIAA 5M49A 2CJDA 1Z7DA 2GB3A 3AOVA 3GZCA 2DGKA 1LW4A 4IYOA 2VIAA 3WCNA 2CH1A 1BT4A 4M2JA 4NOGA 3NUBA 4EB7A 2BI3A 1LC8A 1WYTA 4CBRA 2QA3A 3HQTA 4DBCA 2VMPA 3PDBA 1BQAA 1CZEA 2VGSA 5HDMA 3ECDA 1OATA 1LKCA 4KAMA 3QI6A 2CJHA 3AEMA 1FC4A 3GWPA 4W1XA 2QB3A 1PFFA 1ARGA 1QJ3A 9AATA 3EZSA 4F5MA 3CQ4A 3DR4A 1AMAA 4GE7A 2WK9A 1KMKA 3HL2A 5M46A 2PO3A 4L0OA 4R5ZA 5D5SA 2NMPA 4O6ZA 1QITA 2HZPA 2E54A 4LNLA 3FTBA 4EU1A 2W8UA 4ZSYA 3VP6A 3A2BA 2Z1ZA 3FCRA 3GR9A 2CSTA 3I16A 3NU8A 5DJ1A 4F5JA 1C0NA 1WYUA 3B1EA 3NX3A 4JF0A 4ZASA 3ZZKA 1GC4A 1X0MA 4A0GA 1M0OA 4MY5A 2DR1A 1IAXA 1FG7A 3AEJA 1OXPA 2E7IA 4BHDA 2AATA 4ADEA 4LC3A 2FM1A 4CBSA 3NRAA 4AO4A 2D5YA 1D2FA 1AX4A 3NYTA 4OBVA 2FYFA 2OGEA 3ISLA 4QGRA 1G4XA 1BW0A 2DKBA 1BS0A 1GBNA 2ZSMA 3EI8A 3BCBA 4K2MA 1AMRA 2VYCA 2YHKA 3LVKA 4Y0HA 3WX9A 3PDXA 4ZWVA 1QISA 1AJSA 3QM2A 1GC0A 3BB8A 4GSAA 4F5HA 1AY5A 1O62A 2Z20A 4WYFA 2OKKA 1T3IA 4MQQA 2AY5A 1LC5A 5LHAA 3ELPA 2C7TA 2F8JA 3FSLA 1SZUA 3RI6A 2JJEA 1CQ6A 5BJ4A 1ECXA 3Q8NA 4W1VA 1IX7A 2VI8A 3K40A 2R0TA 4I8AA 1DFOA 5G2QA 2W8JA 2HUFA 3QPGA 2VGUA 1IX8A 1GEWA 1JF9A 1SPAA 3BS8A 5DX5A 3RQ1A 2YCNA 1DTYA 1ZC9A 2JGTA
chains in the Genus database with same CATH superfamily
1W23A 3BCAA 1PG8A 4JE5A 3DR7A 1N8PA 3OKSA 4XQ2A 2R2NA 4AZKA 8AATA 1GCKA 5EAVA 3HLMA 2W7JA 2DKJA 5D95A 3CQ5A 2VGTA 4IX8A 5EIGA 1YOOA 2VGZA 1S08A 1ELQA 2ZUKA 4W91A 4F5IA 1S09A 3LVMA 2G6WA 1BQDA 1AHFA 5FT4A 2JISA 4ZWMA 2X5DA 3JU7A 1DJ9A 1ZODA 1MDOA 3FFHA 3K28A 3KE3A 1KMJA 1AHGA 3UE8A 3TFTA 3NTJA 2OATA 4B98A 2EO5A 3P6KA 4XEWA 1BJ4A 1OHVA 2ZC0A 2QB2A 1LS3A 2BIEA 1Z3ZA 5JAYA 1I43A 2A1VA 1ARIA 3P1TA 1BJWA 1DJUA 3DRDA 3RCHB 2YKYA 3EI7A 4IW7A 2RFVA 2TPLA 1B4XA 4GDYA 1C7NA 1D7VA 1PMMA 1SZSA 2BWPA 2ZJGA 2D7YA 4TN4A 3VK2A 3A9XA 1MLYA 1M0QA 4TMRA 3EI9A 4M2KA 2D64A 1ASFA 2X3LA 4OCAA 1AY4A 1CQ8A 3WLXA 2CANA 1W7MA 4ZLVA 2EZ2A 2V0YA 1GEXA 1IBJA 1XEYA 1X29A 3FZ6A 1AHYA 3HVYA 3MAFB 3RUYA 1D7RA 3TQXA 3BWNC 1SF2A 3GBXA 4UHOA 1AHXA 3LVLB 2R5CA 5EFSA 4BA5A 1UKJA 3ACZA 4IYOB 2YKVA 1MGVA 2DOUA 3E2FA 4ITXA 4WLHA 4A6RA 2JJGA 2YKXA 2C81A 4WXFA 4WYCA 1WYTB 3I5TA 2C44A 3LG0A 3E9KA 4J8LA 3PDBB 4P7YA 4E1OA 1AHEA 1KL1A 2CINA 2BYJA 1UU2A 2WK7A 4WXBA 4JEYA 4GRXA 1W7NA 1G4VA 2AY3A 2VGWA 2VMUA 3B1CA 3DC1A 1QJ5A 1ARSA 1N2TA 1S06A 1SVVA 2Z9XA 2QMAA 3GZDA 1MDXA 4OBUA 3FRKA 4R2NA 4RKCA 1W3UA 4ZDLA 1GD9A 2VMWA 3ZRRA 4WB0A 2VLFA 1OHYA 2OKJA 1AAWA 1WYUB 1V2EA 5TF5A 4F5KA 2WKAA 3FQ8A 1ARTA 3BC8A 1ORDA 2HOZA 3BWNA 2O7CA 3DZZA 4WYEA 1C7OA 5M4DA 2Z9WA 1LC7A 3T32A 2DGMA 3LV2A 1BJOA 1TARA 2O0RA 3FD0A 4FFCA 3NNKA 3G8MA 4MQRA 4XJMA 3AENA 1C7GA 1CL1A 4IY7A 2CJGA 4PVFA 2VMXA 1KL2A 2E7UA 1AJSB 3GETA 4DQ6A 3FQAA 1MAQA 4WYGA 1X2AA 2BKWA 2ZY3A 3FVXA 3E77A 4RJYA 3ZRQA 4JEVA 4K2BA 3H14A 1JS3A 3HMUA 4RITA 3VK4A 1MAPA 1B9HA 2Q7WA 3TCMA 3FVSA 3N4XA 2VMTA 5G2PA 4U1TA 2EH6A 2CB1A 3CBFA 3G0TA 1TOJA 3BV0A 1GC3A 2C0RA 3RBLA 3JWAA 4EMYA 1CQ7A 3FQ7A 1UU0A 1VJOA 4ISYA 2CFBA 4W1WA 3B1DA 1JG8A 1W7LA 1SFFA 3VAXA 1DGEA 1RV3A 3D6KA 3GSBA 2O1BA 3N7NA 1AJRA 5EUNA 2G7JA 2AY1A 5E4ZA 3WKSA 4E77A 1OHWA 1VEFA 4MSOA 3PD6A 4CXQA 3FDDA 4IXSA 3H9XA 3MC6C 2HP1A 3E2ZA 3USFA 1C4KA 4U2HA 2ZY2A 1X28A 5EIGB 4DGTA 3BN1A 3MKJA 4ATQA 1QZ9A 3DXWA 3DYDA 3COGA 1YJSA 1SZKA 3GJUA 2VMYA 3QGUA 2W7HA 2ZY4A 3NYSA 2HOYA 3PGYA 3CQ6A 1GDEA 2FN6A 1M7YA 3DXVA 2D7ZA 2HP2A 3W1IA 1LK9A 1MLZA 1Y4IA 1E5FA 2FKIA 2XH1A 1TASA 2CTZA 3EI5A 1ASDA 3LWSA 4FL0A 5F8VA 5C6UA 2HORA 3ASBA 4A6UA 3ELEA 2FQ6A 3AATA 1B8GA 3QBOA 2PB2A 3WZFA 2VI9A 3NU7A 5DJ9A 5DB5A 4A0HA 2VMQA 3OP7A 4E3QA 2VMNA 4OYTA 3B46A 3F9TA 4XAUA 2D66A 3EIAA 3MEBA 3I4JA 3VK3A 4AOAA 5J8QA 1UU1A 4WP0A 2AEUA 3HBXA 4CXRA 3MAUA 4Q31A 4ZAHA 1FG3A 3W1JA 4MKJA 1BKGA 2R5CB 2W8VA 4H63Q 1AKBA 1IVRA 2AY6A 1I41A 1AMSA 3PIUA 5G4IA 4BA4A 5E3KA 1B5OA 2W7GA 2VMRA 3LVJA 2D65A 1DJEA 2AY8A 4CVQA 1U08A 4Y0IA 3WGCA 2ZYJA 1EJIA 3LY1A 1AKAA 4IXOA 4ADCA 2GMSA 1IAYA 1JS6A 2EGYA 3N75A 2QBTA 2PB0A 3G7QA 3AEMC 4MGRA 4MQPA 1AIBA 3JTXA 2Z61A 5EQCA 4LNJA 4JEXA 1TOKA 2OGAA 1AMQA 1IUGA 4GEBA 4OMAA 4WYDA 4AO9A 3R9AA 4WB0B 3L8AA 3E6GA 4EB5A 1O61A 1WYVA 2HOXA 1WKHA 4WYAA 3VOMA 4BQ0A 4TV7A 4GE9A 3FFRA 2ZP7A 1RV4A 2X8UA 2JJHA 2OQXA 3DU4A 1BJOB 4WBTA 1IJIA 1H0CA 1S07A 1AICA 2AY4A 3AEJC 3AENB 4J5UA 4JEZA 3PJ0A 5F9SA 3BCXA 3FZ7A 2Z9UA 4F5GA 2BI2A 4IXZA 3F0HA 1D7SA 1M32A 2DGLA 4RM1A 4ZM3A 1ASAA 1WSTA 1V2FA 3CAIA 4ITGA 5FT5A 3TATA 1V72A 2AY7A 2X5FA 5EUEA 3MADA 3JWBA 3A9YA 2D63A 5FT6A 4AZJA 1YIYA 1ASLA 3NYUA 4ATPA 3NDNA 3AEOA 2V1PA 1WKGA 3F6TA 7AATA 3JW9A 2WB6A 2YRRA 3HDOA 4UOYA 4BMKA 4OTLA 3FZ8A 2VGVA 3ZZJA 2VLHA 4UHMA 1N31A 1YAAA 3A9ZA 5G0AA 2VMSA 5E5IA 1YJYA 1CZCA 4JEWA 4A00A 1YJZA 1DKAA 1ELUA 1J32A 1V2DA 3JZLA 4H51A 2BWOA 4E3RA 4A72A 2QSRA 3PD6B 3WCOA 4PIWA 1CS1A 1G7WA 1AKCA 2VMOA 4W5KA 5I92A 3FVUA 2W7EA 3H7FA 2VIBA 3E2ZB 4F4EA 4UHNA 3AOWA 3A8UX 4K05A 2Z9VA 1TOGA 1GC2A 4B9BA 4ZM4A 2JJFA 2AY9A 4A0FA 3B8XA 1QGNA 4JE5D 1TPLA 2W8TA 2BWNA 4RJ0A 5AX8A 1VP4A 1ASGA 1H1CA 4WD2A 2W7FA 4Q75A 1TATA 5IWQA 4F5FA 3KGXA 4N0BA 5G4JA 5HXXA 5LH9A 2WK8A 2YCPA 2Z67A 1ARHA 3WGBA 4ZDPA 5M4BA 4GE4A 2BIGA 1M6SA 3WKRA 4RIZA 2FNUA 4ADBA 4ADDA 3UWCA 1I48A 1XI9A 2GQNA 4K2IA 4ZDOA 3PPLA 2HUIA 2QLRA 2AY2A 4P3MA 4UQVA 2BI9A 2YCTA 3EIBA 5BJ3A 4KYOA 