1TOEA

Unliganded structure of hexamutant + a293d mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 140
structure length 395
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1toeA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1toeA01
3PA9A 2VMTA 2W7FA 4W1VA 2CB1A 2VGUA 4UOYA 1Z3ZA 2BI3A 2HOZA 3R4TA 3JZLA 1DKAA 1GC0A 3RI6A 1GC2A 3DYDA 5BJ4A 4IYOB 1M0QA 1JS6A 4LNJA 4JEXA 1UKJA 4O6ZA 4Q76A 3UWCA 4B98A 7AATA 3F9TA 4JE5D 3B1CA 2O1BA 3M5UA 3EI5A 2EZ1A 3A9YA 5E3KA 1WSTA 1BS0A 3K40A 3MC6A 3NU8A 2CTZA 4RM1A 1Z7DA 4ADEA 5EQCA 3UAKA 3BN1A 2DGLA 3AOVA 4WB0B 1G7WA 3A9ZA 4EFFA 1EG5A 1IAXA 3FVXA 3RBFA 2BI5A 1O62A 1BQDA 3LVKA 1ZC9A 2VIAA 4F5FA 2C0RA 2AY1A 1VP4A 3JU7A 3DXVA 1CL2A 1S0AA 3I5TA 4WYFA 1SZKA 2BIEA 2BI9A 2QMAA 1S06A 2BI2A 1LW5A 4ZAHA 2D5YA 2YCTA 3H14A 4GSAA 4EU1A 1AMRA 1EJIA 4A0FA 3DC1A 1Y4IA 4JEVA 4RJ0A 3FVSA 5JAYA 4Y0HA 2FM1A 3JWAA 3MADA 5EAVA 3RQ1A 5F8VA 5M46A 2WK7A 2YCPA 3NU7A 1J04A 2VMVA 5DB5A 1ELUA 2F8JA 1MLZA 3WGCA 2D7ZA 2O0RA 2OGEA 3MAFB 3E2ZB 3PJ0A 4UQVA 3VP6A 4BMKA 3ZZJA 1S09A 3N75A 2W7MA 4AOAA 1AIAA 2JISA 1M0NA 3COGA 1IX7A 4J8LA 4MY5A 1QITA 4ZDPA 2PB0A 2YKUA 5TF5A 1N8PA 5E5IA 1ASBA 1N2TA 1I48A 3QPGA 2ZP7A 2VMPA 1SFFA 2JJFA 1O61A 4OBVA 1CL1A 2QB3A 1CZEA 3QHXA 4W1XA 1WYVA 3KKIA 5HHYA 2CSTA 2GMUA 4OBUA 2Q7WA 2CY8A 3LVMA 3FQ7A 3VK4A 3ATHA 1DJUA 4RAEA 4XJOA 4F5HA 1IX8A 2ZY3A 3IHJA 3E6GA 4WXGA 4A0RA 2VMNA 3CAIA 2VMUA 2VMRA 3LY1A 4HF8A 2Z1YA 5M49A 3BCAA 1AHXA 1OATA 5FT6A 1O4SA 4RIZA 1ZOBA 4AZKA 3LVJA 4FFCA 3TFUA 1U08A 4K2BA 2FN6A 3GZDA 4CBSA 4TN4A 3NYTA 3ISLA 1AHEA 3G0TA 5J8QA 1SPAA 4ZWVA 3K7YA 3HQTA 1KMKA 1M4NA 1X0MA 1YIZA 2JGTA 4GEBA 4ITXA 1GD9A 2X5DA 4K2MA 2BKWA 4R8DA 2AY8A 3LWSA 4M2JA 4WBTA 3A9XA 4IYOA 1IAYA 5DX5A 4A6UA 3HL2A 4Q6RA 2Z67A 1CQ7A 1S08A 2FNIA 1UU1A 3BWNA 2X5FA 1SVVA 4WYAA 1FC4A 3AOWA 3EI8A 1JG8A 3ACZA 8AATA 1MDXA 2X8UA 1M7YA 1FG3A 1WYTB 3NX3A 1G4VA 1TOIA 1MDOA 3AEJA 5E4ZA 3EZ1A 3ASBA 1ASLA 1AKCA 3HBXA 1AAMA 4L0OA 2XH1A 4BA4A 1TOKA 1AMAA 3T32A 2VMOA 5LHAA 2ZY4A 2BHXA 5EFSA 4ATPA 3PD6A 4XJPA 2D7YA 3BV0A 1ELQA 3LG0A 4GE4A 4N0BA 3GR9A 1S07A 4TV7A 3FSLA 1W7NA 2W7KA 4A0GA 3NRAA 4AH3A 5EAAA 3DR4A 3ECDA 4WYEA 3II0A 1MDZA 1M32A 2D63A 2AEVA 4WB0A 2AATA 5K8BA 1SZUA 2R5EA 2W8JA 3HVYA 2VGWA 4KXKA 4CXRA 5G2QA 4IX8A 3AEOA 2HP2A 3FKDA 2HZPA 1IBJA 1B8GA 4PFNA 5G4JA 2GSAA 3WY7A 3DU4A 2PO3A 2Z9UA 5FT5A 4CVQA 2W8TA 1AKAA 2AEUA 2DKBA 3K28A 1D7UA 3OKSA 1WYUA 3I4JA 4ZSYA 1GC4A 3D6KA 3RCHA 1RVUA 4Y0IA 1DFOA 1BJWA 1LC5A 4UHOA 4WYDA 4F5GA 4RITA 2GB3A 3ZZKA 2Z9VA 2DR1A 1C9CA 1B9HA 4EB7A 4W5KA 1C0NA 1UU2A 1CQ8A 3EIBA 2VIBA 3UE8A 1ECXA 1AAWA 1G4XA 4WLHA 2W7LA 4ISYA 2ZJGA 3WZFA 3LVLB 3GWPA 1BT4A 4B9BA 2JJGA 2DGKA 1J32A 4I8AA 1DTYA 2ZYJA 4WLJA 1QIRA 1VEFA 3FZ7A 2VI9A 4OT8A 3FTBA 2V1PA 2TPLA 2EZ2A 3AENA 4WXFA 5EIGA 1C7GA 4XEWA 1IVRA 4XJMA 4A6RA 3FDDA 2R5CA 3RBLA 4WYCA 3WGBA 1GCKA 2R0TA 1D7VA 1KL1A 2EH6A 3AEPA 3FD0A 1OHVA 2EGYA 3PDBA 4M2KA 1EQBA 4P3MA 5FT4A 3R9AA 2CJDA 4A6TA 1B9IA 1PG8A 2YRIA 3AEMA 3G8MA 1ASNA 2DKJA 4AO9A 2W7EA 1ASAA 3ZRQA 1V2DA 3JTXA 4R5FA 1DJEA 3FRKA 2OKJA 3AEMC 3B1EA 1X29A 1D7SA 2X3LA 2D65A 3CQ4A 3HMUA 4BHDA 3EZSA 3DR7A 1XI9A 3E2ZA 4BA5A 2BIGA 3GJUA 4FL0A 4WP0A 2VYCA 3PGYA 3AV7A 3TFTA 2Z20A 1QJ5A 1AKBA 2CJGA 2HUFA 3MEBA 2BWNA 2FNUA 5G0AA 3WX9A 4QGRA 2W7DA 1XEYA 2W8WA 2C7TA 1SF2A 2O7CA 1PMOA 1AY4A 2W7HA 2VGTA 1GEYA 4PFFA 2QBTA 2Z61A 1OHWA 3L8AA 4IXSA 1BJOA 1TOEA 4AZJA 1LK9A 2D64A 2HOXA 4LNMA 5LH9A 3Q8NA 4F5JA 4XQ2A 1QGNA 1M0OA 3EI9A 2WKAA 4E3QA 4ZDOA 1O69A 4KYOA 4Q75A 4MQRA 4DBCA 5F9SA 2RFVA 1TOGA 1CZCA 2EO5A 1T3IA 3DXWA 1BQAA 4DQ6A 1OHYA 4CBRA 1AJSA 3ELEA 2ZSLA 3GZCA 1GEXA 3MC6C 3QI6A 3HT4A 2ZSMA 1H1CA 4LC3A 2AY7A 2OGAA 2C81A 2CFBA 3A2BA 1X2AA 3IF2A 4WD2A 4XJLA 3NYUA 2AY5A 2BWOA 1BJNA 2WK8A 4ITGA 4NOGA 4R5ZA 5C6UA 2OKKA 3ASAA 2D61A 4OC9A 2XBNA 1I29A 3BWNC 5EUNA 3B46A 1KKPA 3AATA 4JF1A 4Q31A 2HOYA 1LC7A 4OCAA 3BC8A 3TCMA 2CH2A 2YCNA 1V72A 1MAQA 3PIUA 2W8UA 4A0HA 3G7QA 3L44A 4U2HA 2QLRA 4GDYA 4R2NA 3DODA 1PFFA 4H51A 3USFA 9AATA 1TOJA 4IY7A 2AY9A 1C7NA 1UU0A 1YIYA 1AMQA 2VMWA 4MSOA 2W7IA 1B4XA 3QGUA 2VI8A 3N0LA 1AHYA 4ZM3A 1LC8A 2HUUA 2PB2A 4GRXA 4XAUA 3A8UX 3CQ5A 3JWBA 5BJ3A 1I43A 3HDOA 2G6WA 4ZM4A 1P3WA 1QJ3A 2FQ6A 1BJ4A 2GQNA 4P7YA 1AIBA 2VMSA 4RLGA 3FZ8A 1MAPA 3AELA 2Z9WA 1PMMA 3AEJC 4IW7A 4F4EA 1IJIA 1IUGA 1ZODA 4ZLVA 1ASFA 1MLYA 2QB2A 3EUCA 1QISA 4BQ0A 4F5LA 2CINA 3F0HA 3W1HA 4AO4A 2E7IA 1W3UA 3BWOA 2OQXA 2HP1A 1RVYA 2AY2A 3FZ6A 2EPJA 1DGEA 2JJEA 3TATA 1YOOA 4IXOA 1D7RA 2C44A 3DZZA 3EI6A 1ORDA 1ARIA 3FVUA 3NDNA 3NUIA 3E77A 4OTLA 1YNUA 4Y0DA 4LW4A 4MQQA 4ZDLA 5DJ1A 5EUEA 1ARGA 2CANA 2VMXA 3F6TA 4N0WA 3E2FA 4DGTA 1BJOB 1W7LA 3VAXA 3GZDC 3BCXA 1CS1A 1C4KA 1AY5A 1E5FA 1E5EA 5AX8A 3RCHB 1CQ6A 3N5MA 4GE9A 1D2FA 1W23A 1X28A 3CQ6A 3GETA 5DJ9A 3EI7A 1ARHA 3KE3A 2ORDA 2YKXA 1YJZA 3WCOA 1AJSB 4A00A 1B5PA 1JS3A 3TQXA 2DOUA 3FFHA 4ATQA 2JG2A 2W8VA 3EIAA 3PAAA 2YKVA 2E54A 2W7GA 5M4BA 4HVKA 3ELPA 1IX6A 3BB8A 2VMZA 4E1OA 3ZRRA 2AY3A 1MGVA 4ZSWA 5EIGB 2ZY2A 4ADDA 2YOBA 4F5MA 3E2YA 1G7XA 1M0PA 5D5SA 4JEZA 4KAMA 3P1TA 4RKCA 3B1DA 5IWQA 1W7MA 2FYFA 4EMYA 2NMPA 1FG7A 4MQPA 4MKKA 4W8IA 2ZY5A 4LW2A 2DGMA 3WLXA 4U1TA 2AY6A 2E7JA 1YJSA 1AHGA 1AHFA 3VOMA 1C7OA 3NNKA 4WYGA 5D95A 2BIAA 1AX4A 2AY4A 2WK9A 2HORA 1GBNA 2YRRA 4ZWMA 4JF0A 1V2EA 1ARTA 2V0YA 1AICA 1OXPA 2OATA 3E9KA 1DGDA 3CBFA 3QM2A 4PIWA 4MGRA 3AENB 2ZUKA 2QA3A 2R5CB 3W1JA 3WKRA 3DRDA 4XK1A 2CJHA 5G2PA 3FFRA 1AY8A 3NYSA 4K2IA 1ASMA 4ADBA 4F5IA 1B5OA 1OXOA 3PPLA 1KL2A 1LW4A 4IXZA 1RV4A 4OMAA 4W91A 3WKSA 4EB5A 4OYTA 2VLHA 1LKCA 1M6SA 5EUDA 4A72A 3QN6A 2BI1A 1VJOA 1RV3A 3MAUA 3PDXA 1LS3A 3BCBA 1TPLA 2VGZA 4W1WA 2HUIA 2JJHA 3OP7A 2BWPA 5I92A 3W1IA 4RKDA 3VK3A 5G4IA 3KGXA 4LNLA 3MKJA 2VMYA 4WXBA 1WKGA 3MBBA 4GE7A 1KKJA 1BW0A 1GDEA 1YJYA 2BYLA 4PVFA 4E3RA 2YKYA 1TARA 1V2FA 1BKGA 4J5UA 1I41A 4M2MA 2VMQA 2BYJA 5FT8A 1ARSA 1AJRA 3FQ8A 1GC3A 3H7FA 5HDMA 3I16A 1GEWA 2D66A 2Z1ZA 1ASCA 3KGWA 1N31A 3QBOA 1DJ9A 1TASA 4JEYA 1WYVB 3HLMA 1QZ9A 2W7JA 3RUYA 4TMRA 2Z9XA 3LV2A 5M4DA 2ZC0A 1TATA 1SZSA 4ADCA 4RJYA 1ASEA 3NTJA 4CXQA 1AMSA 1ASDA 1YAAA 1CJ0A 3JW9A 3FQAA 4JEWA 3BS8A 4ZASA 3WCNA 3NUBA 2GMSA 4UHMA 2VGSA 2CH1A 2VGVA 4UHNA 4F5KA 3P6KA 1KMJA 1WYTA 2E7UA 1WKHA 3VK2A 1H0CA 3FCRA 5HXXA 2R2NA 4MKJA 3GBXA 3FDBA 3MAFA 3PDBB 4JE5A 3GSBA 1JF9A 2VLFA 3B8XA 1ASGA 1WYUB 3ZRPA 4E77A 2YHKA 5G09A 3PD6B
