1TOEA

Unliganded structure of hexamutant + a293d mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 140
structure length 395
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1toeA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1toeA01
1KMKA 3RI6A 3D6KA 2VMSA 2BWOA 2EH6A 3EIAA 4I8AA 3I16A 3VK4A 4IW7A 1BS0A 2VI8A 3KE3A 4M2MA 3LV2A 4XK1A 4A0GA 1EG5A 1IBJA 2F8JA 2OQXA 3B1DA 1AKCA 2W8TA 1CQ6A 3L8AA 9AATA 4P7YA 1H0CA 5G4IA 4R5ZA 4ADDA 4M2KA 2DKJA 3FKDA 1DJUA 2AY5A 2YCPA 4LW4A 4Q31A 1VJOA 4TN4A 4WB0B 3GETA 1AKBA 4FL0A 2FN6A 4PFNA 4LNJA 3NNKA 3OP7A 1DJEA 3VP6A 4JEVA 1PG8A 1TASA 1ASFA 1OHWA 4Q75A 1ARSA 1BKGA 1M6SA 2HUUA 4ZSWA 4A72A 4NOGA 2GSAA 1J32A 3QBOA 2CH1A 1ARGA 1CZEA 2EZ1A 1QITA 4A0HA 1KL1A 3QM2A 4WYFA 1YOOA 2E54A 3FVSA 4F5LA 2CJDA 4GE7A 1TOKA 1JS6A 1Z3ZA 2X3LA 2C0RA 1TOEA 2O1BA 3G0TA 3QN6A 1D7UA 2AATA 1IX7A 3AEJA 1DKAA 1M32A 3CQ5A 2HUIA 1AHEA 1MAPA 2W7EA 4IXZA 4BA5A 4GE4A 4ATQA 1LW4A 5E4ZA 1KL2A 2D64A 2YKYA 1B9IA 1VEFA 4E3RA 1TATA 4MSOA 3VK2A 5M4DA 3VK3A 1FG3A 1M0OA 1S08A 2CJHA 1D2FA 1C9CA 1AMQA 1CL1A 2JGTA 2VGSA 3JWAA 3N75A 4TMRA 5DJ9A 5EUNA 4ADCA 2BI9A 4ZASA 5DX5A 2VMOA 3TATA 1OXOA 5C6UA 3B8XA 2E7JA 1IUGA 4J8LA 2EPJA 3UE8A 3FQAA 4DQ6A 4R8DA 4F5IA 4A00A 2ZY4A 2XH1A 1YJSA 4W8IA 1WSTA 4K2IA 4M2JA 4EB7A 1AJSB 3DR4A 5EAVA 1J04A 1TOIA 3NX3A 2W7IA 3ZZKA 1S06A 4ADEA 4WP0A 1JG8A 1Y4IA 2YRIA 4ZDOA 3A9ZA 3BCXA 1QJ5A 4XJLA 1C4KA 3ZRRA 5E3KA 3BWNC 1O61A 3CBFA 4QGRA 2DKBA 2VIBA 2EGYA 3DC1A 3FVXA 1AAWA 1X28A 3PD6B 4MQQA 1YIYA 3K28A 3E2ZA 2BKWA 3P1TA 3ASAA 3BS8A 4ZDLA 4ZM4A 4A6RA 1AHXA 1AHGA 3H14A 2W7LA 2ZYJA 5G0AA 1BJWA 5EIGA 4N0WA 2CINA 1QJ3A 1WYVB 1AHFA 1V2EA 3GR9A 3PAAA 4P3MA 1D7VA 3QPGA 3FSLA 1B5PA 1M4NA 1M0NA 1X2AA 2JISA 5G09A 3II0A 4U2HA 4ZAHA 3AEPA 3FD0A 1QIRA 3MAUA 2VMVA 3N0LA 1BT4A 2PO3A 3NRAA 4RAEA 3RCHA 2CH2A 1MLYA 2W7MA 3MADA 3WKSA 1M7YA 3FFRA 3DR7A 3PJ0A 2E7UA 3HLMA 1N2TA 2HUFA 4EB5A 1V2DA 3GJUA 4A6TA 2WK8A 3ATHA 1UU0A 4WLJA 4F4EA 3GBXA 1O62A 5HHYA 2D63A 4UQVA 3DRDA 2Z9XA 2W7KA 2QBTA 1WYUA 2VIAA 