2R5EA 3BWOA 3RBFA 2W7DA 3N5MA 2ZSLA 2W7MA 5FT8A 1M4NA 5G09A 1M0PA 1B5PA 2KFPA 5KTBA 4Q76A 4OT8A 4WXGA 1G7XA 2HUUA 1RVUA 3N4RA 3QHXA 3MC6A 3E2YA 1AY8A 2BI5A 2ORDA 1O69A 3NUIA 1ZOBA 3MBBA 4M2MA 3IHJA 1J04A 4HF8A 2W8WA 1LW5A 1CL2A 2GMUA 4LW4A 4KXKA 4RKDA 4RLGA 2CH2A 1B9IA 4Q6RA 5HHYA 1TOIA 5K8BA 3N4SA 1MDZA 2W7KA 2CY8A 1S0AA 3QN6A 3ZRPA 3EI6A 1EQBA 4XJOA 4A0RA 4RAEA 3AELA 4PFNA 4W8IA 3AV7A 5EUDA 3FDBA 3FKDA 4MKKA 2W7LA 1E5EA 4WLJA 4ZSWA 1M0NA 3N0LA 3EUCA 2BI1A 2D61A 2JG2A 1BJNA 1I29A 3HT4A 1ASNA 3II0A 2BHXA 3GZDC 3KKIA 2W7IA 3WY7A 1ASMA 2EZ1A 3DODA 2E7JA 3UAKA 2VMVA 2YOBA 2YRIA 2EPJA 3IF2A 2VMZA 1WYVB 1CJ0A 1OXOA 3M5UA 4XK1A 3W1HA 5EAAA 1D7UA 3RCHA 4JF1A 2FNIA 1O4SA 3R4TA 2XBNA 3L44A 1PMOA 4EFFA 4OC9A 4Y0DA 2AEVA 1EG5A 4HVKA 1YNUA 4PFFA 4N0WA 3ATHA 4A6TA 1ASCA 1C9CA 2BIAA 4XJPA 2ZY5A 2YKUA 1DGDA 3ASAA 4R8DA 1QIRA 4AH3A 1KKPA 1TOEA 3KGWA 3PA9A 1AAMA 1IX6A 1GEYA 2Z1YA 1ASBA 4F5LA 4LNMA 1KKJA 3MAFA 1ASEA 4R5FA 3TFUA 1RVYA 3AEPA 3EZ1A 4XJLA 2GSAA 1P3WA 1YIZA 3K7YA 4LW2A 2BYLA 3PAAA 1AIAA 5M49A 2CJDA 1Z7DA 2GB3A 3AOVA 3GZCA 2DGKA 1LW4A 4IYOA 2VIAA 3WCNA 2CH1A 1BT4A 4M2JA 4NOGA 3NUBA 4EB7A 2BI3A 1LC8A 1WYTA 4CBRA 2QA3A 3HQTA 4DBCA 2VMPA 3PDBA 1BQAA 1CZEA 2VGSA 5HDMA 3ECDA 1OATA 1LKCA 4KAMA 3QI6A 2CJHA 3AEMA 1FC4A 3GWPA 4W1XA 2QB3A 1PFFA 1ARGA 1QJ3A 9AATA 3EZSA 4F5MA 3CQ4A 3DR4A 1AMAA 4GE7A 2WK9A 2EYQA 1KMKA 3HL2A 5M46A 2PO3A 4L0OA 4R5ZA 5D5SA 2NMPA 4O6ZA 1QITA 2HZPA 2E54A 4LNLA 3FTBA 4EU1A 2W8UA 4ZSYA 3VP6A 3A2BA 2Z1ZA 3FCRA 3GR9A 2CSTA 3I16A 3NU8A 5DJ1A 4F5JA 1C0NA 1WYUA 3B1EA 3NX3A 4JF0A 4ZASA 3ZZKA 1GC4A 1X0MA 4A0GA 1M0OA 4MY5A 2DR1A 1IAXA 1FG7A 3AEJA 1OXPA 2E7IA 4BHDA 2AATA 4ADEA 4LC3A 2FM1A 4CBSA 3NRAA 4AO4A 2D5YA 1D2FA 1AX4A 3NYTA 4OBVA 2FYFA 2OGEA 3ISLA 4QGRA 1G4XA 1BW0A 2DKBA 1BS0A 1GBNA 2ZSMA 3EI8A 3BCBA 4K2MA 1AMRA 2VYCA 2YHKA 3LVKA 4Y0HA 3WX9A 3PDXA 4ZWVA 1QISA 1KAFA 1AJSA 3QM2A 1GC0A 3BB8A 4GSAA 4F5HA 1AY5A 1O62A 2Z20A 4WYFA 2OKKA 1T3IA 4MQQA 2AY5A 1LC5A 5LHAA 3ELPA 2C7TA 2F8JA 3FSLA 1SZUA 3RI6A 2JJEA 1CQ6A 5BJ4A 1ECXA 3Q8NA 4W1VA 1IX7A 2VI8A 3K40A 2R0TA 4I8AA 1DFOA 5G2QA 2W8JA 2HUFA 3QPGA 2VGUA 1IX8A 1GEWA 1JF9A 1SPAA 3BS8A 5DX5A 3RQ1A 2YCNA 1DTYA 1ZC9A 2JGTA
chains in the Genus database with same CATH topology
1W23A 3BCAA 1PG8A 4JE5A 3DR7A 1N8PA 3OKSA 4XQ2A 2R2NA 4AZKA 8AATA 1GCKA 5EAVA 3HLMA 2W7JA 2DKJA 5D95A 3CQ5A 2VGTA 4IX8A 5EIGA 1YOOA 2VGZA 1S08A 1ELQA 2ZUKA 4W91A 4F5IA 1S09A 3LVMA 2G6WA 1BQDA 1AHFA 5FT4A 2JISA 4ZWMA 2X5DA 3JU7A 1DJ9A 1ZODA 1MDOA 3FFHA 3K28A 3KE3A 1KMJA 1AHGA 3UE8A 3TFTA 3NTJA 2OATA 4B98A 2EO5A 3P6KA 4XEWA 1BJ4A 1OHVA 2ZC0A 2QB2A 1LS3A 2BIEA 1Z3ZA 5JAYA 1I43A 2A1VA 1ARIA 3P1TA 1BJWA 1DJUA 3DRDA 3RCHB 2YKYA 3EI7A 4IW7A 2RFVA 2TPLA 1B4XA 4GDYA 1C7NA 1D7VA 1PMMA 1SZSA 2BWPA 2ZJGA 2D7YA 4TN4A 3VK2A 3A9XA 1MLYA 1M0QA 4TMRA 3EI9A 4M2KA 2D64A 1ASFA 2X3LA 4OCAA 1AY4A 1CQ8A 3WLXA 2CANA 1W7MA 4ZLVA 2EZ2A 2V0YA 1GEXA 1IBJA 1XEYA 1X29A 3FZ6A 1AHYA 3HVYA 3MAFB 3RUYA 1D7RA 3TQXA 3BWNC 1SF2A 3GBXA 4UHOA 1AHXA 3LVLB 2R5CA 5EFSA 4BA5A 1UKJA 3ACZA 4IYOB 2YKVA 1MGVA 2DOUA 3E2FA 4ITXA 4WLHA 4A6RA 2JJGA 2YKXA 2C81A 4WXFA 4WYCA 1WYTB 3I5TA 2C44A 3LG0A 3E9KA 4J8LA 3PDBB 4P7YA 4E1OA 1AHEA 1KL1A 2CINA 2BYJA 1UU2A 2WK7A 4WXBA 4JEYA 4GRXA 1W7NA 1G4VA 2AY3A 2VGWA 2VMUA 3B1CA 3DC1A 1QJ5A 1ARSA 1N2TA 1S06A 1SVVA 2Z9XA 2QMAA 3GZDA 1MDXA 4OBUA 3FRKA 4R2NA 4RKCA 1W3UA 4ZDLA 1GD9A 2VMWA 3ZRRA 4WB0A 2VLFA 1OHYA 2OKJA 1AAWA 1WYUB 1V2EA 5TF5A 4F5KA 2WKAA 3FQ8A 1ARTA 3BC8A 1ORDA 2HOZA 3BWNA 2O7CA 3DZZA 4WYEA 1C7OA 5M4DA 2Z9WA 1LC7A 3T32A 2DGMA 3LV2A 1BJOA 1TARA 2O0RA 3FD0A 4FFCA 3NNKA 3G8MA 4MQRA 4XJMA 3AENA 1C7GA 1CL1A 4IY7A 2CJGA 4PVFA 2VMXA 1KL2A 2E7UA 1AJSB 3GETA 4DQ6A 3FQAA 1MAQA 4WYGA 1X2AA 2BKWA 2ZY3A 3FVXA 3E77A 4RJYA 3ZRQA 4JEVA 4K2BA 3H14A 1JS3A 3HMUA 4RITA 3VK4A 1MAPA 1B9HA 2Q7WA 3TCMA 3FVSA 3N4XA 2VMTA 5G2PA 4U1TA 2EH6A 2CB1A 3CBFA 3G0TA 1TOJA 3BV0A 1GC3A 2C0RA 3RBLA 3JWAA 4EMYA 1CQ7A 3FQ7A 1UU0A 1VJOA 4ISYA 2CFBA 4W1WA 3B1DA 1JG8A 1W7LA 1SFFA 3VAXA 1DGEA 1RV3A 3D6KA 3GSBA 2O1BA 3N7NA 1AJRA 5EUNA 2G7JA 2AY1A 5E4ZA 3WKSA 4E77A 1OHWA 1VEFA 4MSOA 3PD6A 4CXQA 3FDDA 4IXSA 3H9XA 3MC6C 2HP1A 3E2ZA 3USFA 1C4KA 4U2HA 2ZY2A 1X28A 5EIGB 4DGTA 3BN1A 3MKJA 4ATQA 1QZ9A 3DXWA 3DYDA 3COGA 1YJSA 1SZKA 3GJUA 2VMYA 3QGUA 2W7HA 2ZY4A 3NYSA 2HOYA 3PGYA 3CQ6A 1GDEA 2FN6A 1M7YA 3DXVA 2D7ZA 2HP2A 3W1IA 1LK9A 1MLZA 1Y4IA 1E5FA 2FKIA 2XH1A 1TASA 2CTZA 3EI5A 1ASDA 3LWSA 4FL0A 5F8VA 5C6UA 2HORA 3ASBA 4A6UA 3ELEA 2FQ6A 3AATA 1B8GA 3QBOA 2PB2A 3WZFA 2VI9A 3NU7A 5DJ9A 5DB5A 4A0HA 2VMQA 3OP7A 4E3QA 2VMNA 4OYTA 3B46A 3F9TA 4XAUA 2D66A 3EIAA 3MEBA 3I4JA 3VK3A 4AOAA 5J8QA 1UU1A 4WP0A 2AEUA 3HBXA 4CXRA 3MAUA 4Q31A 4ZAHA 1FG3A 3W1JA 4MKJA 1BKGA 2R5CB 2W8VA 4H63Q 1AKBA 1IVRA 2AY6A 1I41A 1AMSA 3PIUA 5G4IA 4BA4A 5E3KA 1B5OA 2W7GA 2VMRA 3LVJA 2D65A 1DJEA 2AY8A 4CVQA 1U08A 4Y0IA 3WGCA 2ZYJA 1EJIA 3LY1A 1AKAA 4IXOA 4ADCA 2GMSA 1IAYA 1JS6A 2EGYA 3N75A 2QBTA 2PB0A 3G7QA 3AEMC 4MGRA 4MQPA 1AIBA 3JTXA 2Z61A 5EQCA 4LNJA 4JEXA 1TOKA 2OGAA 1AMQA 1IUGA 4GEBA 4OMAA 4WYDA 4AO9A 3R9AA 4WB0B 3L8AA 3E6GA 4EB5A 1O61A 1WYVA 2HOXA 1WKHA 4WYAA 3VOMA 4BQ0A 4TV7A 4GE9A 3FFRA 2ZP7A 1RV4A 2X8UA 2JJHA 2OQXA 3DU4A 