1TOEA

Unliganded structure of hexamutant + a293d mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 140
structure length 395
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1toeA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1toeA01
2AY2A 5G09A 4NOGA 4RIZA 4AZKA 1ARSA 3H7FA 4ADBA 3FRKA 3LVLB 3NRAA 1AJSA 2GQNA 4A0FA 2FM1A 1AKCA 3JTXA 4GDYA 5JAYA 1QGNA 1KL1A 1I43A 1M4NA 2YCTA 4WXBA 4J8LA 1ZOBA 5M46A 3K28A 1RVYA 1S08A 4N0WA 4R8DA 5I92A 3NUBA 2HORA 2CJGA 2AEVA 4OTLA 4P3MA 2VMUA 1C0NA 3TFUA 1AHGA 4AO4A 1P3WA 2DGKA 3NU7A 1ZC9A 1OXPA 2BKWA 3HDOA 3KGWA 4DGTA 1LK9A 4BA5A 2EH6A 2CB1A 3FVSA 1YJYA 1VP4A 4MY5A 1C9CA 2OQXA 2TPLA 3LVKA 2EZ2A 1TOJA 2VGZA 4A6RA 1SZUA 1GEYA 3QBOA 1WKGA 2DR1A 2ZJGA 2R0TA 4OT8A 1AMSA 3MAUA 1OHVA 1Y4IA 1CZEA 1DFOA 3GR9A 2O1BA 4GE7A 1S0AA 2FQ6A 1SPAA 2D63A 2D7ZA 2CY8A 1CQ8A 4RJ0A 1QZ9A 3BV0A 4PFNA 5AX8A 1V72A 3QM2A 1ASNA 3AEMC 3FDDA 3BC8A 3DYDA 2X5FA 3G7QA 1G7XA 4ZDPA 1J32A 5EAVA 3P1TA 3VK3A 1AX4A 4PFFA 1JS6A 1GEXA 1Z7DA 1ASAA 1ORDA 4KAMA 3FVXA 5G4JA 3ZRPA 2DKBA 2GB3A 1TASA 3K7YA 4WLJA 3WKSA 1J04A 4AH3A 1CQ7A 3GJUA 3G0TA 4JE5A 1AICA 2VLHA 1IJIA 2VI9A 2VMOA 3NYUA 1AMAA 4W1WA 5HDMA 2EGYA 3EI8A 4A00A 1ASEA 2W7EA 2R5EA 3ATHA 4J5UA 3WGCA 1IBJA 1QJ3A 2CJHA 3EI9A 1BT4A 1VEFA 2GMUA 4IXOA 1GDEA 1UU0A 1AIAA 4WD2A 5G4IA 4ZWVA 2W8VA 3IHJA 4W5KA 4DQ6A 3CAIA 1VJOA 3MAFB 3BS8A 1ASLA 1OHWA 2BIEA 2HZPA 3EZ1A 1SFFA 4RM1A 4E1OA 2E7JA 2AY8A 4A72A 1TOEA 2QB2A 2VGTA 3RBFA 4A0HA 2E7IA 1CQ6A 2FNIA 1X0MA 5TF5A 5M49A 4Q76A 1B5PA 3M5UA 4B98A 3EUCA 4W8IA 1ARTA 3AOWA 1MDOA 2JJGA 3FZ8A 1GD9A 5EFSA 3WCNA 4ATPA 5C6UA 1ARIA 3PA9A 4BQ0A 4GE4A 4GSAA 1KKPA 2D66A 2OATA 1E5EA 2JISA 2AY3A 1S09A 3B8XA 1B5OA 3VAXA 4F4EA 1WYVB 1CL2A 2W7IA 1ELQA 1V2FA 2OKKA 4M2MA 2VMRA 5IWQA 3EI6A 1BJWA 2BIGA 2YKVA 5E5IA 5FT4A 1PG8A 2XBNA 1AKAA 1YJSA 3A9XA 4IX8A 4MKKA 2D5YA 2NMPA 1Z3ZA 2OGAA 3JW9A 4UHOA 1PMMA 1EJIA 1LW5A 2HOXA 2JJFA 2VMWA 4N0BA 2ZUKA 2BWOA 2CINA 2WK8A 1CJ0A 2YKUA 3E2ZA 4WBTA 4LW2A 2Z1ZA 5EUDA 1KMJA 4MKJA 4CXQA 3II0A 3EI5A 2HP2A 4CXRA 1M7YA 1MDZA 4JF1A 4WB0B 1C7GA 4JEZA 1ASGA 1TOIA 2AY1A 2VMYA 4P7YA 1BW0A 1GC2A 2O0RA 5HXXA 1M6SA 3DODA 3VK2A 1YNUA 2BYLA 1O61A 2W8JA 3LVMA 1MLZA 2YCPA 1ASCA 1W23A 1RV4A 1I29A 1V2EA 1EQBA 4XJOA 3JWBA 4E3RA 5DX5A 1YIZA 4XJPA 1KKJA 3WY7A 2CJDA 2VMPA 4W91A 3RI6A 4EB5A 5DJ9A 2CTZA 2BIAA 3ACZA 1BKGA 4IXZA 2Z9WA 1YJZA 4K2IA 3EIAA 5EIGB 2G6WA 3R9AA 1ASFA 4IXSA 2O7CA 5G2QA 4ITXA 5D95A 1MDXA 4B9BA 3L44A 1DJUA 5M4BA 3DR4A 3BB8A 1CZCA 1AY5A 4MSOA 1CL1A 2HUUA 4ISYA 2BYJA 4ZM3A 4TMRA 3VOMA 3B1EA 1FG3A 1D7SA 4A0RA 4F5IA 3LVJA 4KXKA 1QISA 4XEWA 3W1HA 1D7RA 2WK9A 3ASAA 3PD6B 3WZFA 1ELUA 3WKRA 1AAWA 3N75A 3PD6A 1UU2A 4LNLA 4BA4A 3GWPA 1H1CA 5E4ZA 3KE3A 1O62A 2ZP7A 5HHYA 1AHFA 3AEOA 3LY1A 5EUEA 3TCMA 1LW4A 2ZY5A 1IUGA 2ZY3A 1V2DA 1GEWA 2HUFA 3HMUA 1TOKA 4XK1A 5D5SA 2W7HA 5F9SA 2YKXA 4RITA 4ZSWA 4AOAA 8AATA 3MADA 4OMAA 2YOBA 3QHXA 2V1PA 4ADEA 4I8AA 4LC3A 3AEPA 1ASDA 1JS3A 3BWNA 1BQDA 3MC6C 3W1JA 2W8WA 4Q75A 3N0LA 2AEUA 4F5KA 3ISLA 1RV3A 2BWNA 4UHMA 2JJEA 4WYFA 5EAAA 4E77A 3GBXA 4H51A 4WYCA 3E2YA 2E54A 4ATQA 1ASBA 4RAEA 2W7KA 3VP6A 3RQ1A 3BCXA 3R4TA 3AENB 2AY4A 2PB2A 4HF8A 3MAFA 3AEJC 4U2HA 2QMAA 3GETA 3I4JA 3FDBA 2VGUA 3D6KA 5BJ3A 1AHEA 3GZCA 3GZDC 5FT8A 1ARHA 1GC0A 2D61A 3DU4A 1KL2A 1M0OA 1X2AA 3PDBB 2DGMA 4L0OA 3DXVA 4Y0DA 1ECXA 3FFHA 4E3QA 1AHYA 4F5LA 2CH2A 1E5FA 4IYOB 4A0GA 3DR7A 4WXFA 3WCOA 2JJHA 4OBVA 2D7YA 4GRXA 4WYDA 1N8PA 3ZZJA 1JG8A 4A6TA 1IVRA 1N31A 2AY5A 3ASBA 5E3KA 4OYTA 3BWOA 3PIUA 1SZKA 3AATA 2C81A 2OGEA 3CQ6A 2VMNA 1WYVA 5EQCA 1SZSA 2W8TA 1W7MA 2C44A 3HLMA 1M32A 3PDXA 2ZC0A 1WSTA 2VGWA 3USFA 4FL0A 3E77A 3NYTA 4JF0A 3KGXA 1IAXA 4MGRA 4EMYA 4QGRA 1YOOA 4M2JA 1B4XA 3G8MA 2VYCA 2GSAA 4PVFA 3LWSA 1AY4A 1MAPA 3AEMA 2BHXA 4ZASA 1XEYA 2YKYA 3A2BA 3PPLA 1C7NA 3E9KA 4R5FA 3F0HA 1WYUB 1BJNA 3Q8NA 2W8UA 1N2TA 3CQ5A 3FD0A 3NUIA 3RUYA 1ASMA 3PJ0A 3OP7A 3DXWA 2X3LA 4Q31A 1RVUA 3F6TA 3ELPA 1GC4A 1AMQA 1ARGA 1G4XA 3FQ7A 1BS0A 4WB0A 2VMSA 4GEBA 1DJ9A 1X28A 1SVVA 2D65A 1GBNA 2YRRA 4ZDLA 2CH1A 1IX7A 1M0NA 4U1TA 4F5MA 1DGEA 5LH9A 4F5FA 5EUNA 2BI9A 3ECDA 3QGUA 3UE8A 3JZLA 2CFBA 1D2FA 2EPJA 1G7WA 3AEJA 4MQPA 2W7MA 4F5JA 1TARA 3T32A 3DRDA 4EB7A 3MEBA 4PIWA 2W7JA 3HQTA 5DJ1A 3E2FA 1AKBA 2BI3A 1AY8A 1I41A 4OC9A 4AZJA 3QN6A 4Q6RA 1DGDA 4ITGA 2BI2A 2OKJA 5EIGA 2ORDA 1GC3A 4ZLVA 4EFFA 3P6KA 2XH1A 4LW4A 3KKIA 1ZODA 3QI6A 4K2MA 2CSTA 1AJSB 4UOYA 3JU7A 3AV7A 2YCNA 3QPGA 3DC1A 3OKSA 1W3UA 3E6GA 3LV2A 3PAAA 2AY9A 4A6UA 3W1IA 1FG7A 3FKDA 3WGBA 2ZYJA 3PGYA 4ZAHA 1DJEA 1EG5A 2VGVA 4FFCA 5J8QA 1OXOA 2HOZA 1OHYA 2HOYA 3ELEA 2RFVA 2BWPA 3NX3A 9AATA 3RCHB 2PB0A 4HVKA 4ZM4A 2DGLA 4XJLA 4Y0IA 1O69A 4W1XA 3I16A 2E7UA 3B1CA 2Q7WA 1B9IA 3RCHA 4K2BA 3WLXA 2QBTA 4Y0HA 1H0CA 1AJRA 3LG0A 2VMTA 1QJ5A 2JG2A 1BJOB 1MLYA 2FNUA 3F9TA 1X29A 2F8JA 1M0QA 1WKHA 1C7OA 3HBXA 4RLGA 1BJOA 3L8AA 3AOVA 1D7VA 1QIRA 4O6ZA 4BMKA 4AO9A 3CQ4A 3NNKA 3ZRQA 2D64A 4OCAA 4ZSYA 3N5MA 2AATA 3DZZA 2AY6A 1MAQA 2AY7A 2QA3A 1PMOA 1UKJA 2Z20A 4MQRA 4MQQA 3TFTA 4GE9A 1YAAA 5FT6A 7AATA 3B1DA 1LC8A 3HVYA 1W7LA 3ZRRA 4W1VA 3B46A 2Z67A 4XAUA 3ZZKA 2DKJA 2VMZA 2YHKA 3AENA 4F5HA 2JGTA 1MGVA 2C0RA 1T3IA 3FSLA 5M4DA 2ZY4A 2PO3A 2YRIA 1IAYA 4F5GA 1S06A 4RKDA 4EU1A 1D7UA 3AELA 3FQAA 4WYGA 3PDBA 3VK4A 3EI7A 1I48A 2HUIA 2CANA 4IYOA 3RBLA 3UAKA 1B9HA 1GCKA 1C4KA 2W7GA 3NTJA 4R2NA 4CBRA 1AAMA 1YIYA 1UU1A 3BCBA 3NU8A 4WLHA 3K40A 4XJMA 3WX9A 3BN1A 1BJ4A 2QB3A 2BI5A 3EIBA 2ZSMA 2VMVA 1AMRA 1G4VA 4LNMA 3BCAA 4TN4A 1B8GA 4R5ZA 3A8UX 1LC5A 4ADDA 2ZY2A 4XQ2A 3I5TA 2ZSLA 3FZ7A 2VGSA 4JEVA 3TQXA 2DOUA 4ADCA 2VLFA 2FYFA 2QLRA 2Z61A 4JEWA 4LNJA 3JWAA 1PFFA 1U08A 2Z9XA 3HL2A 1OATA 5BJ4A 1IX8A 1XI9A 1LC7A 2X5DA 1AIBA 2VMQA 2EZ1A 1AHXA 3FCRA 2VIAA 4JE5D 4WXGA 4BHDA 3A9ZA 1WYUA 1SF2A 5FT5A 3H14A 2W7LA 2Z9VA 4IY7A 3MC6A 5DB5A 3FFRA 1W7NA 4CBSA 1LKCA 3HT4A 4M2KA 4WYEA 5K8BA 1LS3A 1DTYA 5LHAA 4WYAA 3A9YA 4OBUA 4UQVA 4WP0A 1KMKA 3E2ZB 1CS1A 2GMSA 2W7FA 4UHNA 3FTBA 3UWCA 2WK7A 1JF9A 2FN6A 2VIBA 2EO5A 1TATA 5G0AA 3FQ8A 4RJYA 2R2NA 5G2PA 3EZSA 1IX6A 1TPLA 3COGA 3MBBA 3MKJA 4DBCA 4ZDOA 3GZDA 2BI1A 4TV7A 1FC4A 4IW7A 2VMXA 2HP1A 3CBFA 1O4SA 1M0PA 4CVQA 1S07A 1BQAA 2W7DA 2VI8A 3NDNA 2R5CB 1QITA 4JEXA 3BWNC 4RKCA 1WYTB 3TATA 2C7TA 1DKAA 2V0YA 2Z9UA 4JEYA 4KYOA 2WKAA 3GSBA 2R5CA 2Z1YA 3NYSA 1WYTA 1TOGA 3FVUA 3FZ6A 3IF2A 5F8VA 2X8UA 4ZWMA