chains in the Genus database with same CATH superfamily
3PA9A 2VMTA 2W7FA 4W1VA 2CB1A 2VGUA 4UOYA 1Z3ZA 2BI3A 2HOZA 3R4TA 3JZLA 1DKAA 1GC0A 3RI6A 1GC2A 3DYDA 5BJ4A 4IYOB 1M0QA 1JS6A 4LNJA 4JEXA 1UKJA 4O6ZA 4Q76A 3UWCA 4B98A 7AATA 3F9TA 4JE5D 3B1CA 2O1BA 3M5UA 3EI5A 2EZ1A 3A9YA 5E3KA 1WSTA 1BS0A 3K40A 3MC6A 3NU8A 2CTZA 4RM1A 1Z7DA 4ADEA 5EQCA 3UAKA 3BN1A 2DGLA 3AOVA 4WB0B 1G7WA 3A9ZA 4EFFA 1EG5A 1IAXA 3FVXA 3RBFA 2BI5A 1O62A 1BQDA 3LVKA 1ZC9A 2VIAA 4F5FA 2C0RA 2AY1A 1VP4A 3JU7A 3DXVA 1CL2A 1S0AA 3I5TA 4WYFA 1SZKA 2BIEA 2BI9A 2QMAA 1S06A 2BI2A 1LW5A 4ZAHA 2D5YA 2YCTA 3H14A 4GSAA 4EU1A 1AMRA 1EJIA 4A0FA 3DC1A 1Y4IA 4JEVA 4RJ0A 3N4XA 3FVSA 5JAYA 4Y0HA 2FM1A 3JWAA 3MADA 5EAVA 3RQ1A 5F8VA 5M46A 2WK7A 2YCPA 3NU7A 1J04A 2VMVA 5DB5A 1ELUA 2F8JA 1MLZA 3WGCA 2D7ZA 2O0RA 2OGEA 3MAFB 3E2ZB 3PJ0A 4UQVA 3VP6A 4BMKA 2FKIA 3ZZJA 1S09A 3N75A 2W7MA 4AOAA 1AIAA 2JISA 1M0NA 3COGA 1IX7A 4J8LA 4MY5A 1QITA 4ZDPA 2PB0A 2YKUA 5TF5A 1N8PA 5E5IA 1ASBA 1N2TA 1I48A 3QPGA 2ZP7A 2VMPA 1SFFA 2JJFA 1O61A 4OBVA 1CL1A 2QB3A 1CZEA 3QHXA 4W1XA 1WYVA 3KKIA 5HHYA 2CSTA 2GMUA 4OBUA 2Q7WA 2CY8A 3LVMA 3FQ7A 3VK4A 3ATHA 3N7NA 1DJUA 4RAEA 4XJOA 4F5HA 1IX8A 2ZY3A 3IHJA 3E6GA 4WXGA 4A0RA 2VMNA 3CAIA 2VMUA 2VMRA 3LY1A 4HF8A 2Z1YA 5M49A 3BCAA 1AHXA 1OATA 5FT6A 1O4SA 2WB6A 4RIZA 1ZOBA 4AZKA 3LVJA 4FFCA 3TFUA 1U08A 4K2BA 2FN6A 3GZDA 4CBSA 4TN4A 3NYTA 2QSRA 3ISLA 1AHEA 3G0TA 5J8QA 1SPAA 4ZWVA 3K7YA 3HQTA 1KMKA 1M4NA 1X0MA 1YIZA 2JGTA 4GEBA 4ITXA 1GD9A 2X5DA 4K2MA 2BKWA 4R8DA 2AY8A 3LWSA 4M2JA 4WBTA 3A9XA 4IYOA 1IAYA 5DX5A 4A6UA 3HL2A 4Q6RA 2Z67A 1CQ7A 1S08A 2FNIA 1UU1A 3BWNA 2X5FA 1SVVA 4WYAA 1FC4A 3AOWA 3EI8A 1JG8A 3ACZA 8AATA 1MDXA 2X8UA 1M7YA 1FG3A 1WYTB 3NX3A 1G4VA 1TOIA 1MDOA 3AEJA 5E4ZA 3EZ1A 3ASBA 1ASLA 1AKCA 3HBXA 1AAMA 4L0OA 2XH1A 4BA4A 1TOKA 1AMAA 3T32A 2VMOA 5LHAA 2ZY4A 2BHXA 5EFSA 4ATPA 3PD6A 4XJPA 2D7YA 3BV0A 1ELQA 3LG0A 4GE4A 4N0BA 3GR9A 1S07A 4TV7A 3FSLA 1W7NA 2W7KA 4A0GA 3NRAA 4AH3A 5EAAA 3DR4A 3ECDA 4WYEA 3II0A 1MDZA 1M32A 2D63A 2AEVA 4WB0A 2AATA 5K8BA 1SZUA 2R5EA 2W8JA 3HVYA 2VGWA 4KXKA 4CXRA 5G2QA 4IX8A 3AEOA 2HP2A 3FKDA 2HZPA 1IBJA 1B8GA 4PFNA 5G4JA 2GSAA 3WY7A 3DU4A 2PO3A 2Z9UA 5FT5A 4CVQA 2W8TA 1AKAA 2AEUA 2DKBA 3K28A 1D7UA 3OKSA 1WYUA 3I4JA 4ZSYA 1GC4A 3D6KA 3RCHA 1RVUA 4Y0IA 1DFOA 1BJWA 1LC5A 4UHOA 4WYDA 4F5GA 4RITA 2GB3A 3ZZKA 2Z9VA 2DR1A 1C9CA 1B9HA 4EB7A 4W5KA 1C0NA 2KFPA 1UU2A 1CQ8A 3EIBA 2VIBA 3UE8A 1ECXA 1AAWA 1G4XA 4WLHA 2W7LA 4ISYA 2ZJGA 3WZFA 3LVLB 3GWPA 1BT4A 4B9BA 2JJGA 2DGKA 1J32A 4I8AA 1DTYA 2ZYJA 5KTBA 4WLJA 1QIRA 1VEFA 3FZ7A 2VI9A 4OT8A 3FTBA 2V1PA 2TPLA 2EZ2A 3AENA 4WXFA 5EIGA 2A1VA 1C7GA 4XEWA 1IVRA 4XJMA 4A6RA 3FDDA 2R5CA 3RBLA 4WYCA 3WGBA 1GCKA 2R0TA 1D7VA 1KL1A 2EH6A 3AEPA 3FD0A 1OHVA 2EGYA 3PDBA 4M2KA 1EQBA 4P3MA 5FT4A 3R9AA 2CJDA 4A6TA 1B9IA 1PG8A 2YRIA 3AEMA 3G8MA 1ASNA 2DKJA 4AO9A 4H63Q 2W7EA 1ASAA 3ZRQA 1V2DA 3JTXA 4R5FA 1DJEA 3FRKA 2OKJA 3AEMC 3B1EA 1X29A 1D7SA 2X3LA 2D65A 3CQ4A 3HMUA 4BHDA 3EZSA 3DR7A 1XI9A 3E2ZA 4BA5A 2BIGA 3GJUA 4FL0A 4WP0A 2VYCA 3PGYA 3AV7A 3TFTA 2Z20A 1QJ5A 1AKBA 2CJGA 2HUFA 3MEBA 2BWNA 2FNUA 5G0AA 3WX9A 4QGRA 2W7DA 1XEYA 2W8WA 2C7TA 1SF2A 2O7CA 1PMOA 1AY4A 2W7HA 1KAFA 2VGTA 1GEYA 4PFFA 2QBTA 2Z61A 1OHWA 3L8AA 4IXSA 1BJOA 1TOEA 4AZJA 1LK9A 2D64A 2HOXA 4LNMA 5LH9A 3Q8NA 4F5JA 4XQ2A 1QGNA 1M0OA 3EI9A 2WKAA 4E3QA 4ZDOA 1O69A 4KYOA 4Q75A 4MQRA 4DBCA 5F9SA 2RFVA 1TOGA 1CZCA 2EO5A 1T3IA 3DXWA 1BQAA 4DQ6A 1OHYA 4CBRA 1AJSA 3ELEA 2ZSLA 3GZCA 1GEXA 3MC6C 3QI6A 3HT4A 4K05A 2ZSMA 1H1CA 4LC3A 2AY7A 2OGAA 2C81A 2CFBA 3A2BA 1X2AA 3IF2A 4WD2A 4XJLA 3NYUA 2AY5A 2BWOA 1BJNA 2WK8A 4ITGA 4NOGA 4R5ZA 5C6UA 2OKKA 3ASAA 2D61A 4OC9A 2XBNA 1I29A 3BWNC 5EUNA 3B46A 1KKPA 3AATA 4JF1A 4Q31A 2HOYA 1LC7A 4OCAA 3BC8A 3TCMA 2CH2A 2YCNA 1V72A 1MAQA 3PIUA 2W8UA 4A0HA 3G7QA 3L44A 4U2HA 2QLRA 4GDYA 4R2NA 3DODA 1PFFA 4H51A 3USFA 9AATA 1TOJA 4IY7A 2AY9A 1C7NA 1UU0A 1YIYA 1AMQA 2VMWA 4MSOA 2W7IA 1B4XA 3QGUA 2VI8A 3N0LA 1AHYA 4ZM3A 1LC8A 2HUUA 2PB2A 4GRXA 4XAUA 3A8UX 3CQ5A 3JWBA 5BJ3A 1I43A 3N4RA 3HDOA 2G6WA 4ZM4A 1P3WA 1QJ3A 2FQ6A 1BJ4A 2GQNA 4P7YA 1AIBA 2VMSA 4RLGA 3FZ8A 1MAPA 3AELA 2Z9WA 1PMMA 3AEJC 4IW7A 4F4EA 1IJIA 1IUGA 1ZODA 4ZLVA 1ASFA 1MLYA 2QB2A 3EUCA 1QISA 4BQ0A 4F5LA 2CINA 3F0HA 3W1HA 4AO4A 2E7IA 1W3UA 3BWOA 2OQXA 2HP1A 1RVYA 2AY2A 3FZ6A 2EPJA 1DGEA 2JJEA 3TATA 1YOOA 4IXOA 1D7RA 2C44A 3DZZA 3EI6A 1ORDA 1ARIA 3FVUA 3NDNA 3NUIA 3E77A 4OTLA 1YNUA 4Y0DA 4LW4A 4MQQA 4ZDLA 5DJ1A 5EUEA 1ARGA 2CANA 2VMXA 3F6TA 4N0WA 3E2FA 4DGTA 1BJOB 1W7LA 3VAXA 3GZDC 3BCXA 1CS1A 1C4KA 1AY5A 1E5FA 1E5EA 5AX8A 3RCHB 1CQ6A 3N5MA 4GE9A 1D2FA 1W23A 1X28A 3CQ6A 3GETA 5DJ9A 3EI7A 1ARHA 3KE3A 2ORDA 2YKXA 1YJZA 3WCOA 1AJSB 4A00A 1B5PA 1JS3A 3TQXA 2DOUA 3FFHA 4ATQA 2JG2A 2W8VA 3EIAA 3PAAA 2YKVA 2E54A 2W7GA 5M4BA 4HVKA 3ELPA 1IX6A 3BB8A 2VMZA 4E1OA 3ZRRA 2AY3A 1MGVA 4ZSWA 5EIGB 2ZY2A 4ADDA 2YOBA 4F5MA 3E2YA 1G7XA 1M0PA 5D5SA 4JEZA 4KAMA 3P1TA 4RKCA 3B1DA 5IWQA 1W7MA 2FYFA 4EMYA 2NMPA 1FG7A 4MQPA 4MKKA 4W8IA 2ZY5A 4LW2A 2DGMA 3WLXA 4U1TA 2AY6A 2E7JA 1YJSA 1AHGA 1AHFA 3VOMA 1C7OA 3NNKA 4WYGA 5D95A 2BIAA 1AX4A 2AY4A 2WK9A 2HORA 1GBNA 2YRRA 4ZWMA 4JF0A 1V2EA 1ARTA 2V0YA 3H9XA 1AICA 1OXPA 2OATA 3E9KA 1DGDA 3CBFA 3QM2A 4PIWA 4MGRA 3N4SA 3AENB 2ZUKA 2QA3A 2R5CB 3W1JA 3WKRA 3DRDA 4XK1A 2CJHA 5G2PA 3FFRA 1AY8A 3NYSA 4K2IA 1ASMA 4ADBA 