1BJOB 4WBTA 1IJIA 1H0CA 1S07A 1AICA 2AY4A 3AEJC 3AENB 4J5UA 4JEZA 3PJ0A 5F9SA 3BCXA 3FZ7A 2Z9UA 4F5GA 2BI2A 4IXZA 3F0HA 1D7SA 1M32A 2DGLA 4RM1A 4ZM3A 1ASAA 1WSTA 1V2FA 3CAIA 4ITGA 5FT5A 3TATA 1V72A 2AY7A 2X5FA 5EUEA 3MADA 3JWBA 3A9YA 2D63A 5FT6A 4AZJA 1YIYA 1ASLA 3NYUA 4ATPA 3NDNA 3AEOA 2V1PA 1WKGA 3F6TA 7AATA 3JW9A 2WB6A 2YRRA 3HDOA 4UOYA 4BMKA 4OTLA 3FZ8A 2VGVA 3ZZJA 2VLHA 4UHMA 1N31A 1YAAA 3A9ZA 5G0AA 2VMSA 5E5IA 1YJYA 1CZCA 4JEWA 4A00A 1YJZA 1DKAA 1ELUA 1J32A 1V2DA 3JZLA 4H51A 2BWOA 4E3RA 4A72A 2QSRA 3PD6B 3WCOA 4PIWA 1CS1A 1G7WA 1AKCA 2VMOA 4W5KA 5I92A 3FVUA 2W7EA 3H7FA 2VIBA 3E2ZB 4F4EA 4UHNA 3AOWA 3A8UX 4K05A 2Z9VA 1TOGA 1GC2A 4B9BA 4ZM4A 2JJFA 2AY9A 4A0FA 3B8XA 1QGNA 4JE5D 1TPLA 2W8TA 2BWNA 4RJ0A 5AX8A 1VP4A 1ASGA 1H1CA 4WD2A 2W7FA 4Q75A 1TATA 5IWQA 4F5FA 3KGXA 4N0BA 5G4JA 5HXXA 5LH9A 2WK8A 2YCPA 2Z67A 1ARHA 3WGBA 4ZDPA 5M4BA 4GE4A 2BIGA 1M6SA 3WKRA 4RIZA 2FNUA 4ADBA 4ADDA 3UWCA 1I48A 1XI9A 2GQNA 4K2IA 4ZDOA 3PPLA 2HUIA 2QLRA 2AY2A 4P3MA 4UQVA 2BI9A 2YCTA 3EIBA 5BJ3A 4KYOA 2R5EA 3BWOA 3RBFA 2W7DA 3N5MA 2ZSLA 2W7MA 5FT8A 1M4NA 5G09A 1M0PA 1B5PA 2KFPA 5KTBA 4Q76A 4OT8A 4WXGA 1G7XA 2HUUA 1RVUA 3N4RA 3QHXA 3MC6A 3E2YA 1AY8A 2BI5A 2ORDA 1O69A 3NUIA 1ZOBA 3MBBA 4M2MA 3IHJA 1J04A 4HF8A 2W8WA 1LW5A 1CL2A 2GMUA 4LW4A 4KXKA 4RKDA 4RLGA 2CH2A 1B9IA 4Q6RA 5HHYA 1TOIA 5K8BA 3N4SA 1MDZA 2W7KA 2CY8A 1S0AA 3QN6A 3ZRPA 3EI6A 1EQBA 4XJOA 4A0RA 4RAEA 3AELA 4PFNA 4W8IA 3AV7A 5EUDA 3FDBA 3FKDA 4MKKA 2W7LA 1E5EA 4WLJA 4ZSWA 1M0NA 3N0LA 3EUCA 2BI1A 2D61A 2JG2A 1BJNA 1I29A 3HT4A 1ASNA 3II0A 2BHXA 3GZDC 3KKIA 2W7IA 3WY7A 1ASMA 2EZ1A 3DODA 2E7JA 3UAKA 2VMVA 2YOBA 2YRIA 2EPJA 3IF2A 2VMZA 1WYVB 1CJ0A 1OXOA 3M5UA 4XK1A 3W1HA 5EAAA 1D7UA 3RCHA 4JF1A 2FNIA 1O4SA 3R4TA 2XBNA 3L44A 1PMOA 4EFFA 4OC9A 4Y0DA 2AEVA 1EG5A 4HVKA 1YNUA 4PFFA 4N0WA 3ATHA 4A6TA 1ASCA 1C9CA 2BIAA 4XJPA 2ZY5A 2YKUA 1DGDA 3ASAA 4R8DA 1QIRA 4AH3A 1KKPA 1TOEA 3KGWA 3PA9A 1AAMA 1IX6A 1GEYA 2Z1YA 1ASBA 4F5LA 4LNMA 1KKJA 3MAFA 1ASEA 4R5FA 3TFUA 1RVYA 3AEPA 3EZ1A 4XJLA 2GSAA 1P3WA 1YIZA 3K7YA 4LW2A 2BYLA 3PAAA 1AIAA 5M49A 2CJDA 1Z7DA 2GB3A 3AOVA 3GZCA 2DGKA 1LW4A 4IYOA 2VIAA 3WCNA 2CH1A 1BT4A 4M2JA 4NOGA 3NUBA 4EB7A 2BI3A 1LC8A 1WYTA 4CBRA 2QA3A 3HQTA 4DBCA 2VMPA 3PDBA 1BQAA 1CZEA 2VGSA 5HDMA 3ECDA 1OATA 1LKCA 4KAMA 3QI6A 2CJHA 3AEMA 1FC4A 3GWPA 4W1XA 2QB3A 1PFFA 1ARGA 1QJ3A 9AATA 3EZSA 4F5MA 3CQ4A 3DR4A 1AMAA 4GE7A 2WK9A 2EYQA 1KMKA 3HL2A 5M46A 2PO3A 4L0OA 4R5ZA 5D5SA 2NMPA 4O6ZA 1QITA 2HZPA 2E54A 4LNLA 3FTBA 4EU1A 2W8UA 4ZSYA 3VP6A 3A2BA 2Z1ZA 3FCRA 3GR9A 2CSTA 3I16A 3NU8A 5DJ1A 4F5JA 1C0NA 1WYUA 3B1EA 3NX3A 4JF0A 4ZASA 3ZZKA 1GC4A 1X0MA 4A0GA 1M0OA 4MY5A 2DR1A 1IAXA 1FG7A 3AEJA 1OXPA 2E7IA 4BHDA 2AATA 4ADEA 4LC3A 2FM1A 4CBSA 3NRAA 4AO4A 2D5YA 1D2FA 1AX4A 3NYTA 4OBVA 2FYFA 2OGEA 3ISLA 4QGRA 1G4XA 1BW0A 2DKBA 1BS0A 1GBNA 2ZSMA 3EI8A 3BCBA 4K2MA 1AMRA 2VYCA 2YHKA 3LVKA 4Y0HA 3WX9A 3PDXA 4ZWVA 1QISA 1AJSA 3QM2A 1GC0A 3BB8A 4GSAA 4F5HA 1AY5A 1O62A 2Z20A 4WYFA 2OKKA 1T3IA 4MQQA 2AY5A 1LC5A 5LHAA 3ELPA 2C7TA 2F8JA 3FSLA 1SZUA 3RI6A 2JJEA 1CQ6A 5BJ4A 1ECXA 3Q8NA 4W1VA 1IX7A 2VI8A 3K40A 2R0TA 4I8AA 1DFOA 5G2QA 2W8JA 2HUFA 3QPGA 2VGUA 1IX8A 1GEWA 1JF9A 1SPAA 3BS8A 5DX5A 3RQ1A 2YCNA 1DTYA 1ZC9A 2JGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W23 A;  3BCA A;  1PG8 A;  4JE5 A;  3DR7 A;  1N8P A;  3OKS A;  4XQ2 A;  2R2N A;  4AZK A;  8AAT A;  1GCK A;  5EAV A;  3HLM A;  2W7J A;  2DKJ A;  5D95 A;  3CQ5 A;  2VGT A;  4IX8 A;  5EIG A;  1YOO A;  2VGZ A;  1S08 A;  1ELQ A;  2ZUK A;  4W91 A;  4F5I A;  1S09 A;  3LVM A;  2G6W A;  1BQD A;  1AHF A;  5FT4 A;  2JIS A;  4ZWM A;  2X5D A;  3JU7 A;  1DJ9 A;  1ZOD A;  1MDO A;  3FFH A;  3K28 A;  3KE3 A;  1KMJ A;  1AHG A;  3UE8 A;  3TFT A;  3NTJ A;  2OAT A;  4B98 A;  2EO5 A;  3P6K A;  4XEW A;  1BJ4 A;  1OHV A;  2ZC0 A;  2QB2 A;  1LS3 A;  2BIE A;  1Z3Z A;  5JAY A;  1I43 A;  1ARI A;  3P1T A;  1BJW A;  1DJU A;  3DRD A;  3RCH B;  2YKY A;  3EI7 A;  4IW7 A;  2RFV A;  2TPL A;  1B4X A;  4GDY A;  1C7N A;  1D7V A;  1PMM A;  1SZS A;  2BWP A;  2ZJG A;  2D7Y A;  4TN4 A;  3VK2 A;  3A9X A;  1MLY A;  1M0Q A;  4TMR A;  3EI9 A;  4M2K A;  2D64 A;  1ASF A;  2X3L A;  4OCA A;  1AY4 A;  1CQ8 A;  3WLX A;  2CAN A;  1W7M A;  4ZLV A;  2EZ2 A;  2V0Y A;  1GEX A;  1IBJ A;  1XEY A;  1X29 A;  3FZ6 A;  1AHY A;  3HVY A;  3MAF B;  3RUY A;  1D7R A;  3TQX A;  3BWN C;  1SF2 A;  3GBX A;  4UHO A;  1AHX A;  3LVL B;  2R5C A;  5EFS A;  4BA5 A;  1UKJ A;  3ACZ A;  4IYO B;  2YKV A;  1MGV A;  2DOU A;  3E2F A;  4ITX A;  4WLH A;  4A6R A;  2JJG A;  2YKX A;  2C81 A;  4WXF A;  4WYC A;  1WYT B;  3I5T A;  2C44 A;  3LG0 A;  3E9K A;  4J8L A;  3PDB B;  4P7Y A;  4E1O A;  1AHE A;  1KL1 A;  2CIN A;  2BYJ A;  1UU2 A;  2WK7 A;  4WXB A;  4JEY A;  4GRX A;  1W7N A;  1G4V A;  2AY3 A;  2VGW A;  2VMU A;  3B1C A;  3DC1 A;  1QJ5 A;  1ARS A;  1N2T A;  1S06 A;  1SVV A;  2Z9X A;  2QMA A;  3GZD A;  1MDX A;  4OBU A;  3FRK A;  4R2N A;  4RKC A;  1W3U A;  4ZDL A;  1GD9 A;  2VMW A;  3ZRR A;  4WB0 A;  2VLF A;  1OHY A;  2OKJ A;  1AAW A;  1WYU B;  1V2E A;  5TF5 A;  4F5K A;  2WKA A;  3FQ8 A;  1ART A;  3BC8 A;  1ORD A;  2HOZ A;  3BWN A;  2O7C A;  3DZZ A;  4WYE