chains in the Genus database with same CATH superfamily
2AY2A 5G09A 4NOGA 4RIZA 4AZKA 1ARSA 3H7FA 4ADBA 3FRKA 3LVLB 3NRAA 1AJSA 2GQNA 4A0FA 2FM1A 1AKCA 3JTXA 4GDYA 5JAYA 1QGNA 1KL1A 1I43A 1M4NA 2YCTA 4WXBA 4J8LA 1ZOBA 5M46A 3K28A 1RVYA 1S08A 4N0WA 4R8DA 5I92A 3NUBA 2HORA 2CJGA 2AEVA 4OTLA 4P3MA 2VMUA 1C0NA 3TFUA 1AHGA 4AO4A 1P3WA 2DGKA 3NU7A 2QSRA 1ZC9A 1OXPA 2BKWA 3HDOA 3KGWA 4DGTA 1LK9A 4BA5A 4K05A 2EH6A 2CB1A 3FVSA 1YJYA 1VP4A 4MY5A 1C9CA 2OQXA 2TPLA 3LVKA 2EZ2A 1TOJA 2VGZA 4A6RA 1SZUA 1GEYA 3QBOA 1WKGA 2DR1A 2ZJGA 2R0TA 4OT8A 1AMSA 3MAUA 1OHVA 1Y4IA 1CZEA 1DFOA 3GR9A 2O1BA 4GE7A 1S0AA 2FQ6A 1SPAA 2D63A 2D7ZA 2CY8A 1CQ8A 4RJ0A 1QZ9A 3BV0A 4PFNA 5AX8A 1V72A 3QM2A 1ASNA 3AEMC 3FDDA 3BC8A 3DYDA 2X5FA 3G7QA 1G7XA 4ZDPA 1J32A 5EAVA 3P1TA 3VK3A 1AX4A 4PFFA 1JS6A 1GEXA 1Z7DA 1ASAA 1ORDA 4KAMA 3FVXA 5G4JA 3ZRPA 2DKBA 2GB3A 1TASA 3K7YA 4WLJA 3WKSA 1J04A 4AH3A 1CQ7A 3GJUA 3G0TA 4JE5A 1AICA 2VLHA 1IJIA 2VI9A 2VMOA 3NYUA 1AMAA 4W1WA 5HDMA 2EGYA 3EI8A 4A00A 1ASEA 2W7EA 2R5EA 3ATHA 4J5UA 3WGCA 1IBJA 1QJ3A 2CJHA 3EI9A 1BT4A 1VEFA 2GMUA 4IXOA 1GDEA 1UU0A 1AIAA 4WD2A 5G4IA 4ZWVA 2W8VA 3IHJA 4W5KA 4DQ6A 2FKIA 3CAIA 1VJOA 3MAFB 3BS8A 1ASLA 1OHWA 2BIEA 2HZPA 3EZ1A 1SFFA 4RM1A 4E1OA 2E7JA 2AY8A 4A72A 1TOEA 2QB2A 2VGTA 3RBFA 4A0HA 2E7IA 1CQ6A 2FNIA 1X0MA 5TF5A 5M49A 4Q76A 1B5PA 3M5UA 4B98A 3H9XA 3EUCA 2WB6A 4W8IA 1ARTA 3AOWA 1MDOA 2JJGA 3FZ8A 1GD9A 5EFSA 3WCNA 4ATPA 5C6UA 1ARIA 3PA9A 4BQ0A 4GE4A 4GSAA 1KKPA 2D66A 2OATA 1E5EA 2JISA 2AY3A 1S09A 3B8XA 1B5OA 3VAXA 4F4EA 1WYVB 1CL2A 2W7IA 1ELQA 1V2FA 2OKKA 4M2MA 2VMRA 5IWQA 3EI6A 1BJWA 2BIGA 2YKVA 5E5IA 5FT4A 1PG8A 2XBNA 1AKAA 1YJSA 3A9XA 4IX8A 4MKKA 2D5YA 2NMPA 1Z3ZA 2OGAA 3JW9A 4UHOA 1PMMA 1EJIA 1LW5A 2HOXA 2JJFA 2VMWA 4N0BA 2ZUKA 2BWOA 2CINA 2WK8A 1CJ0A 2YKUA 3E2ZA 4WBTA 4LW2A 2Z1ZA 5EUDA 1KMJA 4MKJA 4CXQA 3II0A 3EI5A 2HP2A 4CXRA 1M7YA 1MDZA 4JF1A 4WB0B 1C7GA 4JEZA 1ASGA 1TOIA 2AY1A 2VMYA 4P7YA 1BW0A 1GC2A 2O0RA 5HXXA 1M6SA 3DODA 3VK2A 1YNUA 2BYLA 1O61A 2W8JA 3LVMA 1MLZA 2YCPA 3N4RA 1ASCA 1W23A 1RV4A 1I29A 1V2EA 1EQBA 4XJOA 3JWBA 4E3RA 4H63Q 5DX5A 1YIZA 4XJPA 1KKJA 3WY7A 2CJDA 2VMPA 4W91A 3RI6A 4EB5A 5DJ9A 2CTZA 2BIAA 3ACZA 1BKGA 4IXZA 2Z9WA 1YJZA 4K2IA 3EIAA 5EIGB 2G6WA 3R9AA 1ASFA 4IXSA 2O7CA 5G2QA 4ITXA 5D95A 1MDXA 4B9BA 3L44A 1DJUA 5M4BA 3DR4A 3BB8A 1CZCA 1AY5A 4MSOA 1CL1A 2HUUA 4ISYA 2BYJA 4ZM3A 4TMRA 3VOMA 3B1EA 1FG3A 1D7SA 4A0RA 4F5IA 3LVJA 4KXKA 1QISA 4XEWA 3W1HA 1D7RA 2WK9A 3ASAA 3PD6B 3WZFA 1ELUA 3WKRA 1AAWA 3N75A 3PD6A 1UU2A 4LNLA 4BA4A 3GWPA 1H1CA 5E4ZA 3KE3A 1O62A 2ZP7A 5HHYA 1AHFA 3AEOA 3LY1A 5EUEA 3TCMA 1LW4A 2ZY5A 1IUGA 2ZY3A 3N4SA 1V2DA 1GEWA 2HUFA 3HMUA 1TOKA 4XK1A 5D5SA 2W7HA 5F9SA 2YKXA 4RITA 4ZSWA 4AOAA 8AATA 3MADA 4OMAA 2YOBA 3QHXA 2V1PA 4ADEA 3N7NA 4I8AA 4LC3A 3AEPA 1ASDA 1JS3A 3BWNA 1BQDA 3MC6C 3W1JA 2W8WA 4Q75A 3N0LA 2AEUA 4F5KA 3ISLA 1RV3A 2BWNA 4UHMA 2JJEA 4WYFA 5EAAA 4E77A 3GBXA 4H51A 4WYCA 3E2YA 2E54A 4ATQA 1ASBA 4RAEA 2W7KA 3VP6A 3RQ1A 3BCXA 3R4TA 1KAFA 3AENB 2AY4A 2PB2A 4HF8A 3MAFA 3AEJC 4U2HA 2QMAA 3GETA 3I4JA 3FDBA 2VGUA 3D6KA 5BJ3A 1AHEA 3GZCA 3GZDC 5FT8A 1ARHA 1GC0A 2D61A 3DU4A 1KL2A 1M0OA 1X2AA 3PDBB 2DGMA 4L0OA 3DXVA 4Y0DA 1ECXA 3FFHA 4E3QA 1AHYA 4F5LA 2CH2A 1E5FA 4IYOB 4A0GA 3DR7A 4WXFA 3WCOA 2G7JA 2JJHA 4OBVA 2D7YA 4GRXA 4WYDA 1N8PA 3ZZJA 1JG8A 4A6TA 1IVRA 1N31A 2AY5A 3ASBA 5E3KA 4OYTA 3BWOA 3PIUA 1SZKA 3AATA 2C81A 2OGEA 3CQ6A 2VMNA 1WYVA 5EQCA 1SZSA 2W8TA 1W7MA 2C44A 3HLMA 1M32A 3PDXA 2ZC0A 1WSTA 2VGWA 3USFA 4FL0A 3E77A 3NYTA 4JF0A 3KGXA 1IAXA 4MGRA 4EMYA 4QGRA 1YOOA 4M2JA 1B4XA 3G8MA 2VYCA 2GSAA 4PVFA 3LWSA 1AY4A 1MAPA 3AEMA 2BHXA 4ZASA 1XEYA 2YKYA 3A2BA 3PPLA 1C7NA 3E9KA 4R5FA 3F0HA 1WYUB 1BJNA 3Q8NA 2W8UA 1N2TA 3CQ5A 3FD0A 3NUIA 3RUYA 1ASMA 3PJ0A 3OP7A 3DXWA 2X3LA 4Q31A 1RVUA 3F6TA 3ELPA 1GC4A 1AMQA 1ARGA 1G4XA 3FQ7A 1BS0A 4WB0A 2VMSA 4GEBA 5KTBA 1DJ9A 1X28A 1SVVA 2D65A 1GBNA 2YRRA 4ZDLA 2CH1A 1IX7A 1M0NA 4U1TA 4F5MA 1DGEA 5LH9A 4F5FA 5EUNA 2BI9A 3ECDA 3QGUA 3UE8A 3JZLA 2CFBA 1D2FA 2EPJA 1G7WA 3AEJA 4MQPA 2W7MA 4F5JA 1TARA 3T32A 3DRDA 4EB7A 3MEBA 4PIWA 2W7JA 3HQTA 5DJ1A 3E2FA 1AKBA 2BI3A 1AY8A 1I41A 4OC9A 4AZJA 3QN6A 4Q6RA 1DGDA 4ITGA 2BI2A 2OKJA 5EIGA 2ORDA 1GC3A 3N4XA 4ZLVA 4EFFA 3P6KA 2XH1A 4LW4A 3KKIA 1ZODA 3QI6A 4K2MA 2CSTA 1AJSB 4UOYA 3JU7A 3AV7A 2YCNA 3QPGA 3DC1A 3OKSA 1W3UA 3E6GA 3LV2A 3PAAA 2AY9A 4A6UA 3W1IA 1FG7A 3FKDA 3WGBA 2ZYJA 3PGYA 4ZAHA 1DJEA 1EG5A 2VGVA 4FFCA 5J8QA 1OXOA 2HOZA 1OHYA 2HOYA 3ELEA 2RFVA 2BWPA 3NX3A 9AATA 3RCHB 2PB0A 4HVKA 4ZM4A 2DGLA 4XJLA 4Y0IA 1O69A 4W1XA 3I16A 2E7UA 3B1CA 2Q7WA 1B9IA 3RCHA 4K2BA 3WLXA 2QBTA 4Y0HA 1H0CA 1AJRA 3LG0A 2VMTA 1QJ5A 2JG2A 1BJOB 1MLYA 2FNUA 3F9TA 1X29A 2F8JA 2A1VA 1M0QA 1WKHA 1C7OA 3HBXA 4RLGA 1BJOA 3L8AA 3AOVA 1D7VA 1QIRA 4O6ZA 4BMKA 4AO9A 3CQ4A 3NNKA 3ZRQA 2D64A 4OCAA 4ZSYA 3N5MA 2AATA 3DZZA 2AY6A 1MAQA 2AY7A 2QA3A 1PMOA 1UKJA 2Z20A 4MQRA 4MQQA 3TFTA 4GE9A 1YAAA 5FT6A 7AATA 3B1DA 1LC8A 3HVYA 1W7LA 3ZRRA 4W1VA 3B46A 2Z67A 4XAUA 3ZZKA 2DKJA 2VMZA 2YHKA 3AENA 4F5HA 2JGTA 1MGVA 2C0RA 1T3IA 3FSLA 5M4DA 2ZY4A 2PO3A 2YRIA 1IAYA 4F5GA 1S06A 4RKDA 4EU1A 1D7UA 3AELA 3FQAA 4WYGA 3PDBA 3VK4A 3EI7A 1I48A 2HUIA 2CANA 4IYOA 3RBLA 3UAKA 1B9HA 1GCKA 1C4KA 2W7GA 3NTJA 4R2NA 4CBRA 1AAMA 1YIYA 1UU1A 3BCBA 3NU8A 4WLHA 3K40A 4XJMA 2KFPA 3WX9A 3BN1A 1BJ4A 2QB3A 2BI5A 