4F5IA 1B5OA 1OXOA 3PPLA 1KL2A 1LW4A 4IXZA 1RV4A 4OMAA 4W91A 3WKSA 4EB5A 4OYTA 2VLHA 1LKCA 1M6SA 5EUDA 4A72A 3QN6A 2BI1A 1VJOA 1RV3A 3MAUA 3PDXA 1LS3A 3BCBA 1TPLA 2VGZA 4W1WA 2HUIA 2JJHA 3OP7A 2BWPA 5I92A 3W1IA 4RKDA 3VK3A 5G4IA 3KGXA 4LNLA 3MKJA 2VMYA 4WXBA 1WKGA 3MBBA 4GE7A 1KKJA 1BW0A 1GDEA 1YJYA 2BYLA 4PVFA 4E3RA 2YKYA 1TARA 1V2FA 1BKGA 4J5UA 1I41A 4M2MA 2VMQA 2BYJA 5FT8A 1ARSA 1AJRA 3FQ8A 1GC3A 3H7FA 5HDMA 3I16A 1GEWA 2D66A 2Z1ZA 1ASCA 3KGWA 1N31A 3QBOA 1DJ9A 1TASA 4JEYA 2G7JA 1WYVB 3HLMA 1QZ9A 2W7JA 3RUYA 4TMRA 2Z9XA 3LV2A 5M4DA 2ZC0A 1TATA 1SZSA 4ADCA 4RJYA 1ASEA 3NTJA 4CXQA 1AMSA 1ASDA 1YAAA 1CJ0A 3JW9A 3FQAA 4JEWA 3BS8A 4ZASA 3WCNA 3NUBA 2GMSA 4UHMA 2VGSA 2CH1A 2VGVA 4UHNA 4F5KA 3P6KA 1KMJA 1WYTA 2E7UA 1WKHA 3VK2A 2EYQA 1H0CA 3FCRA 5HXXA 2R2NA 4MKJA 3GBXA 3FDBA 3MAFA 3PDBB 4JE5A 3GSBA 1JF9A 2VLFA 3B8XA 1ASGA 1WYUB 3ZRPA 4E77A 2YHKA 5G09A 3PD6B
chains in the Genus database with same CATH topology
3PA9A 2VMTA 2W7FA 4W1VA 2CB1A 2VGUA 4UOYA 1Z3ZA 2BI3A 2HOZA 3R4TA 3JZLA 1DKAA 1GC0A 3RI6A 1GC2A 3DYDA 5BJ4A 4IYOB 1M0QA 1JS6A 4LNJA 4JEXA 1UKJA 4O6ZA 4Q76A 3UWCA 4B98A 7AATA 3F9TA 4JE5D 3B1CA 2O1BA 3M5UA 3EI5A 2EZ1A 3A9YA 5E3KA 1WSTA 1BS0A 3K40A 3MC6A 3NU8A 2CTZA 4RM1A 1Z7DA 4ADEA 5EQCA 3UAKA 3BN1A 2DGLA 3AOVA 4WB0B 1G7WA 3A9ZA 4EFFA 1EG5A 1IAXA 3FVXA 3RBFA 2BI5A 1O62A 1BQDA 3LVKA 1ZC9A 2VIAA 4F5FA 2C0RA 2AY1A 1VP4A 3JU7A 3DXVA 1CL2A 1S0AA 3I5TA 4WYFA 1SZKA 2BIEA 2BI9A 2QMAA 1S06A 2BI2A 1LW5A 4ZAHA 2D5YA 2YCTA 3H14A 4GSAA 4EU1A 1AMRA 1EJIA 4A0FA 3DC1A 1Y4IA 4JEVA 4RJ0A 3N4XA 3FVSA 5JAYA 4Y0HA 2FM1A 3JWAA 3MADA 5EAVA 3RQ1A 5F8VA 5M46A 2WK7A 2YCPA 3NU7A 1J04A 2VMVA 5DB5A 1ELUA 2F8JA 1MLZA 3WGCA 2D7ZA 2O0RA 2OGEA 3MAFB 3E2ZB 3PJ0A 4UQVA 3VP6A 4BMKA 2FKIA 3ZZJA 1S09A 3N75A 2W7MA 4AOAA 1AIAA 2JISA 1M0NA 3COGA 1IX7A 4J8LA 4MY5A 1QITA 4ZDPA 2PB0A 2YKUA 5TF5A 1N8PA 5E5IA 1ASBA 1N2TA 1I48A 3QPGA 2ZP7A 2VMPA 1SFFA 2JJFA 1O61A 4OBVA 1CL1A 2QB3A 1CZEA 3QHXA 4W1XA 1WYVA 3KKIA 5HHYA 2CSTA 2GMUA 4OBUA 2Q7WA 2CY8A 3LVMA 3FQ7A 3VK4A 3ATHA 3N7NA 1DJUA 4RAEA 4XJOA 4F5HA 1IX8A 2ZY3A 3IHJA 3E6GA 4WXGA 4A0RA 2VMNA 3CAIA 2VMUA 2VMRA 3LY1A 4HF8A 2Z1YA 5M49A 3BCAA 1AHXA 1OATA 5FT6A 1O4SA 2WB6A 4RIZA 1ZOBA 4AZKA 3LVJA 4FFCA 3TFUA 1U08A 4K2BA 2FN6A 3GZDA 4CBSA 4TN4A 3NYTA 2QSRA 3ISLA 1AHEA 3G0TA 5J8QA 1SPAA 4ZWVA 3K7YA 3HQTA 1KMKA 1M4NA 1X0MA 1YIZA 2JGTA 4GEBA 4ITXA 1GD9A 2X5DA 4K2MA 2BKWA 4R8DA 2AY8A 3LWSA 4M2JA 4WBTA 3A9XA 4IYOA 1IAYA 5DX5A 4A6UA 3HL2A 4Q6RA 2Z67A 1CQ7A 1S08A 2FNIA 1UU1A 3BWNA 2X5FA 1SVVA 4WYAA 1FC4A 3AOWA 3EI8A 1JG8A 3ACZA 8AATA 1MDXA 2X8UA 1M7YA 1FG3A 1WYTB 3NX3A 1G4VA 1TOIA 1MDOA 3AEJA 5E4ZA 3EZ1A 3ASBA 1ASLA 1AKCA 3HBXA 1AAMA 4L0OA 2XH1A 4BA4A 1TOKA 1AMAA 3T32A 2VMOA 5LHAA 2ZY4A 2BHXA 5EFSA 4ATPA 3PD6A 4XJPA 2D7YA 3BV0A 1ELQA 3LG0A 4GE4A 4N0BA 3GR9A 1S07A 4TV7A 3FSLA 1W7NA 2W7KA 4A0GA 3NRAA 4AH3A 5EAAA 3DR4A 3ECDA 4WYEA 3II0A 1MDZA 1M32A 2D63A 2AEVA 4WB0A 2AATA 5K8BA 1SZUA 2R5EA 2W8JA 3HVYA 2VGWA 4KXKA 4CXRA 5G2QA 4IX8A 3AEOA 2HP2A 3FKDA 2HZPA 1IBJA 1B8GA 4PFNA 5G4JA 2GSAA 3WY7A 3DU4A 2PO3A 2Z9UA 5FT5A 4CVQA 2W8TA 1AKAA 2AEUA 2DKBA 3K28A 1D7UA 3OKSA 1WYUA 3I4JA 4ZSYA 1GC4A 3D6KA 3RCHA 1RVUA 4Y0IA 1DFOA 1BJWA 1LC5A 4UHOA 4WYDA 4F5GA 4RITA 2GB3A 3ZZKA 2Z9VA 2DR1A 1C9CA 1B9HA 4EB7A 4W5KA 1C0NA 2KFPA 1UU2A 1CQ8A 3EIBA 2VIBA 3UE8A 1ECXA 1AAWA 1G4XA 4WLHA 2W7LA 4ISYA 2ZJGA 3WZFA 3LVLB 3GWPA 1BT4A 4B9BA 2JJGA 2DGKA 1J32A 4I8AA 1DTYA 2ZYJA 5KTBA 4WLJA 1QIRA 1VEFA 3FZ7A 2VI9A 4OT8A 3FTBA 2V1PA 2TPLA 2EZ2A 3AENA 4WXFA 5EIGA 2A1VA 1C7GA 4XEWA 1IVRA 4XJMA 4A6RA 3FDDA 2R5CA 3RBLA 4WYCA 3WGBA 1GCKA 2R0TA 1D7VA 1KL1A 2EH6A 3AEPA 3FD0A 1OHVA 2EGYA 3PDBA 4M2KA 1EQBA 4P3MA 5FT4A 3R9AA 2CJDA 4A6TA 1B9IA 1PG8A 2YRIA 3AEMA 3G8MA 1ASNA 2DKJA 4AO9A 4H63Q 2W7EA 1ASAA 3ZRQA 1V2DA 3JTXA 4R5FA 1DJEA 3FRKA 2OKJA 3AEMC 3B1EA 1X29A 1D7SA 2X3LA 2D65A 3CQ4A 3HMUA 4BHDA 3EZSA 3DR7A 1XI9A 3E2ZA 4BA5A 2BIGA 3GJUA 4FL0A 4WP0A 2VYCA 3PGYA 3AV7A 3TFTA 2Z20A 1QJ5A 1AKBA 2CJGA 2HUFA 3MEBA 2BWNA 2FNUA 5G0AA 3WX9A 4QGRA 2W7DA 1XEYA 2W8WA 2C7TA 1SF2A 2O7CA 1PMOA 1AY4A 2W7HA 2VGTA 1GEYA 4PFFA 2QBTA 2Z61A 1OHWA 3L8AA 4IXSA 1BJOA 1TOEA 4AZJA 1LK9A 2D64A 2HOXA 4LNMA 5LH9A 3Q8NA 4F5JA 4XQ2A 1QGNA 1M0OA 3EI9A 2WKAA 4E3QA 4ZDOA 1O69A 4KYOA 4Q75A 4MQRA 4DBCA 5F9SA 2RFVA 1TOGA 1CZCA 2EO5A 1T3IA 3DXWA 1BQAA 4DQ6A 1OHYA 4CBRA 1AJSA 3ELEA 2ZSLA 3GZCA 1GEXA 3MC6C 3QI6A 3HT4A 4K05A 2ZSMA 1H1CA 4LC3A 2AY7A 2OGAA 2C81A 2CFBA 3A2BA 1X2AA 3IF2A 4WD2A 4XJLA 3NYUA 2AY5A 2BWOA 1BJNA 2WK8A 4ITGA 4NOGA 4R5ZA 5C6UA 2OKKA 3ASAA 2D61A 4OC9A 2XBNA 1I29A 3BWNC 5EUNA 3B46A 1KKPA 3AATA 4JF1A 4Q31A 2HOYA 1LC7A 4OCAA 3BC8A 3TCMA 2CH2A 2YCNA 1V72A 1MAQA 3PIUA 2W8UA 4A0HA 3G7QA 3L44A 4U2HA 2QLRA 4GDYA 4R2NA 3DODA 1PFFA 4H51A 3USFA 9AATA 1TOJA 4IY7A 2AY9A 1C7NA 1UU0A 1YIYA 1AMQA 2VMWA 4MSOA 2W7IA 1B4XA 3QGUA 2VI8A 3N0LA 1AHYA 4ZM3A 1LC8A 2HUUA 2PB2A 4GRXA 4XAUA 3A8UX 3CQ5A 3JWBA 5BJ3A 1I43A 3N4RA 3HDOA 2G6WA 4ZM4A 1P3WA 1QJ3A 2FQ6A 1BJ4A 2GQNA 4P7YA 1AIBA 2VMSA 4RLGA 3FZ8A 1MAPA 3AELA 2Z9WA 1PMMA 3AEJC 4IW7A 4F4EA 1IJIA 1IUGA 1ZODA 4ZLVA 1ASFA 1MLYA 2QB2A 3EUCA 1QISA 4BQ0A 4F5LA 2CINA 3F0HA 3W1HA 4AO4A 2E7IA 1W3UA 3BWOA 2OQXA 2HP1A 1RVYA 2AY2A 3FZ6A 2EPJA 1DGEA 2JJEA 3TATA 1YOOA 4IXOA 1D7RA 2C44A 3DZZA 3EI6A 1ORDA 1ARIA 3FVUA 3NDNA 3NUIA 3E77A 4OTLA 1YNUA 4Y0DA 4LW4A 4MQQA 4ZDLA 5DJ1A 5EUEA 1ARGA 2CANA 2VMXA 3F6TA 4N0WA 3E2FA 4DGTA 1BJOB 1W7LA 3VAXA 3GZDC 3BCXA 1CS1A 1C4KA 1AY5A 1E5FA 1E5EA 5AX8A 3RCHB 1CQ6A 3N5MA 4GE9A 1D2FA 1W23A 1X28A 3CQ6A 3GETA 5DJ9A 3EI7A 1ARHA 3KE3A 2ORDA 2YKXA 1YJZA 3WCOA 1AJSB 4A00A 1B5PA 1JS3A 3TQXA 2DOUA 3FFHA 4ATQA 2JG2A 2W8VA 3EIAA 3PAAA 2YKVA 2E54A 2W7GA 5M4BA 4HVKA 3ELPA 1IX6A 3BB8A 2VMZA 4E1OA 3ZRRA 2AY3A 1MGVA 4ZSWA 5EIGB 2ZY2A 4ADDA 2YOBA 4F5MA 3E2YA 1G7XA 1M0PA 5D5SA 4JEZA 4KAMA 3P1TA 4RKCA 3B1DA 