A;  1C7O A;  5M4D A;  2Z9W A;  1LC7 A;  3T32 A;  2DGM A;  3LV2 A;  1BJO A;  1TAR A;  2O0R A;  3FD0 A;  4FFC A;  3NNK A;  3G8M A;  4MQR A;  4XJM A;  3AEN A;  1C7G A;  1CL1 A;  4IY7 A;  2CJG A;  4PVF A;  2VMX A;  1KL2 A;  2E7U A;  1AJS B;  3GET A;  4DQ6 A;  3FQA A;  1MAQ A;  4WYG A;  1X2A A;  2BKW A;  2ZY3 A;  3FVX A;  3E77 A;  4RJY A;  3ZRQ A;  4JEV A;  4K2B A;  3H14 A;  1JS3 A;  3HMU A;  4RIT A;  3VK4 A;  1MAP A;  1B9H A;  2Q7W A;  3TCM A;  3FVS A;  2VMT A;  5G2P A;  4U1T A;  2EH6 A;  2CB1 A;  3CBF A;  3G0T A;  1TOJ A;  3BV0 A;  1GC3 A;  2C0R A;  3RBL A;  3JWA A;  4EMY A;  1CQ7 A;  3FQ7 A;  1UU0 A;  1VJO A;  4ISY A;  2CFB A;  4W1W A;  3B1D A;  1JG8 A;  1W7L A;  1SFF A;  3VAX A;  1DGE A;  1RV3 A;  3D6K A;  3GSB A;  2O1B A;  1AJR A;  5EUN A;  2AY1 A;  5E4Z A;  3WKS A;  4E77 A;  1OHW A;  1VEF A;  4MSO A;  3PD6 A;  4CXQ A;  3FDD A;  4IXS A;  3MC6 C;  2HP1 A;  3E2Z A;  3USF A;  1C4K A;  4U2H A;  2ZY2 A;  1X28 A;  5EIG B;  4DGT A;  3BN1 A;  3MKJ A;  4ATQ A;  1QZ9 A;  3DXW A;  3DYD A;  3COG A;  1YJS A;  1SZK A;  3GJU A;  2VMY A;  3QGU A;  2W7H A;  2ZY4 A;  3NYS A;  2HOY A;  3PGY A;  3CQ6 A;  1GDE A;  2FN6 A;  1M7Y A;  3DXV A;  2D7Z A;  2HP2 A;  3W1I A;  1LK9 A;  1MLZ A;  1Y4I A;  1E5F A;  2XH1 A;  1TAS A;  2CTZ A;  3EI5 A;  1ASD A;  3LWS A;  4FL0 A;  5F8V A;  5C6U A;  2HOR A;  3ASB A;  4A6U A;  3ELE A;  2FQ6 A;  3AAT A;  1B8G A;  3QBO A;  2PB2 A;  3WZF A;  2VI9 A;  3NU7 A;  5DJ9 A;  5DB5 A;  4A0H A;  2VMQ A;  3OP7 A;  4E3Q A;  2VMN A;  4OYT A;  3B46 A;  3F9T A;  4XAU A;  2D66 A;  3EIA A;  3MEB A;  3I4J A;  3VK3 A;  4AOA A;  5J8Q A;  1UU1 A;  4WP0 A;  2AEU A;  3HBX A;  4CXR A;  3MAU A;  4Q31 A;  4ZAH A;  1FG3 A;  3W1J A;  4MKJ A;  1BKG A;  2R5C B;  2W8V A;  1AKB A;  1IVR A;  2AY6 A;  1I41 A;  1AMS A;  3PIU A;  5G4I A;  4BA4 A;  5E3K A;  1B5O A;  2W7G A;  2VMR A;  3LVJ A;  2D65 A;  1DJE A;  2AY8 A;  4CVQ A;  1U08 A;  4Y0I A;  3WGC A;  2ZYJ A;  1EJI A;  3LY1 A;  1AKA A;  4IXO A;  4ADC A;  2GMS A;  1IAY A;  1JS6 A;  2EGY A;  3N75 A;  2QBT A;  2PB0 A;  3G7Q A;  3AEM C;  4MGR A;  4MQP A;  1AIB A;  3JTX A;  2Z61 A;  5EQC A;  4LNJ A;  4JEX A;  1TOK A;  2OGA A;  1AMQ A;  1IUG A;  4GEB A;  4OMA A;  4WYD A;  4AO9 A;  3R9A A;  4WB0 B;  3L8A A;  3E6G A;  4EB5 A;  1O61 A;  1WYV A;  2HOX A;  1WKH A;  4WYA A;  3VOM A;  4BQ0 A;  4TV7 A;  4GE9 A;  3FFR A;  2ZP7 A;  1RV4 A;  2X8U A;  2JJH A;  2OQX A;  3DU4 A;  1BJO B;  4WBT A;  1IJI A;  1H0C A;  1S07 A;  1AIC A;  2AY4 A;  3AEJ C;  3AEN B;  4J5U A;  4JEZ A;  3PJ0 A;  5F9S A;  3BCX A;  3FZ7 A;  2Z9U A;  4F5G A;  2BI2 A;  4IXZ A;  3F0H A;  1D7S A;  1M32 A;  2DGL A;  4RM1 A;  4ZM3 A;  1ASA A;  1WST A;  1V2F A;  3CAI A;  4ITG A;  5FT5 A;  3TAT A;  1V72 A;  2AY7 A;  2X5F A;  5EUE A;  3MAD A;  3JWB A;  3A9Y A;  2D63 A;  5FT6 A;  4AZJ A;  1YIY A;  1ASL A;  3NYU A;  4ATP A;  3NDN A;  3AEO A;  2V1P A;  1WKG A;  3F6T A;  7AAT A;  3JW9 A;  2YRR A;  3HDO A;  4UOY A;  4BMK A;  4OTL A;  3FZ8 A;  2VGV A;  3ZZJ A;  2VLH A;  4UHM A;  1N31 A;  1YAA A;  3A9Z A;  5G0A A;  2VMS A;  5E5I A;  1YJY A;  1CZC A;  4JEW A;  4A00 A;  1YJZ A;  1DKA A;  1ELU A;  1J32 A;  1V2D A;  3JZL A;  4H51 A;  2BWO A;  4E3R A;  4A72 A;  3PD6 B;  3WCO A;  4PIW A;  1CS1 A;  1G7W A;  1AKC A;  2VMO A;  4W5K A;  5I92 A;  3FVU A;  2W7E A;  3H7F A;  2VIB A;  3E2Z B;  4F4E A;  4UHN A;  3AOW A;  3A8U X;  2Z9V A;  1TOG A;  1GC2 A;  4B9B A;  4ZM4 A;  2JJF A;  2AY9 A;  4A0F A;  3B8X A;  1QGN A;  4JE5 D;  1TPL A;  2W8T A;  2BWN A;  4RJ0 A;  5AX8 A;  1VP4 A;  1ASG A;  1H1C A;  4WD2 A;  2W7F A;  4Q75 A;  1TAT A;  5IWQ A;  4F5F A;  3KGX A;  4N0B A;  5G4J A;  5HXX A;  5LH9 A;  2WK8 A;  2YCP A;  2Z67 A;  1ARH A;  3WGB A;  4ZDP A;  5M4B A;  4GE4 A;  2BIG A;  1M6S A;  3WKR A;  4RIZ A;  2FNU A;  4ADB A;  4ADD A;  3UWC A;  1I48 A;  1XI9 A;  2GQN A;  4K2I A;  4ZDO A;  3PPL A;  2HUI A;  2QLR A;  2AY2 A;  4P3M A;  4UQV A;  2BI9 A;  2YCT A;  3EIB A;  5BJ3 A;  4KYO A;  2R5E A;  3BWO A;  3RBF A;  2W7D A;  3N5M A;  2ZSL A;  2W7M A;  5FT8 A;  1M4N A;  5G09 A;  1M0P A;  1B5P A;  4Q76 A;  4OT8 A;  4WXG A;  1G7X A;  2HUU A;  1RVU A;  3QHX A;  3MC6 A;  3E2Y A;  1AY8 A;  2BI5 A;  2ORD A;  1O69 A;  3NUI A;  1ZOB A;  3MBB A;  4M2M A;  3IHJ A;  1J04 A;  4HF8 A;  2W8W A;  1LW5 A;  1CL2 A;  2GMU A;  4LW4 A;  4KXK A;  4RKD A;  4RLG A;  2CH2 A;  1B9I A;  4Q6R A;  5HHY A;  1TOI A;  5K8B A;  1MDZ A;  2W7K A;  2CY8 A;  1S0A A;  3QN6 A;  3ZRP A;  3EI6 A;  1EQB A;  4XJO A;  4A0R A;  4RAE A;  3AEL A;  4PFN A;  4W8I A;  3AV7 A;  5EUD A;  3FDB A;  3FKD A;  4MKK A;  2W7L A;  1E5E A;  4WLJ A;  4ZSW A;  1M0N A;  3N0L A;  3EUC A;  2BI1 A;  2D61 A;  2JG2 A;  1BJN A;  1I29 A;  3HT4 A;  1ASN A;  3II0 A;  2BHX A;  3GZD C;  3KKI A;  2W7I A;  3WY7 A;  1ASM A;  2EZ1 A;  3DOD A;  2E7J A;  3UAK A;  2VMV A;  2YOB A;  2YRI A;  2EPJ A;  3IF2 A;  2VMZ A;  1WYV B;  1CJ0 A;  1OXO A;  3M5U A;  4XK1 A;  3W1H A;  5EAA A;  1D7U A;  3RCH A;  4JF1 A;  2FNI A;  1O4S A;  3R4T A;  2XBN A;  3L44 A;  1PMO A;  4EFF A;  4OC9 A;  4Y0D A;  2AEV A;  1EG5 A;  4HVK A;  1YNU A;  4PFF A;  4N0W A;  3ATH A;  4A6T A;  1ASC A;  1C9C A;  2BIA A;  4XJP A;  2ZY5 