5LHAA 3DODA 4LNMA 2FM1A 1OXPA 1EQBA 2W8VA 3BB8A 1KMJA 2AY1A 1FG7A 2ORDA 4WB0A 2G6WA 3PPLA 2ZY5A 1SVVA 2OKKA 3WCOA 3AV7A 2DGLA 3FVUA 2XBNA 4TV7A 3FDDA 7AATA 2VLFA 2HZPA 3LVMA 3KGWA 1PMOA 1W7LA 1G7XA 3HT4A 3LVKA 2R0TA 1ARIA 4Y0DA 2YHKA 4RM1A 1IAYA 5EQCA 3HQTA 1ASBA 1WYTB 1VP4A 1YJYA 1UU2A 2X8UA 1ASMA 2VGUA 4OC9A 1ELUA 2V0YA 4W5KA 1E5FA 1GCKA 2FNIA 4CVQA 3GZCA 2BYJA 1H1CA 4DGTA 3JU7A 4XQ2A 1BJOA 3QHXA 3F6TA 5FT4A 2D7ZA 1S0AA 2AY9A 2GQNA 2VMPA 1BJOB 2VYCA 5EAAA 4MKJA 1MDXA 1GEXA 5FT6A 1O69A 5HXXA 2YKVA 3FFHA 3W1IA 3RQ1A 1KKJA 1AJRA 1ECXA 2C7TA 3HL2A 3COGA 5EUDA 1N8PA 3NU8A 4OTLA 5G2QA 2YCNA 1DFOA 2D66A 2YRRA 3L44A 2WK9A 1GEWA 5M46A 5HDMA 4Y0IA 2DGMA 3EI9A 1W3UA 2CY8A 1AJSA 1OHVA 2VMWA 2Z9VA 3A2BA 1T3IA 3QI6A 1LC7A 2E7IA 3AENB 5EFSA 4AO4A 4PIWA 1C7OA 3E2ZB 2HP2A 4MQPA 1BW0A 4E1OA 2W7DA 1I48A 4CXRA 3AENA 1UU1A 2BI5A 2ZP7A 4JEZA 5EIGB 2BI2A 2CJGA 4XJOA 2Z67A 2BWPA 4CXQA 2HOXA 4RIZA 1SF2A 3IF2A 3KGXA 2W7FA 4IYOB 4KXKA 2BIAA 3I5TA 4WXBA 3MAFB 4B9BA 3ACZA 5LH9A 1CZCA 4WYCA 3PIUA 3GZDC 3MBBA 3VOMA 1AKAA 2R5CA 4IYOA 3PA9A 1U08A 1ZODA 3MAFA 4W91A 2JG2A 3FZ6A 5BJ4A 4BQ0A 2AY7A 2HOYA 1B5OA 1ASNA 1GEYA 3GWPA 2PB0A 2CTZA 1RVYA 3NUIA 3PDXA 1GC2A 2QB2A 4RKCA 3AEMA 1YAAA 4IY7A 3WZFA 1FC4A 1P3WA 3E2YA 2ZJGA 2VMTA 3RCHB 4ZLVA 3T32A 3UWCA 3MC6C 3LVJA 3HDOA 5EUEA 4EU1A 5D95A 1DGDA 1AX4A 1X0MA 4ATPA 1CS1A 4RLGA 1AIAA 3NDNA 2GB3A 4O6ZA 4OT8A 3WLXA 8AATA 5FT8A 1M0PA 3W1HA 5J8QA 3DZZA 5JAYA 3UAKA 4MGRA 2R5EA 1CQ8A 2AY3A 3GZDA 4MY5A 4B98A 4JEXA 4JF0A 5AX8A 3GSBA 1BQDA 1CJ0A 4A0RA 3ELPA 3WKRA 4N0BA 1WYUB 1AICA 1YNUA 3FZ8A 4EFFA 4Q76A 1I29A 3NYUA 4MQRA 3WCNA 2AEUA 2ZSMA 3LVLB 4XJMA 4E3QA 3R9AA 4EMYA 4WLHA 1E5EA 1ASCA 4WXFA 4E77A 2ZUKA 4F5KA 2Z61A 3WGCA 3E9KA 1LS3A 1XEYA 2FNUA 1C0NA 2OATA 2Q7WA 4Q6RA 1C7GA 4FFCA 1MDOA 1AY5A 2OGAA 2VMYA 2C81A 3FQ8A 2Z20A 2CANA 5E5IA 2BHXA 1ZC9A 4UHOA 2VMUA 3H7FA 1AY8A 3IHJA 1LKCA 4JF1A 4RJYA 2D5YA 2EZ2A 4XAUA 1B9HA 2CSTA 3FZ7A 1G7WA 3M5UA 4GSAA 2ZC0A 1GBNA 4RKDA 4F5GA 3TQXA 1CL2A 2QMAA 2VMRA 5F8VA 3AELA 2VLHA 