5IWQA 1W7MA 2FYFA 4EMYA 2NMPA 1FG7A 4MQPA 4MKKA 4W8IA 2ZY5A 4LW2A 2DGMA 3WLXA 4U1TA 2AY6A 2E7JA 1YJSA 1AHGA 1AHFA 3VOMA 1C7OA 3NNKA 4WYGA 5D95A 2BIAA 1AX4A 2AY4A 2WK9A 2HORA 1GBNA 2YRRA 4ZWMA 4JF0A 1V2EA 1ARTA 2V0YA 3H9XA 1AICA 1OXPA 2OATA 3E9KA 1DGDA 3CBFA 3QM2A 4PIWA 4MGRA 3N4SA 3AENB 2ZUKA 2QA3A 2R5CB 3W1JA 3WKRA 3DRDA 4XK1A 2CJHA 5G2PA 3FFRA 1AY8A 3NYSA 4K2IA 1ASMA 4ADBA 4F5IA 1B5OA 1OXOA 3PPLA 1KL2A 1LW4A 4IXZA 1RV4A 4OMAA 4W91A 3WKSA 4EB5A 4OYTA 2VLHA 1LKCA 1M6SA 5EUDA 4A72A 3QN6A 2BI1A 1VJOA 1RV3A 3MAUA 3PDXA 1LS3A 3BCBA 1TPLA 2VGZA 4W1WA 2HUIA 2JJHA 3OP7A 2BWPA 5I92A 3W1IA 4RKDA 3VK3A 5G4IA 3KGXA 4LNLA 3MKJA 2VMYA 4WXBA 1WKGA 3MBBA 4GE7A 1KKJA 1BW0A 1GDEA 1YJYA 2BYLA 4PVFA 4E3RA 2YKYA 1TARA 1V2FA 1BKGA 4J5UA 1I41A 4M2MA 2VMQA 2BYJA 5FT8A 1ARSA 1AJRA 3FQ8A 1GC3A 3H7FA 5HDMA 3I16A 1GEWA 2D66A 2Z1ZA 1ASCA 3KGWA 1N31A 3QBOA 1DJ9A 1TASA 4JEYA 2G7JA 1WYVB 3HLMA 1QZ9A 2W7JA 3RUYA 4TMRA 2Z9XA 3LV2A 5M4DA 2ZC0A 1TATA 1SZSA 4ADCA 4RJYA 1ASEA 3NTJA 4CXQA 1AMSA 1ASDA 1YAAA 1CJ0A 3JW9A 3FQAA 4JEWA 3BS8A 4ZASA 3WCNA 3NUBA 2GMSA 4UHMA 2VGSA 2CH1A 2VGVA 4UHNA 4F5KA 3P6KA 1KMJA 1WYTA 2E7UA 1WKHA 3VK2A 2EYQA 1H0CA 3FCRA 5HXXA 2R2NA 4MKJA 3GBXA 3FDBA 3MAFA 3PDBB 4JE5A 3GSBA 1JF9A 2VLFA 3B8XA 1ASGA 1WYUB 3ZRPA 4E77A 2YHKA 5G09A 3PD6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PA9 A;  2VMT A;  2W7F A;  4W1V A;  2CB1 A;  2VGU A;  4UOY A;  1Z3Z A;  2BI3 A;  2HOZ A;  3R4T A;  3JZL A;  1DKA A;  1GC0 A;  3RI6 A;  1GC2 A;  3DYD A;  5BJ4 A;  4IYO B;  1M0Q A;  1JS6 A;  4LNJ A;  4JEX A;  1UKJ A;  4O6Z A;  4Q76 A;  3UWC A;  4B98 A;  7AAT A;  3F9T A;  4JE5 D;  3B1C A;  2O1B A;  3M5U A;  3EI5 A;  2EZ1 A;  3A9Y A;  5E3K A;  1WST A;  1BS0 A;  3K40 A;  3MC6 A;  3NU8 A;  2CTZ A;  4RM1 A;  1Z7D A;  4ADE A;  5EQC A;  3UAK A;  3BN1 A;  2DGL A;  3AOV A;  4WB0 B;  1G7W A;  3A9Z A;  4EFF A;  1EG5 A;  1IAX A;  3FVX A;  3RBF A;  2BI5 A;  1O62 A;  1BQD A;  3LVK A;  1ZC9 A;  2VIA A;  4F5F A;  2C0R A;  2AY1 A;  1VP4 A;  3JU7 A;  3DXV A;  1CL2 A;  1S0A A;  3I5T A;  4WYF A;  1SZK A;  2BIE A;  2BI9 A;  2QMA A;  1S06 A;  2BI2 A;  1LW5 A;  4ZAH A;  2D5Y A;  2YCT A;  3H14 A;  4GSA A;  4EU1 A;  1AMR A;  1EJI A;  4A0F A;  3DC1 A;  1Y4I A;  4JEV A;  4RJ0 A;  3FVS A;  5JAY A;  4Y0H A;  2FM1 A;  3JWA A;  3MAD A;  5EAV A;  3RQ1 A;  5F8V A;  5M46 A;  2WK7 A;  2YCP A;  3NU7 A;  1J04 A;  2VMV A;  5DB5 A;  1ELU A;  2F8J A;  1MLZ A;  3WGC A;  2D7Z A;  2O0R A;  2OGE A;  3MAF B;  3E2Z B;  3PJ0 A;  4UQV A;  3VP6 A;  4BMK A;  3ZZJ A;  1S09 A;  3N75 A;  2W7M A;  4AOA A;  1AIA A;  2JIS A;  1M0N A;  3COG A;  1IX7 A;  4J8L A;  4MY5 A;  1QIT A;  4ZDP A;  2PB0 A;  2YKU A;  5TF5 A;  1N8P A;  5E5I A;  1ASB A;  1N2T A;  1I48 A;  3QPG A;  2ZP7 A;  2VMP A;  1SFF A;  2JJF A;  1O61 A;  4OBV A;  1CL1 A;  2QB3 A;  1CZE A;  3QHX A;  4W1X A;  1WYV A;  3KKI A;  5HHY A;  2CST A;  2GMU A;  4OBU A;  2Q7W A;  2CY8 A;  3LVM A;  3FQ7 A;  3VK4 A;  3ATH A;  1DJU A;  4RAE A;  4XJO A;  4F5H A;  1IX8 A;  2ZY3 A;  3IHJ A;  3E6G A;  4WXG A;  4A0R A;  2VMN A;  3CAI A;  2VMU A;  2VMR A;  3LY1 A;  4HF8 A;  2Z1Y A;  5M49 A;  3BCA A;  1AHX A;  1OAT A;  5FT6 A;  1O4S A;  4RIZ A;  1ZOB A;  4AZK A;  3LVJ A;  4FFC A;  3TFU A;  1U08 A;  4K2B A;  2FN6 A;  3GZD A;  4CBS A;  4TN4 A;  3NYT A;  3ISL A;  1AHE A;  3G0T A;  5J8Q A;  1SPA A;  4ZWV A;  3K7Y A;  3HQT A;  1KMK A;  1M4N A;  1X0M A;  1YIZ A;  2JGT A;  4GEB A;  4ITX A;  1GD9 A;  2X5D A;  4K2M A;  2BKW A;  4R8D A;  2AY8 A;  3LWS A;  4M2J A;  4WBT A;  3A9X A;  4IYO A;  1IAY A;  5DX5 A;  4A6U A;  3HL2 A;  4Q6R A;  2Z67 A;  1CQ7 A;  1S08 A;  2FNI A;  1UU1 A;  3BWN A;  2X5F A;  1SVV A;  4WYA A;  1FC4 A;  3AOW A;  3EI8 A;  1JG8 A;  3ACZ A;  8AAT A;  1MDX A;  2X8U A;  1M7Y A;  1FG3 A;  1WYT B;  3NX3 A;  1G4V A;  1TOI A;  1MDO A;  3AEJ A;  5E4Z A;  3EZ1 A;  3ASB A;  1ASL A;  1AKC A;  3HBX A;  1AAM A;  4L0O A;  2XH1 A;  4BA4 A;  1TOK A;  1AMA A;  3T32 A;  2VMO A;  5LHA A;  2ZY4 A;  2BHX A;  5EFS A;  4ATP A;  3PD6 A;  4XJP A;  2D7Y A;  3BV0 A;  1ELQ A;  3LG0 A;  4GE4 A;  4N0B A;  3GR9 A;  1S07 A;  4TV7 A;  3FSL A;  1W7N A;  2W7K A;  4A0G A;  3NRA A;  4AH3 A;  5EAA A;  3DR4 A;  3ECD A;  4WYE A;  3II0 A;  1MDZ A;  1M32 A;  2D63 A;  2AEV A;  4WB0 A;  2AAT A;  5K8B A;  1SZU A;  2R5E A;  2W8J A;  3HVY A;  2VGW A;  4KXK A;  4CXR A;  5G2Q A;  4IX8 A;  3AEO A;  2HP2 A;  3FKD A;  2HZP A;  1IBJ A;  1B8G A;  4PFN A;  5G4J A;  2GSA A;  3WY7 A;  3DU4 A;  2PO3 A;  2Z9U A;  5FT5 A;  4CVQ A;  2W8T A;  1AKA A;  2AEU A;  2DKB A;  3K28 A;  1D7U A;  3OKS A;  1WYU A;  3I4J A;  4ZSY A;  1GC4 A;  3D6K A;  3RCH A;  1RVU A;  4Y0I A;  1DFO A;  1BJW A;  1LC5 A;  4UHO A;  4WYD A;  4F5G A;  4RIT A;  2GB3 A;  3ZZK A;  2Z9V A;  2DR1 A;  1C9C A;  1B9H A;  4EB7 A;  4W5K A;  1C0N A;  1UU2 A;  1CQ8 A;  3EIB A;  2VIB A;  3UE8 A;  1ECX A;  1AAW A;  1G4X A;  4WLH A;  2W7L A;  4ISY A;  2ZJG A;  3WZF A;  3LVL B;  3GWP A;  1BT4 A;  4B9B A;  2JJG A;  2DGK A;  1J32 A;  4I8A A;  1DTY A;  2ZYJ A;  4WLJ A;  1QIR A;  1VEF A;  3FZ7 A;  2VI9 A;  4OT8 A;  3FTB A;  2V1P A;  2TPL A;  2EZ2 A;  3AEN A;  4WXF A;  5EIG A;  1C7G A;  4XEW A;  1IVR A;  4XJM A;  4A6R A;  3FDD A;  2R5C A;  3RBL A;  4WYC A;  3WGB A;  1GCK A;  2R0T A;  1D7V A;  1KL1 A;  2EH6 A;  3AEP A;  3FD0 A;  1OHV A;  2EGY A;  3PDB A;  4M2K A;  1EQB A;  4P3M A;  5FT4 A;  3R9A A;  2CJD A;  4A6T A;  1B9I A;  1PG8 A;  2YRI A;  3AEM A;  3G8M A;  1ASN A;  2DKJ A;  4AO9 A;  2W7E A;  1ASA A;  3ZRQ A;  1V2D A;  3JTX A;  4R5F A;  1DJE A;  3FRK A;  2OKJ A;  3AEM C;  3B1E A;  1X29 A;  1D7S A;  2X3L A;  2D65 A;  3CQ4 A;  3HMU A;  4BHD A;  3EZS A;  3DR7 A;  1XI9 A;  3E2Z A;  4BA5 A;  2BIG A;  3GJU A;  4FL0 A;  4WP0 A;  2VYC A;  3PGY A;  3AV7 A;  3TFT A;  2Z20 A;  1QJ5 A;  1AKB A;  2CJG A;  2HUF A;  3MEB A;  