A;  2YKU A;  1DGD A;  3ASA A;  4R8D A;  1QIR A;  4AH3 A;  1KKP A;  1TOE A;  3KGW A;  3PA9 A;  1AAM A;  1IX6 A;  1GEY A;  2Z1Y A;  1ASB A;  4F5L A;  4LNM A;  1KKJ A;  3MAF A;  1ASE A;  4R5F A;  3TFU A;  1RVY A;  3AEP A;  3EZ1 A;  4XJL A;  2GSA A;  1P3W A;  1YIZ A;  3K7Y A;  4LW2 A;  2BYL A;  3PAA A;  1AIA A;  5M49 A;  2CJD A;  1Z7D A;  2GB3 A;  3AOV A;  3GZC A;  2DGK A;  1LW4 A;  4IYO A;  2VIA A;  3WCN A;  2CH1 A;  1BT4 A;  4M2J A;  4NOG A;  3NUB A;  4EB7 A;  2BI3 A;  1LC8 A;  1WYT A;  4CBR A;  2QA3 A;  3HQT A;  4DBC A;  2VMP A;  3PDB A;  1BQA A;  1CZE A;  2VGS A;  5HDM A;  3ECD A;  1OAT A;  1LKC A;  4KAM A;  3QI6 A;  2CJH A;  3AEM A;  1FC4 A;  3GWP A;  4W1X A;  2QB3 A;  1PFF A;  1ARG A;  1QJ3 A;  9AAT A;  3EZS A;  4F5M A;  3CQ4 A;  3DR4 A;  1AMA A;  4GE7 A;  2WK9 A;  1KMK A;  3HL2 A;  5M46 A;  2PO3 A;  4L0O A;  4R5Z A;  5D5S A;  2NMP A;  4O6Z A;  1QIT A;  2HZP A;  2E54 A;  4LNL A;  3FTB A;  4EU1 A;  2W8U A;  4ZSY A;  3VP6 A;  3A2B A;  2Z1Z A;  3FCR A;  3GR9 A;  2CST A;  3I16 A;  3NU8 A;  5DJ1 A;  4F5J A;  1C0N A;  1WYU A;  3B1E A;  3NX3 A;  4JF0 A;  4ZAS A;  3ZZK A;  1GC4 A;  1X0M A;  4A0G A;  1M0O A;  4MY5 A;  2DR1 A;  1IAX A;  1FG7 A;  3AEJ A;  1OXP A;  2E7I A;  4BHD A;  2AAT A;  4ADE A;  4LC3 A;  2FM1 A;  4CBS A;  3NRA A;  4AO4 A;  2D5Y A;  1D2F A;  1AX4 A;  3NYT A;  4OBV A;  2FYF A;  2OGE A;  3ISL A;  4QGR A;  1G4X A;  1BW0 A;  2DKB A;  1BS0 A;  1GBN A;  2ZSM A;  3EI8 A;  3BCB A;  4K2M A;  1AMR A;  2VYC A;  2YHK A;  3LVK A;  4Y0H A;  3WX9 A;  3PDX A;  4ZWV A;  1QIS A;  1AJS A;  3QM2 A;  1GC0 A;  3BB8 A;  4GSA A;  4F5H A;  1AY5 A;  1O62 A;  2Z20 A;  4WYF A;  2OKK A;  1T3I A;  4MQQ A;  2AY5 A;  1LC5 A;  5LHA A;  3ELP A;  2C7T A;  2F8J A;  3FSL A;  1SZU A;  3RI6 A;  2JJE A;  1CQ6 A;  5BJ4 A;  1ECX A;  3Q8N A;  4W1V A;  1IX7 A;  2VI8 A;  3K40 A;  2R0T A;  4I8A A;  1DFO A;  5G2Q A;  2W8J A;  2HUF A;  3QPG A;  2VGU A;  1IX8 A;  1GEW A;  1JF9 A;  1SPA A;  3BS8 A;  5DX5 A;  3RQ1 A;  2YCN A;  1DTY A;  1ZC9 A;  2JGT A; 
#chains in the Genus database with same CATH topology
 1W23 A;  3BCA A;  1PG8 A;  4JE5 A;  3DR7 A;  1N8P A;  3OKS A;  4XQ2 A;  2R2N A;  4AZK A;  8AAT A;  1GCK A;  5EAV A;  3HLM A;  2W7J A;  2DKJ A;  5D95 A;  3CQ5 A;  2VGT A;  4IX8 A;  5EIG A;  1YOO A;  2VGZ A;  1S08 A;  1ELQ A;  2ZUK A;  4W91 A;  4F5I A;  1S09 A;  3LVM A;  2G6W A;  1BQD A;  1AHF A;  5FT4 A;  2JIS A;  4ZWM A;  2X5D A;  3JU7 A;  1DJ9 A;  1ZOD A;  1MDO A;  3FFH A;  3K28 A;  3KE3 A;  1KMJ A;  1AHG A;  3UE8 A;  3TFT A;  3NTJ A;  2OAT A;  4B98 A;  2EO5 A;  3P6K A;  4XEW A;  1BJ4 A;  1OHV A;  2ZC0 A;  2QB2 A;  1LS3 A;  2BIE A;  1Z3Z A;  5JAY A;  1I43 A;  2A1V A;  1ARI A;  3P1T A;  1BJW A;  1DJU A;  3DRD A;  3RCH B;  2YKY A;  3EI7 A;  4IW7 A;  2RFV A;  2TPL A;  1B4X A;  4GDY A;  1C7N A;  1D7V A;  1PMM A;  1SZS A;  2BWP A;  2ZJG A;  2D7Y A;  4TN4 A;  3VK2 A;  3A9X A;  1MLY A;  1M0Q A;  4TMR A;  3EI9 A;  4M2K A;  2D64 A;  1ASF A;  2X3L A;  4OCA A;  1AY4 A;  1CQ8 A;  3WLX A;  2CAN A;  1W7M A;  4ZLV A;  2EZ2 A;  2V0Y A;  1GEX A;  1IBJ A;  1XEY A;  1X29 A;  3FZ6 A;  1AHY A;  3HVY A;  3MAF B;  3RUY A;  1D7R A;  3TQX A;  3BWN C;  1SF2 A;  3GBX A;  4UHO A;  1AHX A;  3LVL B;  2R5C A;  5EFS A;  4BA5 A;  1UKJ A;  3ACZ A;  4IYO B;  2YKV A;  1MGV A;  2DOU A;  3E2F A;  4ITX A;  4WLH A;  4A6R A;  2JJG A;  2YKX A;  2C81 A;  4WXF A;  4WYC A;  1WYT B;  3I5T A;  2C44 A;  3LG0 A;  3E9K A;  4J8L A;  3PDB B;  4P7Y A;  4E1O A;  1AHE A;  1KL1 A;  2CIN A;  2BYJ A;  1UU2 A;  2WK7 A;  4WXB A;  4JEY A;  4GRX A;  1W7N A;  1G4V A;  2AY3 A;  2VGW A;  2VMU A;  3B1C A;  3DC1 A;  1QJ5 A;  1ARS A;  1N2T A;  1S06 A;  1SVV A;  2Z9X A;  2QMA A;  3GZD A;  1MDX A;  4OBU A;  3FRK A;  4R2N A;  4RKC A;  1W3U A;  4ZDL A;  1GD9 A;  2VMW A;  3ZRR A;  4WB0 A;  2VLF A;  1OHY A;  2OKJ A;  1AAW A;  1WYU B;  1V2E A;  5TF5 A;  4F5K A;  2WKA A;  3FQ8 A;  1ART A;  3BC8 A;  1ORD A;  2HOZ A;  3BWN A;  2O7C A;  3DZZ A;  4WYE A;  1C7O A;  5M4D A;  2Z9W A;  1LC7 A;  3T32 A;  2DGM A;  3LV2 A;  1BJO A;  1TAR A;  2O0R A;  3FD0 A;  4FFC A;  3NNK A;  3G8M A;  4MQR A;  4XJM A;  3AEN A;  1C7G A;  1CL1 A;  4IY7 A;  2CJG A;  4PVF A;  2VMX A;  1KL2 A;  2E7U A;  1AJS B;  3GET A;  4DQ6 A;  3FQA A;  1MAQ A;  4WYG A;  1X2A A;  2BKW A;  2ZY3 A;  3FVX A;  3E77 A;  4RJY A;  3ZRQ A;  4JEV A;  4K2B A;  3H14 A;  1JS3 A;  3HMU A;  4RIT A;  3VK4 A;  1MAP A;  1B9H A;  2Q7W A;  3TCM A;  3FVS A;  3N4X A;  2VMT A;  5G2P A;  4U1T A;  2EH6 A;  2CB1 A;  3CBF A;  3G0T A;  1TOJ A;  3BV0 A;  1GC3 A;  2C0R A;  3RBL A;  3JWA A;  4EMY A;  1CQ7 A;  3FQ7 A;  1UU0 A;  1VJO A;  4ISY A;  2CFB A;  4W1W A;  3B1D A;  1JG8 A;  1W7L A;  1SFF A;  3VAX A;  1DGE A;  1RV3 A;  3D6K A;  3GSB A;  2O1B A;  3N7N A;  1AJR A;  5EUN A;  2G7J A;  2AY1 A;  5E4Z A;  3WKS A;  4E77 A;  1OHW A;  1VEF A;  4MSO A;  3PD6 A;  4CXQ A;  3FDD A;  4IXS A;  3H9X A;  3MC6 C;  2HP1 A;  3E2Z A;  3USF A;  1C4K A;  4U2H A;  2ZY2 A;  1X28 A;  5EIG B;  4DGT A;  3BN1 A;  3MKJ A;  4ATQ A;  1QZ9 A;  3DXW A;  3DYD A;  3COG A;  1YJS A;  1SZK A;  3GJU A;  2VMY A;  3QGU A;  2W7H A;  2ZY4 A;  3NYS A;  2HOY A;  3PGY A;  