3EIBA 2ZSMA 2VMVA 1AMRA 1G4VA 4LNMA 3BCAA 4TN4A 1B8GA 4R5ZA 3A8UX 1LC5A 4ADDA 2ZY2A 4XQ2A 3I5TA 2ZSLA 3FZ7A 2VGSA 4JEVA 3TQXA 2DOUA 4ADCA 2VLFA 2FYFA 2QLRA 2Z61A 4JEWA 4LNJA 3JWAA 1PFFA 1U08A 2Z9XA 3HL2A 2EYQA 1OATA 5BJ4A 1IX8A 1XI9A 1LC7A 2X5DA 1AIBA 2VMQA 2EZ1A 1AHXA 3FCRA 2VIAA 4JE5D 4WXGA 4BHDA 3A9ZA 1WYUA 1SF2A 5FT5A 3H14A 2W7LA 2Z9VA 4IY7A 3MC6A 5DB5A 3FFRA 1W7NA 4CBSA 1LKCA 3HT4A 4M2KA 4WYEA 5K8BA 1LS3A 1DTYA 5LHAA 4WYAA 3A9YA 4OBUA 4UQVA 4WP0A 1KMKA 3E2ZB 1CS1A 2GMSA 2W7FA 4UHNA 3FTBA 3UWCA 2WK7A 1JF9A 2FN6A 2VIBA 2EO5A 1TATA 5G0AA 3FQ8A 4RJYA 2R2NA 5G2PA 3EZSA 1IX6A 1TPLA 3COGA 3MBBA 3MKJA 4DBCA 4ZDOA 3GZDA 2BI1A 4TV7A 1FC4A 4IW7A 2VMXA 2HP1A 3CBFA 1O4SA 1M0PA 4CVQA 1S07A 1BQAA 2W7DA 2VI8A 3NDNA 2R5CB 1QITA 4JEXA 3BWNC 4RKCA 1WYTB 3TATA 2C7TA 1DKAA 2V0YA 2Z9UA 4JEYA 4KYOA 2WKAA 3GSBA 2R5CA 2Z1YA 3NYSA 1WYTA 1TOGA 3FVUA 3FZ6A 3IF2A 5F8VA 2X8UA 4ZWMA
chains in the Genus database with same CATH topology
2AY2A 5G09A 4NOGA 4RIZA 4AZKA 1ARSA 3H7FA 4ADBA 3FRKA 3LVLB 3NRAA 1AJSA 2GQNA 4A0FA 2FM1A 1AKCA 3JTXA 4GDYA 5JAYA 1QGNA 1KL1A 1I43A 1M4NA 2YCTA 4WXBA 4J8LA 1ZOBA 5M46A 3K28A 1RVYA 1S08A 4N0WA 4R8DA 5I92A 3NUBA 2HORA 2CJGA 2AEVA 4OTLA 4P3MA 2VMUA 1C0NA 3TFUA 1AHGA 4AO4A 1P3WA 2DGKA 3NU7A 2QSRA 1ZC9A 1OXPA 2BKWA 3HDOA 3KGWA 4DGTA 1LK9A 4BA5A 4K05A 2EH6A 2CB1A 3FVSA 1YJYA 1VP4A 4MY5A 1C9CA 2OQXA 2TPLA 3LVKA 2EZ2A 1TOJA 2VGZA 4A6RA 1SZUA 1GEYA 3QBOA 1WKGA 2DR1A 2ZJGA 2R0TA 4OT8A 1AMSA 3MAUA 1OHVA 1Y4IA 1CZEA 1DFOA 3GR9A 2O1BA 4GE7A 1S0AA 2FQ6A 1SPAA 2D63A 2D7ZA 2CY8A 1CQ8A 4RJ0A 1QZ9A 3BV0A 4PFNA 5AX8A 1V72A 3QM2A 1ASNA 3AEMC 3FDDA 3BC8A 3DYDA 2X5FA 3G7QA 1G7XA 4ZDPA 1J32A 5EAVA 3P1TA 3VK3A 1AX4A 4PFFA 1JS6A 1GEXA 1Z7DA 1ASAA 1ORDA 4KAMA 3FVXA 5G4JA 3ZRPA 2DKBA 2GB3A 1TASA 3K7YA 4WLJA 3WKSA 1J04A 4AH3A 1CQ7A 3GJUA 3G0TA 4JE5A 1AICA 2VLHA 1IJIA 2VI9A 2VMOA 3NYUA 1AMAA 4W1WA 5HDMA 2EGYA 3EI8A 4A00A 1ASEA 2W7EA 2R5EA 3ATHA 4J5UA 3WGCA 1IBJA 1QJ3A 2CJHA 3EI9A 1BT4A 1VEFA 2GMUA 4IXOA 1GDEA 1UU0A 1AIAA 4WD2A 5G4IA 4ZWVA 2W8VA 3IHJA 4W5KA 4DQ6A 2FKIA 3CAIA 1VJOA 3MAFB 3BS8A 1ASLA 1OHWA 2BIEA 2HZPA 3EZ1A 1SFFA 4RM1A 4E1OA 2E7JA 2AY8A 4A72A 1TOEA 2QB2A 2VGTA 3RBFA 4A0HA 2E7IA 1CQ6A 2FNIA 1X0MA 5TF5A 5M49A 4Q76A 1B5PA 3M5UA 4B98A 3H9XA 3EUCA 2WB6A 4W8IA 1ARTA 3AOWA 1MDOA 2JJGA 3FZ8A 1GD9A 5EFSA 3WCNA 4ATPA 5C6UA 1ARIA 3PA9A 4BQ0A 4GE4A 4GSAA 1KKPA 2D66A 2OATA 1E5EA 2JISA 2AY3A 1S09A 3B8XA 1B5OA 3VAXA 4F4EA 1WYVB 1CL2A 2W7IA 1ELQA 1V2FA 2OKKA 4M2MA 2VMRA 5IWQA 3EI6A 1BJWA 2BIGA 2YKVA 5E5IA 5FT4A 1PG8A 2XBNA 1AKAA 1YJSA 3A9XA 4IX8A 4MKKA 2D5YA 2NMPA 1Z3ZA 2OGAA 3JW9A 4UHOA 1PMMA 1EJIA 1LW5A 2HOXA 2JJFA 2VMWA 4N0BA 2ZUKA 2BWOA 2CINA 2WK8A 1CJ0A 2YKUA 3E2ZA 4WBTA 4LW2A 2Z1ZA 5EUDA 1KMJA 4MKJA 4CXQA 3II0A 3EI5A 2HP2A 4CXRA 1M7YA 1MDZA 4JF1A 4WB0B 1C7GA 4JEZA 1ASGA 1TOIA 2AY1A 2VMYA 4P7YA 1BW0A 1GC2A 2O0RA 5HXXA 1M6SA 3DODA 3VK2A 1YNUA 2BYLA 1O61A 2W8JA 3LVMA 1MLZA 2YCPA 3N4RA 1ASCA 1W23A 1RV4A 1I29A 1V2EA 1EQBA 4XJOA 3JWBA 4E3RA 4H63Q 5DX5A 1YIZA 4XJPA 1KKJA 3WY7A 2CJDA 2VMPA 4W91A 3RI6A 4EB5A 5DJ9A 2CTZA 2BIAA 3ACZA 1BKGA 4IXZA 2Z9WA 1YJZA 4K2IA 3EIAA 5EIGB 2G6WA 3R9AA 1ASFA 4IXSA 2O7CA 5G2QA 4ITXA 5D95A 1MDXA 4B9BA 3L44A 1DJUA 5M4BA 3DR4A 3BB8A 1CZCA 1AY5A 4MSOA 1CL1A 2HUUA 4ISYA 2BYJA 4ZM3A 4TMRA 3VOMA 3B1EA 1FG3A 1D7SA 4A0RA 4F5IA 3LVJA 4KXKA 1QISA 4XEWA 3W1HA 1D7RA 2WK9A 3ASAA 3PD6B 3WZFA 1ELUA 3WKRA 1AAWA 3N75A 3PD6A 1UU2A 4LNLA 4BA4A 3GWPA 1H1CA 5E4ZA 3KE3A 1O62A 2ZP7A 5HHYA 1AHFA 3AEOA 3LY1A 5EUEA 3TCMA 1LW4A 2ZY5A 1IUGA 2ZY3A 3N4SA 1V2DA 1GEWA 2HUFA 3HMUA 1TOKA 4XK1A 5D5SA 2W7HA 5F9SA 2YKXA 4RITA 4ZSWA 4AOAA 8AATA 3MADA 4OMAA 2YOBA 3QHXA 2V1PA 4ADEA 3N7NA 4I8AA 4LC3A 3AEPA 1ASDA 1JS3A 3BWNA 1BQDA 3MC6C 3W1JA 2W8WA 4Q75A 3N0LA 2AEUA 4F5KA 3ISLA 1RV3A 2BWNA 4UHMA 2JJEA 4WYFA 5EAAA 4E77A 3GBXA 4H51A 4WYCA 3E2YA 2E54A 4ATQA 1ASBA 4RAEA 2W7KA 3VP6A 3RQ1A 3BCXA 3R4TA 3AENB 2AY4A 2PB2A 4HF8A 3MAFA 3AEJC 4U2HA 2QMAA 3GETA 3I4JA 3FDBA 2VGUA 3D6KA 5BJ3A 1AHEA 3GZCA 3GZDC 5FT8A 1ARHA 1GC0A 2D61A 3DU4A 1KL2A 1M0OA 1X2AA 3PDBB 2DGMA 4L0OA 3DXVA 4Y0DA 1ECXA 3FFHA 4E3QA 1AHYA 4F5LA 2CH2A 1E5FA 4IYOB 4A0GA 3DR7A 4WXFA 3WCOA 2G7JA 2JJHA 4OBVA 2D7YA 4GRXA 4WYDA 1N8PA 3ZZJA 1JG8A 4A6TA 1IVRA 1N31A 2AY5A 3ASBA 5E3KA 4OYTA 3BWOA 3PIUA 1SZKA 3AATA 2C81A 2OGEA 3CQ6A 2VMNA 1WYVA 5EQCA 1SZSA 2W8TA 1W7MA 2C44A 3HLMA 1M32A 3PDXA 2ZC0A 1WSTA 2VGWA 3USFA 4FL0A 3E77A 3NYTA 4JF0A 3KGXA 1IAXA 4MGRA 4EMYA 4QGRA 1YOOA 4M2JA 1B4XA 3G8MA 2VYCA 2GSAA 4PVFA 3LWSA 1AY4A 1MAPA 3AEMA 2BHXA 4ZASA 1XEYA 2YKYA 3A2BA 3PPLA 1C7NA 3E9KA 4R5FA 3F0HA 1WYUB 1BJNA 3Q8NA 2W8UA 1N2TA 3CQ5A 3FD0A 3NUIA 3RUYA 1ASMA 3PJ0A 3OP7A 3DXWA 2X3LA 4Q31A 1RVUA 3F6TA 3ELPA 1GC4A 1AMQA 1ARGA 1G4XA 3FQ7A 1BS0A 4WB0A 2VMSA 4GEBA 5KTBA 1DJ9A 1X28A 1SVVA 2D65A 1GBNA 2YRRA 4ZDLA 2CH1A 1IX7A 1M0NA 4U1TA 4F5MA 1DGEA 5LH9A 4F5FA 5EUNA 2BI9A 3ECDA 3QGUA 3UE8A 3JZLA 2CFBA 1D2FA 2EPJA 1G7WA 3AEJA 4MQPA 2W7MA 4F5JA 1TARA 3T32A 3DRDA 4EB7A 3MEBA 4PIWA 2W7JA 3HQTA 5DJ1A 3E2FA 1AKBA 2BI3A 1AY8A 1I41A 4OC9A 4AZJA 3QN6A 4Q6RA 1DGDA 4ITGA 2BI2A 2OKJA 5EIGA 2ORDA 1GC3A 3N4XA 4ZLVA 4EFFA 3P6KA 2XH1A 4LW4A 3KKIA 1ZODA 3QI6A 4K2MA 2CSTA 1AJSB 4UOYA 3JU7A 3AV7A 2YCNA 3QPGA 3DC1A 3OKSA 1W3UA 3E6GA 3LV2A 3PAAA 2AY9A 4A6UA 3W1IA 1FG7A 3FKDA 3WGBA 2ZYJA 3PGYA 4ZAHA 1DJEA 1EG5A 2VGVA 4FFCA 5J8QA 1OXOA 2HOZA 1OHYA 2HOYA 3ELEA 2RFVA 2BWPA 3NX3A 9AATA 3RCHB 2PB0A 4HVKA 4ZM4A 2DGLA 4XJLA 4Y0IA 1O69A 4W1XA 3I16A 2E7UA 3B1CA 2Q7WA 1B9IA 3RCHA 4K2BA 3WLXA 2QBTA 4Y0HA 1H0CA 1AJRA 3LG0A 2VMTA 1QJ5A 2JG2A 1BJOB 1MLYA 2FNUA 3F9TA 1X29A 2F8JA 2A1VA 1M0QA 1WKHA 1C7OA 3HBXA 4RLGA 1BJOA 3L8AA 3AOVA 1D7VA 1QIRA 4O6ZA 4BMKA 4AO9A 3CQ4A 3NNKA 3ZRQA 2D64A 4OCAA 4ZSYA 3N5MA 2AATA 3DZZA 2AY6A 1MAQA 2AY7A 2QA3A 1PMOA 1UKJA 2Z20A 4MQRA 4MQQA 3TFTA 4GE9A 1YAAA 5FT6A 7AATA 3B1DA 