2BWN A;  2FNU A;  5G0A A;  3WX9 A;  4QGR A;  2W7D A;  1XEY A;  2W8W A;  2C7T A;  1SF2 A;  2O7C A;  1PMO A;  1AY4 A;  2W7H A;  2VGT A;  1GEY A;  4PFF A;  2QBT A;  2Z61 A;  1OHW A;  3L8A A;  4IXS A;  1BJO A;  1TOE A;  4AZJ A;  1LK9 A;  2D64 A;  2HOX A;  4LNM A;  5LH9 A;  3Q8N A;  4F5J A;  4XQ2 A;  1QGN A;  1M0O A;  3EI9 A;  2WKA A;  4E3Q A;  4ZDO A;  1O69 A;  4KYO A;  4Q75 A;  4MQR A;  4DBC A;  5F9S A;  2RFV A;  1TOG A;  1CZC A;  2EO5 A;  1T3I A;  3DXW A;  1BQA A;  4DQ6 A;  1OHY A;  4CBR A;  1AJS A;  3ELE A;  2ZSL A;  3GZC A;  1GEX A;  3MC6 C;  3QI6 A;  3HT4 A;  2ZSM A;  1H1C A;  4LC3 A;  2AY7 A;  2OGA A;  2C81 A;  2CFB A;  3A2B A;  1X2A A;  3IF2 A;  4WD2 A;  4XJL A;  3NYU A;  2AY5 A;  2BWO A;  1BJN A;  2WK8 A;  4ITG A;  4NOG A;  4R5Z A;  5C6U A;  2OKK A;  3ASA A;  2D61 A;  4OC9 A;  2XBN A;  1I29 A;  3BWN C;  5EUN A;  3B46 A;  1KKP A;  3AAT A;  4JF1 A;  4Q31 A;  2HOY A;  1LC7 A;  4OCA A;  3BC8 A;  3TCM A;  2CH2 A;  2YCN A;  1V72 A;  1MAQ A;  3PIU A;  2W8U A;  4A0H A;  3G7Q A;  3L44 A;  4U2H A;  2QLR A;  4GDY A;  4R2N A;  3DOD A;  1PFF A;  4H51 A;  3USF A;  9AAT A;  1TOJ A;  4IY7 A;  2AY9 A;  1C7N A;  1UU0 A;  1YIY A;  1AMQ A;  2VMW A;  4MSO A;  2W7I A;  1B4X A;  3QGU A;  2VI8 A;  3N0L A;  1AHY A;  4ZM3 A;  1LC8 A;  2HUU A;  2PB2 A;  4GRX A;  4XAU A;  3A8U X;  3CQ5 A;  3JWB A;  5BJ3 A;  1I43 A;  3HDO A;  2G6W A;  4ZM4 A;  1P3W A;  1QJ3 A;  2FQ6 A;  1BJ4 A;  2GQN A;  4P7Y A;  1AIB A;  2VMS A;  4RLG A;  3FZ8 A;  1MAP A;  3AEL A;  2Z9W A;  1PMM A;  3AEJ C;  4IW7 A;  4F4E A;  1IJI A;  1IUG A;  1ZOD A;  4ZLV A;  1ASF A;  1MLY A;  2QB2 A;  3EUC A;  1QIS A;  4BQ0 A;  4F5L A;  2CIN A;  3F0H A;  3W1H A;  4AO4 A;  2E7I A;  1W3U A;  3BWO A;  2OQX A;  2HP1 A;  1RVY A;  2AY2 A;  3FZ6 A;  2EPJ A;  1DGE A;  2JJE A;  3TAT A;  1YOO A;  4IXO A;  1D7R A;  2C44 A;  3DZZ A;  3EI6 A;  1ORD A;  1ARI A;  3FVU A;  3NDN A;  3NUI A;  3E77 A;  4OTL A;  1YNU A;  4Y0D A;  4LW4 A;  4MQQ A;  4ZDL A;  5DJ1 A;  5EUE A;  1ARG A;  2CAN A;  2VMX A;  3F6T A;  4N0W A;  3E2F A;  4DGT A;  1BJO B;  1W7L A;  3VAX A;  3GZD C;  3BCX A;  1CS1 A;  1C4K A;  1AY5 A;  1E5F A;  1E5E A;  5AX8 A;  3RCH B;  1CQ6 A;  3N5M A;  4GE9 A;  1D2F A;  1W23 A;  1X28 A;  3CQ6 A;  3GET A;  5DJ9 A;  3EI7 A;  1ARH A;  3KE3 A;  2ORD A;  2YKX A;  1YJZ A;  3WCO A;  1AJS B;  4A00 A;  1B5P A;  1JS3 A;  3TQX A;  2DOU A;  3FFH A;  4ATQ A;  2JG2 A;  2W8V A;  3EIA A;  3PAA A;  2YKV A;  2E54 A;  2W7G A;  5M4B A;  4HVK A;  3ELP A;  1IX6 A;  3BB8 A;  2VMZ A;  4E1O A;  3ZRR A;  2AY3 A;  1MGV A;  4ZSW A;  5EIG B;  2ZY2 A;  4ADD A;  2YOB A;  4F5M A;  3E2Y A;  1G7X A;  1M0P A;  5D5S A;  4JEZ A;  4KAM A;  3P1T A;  4RKC A;  3B1D A;  5IWQ A;  1W7M A;  2FYF A;  4EMY A;  2NMP A;  1FG7 A;  4MQP A;  4MKK A;  4W8I A;  2ZY5 A;  4LW2 A;  2DGM A;  3WLX A;  4U1T A;  2AY6 A;  2E7J A;  1YJS A;  1AHG A;  1AHF A;  3VOM A;  1C7O A;  3NNK A;  4WYG A;  5D95 A;  2BIA A;  1AX4 A;  2AY4 A;  2WK9 A;  2HOR A;  1GBN A;  2YRR A;  4ZWM A;  4JF0 A;  1V2E A;  1ART A;  2V0Y A;  1AIC A;  1OXP A;  2OAT A;  3E9K A;  1DGD A;  3CBF A;  3QM2 A;  4PIW A;  4MGR A;  3AEN B;  2ZUK A;  2QA3 A;  2R5C B;  3W1J A;  3WKR A;  3DRD A;  4XK1 A;  2CJH A;  5G2P A;  3FFR A;  1AY8 A;  3NYS A;  4K2I A;  1ASM A;  4ADB A;  4F5I A;  1B5O A;  1OXO A;  3PPL A;  1KL2 A;  1LW4 A;  4IXZ A;  1RV4 A;  4OMA A;  4W91 A;  3WKS A;  4EB5 A;  4OYT A;  2VLH A;  1LKC A;  1M6S A;  5EUD A;  4A72 A;  3QN6 A;  2BI1 A;  1VJO A;  1RV3 A;  3MAU A;  3PDX A;  1LS3 A;  3BCB A;  1TPL A;  2VGZ A;  4W1W A;  2HUI A;  2JJH A;  3OP7 A;  2BWP A;  5I92 A;  3W1I A;  4RKD A;  3VK3 A;  5G4I A;  3KGX A;  4LNL A;  3MKJ A;  2VMY A;  4WXB A;  1WKG A;  3MBB A;  4GE7 A;  1KKJ A;  1BW0 A;  1GDE A;  1YJY A;  2BYL A;  4PVF A;  4E3R A;  2YKY A;  1TAR A;  1V2F A;  1BKG A;  4J5U A;  1I41 A;  4M2M A;  2VMQ A;  2BYJ A;  5FT8 A;  1ARS A;  1AJR A;  3FQ8 A;  1GC3 A;  3H7F A;  5HDM A;  3I16 A;  1GEW A;  2D66 A;  2Z1Z A;  1ASC A;  3KGW A;  1N31 A;  3QBO A;  1DJ9 A;  1TAS A;  4JEY A;  1WYV B;  3HLM A;  1QZ9 A;  2W7J A;  3RUY A;  4TMR A;  2Z9X A;  3LV2 A;  5M4D A;  2ZC0 A;  1TAT A;  1SZS A;  4ADC A;  4RJY A;  1ASE A;  3NTJ A;  4CXQ A;  1AMS A;  1ASD A;  1YAA A;  1CJ0 A;  3JW9 A;  3FQA A;  4JEW A;  3BS8 A;  4ZAS A;  3WCN A;  3NUB A;  2GMS A;  4UHM A;  2VGS A;  2CH1 A;  2VGV A;  4UHN A;  4F5K A;  3P6K A;  1KMJ A;  1WYT A;  2E7U A;  1WKH A;  3VK2 A;  1H0C A;  3FCR A;  5HXX A;  2R2N A;  4MKJ A;  3GBX A;  3FDB A;  3MAF A;  3PDB B;  4JE5 A;  3GSB A;  1JF9 A;  2VLF A;  3B8X A;  1ASG A;  1WYU B;  3ZRP A;  4E77 A;  2YHK A;  5G09 A;  3PD6 B; 
#chains in the Genus database with same CATH topology
 3PA9 A;  2VMT A;  2W7F A;  4W1V A;  2CB1 A;  2VGU A;  4UOY A;  1Z3Z A;  2BI3 A;  2HOZ A;  3R4T A;  3JZL A;  1DKA A;  1GC0 A;  3RI6 A;  1GC2 A;  3DYD A;  5BJ4 A;  4IYO B;  1M0Q A;  1JS6 A;  4LNJ A;  4JEX A;  1UKJ A;  4O6Z A;  4Q76 A;  3UWC A;  4B98 A;  7AAT A;  3F9T A;  4JE5 D;  3B1C A;  2O1B A;  3M5U A;  3EI5 A;  2EZ1 A;  3A9Y A;  5E3K A;  1WST A;  1BS0 A;  3K40 A;  3MC6 A;  3NU8 A;  2CTZ A;  4RM1 A;  1Z7D A;  4ADE A;  5EQC A;  3UAK A;  3BN1 A;  2DGL A;  3AOV A;  4WB0 B;  1G7W A;  3A9Z A;  4EFF A;  1EG5 A;  1IAX A;  3FVX A;  3RBF A;  2BI5 A;  1O62 A;  1BQD A;  3LVK A;  1ZC9 A;  2VIA A;  4F5F A;  2C0R A;  2AY1 A;  1VP4 A;  3JU7 A;  3DXV A;  1CL2 A;  1S0A A;  3I5T A;  4WYF A;  1SZK A;  2BIE A;  2BI9 A;  2QMA A;  1S06 A;  2BI2 A;  1LW5 A;  4ZAH A;  2D5Y A;  2YCT A;  3H14 A;  4GSA A;  4EU1 A;  1AMR A;  1EJI A;  4A0F A;  3DC1 A;  1Y4I A;  4JEV A;  4RJ0 A;  3N4X A;  3FVS A;  5JAY A;  4Y0H A;  2FM1 A;  3JWA A;  3MAD A;  5EAV A;  3RQ1 A;  5F8V A;  5M46 A;  2WK7 A;  2YCP A;  3NU7 A;  1J04 A;  2VMV A;  5DB5 A;  1ELU A;  2F8J A;  1MLZ A;  3WGC A;  2D7Z A;  2O0R A;  2OGE A;  3MAF