3CQ6 A;  1GDE A;  2FN6 A;  1M7Y A;  3DXV A;  2D7Z A;  2HP2 A;  3W1I A;  1LK9 A;  1MLZ A;  1Y4I A;  1E5F A;  2FKI A;  2XH1 A;  1TAS A;  2CTZ A;  3EI5 A;  1ASD A;  3LWS A;  4FL0 A;  5F8V A;  5C6U A;  2HOR A;  3ASB A;  4A6U A;  3ELE A;  2FQ6 A;  3AAT A;  1B8G A;  3QBO A;  2PB2 A;  3WZF A;  2VI9 A;  3NU7 A;  5DJ9 A;  5DB5 A;  4A0H A;  2VMQ A;  3OP7 A;  4E3Q A;  2VMN A;  4OYT A;  3B46 A;  3F9T A;  4XAU A;  2D66 A;  3EIA A;  3MEB A;  3I4J A;  3VK3 A;  4AOA A;  5J8Q A;  1UU1 A;  4WP0 A;  2AEU A;  3HBX A;  4CXR A;  3MAU A;  4Q31 A;  4ZAH A;  1FG3 A;  3W1J A;  4MKJ A;  1BKG A;  2R5C B;  2W8V A;  4H63 Q;  1AKB A;  1IVR A;  2AY6 A;  1I41 A;  1AMS A;  3PIU A;  5G4I A;  4BA4 A;  5E3K A;  1B5O A;  2W7G A;  2VMR A;  3LVJ A;  2D65 A;  1DJE A;  2AY8 A;  4CVQ A;  1U08 A;  4Y0I A;  3WGC A;  2ZYJ A;  1EJI A;  3LY1 A;  1AKA A;  4IXO A;  4ADC A;  2GMS A;  1IAY A;  1JS6 A;  2EGY A;  3N75 A;  2QBT A;  2PB0 A;  3G7Q A;  3AEM C;  4MGR A;  4MQP A;  1AIB A;  3JTX A;  2Z61 A;  5EQC A;  4LNJ A;  4JEX A;  1TOK A;  2OGA A;  1AMQ A;  1IUG A;  4GEB A;  4OMA A;  4WYD A;  4AO9 A;  3R9A A;  4WB0 B;  3L8A A;  3E6G A;  4EB5 A;  1O61 A;  1WYV A;  2HOX A;  1WKH A;  4WYA A;  3VOM A;  4BQ0 A;  4TV7 A;  4GE9 A;  3FFR A;  2ZP7 A;  1RV4 A;  2X8U A;  2JJH A;  2OQX A;  3DU4 A;  1BJO B;  4WBT A;  1IJI A;  1H0C A;  1S07 A;  1AIC A;  2AY4 A;  3AEJ C;  3AEN B;  4J5U A;  4JEZ A;  3PJ0 A;  5F9S A;  3BCX A;  3FZ7 A;  2Z9U A;  4F5G A;  2BI2 A;  4IXZ A;  3F0H A;  1D7S A;  1M32 A;  2DGL A;  4RM1 A;  4ZM3 A;  1ASA A;  1WST A;  1V2F A;  3CAI A;  4ITG A;  5FT5 A;  3TAT A;  1V72 A;  2AY7 A;  2X5F A;  5EUE A;  3MAD A;  3JWB A;  3A9Y A;  2D63 A;  5FT6 A;  4AZJ A;  1YIY A;  1ASL A;  3NYU A;  4ATP A;  3NDN A;  3AEO A;  2V1P A;  1WKG A;  3F6T A;  7AAT A;  3JW9 A;  2WB6 A;  2YRR A;  3HDO A;  4UOY A;  4BMK A;  4OTL A;  3FZ8 A;  2VGV A;  3ZZJ A;  2VLH A;  4UHM A;  1N31 A;  1YAA A;  3A9Z A;  5G0A A;  2VMS A;  5E5I A;  1YJY A;  1CZC A;  4JEW A;  4A00 A;  1YJZ A;  1DKA A;  1ELU A;  1J32 A;  1V2D A;  3JZL A;  4H51 A;  2BWO A;  4E3R A;  4A72 A;  2QSR A;  3PD6 B;  3WCO A;  4PIW A;  1CS1 A;  1G7W A;  1AKC A;  2VMO A;  4W5K A;  5I92 A;  3FVU A;  2W7E A;  3H7F A;  2VIB A;  3E2Z B;  4F4E A;  4UHN A;  3AOW A;  3A8U X;  4K05 A;  2Z9V A;  1TOG A;  1GC2 A;  4B9B A;  4ZM4 A;  2JJF A;  2AY9 A;  4A0F A;  3B8X A;  1QGN A;  4JE5 D;  1TPL A;  2W8T A;  2BWN A;  4RJ0 A;  5AX8 A;  1VP4 A;  1ASG A;  1H1C A;  4WD2 A;  2W7F A;  4Q75 A;  1TAT A;  5IWQ A;  4F5F A;  3KGX A;  4N0B A;  5G4J A;  5HXX A;  5LH9 A;  2WK8 A;  2YCP A;  2Z67 A;  1ARH A;  3WGB A;  4ZDP A;  5M4B A;  4GE4 A;  2BIG A;  1M6S A;  3WKR A;  4RIZ A;  2FNU A;  4ADB A;  4ADD A;  3UWC A;  1I48 A;  1XI9 A;  2GQN A;  4K2I A;  4ZDO A;  3PPL A;  2HUI A;  2QLR A;  2AY2 A;  4P3M A;  4UQV A;  2BI9 A;  2YCT A;  3EIB A;  5BJ3 A;  4KYO A;  2R5E A;  3BWO A;  3RBF A;  2W7D A;  3N5M A;  2ZSL A;  2W7M A;  5FT8 A;  1M4N A;  5G09 A;  1M0P A;  1B5P A;  2KFP A;  5KTB A;  4Q76 A;  4OT8 A;  4WXG A;  1G7X A;  2HUU A;  1RVU A;  3N4R A;  3QHX A;  3MC6 A;  3E2Y A;  1AY8 A;  2BI5 A;  2ORD A;  1O69 A;  3NUI A;  1ZOB A;  3MBB A;  4M2M A;  3IHJ A;  1J04 A;  4HF8 A;  2W8W A;  1LW5 A;  1CL2 A;  2GMU A;  4LW4 A;  4KXK A;  4RKD A;  4RLG A;  2CH2 A;  1B9I A;  4Q6R A;  5HHY A;  1TOI A;  5K8B A;  3N4S A;  1MDZ A;  2W7K A;  2CY8 A;  1S0A A;  3QN6 A;  3ZRP A;  3EI6 A;  1EQB A;  4XJO A;  4A0R A;  4RAE A;  3AEL A;  4PFN A;  4W8I A;  3AV7 A;  5EUD A;  3FDB A;  3FKD A;  4MKK A;  2W7L A;  1E5E A;  4WLJ A;  4ZSW A;  1M0N A;  3N0L A;  3EUC A;  2BI1 A;  2D61 A;  2JG2 A;  1BJN A;  1I29 A;  3HT4 A;  1ASN A;  3II0 A;  2BHX A;  3GZD C;  3KKI A;  2W7I A;  3WY7 A;  1ASM A;  2EZ1 A;  3DOD A;  2E7J A;  3UAK A;  2VMV A;  2YOB A;  2YRI A;  2EPJ A;  3IF2 A;  2VMZ A;  1WYV B;  1CJ0 A;  1OXO A;  3M5U A;  4XK1 A;  3W1H A;  5EAA A;  1D7U A;  3RCH A;  4JF1 A;  2FNI A;  1O4S A;  3R4T A;  2XBN A;  3L44 A;  1PMO A;  4EFF A;  4OC9 A;  4Y0D A;  2AEV A;  1EG5 A;  4HVK A;  1YNU A;  4PFF A;  4N0W A;  3ATH A;  4A6T A;  1ASC A;  1C9C A;  2BIA A;  4XJP A;  2ZY5 A;  2YKU A;  1DGD A;  3ASA A;  4R8D A;  1QIR A;  4AH3 A;  1KKP A;  1TOE A;  3KGW A;  3PA9 A;  1AAM A;  1IX6 A;  1GEY A;  2Z1Y A;  1ASB A;  4F5L A;  4LNM A;  1KKJ A;  3MAF A;  1ASE A;  4R5F A;  3TFU A;  1RVY A;  3AEP A;  3EZ1 A;  4XJL A;  2GSA A;  1P3W A;  1YIZ A;  3K7Y A;  4LW2 A;  2BYL A;  3PAA A;  1AIA A;  5M49 A;  2CJD A;  1Z7D A;  2GB3 A;  3AOV A;  3GZC A;  2DGK A;  1LW4 A;  4IYO A;  2VIA A;  3WCN A;  2CH1 A;  1BT4 A;  4M2J A;  4NOG A;  3NUB A;  4EB7 A;  2BI3 A;  1LC8 A;  1WYT A;  4CBR A;  2QA3 A;  3HQT A;  4DBC A;  2VMP A;  3PDB A;  1BQA A;  1CZE A;  2VGS A;  5HDM A;  3ECD A;  1OAT A;  1LKC A;  4KAM A;  3QI6 A;  2CJH A;  3AEM A;  1FC4 A;  3GWP A;  4W1X A;  2QB3 A;  1PFF A;  1ARG A;  1QJ3 A;  9AAT A;  3EZS A;  4F5M A;  3CQ4 A;  3DR4 A;  1AMA A;  4GE7 A;  2WK9 A;  2EYQ A;  1KMK A;  3HL2 A;  5M46 A;  2PO3 A;  4L0O A;  4R5Z A;  5D5S A;  2NMP A;  4O6Z A;  1QIT A;  2HZP A;  2E54 A;  4LNL A;  3FTB A;  4EU1 A;  2W8U A;  4ZSY A;  3VP6 A;  3A2B A;  2Z1Z A;  3FCR A;  3GR9 A;  2CST A;  3I16 A;  3NU8 A;  