1LC8A 3HVYA 1W7LA 3ZRRA 4W1VA 3B46A 2Z67A 4XAUA 3ZZKA 2DKJA 2VMZA 2YHKA 3AENA 4F5HA 2JGTA 1MGVA 2C0RA 1T3IA 3FSLA 5M4DA 2ZY4A 2PO3A 2YRIA 1IAYA 4F5GA 1S06A 4RKDA 4EU1A 1D7UA 3AELA 3FQAA 4WYGA 3PDBA 3VK4A 3EI7A 1I48A 2HUIA 2CANA 4IYOA 3RBLA 3UAKA 1B9HA 1GCKA 1C4KA 2W7GA 3NTJA 4R2NA 4CBRA 1AAMA 1YIYA 1UU1A 3BCBA 3NU8A 4WLHA 3K40A 4XJMA 2KFPA 3WX9A 3BN1A 1BJ4A 2QB3A 2BI5A 3EIBA 2ZSMA 2VMVA 1AMRA 1G4VA 4LNMA 3BCAA 4TN4A 1B8GA 4R5ZA 3A8UX 1LC5A 4ADDA 2ZY2A 4XQ2A 3I5TA 2ZSLA 3FZ7A 2VGSA 4JEVA 3TQXA 2DOUA 4ADCA 2VLFA 2FYFA 2QLRA 2Z61A 4JEWA 4LNJA 3JWAA 1PFFA 1U08A 2Z9XA 3HL2A 2EYQA 1OATA 5BJ4A 1IX8A 1XI9A 1LC7A 2X5DA 1AIBA 2VMQA 2EZ1A 1AHXA 3FCRA 2VIAA 4JE5D 4WXGA 4BHDA 3A9ZA 1WYUA 1SF2A 5FT5A 3H14A 2W7LA 2Z9VA 4IY7A 3MC6A 5DB5A 3FFRA 1W7NA 4CBSA 1LKCA 3HT4A 4M2KA 4WYEA 5K8BA 1LS3A 1DTYA 5LHAA 4WYAA 3A9YA 4OBUA 4UQVA 4WP0A 1KMKA 3E2ZB 1CS1A 2GMSA 2W7FA 4UHNA 3FTBA 3UWCA 2WK7A 1JF9A 2FN6A 2VIBA 2EO5A 1TATA 5G0AA 3FQ8A 4RJYA 2R2NA 5G2PA 3EZSA 1IX6A 1TPLA 3COGA 3MBBA 3MKJA 4DBCA 4ZDOA 3GZDA 2BI1A 4TV7A 1FC4A 4IW7A 2VMXA 2HP1A 3CBFA 1O4SA 1M0PA 4CVQA 1S07A 1BQAA 2W7DA 2VI8A 3NDNA 2R5CB 1QITA 4JEXA 3BWNC 4RKCA 1WYTB 3TATA 2C7TA 1DKAA 2V0YA 2Z9UA 4JEYA 4KYOA 2WKAA 3GSBA 2R5CA 2Z1YA 3NYSA 1WYTA 1TOGA 3FVUA 3FZ6A 3IF2A 5F8VA 2X8UA 4ZWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY2 A;  5G09 A;  4NOG A;  4RIZ A;  4AZK A;  1ARS A;  3H7F A;  4ADB A;  3FRK A;  3LVL B;  3NRA A;  1AJS A;  2GQN A;  4A0F A;  2FM1 A;  1AKC A;  3JTX A;  4GDY A;  5JAY A;  1QGN A;  1KL1 A;  1I43 A;  1M4N A;  2YCT A;  4WXB A;  4J8L A;  1ZOB A;  5M46 A;  3K28 A;  1RVY A;  1S08 A;  4N0W A;  4R8D A;  5I92 A;  3NUB A;  2HOR A;  2CJG A;  2AEV A;  4OTL A;  4P3M A;  2VMU A;  1C0N A;  3TFU A;  1AHG A;  4AO4 A;  1P3W A;  2DGK A;  3NU7 A;  1ZC9 A;  1OXP A;  2BKW A;  3HDO A;  3KGW A;  4DGT A;  1LK9 A;  4BA5 A;  2EH6 A;  2CB1 A;  3FVS A;  1YJY A;  1VP4 A;  4MY5 A;  1C9C A;  2OQX A;  2TPL A;  3LVK A;  2EZ2 A;  1TOJ A;  2VGZ A;  4A6R A;  1SZU A;  1GEY A;  3QBO A;  1WKG A;  2DR1 A;  2ZJG A;  2R0T A;  4OT8 A;  1AMS A;  3MAU A;  1OHV A;  1Y4I A;  1CZE A;  1DFO A;  3GR9 A;  2O1B A;  4GE7 A;  1S0A A;  2FQ6 A;  1SPA A;  2D63 A;  2D7Z A;  2CY8 A;  1CQ8 A;  4RJ0 A;  1QZ9 A;  3BV0 A;  4PFN A;  5AX8 A;  1V72 A;  3QM2 A;  1ASN A;  3AEM C;  3FDD A;  3BC8 A;  3DYD A;  2X5F A;  3G7Q A;  1G7X A;  4ZDP A;  1J32 A;  5EAV A;  3P1T A;  3VK3 A;  1AX4 A;  4PFF A;  1JS6 A;  1GEX A;  1Z7D A;  1ASA A;  1ORD A;  4KAM A;  3FVX A;  5G4J A;  3ZRP A;  2DKB A;  2GB3 A;  1TAS A;  3K7Y A;  4WLJ A;  3WKS A;  1J04 A;  4AH3 A;  1CQ7 A;  3GJU A;  3G0T A;  4JE5 A;  1AIC A;  2VLH A;  1IJI A;  2VI9 A;  2VMO A;  3NYU A;  1AMA A;  4W1W A;  5HDM A;  2EGY A;  3EI8 A;  4A00 A;  1ASE A;  2W7E A;  2R5E A;  3ATH A;  4J5U A;  3WGC A;  1IBJ A;  1QJ3 A;  2CJH A;  3EI9 A;  1BT4 A;  1VEF A;  2GMU A;  4IXO A;  1GDE A;  1UU0 A;  1AIA A;  4WD2 A;  5G4I A;  4ZWV A;  2W8V A;  3IHJ A;  4W5K A;  4DQ6 A;  3CAI A;  1VJO A;  3MAF B;  3BS8 A;  1ASL A;  1OHW A;  2BIE A;  2HZP A;  3EZ1 A;  1SFF A;  4RM1 A;  4E1O A;  2E7J A;  2AY8 A;  4A72 A;  1TOE A;  2QB2 A;  2VGT A;  3RBF A;  4A0H A;  2E7I A;  1CQ6 A;  2FNI A;  1X0M A;  5TF5 A;  5M49 A;  4Q76 A;  1B5P A;  3M5U A;  4B98 A;  3EUC A;  4W8I A;  1ART A;  3AOW A;  1MDO A;  2JJG A;  3FZ8 A;  1GD9 A;  5EFS A;  3WCN A;  4ATP A;  5C6U A;  1ARI A;  3PA9 A;  4BQ0 A;  4GE4 A;  4GSA A;  1KKP A;  2D66 A;  2OAT A;  1E5E A;  2JIS A;  2AY3 A;  1S09 A;  3B8X A;  1B5O A;  3VAX A;  4F4E A;  1WYV B;  1CL2 A;  2W7I A;  1ELQ A;  1V2F A;  2OKK A;  4M2M A;  2VMR A;  5IWQ A;  3EI6 A;  1BJW A;  2BIG A;  2YKV A;  5E5I A;  5FT4 A;  1PG8 A;  2XBN A;  1AKA A;  1YJS A;  3A9X A;  4IX8 A;  4MKK A;  2D5Y A;  2NMP A;  1Z3Z A;  2OGA A;  3JW9 A;  4UHO A;  1PMM A;  1EJI A;  1LW5 A;  2HOX A;  2JJF A;  2VMW A;  4N0B A;  2ZUK A;  2BWO A;  2CIN A;  2WK8 A;  1CJ0 A;  2YKU A;  3E2Z A;  4WBT A;  4LW2 A;  2Z1Z A;  5EUD A;  1KMJ A;  4MKJ A;  4CXQ A;  3II0 A;  3EI5 A;  2HP2 A;  4CXR A;  1M7Y A;  1MDZ A;  4JF1 A;  4WB0 B;  1C7G A;  4JEZ A;  1ASG A;  1TOI A;  2AY1 A;  2VMY A;  4P7Y A;  1BW0 A;  1GC2 A;  2O0R A;  5HXX A;  1M6S A;  3DOD A;  3VK2 A;  1YNU A;  2BYL A;  1O61 A;  2W8J A;  3LVM A;  1MLZ A;  2YCP A;  1ASC A;  1W23 A;  1RV4 A;  1I29 A;  1V2E A;  1EQB A;  4XJO A;  3JWB A;  4E3R A;  5DX5 A;  1YIZ A;  4XJP A;  1KKJ A;  3WY7 A;  2CJD A;  2VMP A;  4W91 A;  3RI6 A;  4EB5 A;  5DJ9 A;  2CTZ A;  2BIA A;  3ACZ A;  1BKG A;  4IXZ A;  2Z9W A;  1YJZ A;  4K2I A;  3EIA A;  5EIG B;  2G6W A;  3R9A A;  1ASF A;  4IXS A;  2O7C A;  5G2Q A;  4ITX A;  5D95 A;  1MDX A;  4B9B A;  3L44 A;  1DJU A;  5M4B A;  3DR4 A;  3BB8 A;  1CZC A;  1AY5 A;  4MSO A;  1CL1 A;  2HUU A;  4ISY A;  2BYJ A;  4ZM3 A;  4TMR A;  3VOM A;  3B1E A;  1FG3 A;  1D7S A;  4A0R A;  4F5I A;  3LVJ A;  4KXK A;  1QIS A;  4XEW A;  3W1H A;  1D7R A;  2WK9 A;  3ASA A;  3PD6 B;  3WZF A;  1ELU A;  3WKR A;  1AAW A;  3N75 A;  3PD6 A;  1UU2 A;  4LNL A;  4BA4 A;  3GWP A;  1H1C A;  5E4Z A;  3KE3 A;  1O62 A;  2ZP7 A;  5HHY A;  1AHF A;  3AEO A;  3LY1 A;  5EUE A;  3TCM A;  1LW4 A;  2ZY5 A;  1IUG A;  2ZY3 A;  1V2D A;  1GEW A;  2HUF A;  3HMU A;  1TOK A;  4XK1 A;  5D5S A;  2W7H A;  5F9S A;  2YKX A;  4RIT A;  4ZSW A;  4AOA A;  8AAT A;  3MAD A;  4OMA A;  2YOB A;  3QHX A;  2V1P A;  4ADE A;  4I8A A;  4LC3 A;  3AEP A;  1ASD A;  1JS3 A;  3BWN A;  1BQD A;  3MC6 C;  3W1J A;  2W8W A;  4Q75 A;  3N0L A;  2AEU A;  4F5K A;  3ISL A;  1RV3 A;  2BWN A;  4UHM A;  2JJE A;  4WYF A;  5EAA A;  4E77 A;  3GBX A;  4H51 A;  4WYC A;  3E2Y A;  2E54 A;  4ATQ A;  1ASB A;  4RAE A;  2W7K A;  3VP6 A;  3RQ1 A;  3BCX A;  3R4T A;  3AEN B;  2AY4 A;  2PB2 A;  4HF8 A;  3MAF A;  3AEJ C;  4U2H A;  2QMA A;  3GET A;  3I4J A;  3FDB A;  2VGU A;  3D6K A;  5BJ3 A;  1AHE A;  3GZC A;  