B;  3E2Z B;  3PJ0 A;  4UQV A;  3VP6 A;  4BMK A;  2FKI A;  3ZZJ A;  1S09 A;  3N75 A;  2W7M A;  4AOA A;  1AIA A;  2JIS A;  1M0N A;  3COG A;  1IX7 A;  4J8L A;  4MY5 A;  1QIT A;  4ZDP A;  2PB0 A;  2YKU A;  5TF5 A;  1N8P A;  5E5I A;  1ASB A;  1N2T A;  1I48 A;  3QPG A;  2ZP7 A;  2VMP A;  1SFF A;  2JJF A;  1O61 A;  4OBV A;  1CL1 A;  2QB3 A;  1CZE A;  3QHX A;  4W1X A;  1WYV A;  3KKI A;  5HHY A;  2CST A;  2GMU A;  4OBU A;  2Q7W A;  2CY8 A;  3LVM A;  3FQ7 A;  3VK4 A;  3ATH A;  3N7N A;  1DJU A;  4RAE A;  4XJO A;  4F5H A;  1IX8 A;  2ZY3 A;  3IHJ A;  3E6G A;  4WXG A;  4A0R A;  2VMN A;  3CAI A;  2VMU A;  2VMR A;  3LY1 A;  4HF8 A;  2Z1Y A;  5M49 A;  3BCA A;  1AHX A;  1OAT A;  5FT6 A;  1O4S A;  2WB6 A;  4RIZ A;  1ZOB A;  4AZK A;  3LVJ A;  4FFC A;  3TFU A;  1U08 A;  4K2B A;  2FN6 A;  3GZD A;  4CBS A;  4TN4 A;  3NYT A;  2QSR A;  3ISL A;  1AHE A;  3G0T A;  5J8Q A;  1SPA A;  4ZWV A;  3K7Y A;  3HQT A;  1KMK A;  1M4N A;  1X0M A;  1YIZ A;  2JGT A;  4GEB A;  4ITX A;  1GD9 A;  2X5D A;  4K2M A;  2BKW A;  4R8D A;  2AY8 A;  3LWS A;  4M2J A;  4WBT A;  3A9X A;  4IYO A;  1IAY A;  5DX5 A;  4A6U A;  3HL2 A;  4Q6R A;  2Z67 A;  1CQ7 A;  1S08 A;  2FNI A;  1UU1 A;  3BWN A;  2X5F A;  1SVV A;  4WYA A;  1FC4 A;  3AOW A;  3EI8 A;  1JG8 A;  3ACZ A;  8AAT A;  1MDX A;  2X8U A;  1M7Y A;  1FG3 A;  1WYT B;  3NX3 A;  1G4V A;  1TOI A;  1MDO A;  3AEJ A;  5E4Z A;  3EZ1 A;  3ASB A;  1ASL A;  1AKC A;  3HBX A;  1AAM A;  4L0O A;  2XH1 A;  4BA4 A;  1TOK A;  1AMA A;  3T32 A;  2VMO A;  5LHA A;  2ZY4 A;  2BHX A;  5EFS A;  4ATP A;  3PD6 A;  4XJP A;  2D7Y A;  3BV0 A;  1ELQ A;  3LG0 A;  4GE4 A;  4N0B A;  3GR9 A;  1S07 A;  4TV7 A;  3FSL A;  1W7N A;  2W7K A;  4A0G A;  3NRA A;  4AH3 A;  5EAA A;  3DR4 A;  3ECD A;  4WYE A;  3II0 A;  1MDZ A;  1M32 A;  2D63 A;  2AEV A;  4WB0 A;  2AAT A;  5K8B A;  1SZU A;  2R5E A;  2W8J A;  3HVY A;  2VGW A;  4KXK A;  4CXR A;  5G2Q A;  4IX8 A;  3AEO A;  2HP2 A;  3FKD A;  2HZP A;  1IBJ A;  1B8G A;  4PFN A;  5G4J A;  2GSA A;  3WY7 A;  3DU4 A;  2PO3 A;  2Z9U A;  5FT5 A;  4CVQ A;  2W8T A;  1AKA A;  2AEU A;  2DKB A;  3K28 A;  1D7U A;  3OKS A;  1WYU A;  3I4J A;  4ZSY A;  1GC4 A;  3D6K A;  3RCH A;  1RVU A;  4Y0I A;  1DFO A;  1BJW A;  1LC5 A;  4UHO A;  4WYD A;  4F5G A;  4RIT A;  2GB3 A;  3ZZK A;  2Z9V A;  2DR1 A;  1C9C A;  1B9H A;  4EB7 A;  4W5K A;  1C0N A;  2KFP A;  1UU2 A;  1CQ8 A;  3EIB A;  2VIB A;  3UE8 A;  1ECX A;  1AAW A;  1G4X A;  4WLH A;  2W7L A;  4ISY A;  2ZJG A;  3WZF A;  3LVL B;  3GWP A;  1BT4 A;  4B9B A;  2JJG A;  2DGK A;  1J32 A;  4I8A A;  1DTY A;  2ZYJ A;  5KTB A;  4WLJ A;  1QIR A;  1VEF A;  3FZ7 A;  2VI9 A;  4OT8 A;  3FTB A;  2V1P A;  2TPL A;  2EZ2 A;  3AEN A;  4WXF A;  5EIG A;  2A1V A;  1C7G A;  4XEW A;  1IVR A;  4XJM A;  4A6R A;  3FDD A;  2R5C A;  3RBL A;  4WYC A;  3WGB A;  1GCK A;  2R0T A;  1D7V A;  1KL1 A;  2EH6 A;  3AEP A;  3FD0 A;  1OHV A;  2EGY A;  3PDB A;  4M2K A;  1EQB A;  4P3M A;  5FT4 A;  3R9A A;  2CJD A;  4A6T A;  1B9I A;  1PG8 A;  2YRI A;  3AEM A;  3G8M A;  1ASN A;  2DKJ A;  4AO9 A;  4H63 Q;  2W7E A;  1ASA A;  3ZRQ A;  1V2D A;  3JTX A;  4R5F A;  1DJE A;  3FRK A;  2OKJ A;  3AEM C;  3B1E A;  1X29 A;  1D7S A;  2X3L A;  2D65 A;  3CQ4 A;  3HMU A;  4BHD A;  3EZS A;  3DR7 A;  1XI9 A;  3E2Z A;  4BA5 A;  2BIG A;  3GJU A;  4FL0 A;  4WP0 A;  2VYC A;  3PGY A;  3AV7 A;  3TFT A;  2Z20 A;  1QJ5 A;  1AKB A;  2CJG A;  2HUF A;  3MEB A;  2BWN A;  2FNU A;  5G0A A;  3WX9 A;  4QGR A;  2W7D A;  1XEY A;  2W8W A;  2C7T A;  1SF2 A;  2O7C A;  1PMO A;  1AY4 A;  2W7H A;  1KAF A;  2VGT A;  1GEY A;  4PFF A;  2QBT A;  2Z61 A;  1OHW A;  3L8A A;  4IXS A;  1BJO A;  1TOE A;  4AZJ A;  1LK9 A;  2D64 A;  2HOX A;  4LNM A;  5LH9 A;  3Q8N A;  4F5J A;  4XQ2 A;  1QGN A;  1M0O A;  3EI9 A;  2WKA A;  4E3Q A;  4ZDO A;  1O69 A;  4KYO A;  4Q75 A;  4MQR A;  4DBC A;  5F9S A;  2RFV A;  1TOG A;  1CZC A;  2EO5 A;  1T3I A;  3DXW A;  1BQA A;  4DQ6 A;  1OHY A;  4CBR A;  1AJS A;  3ELE A;  2ZSL A;  3GZC A;  1GEX A;  3MC6 C;  3QI6 A;  3HT4 A;  4K05 A;  2ZSM A;  1H1C A;  4LC3 A;  2AY7 A;  2OGA A;  2C81 A;  2CFB A;  3A2B A;  1X2A A;  3IF2 A;  4WD2 A;  4XJL A;  3NYU A;  2AY5 A;  2BWO A;  1BJN A;  2WK8 A;  4ITG A;  4NOG A;  4R5Z A;  5C6U A;  2OKK A;  3ASA A;  2D61 A;  4OC9 A;  2XBN A;  1I29 A;  3BWN C;  5EUN A;  3B46 A;  1KKP A;  3AAT A;  4JF1 A;  4Q31 A;  2HOY A;  1LC7 A;  4OCA A;  3BC8 A;  3TCM A;  2CH2 A;  2YCN A;  1V72 A;  1MAQ A;  3PIU A;  2W8U A;  4A0H A;  3G7Q A;  3L44 A;  4U2H A;  2QLR A;  4GDY A;  4R2N A;  3DOD A;  1PFF A;  4H51 A;  3USF A;  9AAT A;  1TOJ A;  4IY7 A;  2AY9 A;  1C7N A;  1UU0 A;  1YIY A;  1AMQ A;  2VMW A;  4MSO A;  2W7I A;  1B4X A;  3QGU A;  2VI8 A;  3N0L A;  1AHY A;  4ZM3 A;  1LC8 A;  2HUU A;  2PB2 A;  4GRX A;  4XAU A;  3A8U X;  3CQ5 A;  3JWB A;  5BJ3 A;  1I43 A;  3N4R A;  3HDO A;  2G6W A;  4ZM4 A;  1P3W A;  1QJ3 A;  2FQ6 A;  1BJ4 A;  2GQN A;  4P7Y A;  1AIB A;  2VMS A;  4RLG A;  3FZ8 A;  1MAP A;  3AEL A;  2Z9W A;  1PMM A;  3AEJ C;  4IW7 A;  4F4E A;  1IJI A;  1IUG A;  1ZOD A;  4ZLV A;  1ASF A;  1MLY A;  2QB2 A;  3EUC A;  1QIS A;  4BQ0 A;  4F5L A;  2CIN A;  3F0H A;  3W1H A;  4AO4 A;  2E7I A;  1W3U A;  3BWO A;  2OQX A;  2HP1 A;  1RVY A;  2AY2 A;  3FZ6 A;  2EPJ A;  1DGE A;  2JJE A;  3TAT A;  1YOO A;  4IXO A;  1D7R A;  2C44 A;  3DZZ A;  3EI6 A;  1ORD A;  1ARI A;  3FVU A;  3NDN A;  3NUI A;  3E77 A;  4OTL A;  1YNU A;  4Y0D A;  4LW4 A;  4MQQ A;  4ZDL A;  5DJ1 A;  5EUE A;  1ARG A;  2CAN A;  2VMX A;  3F6T A;  4N0W A;  3E2F A;  4DGT A;  1BJO B;  1W7L A;  3VAX A;  3GZD C;  3BCX A;  1CS1 A;  1C4K A;  1AY5 A;  1E5F A;  1E5E A;  5AX8 A;  3RCH B;  1CQ6 A;  3N5M A;  4GE9 A;  1D2F A;  1W23 A;  1X28 A;  3CQ6 A;  3GET A;  5DJ9 A;  3EI7 A;  1ARH A;  3KE3 A;  2ORD A;  2YKX A;  1YJZ A;  3WCO A;  1AJS B;  4A00 A;  1B5P A;  1JS3 A;  