5DJ1 A;  4F5J A;  1C0N A;  1WYU A;  3B1E A;  3NX3 A;  4JF0 A;  4ZAS A;  3ZZK A;  1GC4 A;  1X0M A;  4A0G A;  1M0O A;  4MY5 A;  2DR1 A;  1IAX A;  1FG7 A;  3AEJ A;  1OXP A;  2E7I A;  4BHD A;  2AAT A;  4ADE A;  4LC3 A;  2FM1 A;  4CBS A;  3NRA A;  4AO4 A;  2D5Y A;  1D2F A;  1AX4 A;  3NYT A;  4OBV A;  2FYF A;  2OGE A;  3ISL A;  4QGR A;  1G4X A;  1BW0 A;  2DKB A;  1BS0 A;  1GBN A;  2ZSM A;  3EI8 A;  3BCB A;  4K2M A;  1AMR A;  2VYC A;  2YHK A;  3LVK A;  4Y0H A;  3WX9 A;  3PDX A;  4ZWV A;  1QIS A;  1KAF A;  1AJS A;  3QM2 A;  1GC0 A;  3BB8 A;  4GSA A;  4F5H A;  1AY5 A;  1O62 A;  2Z20 A;  4WYF A;  2OKK A;  1T3I A;  4MQQ A;  2AY5 A;  1LC5 A;  5LHA A;  3ELP A;  2C7T A;  2F8J A;  3FSL A;  1SZU A;  3RI6 A;  2JJE A;  1CQ6 A;  5BJ4 A;  1ECX A;  3Q8N A;  4W1V A;  1IX7 A;  2VI8 A;  3K40 A;  2R0T A;  4I8A A;  1DFO A;  5G2Q A;  2W8J A;  2HUF A;  3QPG A;  2VGU A;  1IX8 A;  1GEW A;  1JF9 A;  1SPA A;  3BS8 A;  5DX5 A;  3RQ1 A;  2YCN A;  1DTY A;  1ZC9 A;  2JGT A; 
#chains in the Genus database with same CATH homology
 1W23 A;  3BCA A;  1PG8 A;  4JE5 A;  3DR7 A;  1N8P A;  3OKS A;  4XQ2 A;  2R2N A;  4AZK A;  8AAT A;  1GCK A;  5EAV A;  3HLM A;  2W7J A;  2DKJ A;  5D95 A;  3CQ5 A;  2VGT A;  4IX8 A;  5EIG A;  1YOO A;  2VGZ A;  1S08 A;  1ELQ A;  2ZUK A;  4W91 A;  4F5I A;  1S09 A;  3LVM A;  2G6W A;  1BQD A;  1AHF A;  5FT4 A;  2JIS A;  4ZWM A;  2X5D A;  3JU7 A;  1DJ9 A;  1ZOD A;  1MDO A;  3FFH A;  3K28 A;  3KE3 A;  1KMJ A;  1AHG A;  3UE8 A;  3TFT A;  3NTJ A;  2OAT A;  4B98 A;  2EO5 A;  3P6K A;  4XEW A;  1BJ4 A;  1OHV A;  2ZC0 A;  2QB2 A;  1LS3 A;  2BIE A;  1Z3Z A;  5JAY A;  1I43 A;  2A1V A;  1ARI A;  3P1T A;  1BJW A;  1DJU A;  3DRD A;  3RCH B;  2YKY A;  3EI7 A;  4IW7 A;  2RFV A;  2TPL A;  1B4X A;  4GDY A;  1C7N A;  1D7V A;  1PMM A;  1SZS A;  2BWP A;  2ZJG A;  2D7Y A;  4TN4 A;  3VK2 A;  3A9X A;  1MLY A;  1M0Q A;  4TMR A;  3EI9 A;  4M2K A;  2D64 A;  1ASF A;  2X3L A;  4OCA A;  1AY4 A;  1CQ8 A;  3WLX A;  2CAN A;  1W7M A;  4ZLV A;  2EZ2 A;  2V0Y A;  1GEX A;  1IBJ A;  1XEY A;  1X29 A;  3FZ6 A;  1AHY A;  3HVY A;  3MAF B;  3RUY A;  1D7R A;  3TQX A;  3BWN C;  1SF2 A;  3GBX A;  4UHO A;  1AHX A;  3LVL B;  2R5C A;  5EFS A;  4BA5 A;  1UKJ A;  3ACZ A;  4IYO B;  2YKV A;  1MGV A;  2DOU A;  3E2F A;  4ITX A;  4WLH A;  4A6R A;  2JJG A;  2YKX A;  2C81 A;  4WXF A;  4WYC A;  1WYT B;  3I5T A;  2C44 A;  3LG0 A;  3E9K A;  4J8L A;  3PDB B;  4P7Y A;  4E1O A;  1AHE A;  1KL1 A;  2CIN A;  2BYJ A;  1UU2 A;  2WK7 A;  4WXB A;  4JEY A;  4GRX A;  1W7N A;  1G4V A;  2AY3 A;  2VGW A;  2VMU A;  3B1C A;  3DC1 A;  1QJ5 A;  1ARS A;  1N2T A;  1S06 A;  1SVV A;  2Z9X A;  2QMA A;  3GZD A;  1MDX A;  4OBU A;  3FRK A;  4R2N A;  4RKC A;  1W3U A;  4ZDL A;  1GD9 A;  2VMW A;  3ZRR A;  4WB0 A;  2VLF A;  1OHY A;  2OKJ A;  1AAW A;  1WYU B;  1V2E A;  5TF5 A;  4F5K A;  2WKA A;  3FQ8 A;  1ART A;  3BC8 A;  1ORD A;  2HOZ A;  3BWN A;  2O7C A;  3DZZ A;  4WYE A;  1C7O A;  5M4D A;  2Z9W A;  1LC7 A;  3T32 A;  2DGM A;  3LV2 A;  1BJO A;  1TAR A;  2O0R A;  3FD0 A;  4FFC A;  3NNK A;  3G8M A;  4MQR A;  4XJM A;  3AEN A;  1C7G A;  1CL1 A;  4IY7 A;  2CJG A;  4PVF A;  2VMX A;  1KL2 A;  2E7U A;  1AJS B;  3GET A;  4DQ6 A;  3FQA A;  1MAQ A;  4WYG A;  1X2A A;  2BKW A;  2ZY3 A;  3FVX A;  3E77 A;  4RJY A;  3ZRQ A;  4JEV A;  4K2B A;  3H14 A;  1JS3 A;  3HMU A;  4RIT A;  3VK4 A;  1MAP A;  1B9H A;  2Q7W A;  3TCM A;  3FVS A;  3N4X A;  2VMT A;  5G2P A;  4U1T A;  2EH6 A;  2CB1 A;  3CBF A;  3G0T A;  1TOJ A;  3BV0 A;  1GC3 A;  2C0R A;  3RBL A;  3JWA A;  4EMY A;  1CQ7 A;  3FQ7 A;  1UU0 A;  1VJO A;  4ISY A;  2CFB A;  4W1W A;  3B1D A;  1JG8 A;  1W7L A;  1SFF A;  3VAX A;  1DGE A;  1RV3 A;  3D6K A;  3GSB A;  2O1B A;  3N7N A;  1AJR A;  5EUN A;  2G7J A;  2AY1 A;  5E4Z A;  3WKS A;  4E77 A;  1OHW A;  1VEF A;  4MSO A;  3PD6 A;  4CXQ A;  3FDD A;  4IXS A;  3H9X A;  3MC6 C;  2HP1 A;  3E2Z A;  3USF A;  1C4K A;  4U2H A;  2ZY2 A;  1X28 A;  5EIG B;  4DGT A;  3BN1 A;  3MKJ A;  4ATQ A;  1QZ9 A;  3DXW A;  3DYD A;  3COG A;  1YJS A;  1SZK A;  3GJU A;  2VMY A;  3QGU A;  2W7H A;  2ZY4 A;  3NYS A;  2HOY A;  3PGY A;  3CQ6 A;  1GDE A;  2FN6 A;  1M7Y A;  3DXV A;  2D7Z A;  2HP2 A;  3W1I A;  1LK9 A;  1MLZ A;  1Y4I A;  1E5F A;  2FKI A;  2XH1 A;  1TAS A;  2CTZ A;  3EI5 A;  1ASD A;  3LWS A;  4FL0 A;  5F8V A;  5C6U A;  2HOR A;  3ASB A;  4A6U A;  3ELE A;  2FQ6 A;  3AAT A;  1B8G A;  3QBO A;  2PB2 A;  3WZF A;  2VI9 A;  3NU7 A;  5DJ9 A;  5DB5 A;  4A0H A;  2VMQ A;  3OP7 A;  4E3Q A;  2VMN A;  4OYT A;  3B46 A;  3F9T A;  4XAU A;  2D66 A;  3EIA A;  3MEB A;  3I4J A;  3VK3 A;  4AOA A;  5J8Q A;  1UU1 A;  4WP0 A;  2AEU A;  3HBX A;  4CXR A;  3MAU A;  4Q31 A;  4ZAH A;  1FG3 A;  3W1J A;  4MKJ A;  1BKG A;  2R5C B;  2W8V A;  4H63 Q;  1AKB A;  1IVR A;  2AY6 A;  1I41 A;  1AMS A;  3PIU A;  5G4I A;  4BA4 A;  5E3K A;  1B5O A;  2W7G A;  2VMR A;  3LVJ A;  2D65 A;  1DJE A;  2AY8 A;  4CVQ A;  1U08 A;  4Y0I A;  3WGC A;  2ZYJ A;  1EJI A;  3LY1 A;  1AKA A;  4IXO A;  4ADC A;  2GMS A;  1IAY A;  1JS6 A;  2EGY A;  3N75 A;  2QBT A;  2PB0 A;  3G7Q A;  3AEM C;  4MGR A;  4MQP A;  1AIB A;  3JTX A;  2Z61 A;  5EQC A;  4LNJ A;  4JEX A;  1TOK