3GZD C;  5FT8 A;  1ARH A;  1GC0 A;  2D61 A;  3DU4 A;  1KL2 A;  1M0O A;  1X2A A;  3PDB B;  2DGM A;  4L0O A;  3DXV A;  4Y0D A;  1ECX A;  3FFH A;  4E3Q A;  1AHY A;  4F5L A;  2CH2 A;  1E5F A;  4IYO B;  4A0G A;  3DR7 A;  4WXF A;  3WCO A;  2JJH A;  4OBV A;  2D7Y A;  4GRX A;  4WYD A;  1N8P A;  3ZZJ A;  1JG8 A;  4A6T A;  1IVR A;  1N31 A;  2AY5 A;  3ASB A;  5E3K A;  4OYT A;  3BWO A;  3PIU A;  1SZK A;  3AAT A;  2C81 A;  2OGE A;  3CQ6 A;  2VMN A;  1WYV A;  5EQC A;  1SZS A;  2W8T A;  1W7M A;  2C44 A;  3HLM A;  1M32 A;  3PDX A;  2ZC0 A;  1WST A;  2VGW A;  3USF A;  4FL0 A;  3E77 A;  3NYT A;  4JF0 A;  3KGX A;  1IAX A;  4MGR A;  4EMY A;  4QGR A;  1YOO A;  4M2J A;  1B4X A;  3G8M A;  2VYC A;  2GSA A;  4PVF A;  3LWS A;  1AY4 A;  1MAP A;  3AEM A;  2BHX A;  4ZAS A;  1XEY A;  2YKY A;  3A2B A;  3PPL A;  1C7N A;  3E9K A;  4R5F A;  3F0H A;  1WYU B;  1BJN A;  3Q8N A;  2W8U A;  1N2T A;  3CQ5 A;  3FD0 A;  3NUI A;  3RUY A;  1ASM A;  3PJ0 A;  3OP7 A;  3DXW A;  2X3L A;  4Q31 A;  1RVU A;  3F6T A;  3ELP A;  1GC4 A;  1AMQ A;  1ARG A;  1G4X A;  3FQ7 A;  1BS0 A;  4WB0 A;  2VMS A;  4GEB A;  1DJ9 A;  1X28 A;  1SVV A;  2D65 A;  1GBN A;  2YRR A;  4ZDL A;  2CH1 A;  1IX7 A;  1M0N A;  4U1T A;  4F5M A;  1DGE A;  5LH9 A;  4F5F A;  5EUN A;  2BI9 A;  3ECD A;  3QGU A;  3UE8 A;  3JZL A;  2CFB A;  1D2F A;  2EPJ A;  1G7W A;  3AEJ A;  4MQP A;  2W7M A;  4F5J A;  1TAR A;  3T32 A;  3DRD A;  4EB7 A;  3MEB A;  4PIW A;  2W7J A;  3HQT A;  5DJ1 A;  3E2F A;  1AKB A;  2BI3 A;  1AY8 A;  1I41 A;  4OC9 A;  4AZJ A;  3QN6 A;  4Q6R A;  1DGD A;  4ITG A;  2BI2 A;  2OKJ A;  5EIG A;  2ORD A;  1GC3 A;  4ZLV A;  4EFF A;  3P6K A;  2XH1 A;  4LW4 A;  3KKI A;  1ZOD A;  3QI6 A;  4K2M A;  2CST A;  1AJS B;  4UOY A;  3JU7 A;  3AV7 A;  2YCN A;  3QPG A;  3DC1 A;  3OKS A;  1W3U A;  3E6G A;  3LV2 A;  3PAA A;  2AY9 A;  4A6U A;  3W1I A;  1FG7 A;  3FKD A;  3WGB A;  2ZYJ A;  3PGY A;  4ZAH A;  1DJE A;  1EG5 A;  2VGV A;  4FFC A;  5J8Q A;  1OXO A;  2HOZ A;  1OHY A;  2HOY A;  3ELE A;  2RFV A;  2BWP A;  3NX3 A;  9AAT A;  3RCH B;  2PB0 A;  4HVK A;  4ZM4 A;  2DGL A;  4XJL A;  4Y0I A;  1O69 A;  4W1X A;  3I16 A;  2E7U A;  3B1C A;  2Q7W A;  1B9I A;  3RCH A;  4K2B A;  3WLX A;  2QBT A;  4Y0H A;  1H0C A;  1AJR A;  3LG0 A;  2VMT A;  1QJ5 A;  2JG2 A;  1BJO B;  1MLY A;  2FNU A;  3F9T A;  1X29 A;  2F8J A;  1M0Q A;  1WKH A;  1C7O A;  3HBX A;  4RLG A;  1BJO A;  3L8A A;  3AOV A;  1D7V A;  1QIR A;  4O6Z A;  4BMK A;  4AO9 A;  3CQ4 A;  3NNK A;  3ZRQ A;  2D64 A;  4OCA A;  4ZSY A;  3N5M A;  2AAT A;  3DZZ A;  2AY6 A;  1MAQ A;  2AY7 A;  2QA3 A;  1PMO A;  1UKJ A;  2Z20 A;  4MQR A;  4MQQ A;  3TFT A;  4GE9 A;  1YAA A;  5FT6 A;  7AAT A;  3B1D A;  1LC8 A;  3HVY A;  1W7L A;  3ZRR A;  4W1V A;  3B46 A;  2Z67 A;  4XAU A;  3ZZK A;  2DKJ A;  2VMZ A;  2YHK A;  3AEN A;  4F5H A;  2JGT A;  1MGV A;  2C0R A;  1T3I A;  3FSL A;  5M4D A;  2ZY4 A;  2PO3 A;  2YRI A;  1IAY A;  4F5G A;  1S06 A;  4RKD A;  4EU1 A;  1D7U A;  3AEL A;  3FQA A;  4WYG A;  3PDB A;  3VK4 A;  3EI7 A;  1I48 A;  2HUI A;  2CAN A;  4IYO A;  3RBL A;  3UAK A;  1B9H A;  1GCK A;  1C4K A;  2W7G A;  3NTJ A;  4R2N A;  4CBR A;  1AAM A;  1YIY A;  1UU1 A;  3BCB A;  3NU8 A;  4WLH A;  3K40 A;  4XJM A;  3WX9 A;  3BN1 A;  1BJ4 A;  2QB3 A;  2BI5 A;  3EIB A;  2ZSM A;  2VMV A;  1AMR A;  1G4V A;  4LNM A;  3BCA A;  4TN4 A;  1B8G A;  4R5Z A;  3A8U X;  1LC5 A;  4ADD A;  2ZY2 A;  4XQ2 A;  3I5T A;  2ZSL A;  3FZ7 A;  2VGS A;  4JEV A;  3TQX A;  2DOU A;  4ADC A;  2VLF A;  2FYF A;  2QLR A;  2Z61 A;  4JEW A;  4LNJ A;  3JWA A;  1PFF A;  1U08 A;  2Z9X A;  3HL2 A;  1OAT A;  5BJ4 A;  1IX8 A;  1XI9 A;  1LC7 A;  2X5D A;  1AIB A;  2VMQ A;  2EZ1 A;  1AHX A;  3FCR A;  2VIA A;  4JE5 D;  4WXG A;  4BHD A;  3A9Z A;  1WYU A;  1SF2 A;  5FT5 A;  3H14 A;  2W7L A;  2Z9V A;  4IY7 A;  3MC6 A;  5DB5 A;  3FFR A;  1W7N A;  4CBS A;  1LKC A;  3HT4 A;  4M2K A;  4WYE A;  5K8B A;  1LS3 A;  1DTY A;  5LHA A;  4WYA A;  3A9Y A;  4OBU A;  4UQV A;  4WP0 A;  1KMK A;  3E2Z B;  1CS1 A;  2GMS A;  2W7F A;  4UHN A;  3FTB A;  3UWC A;  2WK7 A;  1JF9 A;  2FN6 A;  2VIB A;  2EO5 A;  1TAT A;  5G0A A;  3FQ8 A;  4RJY A;  2R2N A;  5G2P A;  3EZS A;  1IX6 A;  1TPL A;  3COG A;  3MBB A;  3MKJ A;  4DBC A;  4ZDO A;  3GZD A;  2BI1 A;  4TV7 A;  1FC4 A;  4IW7 A;  2VMX A;  2HP1 A;  3CBF A;  1O4S A;  1M0P A;  4CVQ A;  1S07 A;  1BQA A;  2W7D A;  2VI8 A;  3NDN A;  2R5C B;  1QIT A;  4JEX A;  3BWN C;  4RKC A;  1WYT B;  3TAT A;  2C7T A;  1DKA A;  2V0Y A;  2Z9U A;  4JEY A;  4KYO A;  2WKA A;  3GSB A;  2R5C A;  2Z1Y A;  3NYS A;  1WYT A;  1TOG A;  3FVU A;  3FZ6 A;  3IF2 A;  5F8V A;  2X8U A;  4ZWM A; 
#chains in the Genus database with same CATH topology
 2AY2 A;  5G09 A;  4NOG A;  4RIZ A;  4AZK A;  1ARS A;  3H7F A;  4ADB A;  3FRK A;  3LVL B;  3NRA A;  1AJS A;  2GQN A;  4A0F A;  2FM1 A;  1AKC A;  3JTX A;  4GDY A;  5JAY A;  1QGN A;  1KL1 A;  1I43 A;  1M4N A;  2YCT A;  4WXB A;  4J8L A;  1ZOB A;  5M46 A;  3K28 A;  1RVY A;  1S08 A;  4N0W A;  4R8D A;  5I92 A;  3NUB A;  2HOR A;  2CJG A;  2AEV A;  4OTL A;  4P3M A;  2VMU A;  1C0N A;  3TFU A;  1AHG A;  4AO4 A;  1P3W A;  2DGK A;  3NU7 A;  2QSR A;  1ZC9 A;  1OXP A;  2BKW A;  3HDO A;  3KGW A;  4DGT A;  1LK9 A;  4BA5 A;  4K05 A;  2EH6 A;  2CB1 A;  3FVS A;  1YJY A;  1VP4 A;  4MY5 A;  1C9C A;  2OQX A;  2TPL A;  3LVK A;  2EZ2 A;  1TOJ A;  2VGZ A;  4A6R A;  1SZU A;  1GEY A;  3QBO A;  1WKG A;  2DR1 A;  2ZJG A;  2R0T A;  4OT8 A;  1AMS A;  3MAU A;  1OHV A;  1Y4I A;  1CZE A;  1DFO A;  3GR9 A;  2O1B A;  4GE7 A;  1S0A A;  2FQ6 A;  1SPA A;  2D63 A;  2D7Z A;  2CY8 A;  1CQ8 A;  4RJ0 A;  1QZ9 A;  3BV0 A;  4PFN A;  5AX8 A;  1V72 A;  3QM2 A;  1ASN A;  3AEM C;  3FDD A;  3BC8 A;  3DYD A;  2X5F A;  3G7Q A;  1G7X A;  4ZDP A;  1J32 A;  5EAV A;  3P1T A;  3VK3 A;  1AX4 A;  4PFF A;  1JS6 A;  1GEX A;  1Z7D