3TQX A;  2DOU A;  3FFH A;  4ATQ A;  2JG2 A;  2W8V A;  3EIA A;  3PAA A;  2YKV A;  2E54 A;  2W7G A;  5M4B A;  4HVK A;  3ELP A;  1IX6 A;  3BB8 A;  2VMZ A;  4E1O A;  3ZRR A;  2AY3 A;  1MGV A;  4ZSW A;  5EIG B;  2ZY2 A;  4ADD A;  2YOB A;  4F5M A;  3E2Y A;  1G7X A;  1M0P A;  5D5S A;  4JEZ A;  4KAM A;  3P1T A;  4RKC A;  3B1D A;  5IWQ A;  1W7M A;  2FYF A;  4EMY A;  2NMP A;  1FG7 A;  4MQP A;  4MKK A;  4W8I A;  2ZY5 A;  4LW2 A;  2DGM A;  3WLX A;  4U1T A;  2AY6 A;  2E7J A;  1YJS A;  1AHG A;  1AHF A;  3VOM A;  1C7O A;  3NNK A;  4WYG A;  5D95 A;  2BIA A;  1AX4 A;  2AY4 A;  2WK9 A;  2HOR A;  1GBN A;  2YRR A;  4ZWM A;  4JF0 A;  1V2E A;  1ART A;  2V0Y A;  3H9X A;  1AIC A;  1OXP A;  2OAT A;  3E9K A;  1DGD A;  3CBF A;  3QM2 A;  4PIW A;  4MGR A;  3N4S A;  3AEN B;  2ZUK A;  2QA3 A;  2R5C B;  3W1J A;  3WKR A;  3DRD A;  4XK1 A;  2CJH A;  5G2P A;  3FFR A;  1AY8 A;  3NYS A;  4K2I A;  1ASM A;  4ADB A;  4F5I A;  1B5O A;  1OXO A;  3PPL A;  1KL2 A;  1LW4 A;  4IXZ A;  1RV4 A;  4OMA A;  4W91 A;  3WKS A;  4EB5 A;  4OYT A;  2VLH A;  1LKC A;  1M6S A;  5EUD A;  4A72 A;  3QN6 A;  2BI1 A;  1VJO A;  1RV3 A;  3MAU A;  3PDX A;  1LS3 A;  3BCB A;  1TPL A;  2VGZ A;  4W1W A;  2HUI A;  2JJH A;  3OP7 A;  2BWP A;  5I92 A;  3W1I A;  4RKD A;  3VK3 A;  5G4I A;  3KGX A;  4LNL A;  3MKJ A;  2VMY A;  4WXB A;  1WKG A;  3MBB A;  4GE7 A;  1KKJ A;  1BW0 A;  1GDE A;  1YJY A;  2BYL A;  4PVF A;  4E3R A;  2YKY A;  1TAR A;  1V2F A;  1BKG A;  4J5U A;  1I41 A;  4M2M A;  2VMQ A;  2BYJ A;  5FT8 A;  1ARS A;  1AJR A;  3FQ8 A;  1GC3 A;  3H7F A;  5HDM A;  3I16 A;  1GEW A;  2D66 A;  2Z1Z A;  1ASC A;  3KGW A;  1N31 A;  3QBO A;  1DJ9 A;  1TAS A;  4JEY A;  2G7J A;  1WYV B;  3HLM A;  1QZ9 A;  2W7J A;  3RUY A;  4TMR A;  2Z9X A;  3LV2 A;  5M4D A;  2ZC0 A;  1TAT A;  1SZS A;  4ADC A;  4RJY A;  1ASE A;  3NTJ A;  4CXQ A;  1AMS A;  1ASD A;  1YAA A;  1CJ0 A;  3JW9 A;  3FQA A;  4JEW A;  3BS8 A;  4ZAS A;  3WCN A;  3NUB A;  2GMS A;  4UHM A;  2VGS A;  2CH1 A;  2VGV A;  4UHN A;  4F5K A;  3P6K A;  1KMJ A;  1WYT A;  2E7U A;  1WKH A;  3VK2 A;  2EYQ A;  1H0C A;  3FCR A;  5HXX A;  2R2N A;  4MKJ A;  3GBX A;  3FDB A;  3MAF A;  3PDB B;  4JE5 A;  3GSB A;  1JF9 A;  2VLF A;  3B8X A;  1ASG A;  1WYU B;  3ZRP A;  4E77 A;  2YHK A;  5G09 A;  3PD6 B; 
#chains in the Genus database with same CATH homology
 3PA9 A;  2VMT A;  2W7F A;  4W1V A;  2CB1 A;  2VGU A;  4UOY A;  1Z3Z A;  2BI3 A;  2HOZ A;  3R4T A;  3JZL A;  1DKA A;  1GC0 A;  3RI6 A;  1GC2 A;  3DYD A;  5BJ4 A;  4IYO B;  1M0Q A;  1JS6 A;  4LNJ A;  4JEX A;  1UKJ A;  4O6Z A;  4Q76 A;  3UWC A;  4B98 A;  7AAT A;  3F9T A;  4JE5 D;  3B1C A;  2O1B A;  3M5U A;  3EI5 A;  2EZ1 A;  3A9Y A;  5E3K A;  1WST A;  1BS0 A;  3K40 A;  3MC6 A;  3NU8 A;  2CTZ A;  4RM1 A;  1Z7D A;  4ADE A;  5EQC A;  3UAK A;  3BN1 A;  2DGL A;  3AOV A;  4WB0 B;  1G7W A;  3A9Z A;  4EFF A;  1EG5 A;  1IAX A;  3FVX A;  3RBF A;  2BI5 A;  1O62 A;  1BQD A;  3LVK A;  1ZC9 A;  2VIA A;  4F5F A;  2C0R A;  2AY1 A;  1VP4 A;  3JU7 A;  3DXV A;  1CL2 A;  1S0A A;  3I5T A;  4WYF A;  1SZK A;  2BIE A;  2BI9 A;  2QMA A;  1S06 A;  2BI2 A;  1LW5 A;  4ZAH A;  2D5Y A;  2YCT A;  3H14 A;  4GSA A;  4EU1 A;  1AMR A;  1EJI A;  4A0F A;  3DC1 A;  1Y4I A;  4JEV A;  4RJ0 A;  3N4X A;  3FVS A;  5JAY A;  4Y0H A;  2FM1 A;  3JWA A;  3MAD A;  5EAV A;  3RQ1 A;  5F8V A;  5M46 A;  2WK7 A;  2YCP A;  3NU7 A;  1J04 A;  2VMV A;  5DB5 A;  1ELU A;  2F8J A;  1MLZ A;  3WGC A;  2D7Z A;  2O0R A;  2OGE A;  3MAF B;  3E2Z B;  3PJ0 A;  4UQV A;  3VP6 A;  4BMK A;  2FKI A;  3ZZJ A;  1S09 A;  3N75 A;  2W7M A;  4AOA A;  1AIA A;  2JIS A;  1M0N A;  3COG A;  1IX7 A;  4J8L A;  4MY5 A;  1QIT A;  4ZDP A;  2PB0 A;  2YKU A;  5TF5 A;  1N8P A;  5E5I A;  1ASB A;  1N2T A;  1I48 A;  3QPG A;  2ZP7 A;  2VMP A;  1SFF A;  2JJF A;  1O61 A;  4OBV A;  1CL1 A;  2QB3 A;  1CZE A;  3QHX A;  4W1X A;  1WYV A;  3KKI A;  5HHY A;  2CST A;  2GMU A;  4OBU A;  2Q7W A;  2CY8 A;  3LVM A;  3FQ7 A;  3VK4 A;  3ATH A;  3N7N A;  1DJU A;  4RAE A;  4XJO A;  4F5H A;  1IX8 A;  2ZY3 A;  3IHJ A;  3E6G A;  4WXG A;  4A0R A;  2VMN A;  3CAI A;  2VMU A;  2VMR A;  3LY1 A;  4HF8 A;  2Z1Y A;  5M49 A;  3BCA A;  1AHX A;  1OAT A;  5FT6 A;  1O4S A;  2WB6 A;  4RIZ A;  1ZOB A;  4AZK A;  3LVJ A;  4FFC A;  3TFU A;  1U08 A;  4K2B A;  2FN6 A;  3GZD A;  4CBS A;  4TN4 A;  3NYT A;  2QSR A;  3ISL A;  1AHE A;  3G0T A;  5J8Q A;  1SPA A;  4ZWV A;  3K7Y A;  3HQT A;  1KMK A;  1M4N A;  1X0M A;  1YIZ A;  2JGT A;  4GEB A;  4ITX A;  1GD9 A;  2X5D A;  4K2M A;  2BKW A;  4R8D A;  2AY8 A;  3LWS A;  4M2J A;  4WBT A;  3A9X A;  4IYO A;  1IAY A;  5DX5 A;  4A6U A;  3HL2 A;  4Q6R A;  2Z67 A;  1CQ7 A;  1S08 A;  2FNI A;  1UU1 A;  3BWN A;  2X5F A;  1SVV A;  4WYA A;  1FC4 A;  3AOW A;  3EI8 A;  1JG8 A;  3ACZ A;  8AAT A;  1MDX A;  2X8U A;  1M7Y A;  1FG3 A;  1WYT B;  3NX3 A;  1G4V A;  1TOI A;  1MDO A;  3AEJ A;  5E4Z A;  3EZ1 A;  3ASB A;  1ASL A;  1AKC A;  3HBX A;  1AAM A;  4L0O A;  2XH1 A;  4BA4 A;  1TOK A;  1AMA A;  3T32 A;  2VMO A;  5LHA A;  2ZY4 A;  2BHX A;  5EFS A;  4ATP A;  3PD6 A;  4XJP A;  2D7Y A;  3BV0 A;  1ELQ A;  3LG0 A;  4GE4 A;  4N0B A;  3GR9 A;  1S07 A;  4TV7 A;  3FSL A;  1W7N A;  2W7K A;  4A0G A;  3NRA A;  4AH3 A;  5EAA A;  3DR4 A;  3ECD A;  4WYE A;  3II0 A;  1MDZ A;  1M32 A;  2D63 A;  2AEV A;  4WB0 A;  2AAT A;  5K8B A;  1SZU A;  2R5E A;  2W8J A;  3HVY A;  2VGW A;  4KXK A;  4CXR A;  5G2Q A;  4IX8 A;  3AEO A;  2HP2 A;  3FKD A;  2HZP A;  1IBJ A;  1B8G A;  4PFN A;  5G4J A;  2GSA A;  3WY7 A;  3DU4 A;  2PO3 A;  2Z9U A;  5FT5 A;  4CVQ A;  2W8T A;  1AKA A;  2AEU A;  2DKB A;  3K28 A;  1D7U A;  3OKS A;  1WYU A;  3I4J A;  4ZSY A;  1GC4 A;  3D6K A;  3RCH A;  1RVU A;  4Y0I A;  1DFO A;  1BJW A;  1LC5 A;  4UHO A;  4WYD A;  4F5G A;  4RIT A;  2GB3 A;  3ZZK A;  2Z9V A;  2DR1 A;  1C9C A;  1B9H A;  