3I4JA 2W8UA 2VGTA 1B8GA 3NU7A 3WY7A 1JF9A 3ISLA 4OMAA 2VGVA 3BCBA 4GRXA 2O7CA 5I92A 3BV0A 1UKJA 1W7NA 3A9YA 1ZOBA 3USFA 4UHMA 4GEBA 1DTYA 3G7QA 1TOGA 2AY4A 4K2MA 4ZSYA 4XEWA 3FCRA 3ZRQA 2FYFA 4XJPA 5F9SA 2ZY2A 4WYDA 3DYDA 2VMXA 3EZSA 1TARA 1RVUA 1MDZA 1ASGA 1S07A 2BIEA 2YKUA 3N5MA 1GC0A 3WGBA 1RV4A 2JJFA 4KAMA 1G4VA 4AOAA 4GDYA 1OHYA 1IJIA 1CQ7A 3NUBA 2FQ6A 4A0FA 4BA4A 1D7RA 3BWOA 1Z7DA 1W23A 3ECDA 1AAMA 3Q8NA 2JJEA 4JE5D 2BIGA 2D7YA 2AY8A 2OKJA 1ELQA 1MGVA 3RUYA 3EI5A 3DXWA 2AY2A 1SZKA 1ASDA 4JEWA 1AY4A 1N31A 2Z9WA 4OCAA 1LC8A 4ZWVA 1GC4A 1TOJA 1WKHA 1SZUA 2YOBA 3ASBA 3K7YA 4LNLA 3OKSA 3TCMA 4BMKA 2CB1A 5TF5A 1ASEA 4K2BA 3JW9A 2R2NA 1IAXA 3PDBA 4AZJA 1YIZA 4HF8A 1SZSA 4CBRA 4W1WA 2W7HA 1GDEA 4UOYA 5G2PA 3PDBB 3W1JA 1AMRA 3RBFA 1AMAA 2C44A 3B46A 4GE9A 3JWBA 4F5HA 1BJ4A 1LW5A 4PFFA 3FQ7A 3LWSA 2X5FA 4ZDPA 5BJ3A 1GC3A 2GMSA 3EI7A 3HMUA 2PB2A 4F5MA 3CQ4A 3CAIA 2AY6A 4WD2A 1V2FA 2VGWA 1XI9A 2TPLA 3MKJA 4UHNA 3ELEA 1YJZA 2VMNA 4AZKA 3MC6A 1O4SA 1TPLA 3F9TA 1PMMA 2Z1YA 3AEMC 4OYTA 2BWNA 2W8JA 2OGEA 1M0QA 2AEVA 2JJGA 2W7JA 3EI8A 2O0RA 3MEBA 1LK9A 2BI1A 1RV3A 3NYSA 3DXVA 3FRKA 4JEYA 3LG0A 5G4JA 4OBVA 2YKXA 2NMPA 2YCTA 3AOWA 1ARTA 3ZZJA 3WX9A 4ITXA 1MAQA 1JS3A 2VMZA 3A9XA 2VGZA 1B4XA 3E77A 3HBXA 3A8UX 4LC3A 2WKAA 1BJNA 1WYTA 1ORDA 4DBCA 1LC5A 1IX6A 4F5FA 3NTJA 1AIBA 1ARHA 4IXOA 4W1XA 4WYAA 2JJHA 4R5FA 1V72A 4IXSA 2X5DA 2GMUA 2ZY3A 2D65A 3BN1A 3VAXA 3F0HA 1ASAA 2VI9A 2CFBA 4ISYA 5DJ1A 1KKPA 5M4BA 3K40A 4MKKA 2HP1A 2V1PA 3DU4A 3E2FA 2W7GA 5DB5A 5FT5A 3TFTA 4L0OA 4OBUA 4J5UA 3R4TA 2HOZA 5K8BA 2BI3A 1IVRA 4WBTA 3LY1A 3E6GA 2RFVA 1W7MA 2ZSLA 4AO9A 3EUCA 4WYGA 1IX8A 4R2NA 1EJIA 1D7SA 1DGEA 2VMQA 3FDBA 3FTBA 1MLZA 1SFFA 3QGUA 5IWQA 1GD9A 3EZ1A 4IX8A 3PGYA 3AATA 3EI6A 3G8MA 3JZLA 1SPAA 4ZWMA 2HORA 3AEJC 3BCAA 4RJ0A 4AH3A 2BYLA 3KKIA 5D5SA 4LW2A 4KYOA 1AMSA 3BWNA 2Z9UA 3B1EA 1ASLA 4Y0HA 1X29A 1QISA 3HVYA 3JTXA 4WXGA 4CBSA 2DOUA 1BQAA 4ITGA 4F5JA 2EO5A 1S09A 2QLRA 2QA3A 4PVFA 4U1TA 4ZM3A 3EIBA 2W8WA 1WYVA 4H51A 1PFFA 2D61A 2WK7A 3PD6A 4RITA 4WYEA 3ZRPA 1I41A 2DGKA 3AOVA 1DJ9A 3CQ6A 1C7NA 1QZ9A 3B1CA 3BC8A 2QB3A 3AEOA 3P6KA 3RBLA 4W1VA 1G4XA 4BHDA 1OATA 1I43A 1WKGA 4ADBA 1QGNA 2Z1ZA 4HVKA 5M49A 4JE5A 4A6UA 2R5CB 3NYTA 1AHYA 2DR1A 3TFUA