A;  1ASA A;  1ORD A;  4KAM A;  3FVX A;  5G4J A;  3ZRP A;  2DKB A;  2GB3 A;  1TAS A;  3K7Y A;  4WLJ A;  3WKS A;  1J04 A;  4AH3 A;  1CQ7 A;  3GJU A;  3G0T A;  4JE5 A;  1AIC A;  2VLH A;  1IJI A;  2VI9 A;  2VMO A;  3NYU A;  1AMA A;  4W1W A;  5HDM A;  2EGY A;  3EI8 A;  4A00 A;  1ASE A;  2W7E A;  2R5E A;  3ATH A;  4J5U A;  3WGC A;  1IBJ A;  1QJ3 A;  2CJH A;  3EI9 A;  1BT4 A;  1VEF A;  2GMU A;  4IXO A;  1GDE A;  1UU0 A;  1AIA A;  4WD2 A;  5G4I A;  4ZWV A;  2W8V A;  3IHJ A;  4W5K A;  4DQ6 A;  2FKI A;  3CAI A;  1VJO A;  3MAF B;  3BS8 A;  1ASL A;  1OHW A;  2BIE A;  2HZP A;  3EZ1 A;  1SFF A;  4RM1 A;  4E1O A;  2E7J A;  2AY8 A;  4A72 A;  1TOE A;  2QB2 A;  2VGT A;  3RBF A;  4A0H A;  2E7I A;  1CQ6 A;  2FNI A;  1X0M A;  5TF5 A;  5M49 A;  4Q76 A;  1B5P A;  3M5U A;  4B98 A;  3H9X A;  3EUC A;  2WB6 A;  4W8I A;  1ART A;  3AOW A;  1MDO A;  2JJG A;  3FZ8 A;  1GD9 A;  5EFS A;  3WCN A;  4ATP A;  5C6U A;  1ARI A;  3PA9 A;  4BQ0 A;  4GE4 A;  4GSA A;  1KKP A;  2D66 A;  2OAT A;  1E5E A;  2JIS A;  2AY3 A;  1S09 A;  3B8X A;  1B5O A;  3VAX A;  4F4E A;  1WYV B;  1CL2 A;  2W7I A;  1ELQ A;  1V2F A;  2OKK A;  4M2M A;  2VMR A;  5IWQ A;  3EI6 A;  1BJW A;  2BIG A;  2YKV A;  5E5I A;  5FT4 A;  1PG8 A;  2XBN A;  1AKA A;  1YJS A;  3A9X A;  4IX8 A;  4MKK A;  2D5Y A;  2NMP A;  1Z3Z A;  2OGA A;  3JW9 A;  4UHO A;  1PMM A;  1EJI A;  1LW5 A;  2HOX A;  2JJF A;  2VMW A;  4N0B A;  2ZUK A;  2BWO A;  2CIN A;  2WK8 A;  1CJ0 A;  2YKU A;  3E2Z A;  4WBT A;  4LW2 A;  2Z1Z A;  5EUD A;  1KMJ A;  4MKJ A;  4CXQ A;  3II0 A;  3EI5 A;  2HP2 A;  4CXR A;  1M7Y A;  1MDZ A;  4JF1 A;  4WB0 B;  1C7G A;  4JEZ A;  1ASG A;  1TOI A;  2AY1 A;  2VMY A;  4P7Y A;  1BW0 A;  1GC2 A;  2O0R A;  5HXX A;  1M6S A;  3DOD A;  3VK2 A;  1YNU A;  2BYL A;  1O61 A;  2W8J A;  3LVM A;  1MLZ A;  2YCP A;  3N4R A;  1ASC A;  1W23 A;  1RV4 A;  1I29 A;  1V2E A;  1EQB A;  4XJO A;  3JWB A;  4E3R A;  4H63 Q;  5DX5 A;  1YIZ A;  4XJP A;  1KKJ A;  3WY7 A;  2CJD A;  2VMP A;  4W91 A;  3RI6 A;  4EB5 A;  5DJ9 A;  2CTZ A;  2BIA A;  3ACZ A;  1BKG A;  4IXZ A;  2Z9W A;  1YJZ A;  4K2I A;  3EIA A;  5EIG B;  2G6W A;  3R9A A;  1ASF A;  4IXS A;  2O7C A;  5G2Q A;  4ITX A;  5D95 A;  1MDX A;  4B9B A;  3L44 A;  1DJU A;  5M4B A;  3DR4 A;  3BB8 A;  1CZC A;  1AY5 A;  4MSO A;  1CL1 A;  2HUU A;  4ISY A;  2BYJ A;  4ZM3 A;  4TMR A;  3VOM A;  3B1E A;  1FG3 A;  1D7S A;  4A0R A;  4F5I A;  3LVJ A;  4KXK A;  1QIS A;  4XEW A;  3W1H A;  1D7R A;  2WK9 A;  3ASA A;  3PD6 B;  3WZF A;  1ELU A;  3WKR A;  1AAW A;  3N75 A;  3PD6 A;  1UU2 A;  4LNL A;  4BA4 A;  3GWP A;  1H1C A;  5E4Z A;  3KE3 A;  1O62 A;  2ZP7 A;  5HHY A;  1AHF A;  3AEO A;  3LY1 A;  5EUE A;  3TCM A;  1LW4 A;  2ZY5 A;  1IUG A;  2ZY3 A;  3N4S A;  1V2D A;  1GEW A;  2HUF A;  3HMU A;  1TOK A;  4XK1 A;  5D5S A;  2W7H A;  5F9S A;  2YKX A;  4RIT A;  4ZSW A;  4AOA A;  8AAT A;  3MAD A;  4OMA A;  2YOB A;  3QHX A;  2V1P A;  4ADE A;  3N7N A;  4I8A A;  4LC3 A;  3AEP A;  1ASD A;  1JS3 A;  3BWN A;  1BQD A;  3MC6 C;  3W1J A;  2W8W A;  4Q75 A;  3N0L A;  2AEU A;  4F5K A;  3ISL A;  1RV3 A;  2BWN A;  4UHM A;  2JJE A;  4WYF A;  5EAA A;  4E77 A;  3GBX A;  4H51 A;  4WYC A;  3E2Y A;  2E54 A;  4ATQ A;  1ASB A;  4RAE A;  2W7K A;  3VP6 A;  3RQ1 A;  3BCX A;  3R4T A;  1KAF A;  3AEN B;  2AY4 A;  2PB2 A;  4HF8 A;  3MAF A;  3AEJ C;  4U2H A;  2QMA A;  3GET A;  3I4J A;  3FDB A;  2VGU A;  3D6K A;  5BJ3 A;  1AHE A;  3GZC A;  3GZD C;  5FT8 A;  1ARH A;  1GC0 A;  2D61 A;  3DU4 A;  1KL2 A;  1M0O A;  1X2A A;  3PDB B;  2DGM A;  4L0O A;  3DXV A;  4Y0D A;  1ECX A;  3FFH A;  4E3Q A;  1AHY A;  4F5L A;  2CH2 A;  1E5F A;  4IYO B;  4A0G A;  3DR7 A;  4WXF A;  3WCO A;  2G7J A;  2JJH A;  4OBV A;  2D7Y A;  4GRX A;  4WYD A;  1N8P A;  3ZZJ A;  1JG8 A;  4A6T A;  1IVR A;  1N31 A;  2AY5 A;  3ASB A;  5E3K A;  4OYT A;  3BWO A;  3PIU A;  1SZK A;  3AAT A;  2C81 A;  2OGE A;  3CQ6 A;  2VMN A;  1WYV A;  5EQC A;  1SZS A;  2W8T A;  1W7M A;  2C44 A;  3HLM A;  1M32 A;  3PDX A;  2ZC0 A;  1WST A;  2VGW A;  3USF A;  4FL0 A;  3E77 A;  3NYT A;  4JF0 A;  3KGX A;  1IAX A;  4MGR A;  4EMY A;  4QGR A;  1YOO A;  4M2J A;  1B4X A;  3G8M A;  2VYC A;  2GSA A;  4PVF A;  3LWS A;  1AY4 A;  1MAP A;  3AEM A;  2BHX A;  4ZAS A;  1XEY A;  2YKY A;  3A2B A;  3PPL A;  1C7N A;  3E9K A;  4R5F A;  3F0H A;  1WYU B;  1BJN A;  3Q8N A;  2W8U A;  1N2T A;  3CQ5 A;  3FD0 A;  3NUI A;  3RUY A;  1ASM A;  3PJ0 A;  3OP7 A;  3DXW A;  2X3L A;  4Q31 A;  1RVU A;  3F6T A;  3ELP A;  1GC4 A;  1AMQ A;  1ARG A;  1G4X A;  3FQ7 A;  1BS0 A;  4WB0 A;  2VMS A;  4GEB A;  5KTB A;  1DJ9 A;  1X28 A;  1SVV A;  2D65 A;  1GBN A;  2YRR A;  4ZDL A;  2CH1 A;  1IX7 A;  1M0N A;  4U1T A;  4F5M A;  1DGE A;  5LH9 A;  4F5F A;  5EUN A;  2BI9 A;  3ECD A;  3QGU A;  3UE8 A;  3JZL A;  2CFB A;  1D2F A;  2EPJ A;  1G7W A;  3AEJ A;  4MQP A;  2W7M A;  4F5J A;  1TAR A;  3T32 A;  3DRD A;  4EB7 A;  3MEB A;  4PIW A;  2W7J A;  3HQT A;  5DJ1 A;  3E2F A;  1AKB A;  2BI3 A;  1AY8 A;  1I41 A;  4OC9 A;  4AZJ A;  3QN6 A;  4Q6R A;  1DGD A;  4ITG A;  2BI2 A;  2OKJ A;  5EIG A;  2ORD A;  1GC3 A;  3N4X A;  4ZLV A;  4EFF A;  3P6K A;  2XH1 A;  4LW4 A;  3KKI A;  1ZOD A;  3QI6 A;  4K2M A;  2CST A;  1AJS B;  4UOY A;  3JU7 A;  3AV7 A;  2YCN A;  3QPG A;  3DC1 A;  3OKS A;  1W3U A;  3E6G A;  3LV2 A;  3PAA A;  2AY9 A;  4A6U A;  3W1I A;  1FG7 A;  3FKD A;  3WGB A;  2ZYJ A;  3PGY A;  4ZAH A;  1DJE A;  1EG5 A;  2VGV A;  4FFC A;  5J8Q A;  1OXO A;  2HOZ A;  1OHY A;  2HOY A;  3ELE A;  2RFV A;  2BWP A;  3NX3 A;  9AAT A;  3RCH B;  2PB0 A;  4HVK A;  4ZM4 A;  2DGL A;  4XJL A;  4Y0I A;  1O69 A;  4W1X A;  3I16 A;  2E7U A;  3B1C A;  2Q7W A;  1B9I A;  3RCH A;  4K2B A;  3WLX A;  2QBT A;  4Y0H A;  1H0C A;  1AJR A;  3LG0 A;  2VMT A;  1QJ5 A;  2JG2 A;  1BJO B;  1MLY A;  2FNU A;  3F9T A;  1X29 A;  2F8J A;  2A1V A;  1M0Q