4EB7 A;  4W5K A;  1C0N A;  2KFP A;  1UU2 A;  1CQ8 A;  3EIB A;  2VIB A;  3UE8 A;  1ECX A;  1AAW A;  1G4X A;  4WLH A;  2W7L A;  4ISY A;  2ZJG A;  3WZF A;  3LVL B;  3GWP A;  1BT4 A;  4B9B A;  2JJG A;  2DGK A;  1J32 A;  4I8A A;  1DTY A;  2ZYJ A;  5KTB A;  4WLJ A;  1QIR A;  1VEF A;  3FZ7 A;  2VI9 A;  4OT8 A;  3FTB A;  2V1P A;  2TPL A;  2EZ2 A;  3AEN A;  4WXF A;  5EIG A;  2A1V A;  1C7G A;  4XEW A;  1IVR A;  4XJM A;  4A6R A;  3FDD A;  2R5C A;  3RBL A;  4WYC A;  3WGB A;  1GCK A;  2R0T A;  1D7V A;  1KL1 A;  2EH6 A;  3AEP A;  3FD0 A;  1OHV A;  2EGY A;  3PDB A;  4M2K A;  1EQB A;  4P3M A;  5FT4 A;  3R9A A;  2CJD A;  4A6T A;  1B9I A;  1PG8 A;  2YRI A;  3AEM A;  3G8M A;  1ASN A;  2DKJ A;  4AO9 A;  4H63 Q;  2W7E A;  1ASA A;  3ZRQ A;  1V2D A;  3JTX A;  4R5F A;  1DJE A;  3FRK A;  2OKJ A;  3AEM C;  3B1E A;  1X29 A;  1D7S A;  2X3L A;  2D65 A;  3CQ4 A;  3HMU A;  4BHD A;  3EZS A;  3DR7 A;  1XI9 A;  3E2Z A;  4BA5 A;  2BIG A;  3GJU A;  4FL0 A;  4WP0 A;  2VYC A;  3PGY A;  3AV7 A;  3TFT A;  2Z20 A;  1QJ5 A;  1AKB A;  2CJG A;  2HUF A;  3MEB A;  2BWN A;  2FNU A;  5G0A A;  3WX9 A;  4QGR A;  2W7D A;  1XEY A;  2W8W A;  2C7T A;  1SF2 A;  2O7C A;  1PMO A;  1AY4 A;  2W7H A;  2VGT A;  1GEY A;  4PFF A;  2QBT A;  2Z61 A;  1OHW A;  3L8A A;  4IXS A;  1BJO A;  1TOE A;  4AZJ A;  1LK9 A;  2D64 A;  2HOX A;  4LNM A;  5LH9 A;  3Q8N A;  4F5J A;  4XQ2 A;  1QGN A;  1M0O A;  3EI9 A;  2WKA A;  4E3Q A;  4ZDO A;  1O69 A;  4KYO A;  4Q75 A;  4MQR A;  4DBC A;  5F9S A;  2RFV A;  1TOG A;  1CZC A;  2EO5 A;  1T3I A;  3DXW A;  1BQA A;  4DQ6 A;  1OHY A;  4CBR A;  1AJS A;  3ELE A;  2ZSL A;  3GZC A;  1GEX A;  3MC6 C;  3QI6 A;  3HT4 A;  4K05 A;  2ZSM A;  1H1C A;  4LC3 A;  2AY7 A;  2OGA A;  2C81 A;  2CFB A;  3A2B A;  1X2A A;  3IF2 A;  4WD2 A;  4XJL A;  3NYU A;  2AY5 A;  2BWO A;  1BJN A;  2WK8 A;  4ITG A;  4NOG A;  4R5Z A;  5C6U A;  2OKK A;  3ASA A;  2D61 A;  4OC9 A;  2XBN A;  1I29 A;  3BWN C;  5EUN A;  3B46 A;  1KKP A;  3AAT A;  4JF1 A;  4Q31 A;  2HOY A;  1LC7 A;  4OCA A;  3BC8 A;  3TCM A;  2CH2 A;  2YCN A;  1V72 A;  1MAQ A;  3PIU A;  2W8U A;  4A0H A;  3G7Q A;  3L44 A;  4U2H A;  2QLR A;  4GDY A;  4R2N A;  3DOD A;  1PFF A;  4H51 A;  3USF A;  9AAT A;  1TOJ A;  4IY7 A;  2AY9 A;  1C7N A;  1UU0 A;  1YIY A;  1AMQ A;  2VMW A;  4MSO A;  2W7I A;  1B4X A;  3QGU A;  2VI8 A;  3N0L A;  1AHY A;  4ZM3 A;  1LC8 A;  2HUU A;  2PB2 A;  4GRX A;  4XAU A;  3A8U X;  3CQ5 A;  3JWB A;  5BJ3 A;  1I43 A;  3N4R A;  3HDO A;  2G6W A;  4ZM4 A;  1P3W A;  1QJ3 A;  2FQ6 A;  1BJ4 A;  2GQN A;  4P7Y A;  1AIB A;  2VMS A;  4RLG A;  3FZ8 A;  1MAP A;  3AEL A;  2Z9W A;  1PMM A;  3AEJ C;  4IW7 A;  4F4E A;  1IJI A;  1IUG A;  1ZOD A;  4ZLV A;  1ASF A;  1MLY A;  2QB2 A;  3EUC A;  1QIS A;  4BQ0 A;  4F5L A;  2CIN A;  3F0H A;  3W1H A;  4AO4 A;  2E7I A;  1W3U A;  3BWO A;  2OQX A;  2HP1 A;  1RVY A;  2AY2 A;  3FZ6 A;  2EPJ A;  1DGE A;  2JJE A;  3TAT A;  1YOO A;  4IXO A;  1D7R A;  2C44 A;  3DZZ A;  3EI6 A;  1ORD A;  1ARI A;  3FVU A;  3NDN A;  3NUI A;  3E77 A;  4OTL A;  1YNU A;  4Y0D A;  4LW4 A;  4MQQ A;  4ZDL A;  5DJ1 A;  5EUE A;  1ARG A;  2CAN A;  2VMX A;  3F6T A;  4N0W A;  3E2F A;  4DGT A;  1BJO B;  1W7L A;  3VAX A;  3GZD C;  3BCX A;  1CS1 A;  1C4K A;  1AY5 A;  1E5F A;  1E5E A;  5AX8 A;  3RCH B;  1CQ6 A;  3N5M A;  4GE9 A;  1D2F A;  1W23 A;  1X28 A;  3CQ6 A;  3GET A;  5DJ9 A;  3EI7 A;  1ARH A;  3KE3 A;  2ORD A;  2YKX A;  1YJZ A;  3WCO A;  1AJS B;  4A00 A;  1B5P A;  1JS3 A;  3TQX A;  2DOU A;  3FFH A;  4ATQ A;  2JG2 A;  2W8V A;  3EIA A;  3PAA A;  2YKV A;  2E54 A;  2W7G A;  5M4B A;  4HVK A;  3ELP A;  1IX6 A;  3BB8 A;  2VMZ A;  4E1O A;  3ZRR A;  2AY3 A;  1MGV A;  4ZSW A;  5EIG B;  2ZY2 A;  4ADD A;  2YOB A;  4F5M A;  3E2Y A;  1G7X A;  1M0P A;  5D5S A;  4JEZ A;  4KAM A;  3P1T A;  4RKC A;  3B1D A;  5IWQ A;  1W7M A;  2FYF A;  4EMY A;  2NMP A;  1FG7 A;  4MQP A;  4MKK A;  4W8I A;  2ZY5 A;  4LW2 A;  2DGM A;  3WLX A;  4U1T A;  2AY6 A;  2E7J A;  1YJS A;  1AHG A;  1AHF A;  3VOM A;  1C7O A;  3NNK A;  4WYG A;  5D95 A;  2BIA A;  1AX4 A;  2AY4 A;  2WK9 A;  2HOR A;  1GBN A;  2YRR A;  4ZWM A;  4JF0 A;  1V2E A;  1ART A;  2V0Y A;  3H9X A;  1AIC A;  1OXP A;  2OAT A;  3E9K A;  1DGD A;  3CBF A;  3QM2 A;  4PIW A;  4MGR A;  3N4S A;  3AEN B;  2ZUK A;  2QA3 A;  2R5C B;  3W1J A;  3WKR A;  3DRD A;  4XK1 A;  2CJH A;  5G2P A;  3FFR A;  1AY8 A;  3NYS A;  4K2I A;  1ASM A;  4ADB A;  4F5I A;  1B5O A;  1OXO A;  3PPL A;  1KL2 A;  1LW4 A;  4IXZ A;  1RV4 A;  4OMA A;  4W91 A;  3WKS A;  4EB5 A;  4OYT A;  2VLH A;  1LKC A;  1M6S A;  5EUD A;  4A72 A;  3QN6 A;  2BI1 A;  1VJO A;  1RV3 A;  3MAU A;  3PDX A;  1LS3 A;  3BCB A;  1TPL A;  2VGZ A;  4W1W A;  2HUI A;  2JJH A;  3OP7 A;  2BWP A;  5I92 A;  3W1I A;  4RKD A;  3VK3 A;  5G4I A;  3KGX A;  4LNL A;  3MKJ A;  2VMY A;  4WXB A;  1WKG A;  3MBB A;  4GE7 A;  1KKJ A;  1BW0 A;  1GDE A;  1YJY A;  2BYL A;  4PVF A;  4E3R A;  2YKY A;  1TAR A;  1V2F A;  1BKG A;  4J5U A;  1I41 A;  4M2M A;  2VMQ A;  2BYJ A;  5FT8 A;  1ARS A;  1AJR A;  3FQ8 A;  1GC3 A;  3H7F A;  5HDM A;  3I16 A;  1GEW A;  2D66 A;  2Z1Z A;  1ASC A;  3KGW A;  1N31 A;  3QBO A;  1DJ9 A;  1TAS A;  4JEY A;  2G7J A;  1WYV B;  3HLM A;  1QZ9 A;  2W7J A;  3RUY A;  4TMR A;  2Z9X A;  3LV2 A;  5M4D A;  2ZC0 A;  1TAT A;  1SZS A;  4ADC A;  4RJY A;  1ASE A;  3NTJ A;  4CXQ A;  1AMS A;  1ASD A;  1YAA A;  1CJ0 A;  3JW9 A;  3FQA A;  4JEW A;  3BS8 A;  4ZAS A;  3WCN A;  3NUB A;  2GMS A;  4UHM A;  2VGS A;  2CH1 A;  2VGV A;  4UHN A;  4F5K A;  3P6K A;  1KMJ A;  1WYT A;  2E7U A;  1WKH A;  3VK2 A;  2EYQ A;  1H0C A;  3FCR A;  5HXX A;  2R2N A;  4MKJ A;  3GBX A;  3FDB A;  3MAF A;  3PDB B;  4JE5 A;  3GSB A;  1JF9 A;  2VLF A;  3B8X A;  1ASG A;  1WYU B;  3ZRP A;  4E77 A;  2YHK A;  5G09 A;  3PD6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...