A;  2OGA A;  1AMQ A;  1IUG A;  4GEB A;  4OMA A;  4WYD A;  4AO9 A;  3R9A A;  4WB0 B;  3L8A A;  3E6G A;  4EB5 A;  1O61 A;  1WYV A;  2HOX A;  1WKH A;  4WYA A;  3VOM A;  4BQ0 A;  4TV7 A;  4GE9 A;  3FFR A;  2ZP7 A;  1RV4 A;  2X8U A;  2JJH A;  2OQX A;  3DU4 A;  1BJO B;  4WBT A;  1IJI A;  1H0C A;  1S07 A;  1AIC A;  2AY4 A;  3AEJ C;  3AEN B;  4J5U A;  4JEZ A;  3PJ0 A;  5F9S A;  3BCX A;  3FZ7 A;  2Z9U A;  4F5G A;  2BI2 A;  4IXZ A;  3F0H A;  1D7S A;  1M32 A;  2DGL A;  4RM1 A;  4ZM3 A;  1ASA A;  1WST A;  1V2F A;  3CAI A;  4ITG A;  5FT5 A;  3TAT A;  1V72 A;  2AY7 A;  2X5F A;  5EUE A;  3MAD A;  3JWB A;  3A9Y A;  2D63 A;  5FT6 A;  4AZJ A;  1YIY A;  1ASL A;  3NYU A;  4ATP A;  3NDN A;  3AEO A;  2V1P A;  1WKG A;  3F6T A;  7AAT A;  3JW9 A;  2WB6 A;  2YRR A;  3HDO A;  4UOY A;  4BMK A;  4OTL A;  3FZ8 A;  2VGV A;  3ZZJ A;  2VLH A;  4UHM A;  1N31 A;  1YAA A;  3A9Z A;  5G0A A;  2VMS A;  5E5I A;  1YJY A;  1CZC A;  4JEW A;  4A00 A;  1YJZ A;  1DKA A;  1ELU A;  1J32 A;  1V2D A;  3JZL A;  4H51 A;  2BWO A;  4E3R A;  4A72 A;  2QSR A;  3PD6 B;  3WCO A;  4PIW A;  1CS1 A;  1G7W A;  1AKC A;  2VMO A;  4W5K A;  5I92 A;  3FVU A;  2W7E A;  3H7F A;  2VIB A;  3E2Z B;  4F4E A;  4UHN A;  3AOW A;  3A8U X;  4K05 A;  2Z9V A;  1TOG A;  1GC2 A;  4B9B A;  4ZM4 A;  2JJF A;  2AY9 A;  4A0F A;  3B8X A;  1QGN A;  4JE5 D;  1TPL A;  2W8T A;  2BWN A;  4RJ0 A;  5AX8 A;  1VP4 A;  1ASG A;  1H1C A;  4WD2 A;  2W7F A;  4Q75 A;  1TAT A;  5IWQ A;  4F5F A;  3KGX A;  4N0B A;  5G4J A;  5HXX A;  5LH9 A;  2WK8 A;  2YCP A;  2Z67 A;  1ARH A;  3WGB A;  4ZDP A;  5M4B A;  4GE4 A;  2BIG A;  1M6S A;  3WKR A;  4RIZ A;  2FNU A;  4ADB A;  4ADD A;  3UWC A;  1I48 A;  1XI9 A;  2GQN A;  4K2I A;  4ZDO A;  3PPL A;  2HUI A;  2QLR A;  2AY2 A;  4P3M A;  4UQV A;  2BI9 A;  2YCT A;  3EIB A;  5BJ3 A;  4KYO A;  2R5E A;  3BWO A;  3RBF A;  2W7D A;  3N5M A;  2ZSL A;  2W7M A;  5FT8 A;  1M4N A;  5G09 A;  1M0P A;  1B5P A;  2KFP A;  5KTB A;  4Q76 A;  4OT8 A;  4WXG A;  1G7X A;  2HUU A;  1RVU A;  3N4R A;  3QHX A;  3MC6 A;  3E2Y A;  1AY8 A;  2BI5 A;  2ORD A;  1O69 A;  3NUI A;  1ZOB A;  3MBB A;  4M2M A;  3IHJ A;  1J04 A;  4HF8 A;  2W8W A;  1LW5 A;  1CL2 A;  2GMU A;  4LW4 A;  4KXK A;  4RKD A;  4RLG A;  2CH2 A;  1B9I A;  4Q6R A;  5HHY A;  1TOI A;  5K8B A;  3N4S A;  1MDZ A;  2W7K A;  2CY8 A;  1S0A A;  3QN6 A;  3ZRP A;  3EI6 A;  1EQB A;  4XJO A;  4A0R A;  4RAE A;  3AEL A;  4PFN A;  4W8I A;  3AV7 A;  5EUD A;  3FDB A;  3FKD A;  4MKK A;  2W7L A;  1E5E A;  4WLJ A;  4ZSW A;  1M0N A;  3N0L A;  3EUC A;  2BI1 A;  2D61 A;  2JG2 A;  1BJN A;  1I29 A;  3HT4 A;  1ASN A;  3II0 A;  2BHX A;  3GZD C;  3KKI A;  2W7I A;  3WY7 A;  1ASM A;  2EZ1 A;  3DOD A;  2E7J A;  3UAK A;  2VMV A;  2YOB A;  2YRI A;  2EPJ A;  3IF2 A;  2VMZ A;  1WYV B;  1CJ0 A;  1OXO A;  3M5U A;  4XK1 A;  3W1H A;  5EAA A;  1D7U A;  3RCH A;  4JF1 A;  2FNI A;  1O4S A;  3R4T A;  2XBN A;  3L44 A;  1PMO A;  4EFF A;  4OC9 A;  4Y0D A;  2AEV A;  1EG5 A;  4HVK A;  1YNU A;  4PFF A;  4N0W A;  3ATH A;  4A6T A;  1ASC A;  1C9C A;  2BIA A;  4XJP A;  2ZY5 A;  2YKU A;  1DGD A;  3ASA A;  4R8D A;  1QIR A;  4AH3 A;  1KKP A;  1TOE A;  3KGW A;  3PA9 A;  1AAM A;  1IX6 A;  1GEY A;  2Z1Y A;  1ASB A;  4F5L A;  4LNM A;  1KKJ A;  3MAF A;  1ASE A;  4R5F A;  3TFU A;  1RVY A;  3AEP A;  3EZ1 A;  4XJL A;  2GSA A;  1P3W A;  1YIZ A;  3K7Y A;  4LW2 A;  2BYL A;  3PAA A;  1AIA A;  5M49 A;  2CJD A;  1Z7D A;  2GB3 A;  3AOV A;  3GZC A;  2DGK A;  1LW4 A;  4IYO A;  2VIA A;  3WCN A;  2CH1 A;  1BT4 A;  4M2J A;  4NOG A;  3NUB A;  4EB7 A;  2BI3 A;  1LC8 A;  1WYT A;  4CBR A;  2QA3 A;  3HQT A;  4DBC A;  2VMP A;  3PDB A;  1BQA A;  1CZE A;  2VGS A;  5HDM A;  3ECD A;  1OAT A;  1LKC A;  4KAM A;  3QI6 A;  2CJH A;  3AEM A;  1FC4 A;  3GWP A;  4W1X A;  2QB3 A;  1PFF A;  1ARG A;  1QJ3 A;  9AAT A;  3EZS A;  4F5M A;  3CQ4 A;  3DR4 A;  1AMA A;  4GE7 A;  2WK9 A;  2EYQ A;  1KMK A;  3HL2 A;  5M46 A;  2PO3 A;  4L0O A;  4R5Z A;  5D5S A;  2NMP A;  4O6Z A;  1QIT A;  2HZP A;  2E54 A;  4LNL A;  3FTB A;  4EU1 A;  2W8U A;  4ZSY A;  3VP6 A;  3A2B A;  2Z1Z A;  3FCR A;  3GR9 A;  2CST A;  3I16 A;  3NU8 A;  5DJ1 A;  4F5J A;  1C0N A;  1WYU A;  3B1E A;  3NX3 A;  4JF0 A;  4ZAS A;  3ZZK A;  1GC4 A;  1X0M A;  4A0G A;  1M0O A;  4MY5 A;  2DR1 A;  1IAX A;  1FG7 A;  3AEJ A;  1OXP A;  2E7I A;  4BHD A;  2AAT A;  4ADE A;  4LC3 A;  2FM1 A;  4CBS A;  3NRA A;  4AO4 A;  2D5Y A;  1D2F A;  1AX4 A;  3NYT A;  4OBV A;  2FYF A;  2OGE A;  3ISL A;  4QGR A;  1G4X A;  1BW0 A;  2DKB A;  1BS0 A;  1GBN A;  2ZSM A;  3EI8 A;  3BCB A;  4K2M A;  1AMR A;  2VYC A;  2YHK A;  3LVK A;  4Y0H A;  3WX9 A;  3PDX A;  4ZWV A;  1QIS A;  1AJS A;  3QM2 A;  1GC0 A;  3BB8 A;  4GSA A;  4F5H A;  1AY5 A;  1O62 A;  2Z20 A;  4WYF A;  2OKK A;  1T3I A;  4MQQ A;  2AY5 A;  1LC5 A;  5LHA A;  3ELP A;  2C7T A;  2F8J A;  3FSL A;  1SZU A;  3RI6 A;  2JJE A;  1CQ6 A;  5BJ4 A;  1ECX A;  3Q8N A;  4W1V A;  1IX7 A;  2VI8 A;  3K40 A;  2R0T A;  4I8A A;  1DFO A;  5G2Q A;  2W8J A;  2HUF A;  3QPG A;  2VGU A;  1IX8 A;  1GEW A;  1JF9 A;  1SPA A;  3BS8 A;  5DX5 A;  3RQ1 A;  2YCN A;  1DTY A;  1ZC9 A;  2JGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...