A;  1WKH A;  1C7O A;  3HBX A;  4RLG A;  1BJO A;  3L8A A;  3AOV A;  1D7V A;  1QIR A;  4O6Z A;  4BMK A;  4AO9 A;  3CQ4 A;  3NNK A;  3ZRQ A;  2D64 A;  4OCA A;  4ZSY A;  3N5M A;  2AAT A;  3DZZ A;  2AY6 A;  1MAQ A;  2AY7 A;  2QA3 A;  1PMO A;  1UKJ A;  2Z20 A;  4MQR A;  4MQQ A;  3TFT A;  4GE9 A;  1YAA A;  5FT6 A;  7AAT A;  3B1D A;  1LC8 A;  3HVY A;  1W7L A;  3ZRR A;  4W1V A;  3B46 A;  2Z67 A;  4XAU A;  3ZZK A;  2DKJ A;  2VMZ A;  2YHK A;  3AEN A;  4F5H A;  2JGT A;  1MGV A;  2C0R A;  1T3I A;  3FSL A;  5M4D A;  2ZY4 A;  2PO3 A;  2YRI A;  1IAY A;  4F5G A;  1S06 A;  4RKD A;  4EU1 A;  1D7U A;  3AEL A;  3FQA A;  4WYG A;  3PDB A;  3VK4 A;  3EI7 A;  1I48 A;  2HUI A;  2CAN A;  4IYO A;  3RBL A;  3UAK A;  1B9H A;  1GCK A;  1C4K A;  2W7G A;  3NTJ A;  4R2N A;  4CBR A;  1AAM A;  1YIY A;  1UU1 A;  3BCB A;  3NU8 A;  4WLH A;  3K40 A;  4XJM A;  2KFP A;  3WX9 A;  3BN1 A;  1BJ4 A;  2QB3 A;  2BI5 A;  3EIB A;  2ZSM A;  2VMV A;  1AMR A;  1G4V A;  4LNM A;  3BCA A;  4TN4 A;  1B8G A;  4R5Z A;  3A8U X;  1LC5 A;  4ADD A;  2ZY2 A;  4XQ2 A;  3I5T A;  2ZSL A;  3FZ7 A;  2VGS A;  4JEV A;  3TQX A;  2DOU A;  4ADC A;  2VLF A;  2FYF A;  2QLR A;  2Z61 A;  4JEW A;  4LNJ A;  3JWA A;  1PFF A;  1U08 A;  2Z9X A;  3HL2 A;  2EYQ A;  1OAT A;  5BJ4 A;  1IX8 A;  1XI9 A;  1LC7 A;  2X5D A;  1AIB A;  2VMQ A;  2EZ1 A;  1AHX A;  3FCR A;  2VIA A;  4JE5 D;  4WXG A;  4BHD A;  3A9Z A;  1WYU A;  1SF2 A;  5FT5 A;  3H14 A;  2W7L A;  2Z9V A;  4IY7 A;  3MC6 A;  5DB5 A;  3FFR A;  1W7N A;  4CBS A;  1LKC A;  3HT4 A;  4M2K A;  4WYE A;  5K8B A;  1LS3 A;  1DTY A;  5LHA A;  4WYA A;  3A9Y A;  4OBU A;  4UQV A;  4WP0 A;  1KMK A;  3E2Z B;  1CS1 A;  2GMS A;  2W7F A;  4UHN A;  3FTB A;  3UWC A;  2WK7 A;  1JF9 A;  2FN6 A;  2VIB A;  2EO5 A;  1TAT A;  5G0A A;  3FQ8 A;  4RJY A;  2R2N A;  5G2P A;  3EZS A;  1IX6 A;  1TPL A;  3COG A;  3MBB A;  3MKJ A;  4DBC A;  4ZDO A;  3GZD A;  2BI1 A;  4TV7 A;  1FC4 A;  4IW7 A;  2VMX A;  2HP1 A;  3CBF A;  1O4S A;  1M0P A;  4CVQ A;  1S07 A;  1BQA A;  2W7D A;  2VI8 A;  3NDN A;  2R5C B;  1QIT A;  4JEX A;  3BWN C;  4RKC A;  1WYT B;  3TAT A;  2C7T A;  1DKA A;  2V0Y A;  2Z9U A;  4JEY A;  4KYO A;  2WKA A;  3GSB A;  2R5C A;  2Z1Y A;  3NYS A;  1WYT A;  1TOG A;  3FVU A;  3FZ6 A;  3IF2 A;  5F8V A;  2X8U A;  4ZWM A; 
#chains in the Genus database with same CATH homology
 2AY2 A;  5G09 A;  4NOG A;  4RIZ A;  4AZK A;  1ARS A;  3H7F A;  4ADB A;  3FRK A;  3LVL B;  3NRA A;  1AJS A;  2GQN A;  4A0F A;  2FM1 A;  1AKC A;  3JTX A;  4GDY A;  5JAY A;  1QGN A;  1KL1 A;  1I43 A;  1M4N A;  2YCT A;  4WXB A;  4J8L A;  1ZOB A;  5M46 A;  3K28 A;  1RVY A;  1S08 A;  4N0W A;  4R8D A;  5I92 A;  3NUB A;  2HOR A;  2CJG A;  2AEV A;  4OTL A;  4P3M A;  2VMU A;  1C0N A;  3TFU A;  1AHG A;  4AO4 A;  1P3W A;  2DGK A;  3NU7 A;  2QSR A;  1ZC9 A;  1OXP A;  2BKW A;  3HDO A;  3KGW A;  4DGT A;  1LK9 A;  4BA5 A;  4K05 A;  2EH6 A;  2CB1 A;  3FVS A;  1YJY A;  1VP4 A;  4MY5 A;  1C9C A;  2OQX A;  2TPL A;  3LVK A;  2EZ2 A;  1TOJ A;  2VGZ A;  4A6R A;  1SZU A;  1GEY A;  3QBO A;  1WKG A;  2DR1 A;  2ZJG A;  2R0T A;  4OT8 A;  1AMS A;  3MAU A;  1OHV A;  1Y4I A;  1CZE A;  1DFO A;  3GR9 A;  2O1B A;  4GE7 A;  1S0A A;  2FQ6 A;  1SPA A;  2D63 A;  2D7Z A;  2CY8 A;  1CQ8 A;  4RJ0 A;  1QZ9 A;  3BV0 A;  4PFN A;  5AX8 A;  1V72 A;  3QM2 A;  1ASN A;  3AEM C;  3FDD A;  3BC8 A;  3DYD A;  2X5F A;  3G7Q A;  1G7X A;  4ZDP A;  1J32 A;  5EAV A;  3P1T A;  3VK3 A;  1AX4 A;  4PFF A;  1JS6 A;  1GEX A;  1Z7D A;  1ASA A;  1ORD A;  4KAM A;  3FVX A;  5G4J A;  3ZRP A;  2DKB A;  2GB3 A;  1TAS A;  3K7Y A;  4WLJ A;  3WKS A;  1J04 A;  4AH3 A;  1CQ7 A;  3GJU A;  3G0T A;  4JE5 A;  1AIC A;  2VLH A;  1IJI A;  2VI9 A;  2VMO A;  3NYU A;  1AMA A;  4W1W A;  5HDM A;  2EGY A;  3EI8 A;  4A00 A;  1ASE A;  2W7E A;  2R5E A;  3ATH A;  4J5U A;  3WGC A;  1IBJ A;  1QJ3 A;  2CJH A;  3EI9 A;  1BT4 A;  1VEF A;  2GMU A;  4IXO A;  1GDE A;  1UU0 A;  1AIA A;  4WD2 A;  5G4I A;  4ZWV A;  2W8V A;  3IHJ A;  4W5K A;  4DQ6 A;  2FKI A;  3CAI A;  1VJO A;  3MAF B;  3BS8 A;  1ASL A;  1OHW A;  2BIE A;  2HZP A;  3EZ1 A;  1SFF A;  4RM1 A;  4E1O A;  2E7J A;  2AY8 A;  4A72 A;  1TOE A;  2QB2 A;  2VGT A;  3RBF A;  4A0H A;  2E7I A;  1CQ6 A;  2FNI A;  1X0M A;  5TF5 A;  5M49 A;  4Q76 A;  1B5P A;  3M5U A;  4B98 A;  3H9X A;  3EUC A;  2WB6 A;  4W8I A;  1ART A;  3AOW A;  1MDO A;  2JJG A;  3FZ8 A;  1GD9 A;  5EFS A;  3WCN A;  4ATP A;  5C6U A;  1ARI A;  3PA9 A;  4BQ0 A;  4GE4 A;  4GSA A;  1KKP A;  2D66 A;  2OAT A;  1E5E A;  2JIS A;  2AY3 A;  1S09 A;  3B8X A;  1B5O A;  3VAX A;  4F4E A;  1WYV B;  1CL2 A;  2W7I A;  1ELQ A;  1V2F A;  2OKK A;  4M2M A;  2VMR A;  5IWQ A;  3EI6 A;  1BJW A;  2BIG A;  2YKV A;  5E5I A;  5FT4 A;  1PG8 A;  2XBN A;  1AKA A;  1YJS A;  3A9X A;  4IX8 A;  4MKK A;  2D5Y A;  2NMP A;  1Z3Z A;  2OGA A;  3JW9 A;  4UHO A;  1PMM A;  1EJI A;  1LW5 A;  2HOX A;  2JJF A;  2VMW A;  4N0B A;  2ZUK A;  2BWO A;  2CIN A;  2WK8 A;  1CJ0 A;  2YKU A;  3E2Z A;  4WBT A;  4LW2 A;  2Z1Z A;  5EUD A;  1KMJ A;  4MKJ A;  4CXQ A;  3II0 A;  3EI5 A;  2HP2 A;  4CXR A;  1M7Y A;  1MDZ A;  4JF1 A;  4WB0 B;  1C7G A;  4JEZ A;  1ASG A;  1TOI A;  2AY1 A;  2VMY A;  4P7Y A;  1BW0 A;  1GC2 A;  2O0R A;  5HXX A;  1M6S A;  3DOD A;  3VK2 A;  1YNU A;  2BYL A;  1O61 A;  2W8J A;  3LVM A;  1MLZ A;  2YCP A;  3N4R A;  1ASC A;  1W23 A;  1RV4 A;  1I29 A;  1V2E A;  1EQB A;  4XJO A;  3JWB A;  4E3R A;  4H63 Q;  5DX5 A;  1YIZ A;  4XJP A;  1KKJ A;  3WY7 A;  2CJD A;  2VMP A;  4W91 A;  3RI6 A;  4EB5 A;  5DJ9 A;  2CTZ A;  2BIA A;  3ACZ A;  1BKG A;  4IXZ A;  2Z9W A;  1YJZ A;  4K2I A;  3EIA A;  5EIG B;  2G6W A;  3R9A A;  1ASF A;  4IXS A;  2O7C A;  5G2Q A;  4ITX A;  5D95 A;  1MDX A;  4B9B A;  3L44 A;  1DJU A;  5M4B A;  3DR4 A;  3BB8 A;  1CZC A;  1AY5 A;  4MSO A;  1CL1 A;  2HUU A;  4ISY A;  2BYJ A;  4ZM3 A;  4TMR A;  3VOM A;  3B1E A;  1FG3 A;  1D7S A;  4A0R A;  4F5I A;  3LVJ A;  4KXK A;  1QIS A;  4XEW A;  3W1H A;  1D7R A;  2WK9 A;  3ASA A;  3PD6 B;  3WZF A;  1ELU A;  3WKR A;  1AAW A;  3N75 A;  3PD6 A;  1UU2 A;  4LNL A;  4BA4 A;  3GWP A;  1H1C A;  5E4Z A;  3KE3 A;  1O62 A;  2ZP7 A;  5HHY A;  1AHF A;  3AEO A;  3LY1 A;  5EUE A;  3TCM A;  1LW4 A;  2ZY5 A;  1IUG A;  2ZY3 A;  3N4S A;  1V2D A;  1GEW A;  2HUF A;  3HMU A;  1TOK A;  4XK1 A;  5D5S A;  2W7H A;  5F9S A;  2YKX A;  4RIT A;  4ZSW A;  4AOA A;  8AAT A;  3MAD A;  4OMA A;  2YOB A;  3QHX A;  2V1P A;  4ADE A;  3N7N A;  4I8A A;  4LC3 A;  3AEP A;  1ASD A;  1JS3 A;  3BWN A;  1BQD A;  3MC6 C;  3W1J A;  2W8W A;  4Q75 A;  3N0L A;  2AEU A;  4F5K A;  3ISL A;  1RV3 A;  2BWN A;  4UHM A;  2JJE A;  4WYF A;  5EAA A;  4E77 A;  3GBX A;  4H51 A;  4WYC A;  3E2Y A;  2E54 A;  4ATQ A;  1ASB A;  4RAE A;  2W7K A;  3VP6 A;  3RQ1 A;  3BCX A;  3R4T A;  3AEN B;  2AY4 A;  2PB2 A;  4HF8 A;  3MAF A;  3AEJ C;  4U2H A;  2QMA A;  3GET A;  3I4J A;  3FDB A;  2VGU A;  3D6K A;  5BJ3 A;  1AHE A;  3GZC A;  3GZD C;  5FT8 A;  1ARH A;  1GC0 A;  2D61 A;  3DU4 A;  1KL2 A;  1M0O A;  1X2A A;  3PDB B;  2DGM A;  4L0O A;  3DXV A;  4Y0D A;  1ECX A;  3FFH A;  4E3Q A;  1AHY A;  4F5L A;  2CH2 A;  1E5F A;  4IYO B;  4A0G A;  3DR7 A;  4WXF A;  3WCO A;  2G7J A;  2JJH A;  4OBV A;  2D7Y A;  4GRX A;  4WYD A;  1N8P A;  3ZZJ A;  1JG8 A;  4A6T A;  1IVR A;  1N31 A;  2AY5 A;  3ASB A;  5E3K A;  4OYT A;  3BWO A;  3PIU A;  1SZK A;  3AAT A;  2C81 A;  2OGE A;  3CQ6 A;  2VMN A;  1WYV A;  5EQC A;  1SZS A;  2W8T A;  1W7M A;  2C44 A;  3HLM A;  1M32 A;  3PDX A;  2ZC0 A;  1WST A;  2VGW A;  3USF A;  4FL0 A;  3E77 A;  3NYT A;  4JF0 A;  3KGX A;  1IAX A;  4MGR A;  4EMY A;  4QGR A;  1YOO A;  4M2J A;  1B4X A;  3G8M A;  2VYC A;  2GSA A;  4PVF A;  3LWS A;  1AY4 A;  1MAP A;  3AEM A;  2BHX A;  4ZAS A;  1XEY A;  2YKY A;  3A2B A;  3PPL A;  1C7N A;  3E9K A;  4R5F A;  3F0H A;  1WYU B;  1BJN A;  3Q8N A;  2W8U A;  1N2T A;  3CQ5 A;  3FD0 A;  3NUI A;  3RUY A;  1ASM A;  3PJ0 A;  3OP7 A;  3DXW A;  2X3L A;  4Q31 A;  1RVU A;  3F6T A;  3ELP A;  1GC4 A;  1AMQ A;  1ARG A;  1G4X A;  3FQ7 A;  1BS0 A;  4WB0 A;  2VMS A;  4GEB A;  5KTB A;  1DJ9 A;  1X28 A;  1SVV A;  2D65 A;  1GBN A;  2YRR A;  4ZDL A;  2CH1 A;  1IX7 A;  1M0N A;  4U1T A;  4F5M A;  1DGE A;  5LH9 A;  4F5F A;  5EUN A;  2BI9 A;  3ECD A;  3QGU A;  3UE8 A;  3JZL A;  2CFB A;  1D2F A;  2EPJ A;  1G7W A;  3AEJ A;  4MQP A;  2W7M A;  4F5J A;  1TAR A;  3T32 A;  3DRD A;  4EB7 A;  3MEB A;  4PIW A;  2W7J A;  3HQT A;  5DJ1 A;  3E2F A;  1AKB A;  2BI3 A;  1AY8 A;  1I41 A;  4OC9 A;  4AZJ A;  3QN6 A;  4Q6R A;  1DGD A;  4ITG A;  2BI2 A;  2OKJ A;  5EIG A;  2ORD A;  1GC3 A;  3N4X A;  4ZLV A;  4EFF A;  3P6K A;  2XH1 A;  4LW4 A;  3KKI A;  1ZOD A;  3QI6 A;  4K2M A;  2CST A;  1AJS B;  4UOY A;  3JU7 A;  3AV7 A;  2YCN A;  3QPG A;  3DC1 A;  3OKS A;  1W3U A;  3E6G A;  3LV2 A;  3PAA A;  2AY9 A;  4A6U A;  3W1I A;  1FG7 A;  3FKD A;  3WGB A;  2ZYJ A;  3PGY A;  4ZAH A;  1DJE A;  1EG5 A;  2VGV A;  4FFC A;  5J8Q A;  1OXO A;  2HOZ A;  1OHY A;  2HOY A;  3ELE A;  2RFV A;  2BWP A;  3NX3 A;  9AAT A;  3RCH B;  2PB0 A;  4HVK A;  4ZM4 A;  2DGL A;  4XJL A;  4Y0I A;  1O69 A;  4W1X A;  3I16 A;  2E7U A;  3B1C A;  2Q7W A;  1B9I A;  3RCH A;  4K2B A;  3WLX A;  2QBT A;  4Y0H A;  1H0C A;  1AJR A;  3LG0 A;  2VMT A;  1QJ5 A;  2JG2 A;  1BJO B;  1MLY A;  2FNU A;  3F9T A;  1X29 A;  2F8J A;  2A1V A;  1M0Q A;  1WKH A;  1C7O A;  3HBX A;  4RLG A;  1BJO A;  3L8A A;  3AOV A;  1D7V A;  1QIR A;  4O6Z A;  4BMK A;  4AO9 A;  3CQ4 A;  3NNK A;  3ZRQ A;  2D64 A;  4OCA A;  4ZSY A;  3N5M A;  2AAT A;  3DZZ A;  2AY6 A;  1MAQ A;  2AY7 A;  2QA3 A;  1PMO A;  1UKJ A;  2Z20 A;  4MQR A;  4MQQ A;  3TFT A;  4GE9 A;  1YAA A;  5FT6 A;  7AAT A;  3B1D A;  1LC8 A;  3HVY A;  1W7L A;  3ZRR A;  4W1V A;  3B46 A;  2Z67 A;  4XAU A;  3ZZK A;  2DKJ A;  2VMZ A;  2YHK A;  3AEN A;  4F5H A;  2JGT A;  1MGV A;  2C0R A;  1T3I A;  3FSL A;  5M4D A;  2ZY4 A;  2PO3 A;  2YRI A;  1IAY A;  4F5G A;  1S06 A;  4RKD A;  4EU1 A;  1D7U A;  3AEL A;  3FQA A;  4WYG A;  3PDB A;  3VK4 A;  3EI7 A;  1I48 A;  2HUI A;  2CAN A;  4IYO A;  3RBL A;  3UAK A;  1B9H A;  1GCK A;  1C4K A;  2W7G A;  3NTJ A;  4R2N A;  4CBR A;  1AAM A;  1YIY A;  1UU1 A;  3BCB A;  3NU8 A;  4WLH A;  3K40 A;  4XJM A;  2KFP A;  3WX9 A;  3BN1 A;  1BJ4 A;  2QB3 A;  2BI5 A;  3EIB A;  2ZSM A;  2VMV A;  1AMR A;  1G4V A;  4LNM A;  3BCA A;  4TN4 A;  1B8G A;  4R5Z A;  3A8U X;  1LC5 A;  4ADD A;  2ZY2 A;  4XQ2 A;  3I5T A;  2ZSL A;  3FZ7 A;  2VGS A;  4JEV A;  3TQX A;  2DOU A;  4ADC A;  2VLF A;  2FYF A;  2QLR A;  2Z61 A;  4JEW A;  4LNJ A;  3JWA A;  1PFF A;  1U08 A;  2Z9X A;  3HL2 A;  2EYQ A;  1OAT A;  5BJ4 A;  1IX8 A;  1XI9 A;  1LC7 A;  2X5D A;  1AIB A;  2VMQ A;  2EZ1 A;  1AHX A;  3FCR A;  2VIA A;  4JE5 D;  4WXG A;  4BHD A;  3A9Z A;  1WYU A;  1SF2 A;  5FT5 A;  3H14 A;  2W7L A;  2Z9V A;  4IY7 A;  3MC6 A;  5DB5 A;  3FFR A;  1W7N A;  4CBS A;  1LKC A;  3HT4 A;  4M2K A;  4WYE A;  5K8B A;  1LS3 A;  1DTY A;  5LHA A;  4WYA A;  3A9Y A;  4OBU A;  4UQV A;  4WP0 A;  1KMK A;  3E2Z B;  1CS1 A;  2GMS A;  2W7F A;  4UHN A;  3FTB A;  3UWC A;  2WK7 A;  1JF9 A;  2FN6 A;  2VIB A;  2EO5 A;  1TAT A;  5G0A A;  3FQ8 A;  4RJY A;  2R2N A;  5G2P A;  3EZS A;  1IX6 A;  1TPL A;  3COG A;  3MBB A;  3MKJ A;  4DBC A;  4ZDO A;  3GZD A;  2BI1 A;  4TV7 A;  1FC4 A;  4IW7 A;  2VMX A;  2HP1 A;  3CBF A;  1O4S A;  1M0P A;  4CVQ A;  1S07 A;  1BQA A;  2W7D A;  2VI8 A;  3NDN A;  2R5C B;  1QIT A;  4JEX A;  3BWN C;  4RKC A;  1WYT B;  3TAT A;  2C7T A;  1DKA A;  2V0Y A;  2Z9U A;  4JEY A;  4KYO A;  2WKA A;  3GSB A;  2R5C A;  2Z1Y A;  3NYS A;  1WYT A;  1TOG A;  3FVU A;  3FZ6 A;  3IF2 A;  5F8V A;  2X8U A;  4ZWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...