chains in the Genus database with same CATH superfamily
1KMKA 3RI6A 3D6KA 2VMSA 2BWOA 2EH6A 3EIAA 4I8AA 3I16A 3VK4A 4IW7A 1BS0A 2VI8A 3KE3A 4M2MA 3LV2A 4XK1A 4A0GA 1EG5A 1IBJA 2F8JA 2OQXA 3B1DA 1AKCA 2W8TA 1CQ6A 3L8AA 9AATA 4P7YA 1H0CA 5G4IA 4R5ZA 4ADDA 4M2KA 2DKJA 3FKDA 1DJUA 2AY5A 2YCPA 4LW4A 4Q31A 1VJOA 4TN4A 4WB0B 3GETA 1AKBA 4FL0A 2FN6A 4PFNA 4LNJA 3NNKA 3OP7A 1DJEA 3VP6A 4JEVA 1PG8A 1TASA 1ASFA 1OHWA 4Q75A 1ARSA 1BKGA 1M6SA 2HUUA 4ZSWA 4A72A 4NOGA 2FKIA 2GSAA 1J32A 3QBOA 2EYQA 2CH1A 1ARGA 1CZEA 2EZ1A 1QITA 4A0HA 1KL1A 3QM2A 4WYFA 1YOOA 2E54A 3FVSA 4F5LA 2CJDA 4GE7A 1TOKA 1JS6A 1Z3ZA 2X3LA 2C0RA 1TOEA 2O1BA 3G0TA 3QN6A 1D7UA 2AATA 1IX7A 3AEJA 1DKAA 1M32A 3CQ5A 2HUIA 1AHEA 1MAPA 2W7EA 4IXZA 4BA5A 4GE4A 4ATQA 1LW4A 5E4ZA 4K05A 1KL2A 2D64A 2YKYA 3N4XA 1B9IA 1VEFA 4E3RA 1TATA 4MSOA 3VK2A 5M4DA 3VK3A 1FG3A 1M0OA 1S08A 2CJHA 1D2FA 1C9CA 1AMQA 1CL1A 2JGTA 2VGSA 3JWAA 3N75A 4TMRA 5DJ9A 5EUNA 4ADCA 2BI9A 4ZASA 5DX5A 2VMOA 3TATA 1OXOA 5C6UA 3B8XA 2E7JA 1IUGA 4J8LA 2EPJA 3UE8A 3FQAA 4DQ6A 4R8DA 4F5IA 4A00A 2ZY4A 2XH1A 1YJSA 4W8IA 1WSTA 4K2IA 4M2JA 4EB7A 1AJSB 3DR4A 5EAVA 1J04A 1TOIA 3NX3A 2W7IA 3ZZKA 1S06A 4ADEA 4WP0A 1JG8A 1Y4IA 2YRIA 4ZDOA 3A9ZA 3BCXA 1QJ5A 4XJLA 1C4KA 3ZRRA 5E3KA 3BWNC 1O61A 3CBFA 4QGRA 2DKBA 2VIBA 2EGYA 3DC1A 3FVXA 1AAWA 1X28A 3PD6B 4MQQA 1YIYA 3K28A 3E2ZA 2BKWA 3P1TA 3ASAA 3BS8A 4ZDLA 4ZM4A 4A6RA 1AHXA 1AHGA 3H14A 2W7LA 2ZYJA 2G7JA 5G0AA 1BJWA 5EIGA 4N0WA 2CINA 1QJ3A 1WYVB 1AHFA 1V2EA 3GR9A 3PAAA 4P3MA 1D7VA 3QPGA 5KTBA 3FSLA 1B5PA 1M4NA 1M0NA 1X2AA 2JISA 5G09A 3II0A 4U2HA 4ZAHA 3AEPA 3FD0A 1QIRA 3MAUA 2VMVA 3N0LA 1BT4A 2PO3A 3NRAA 4RAEA 3RCHA 2CH2A 1MLYA 2W7MA 3MADA 3WKSA 1M7YA 3FFRA 3N4RA 3DR7A 3PJ0A 2E7UA 3HLMA 1N2TA 2HUFA 4EB5A 1V2DA 3GJUA 4A6TA 2WK8A 3ATHA 1UU0A 4WLJA 4F4EA 3GBXA 1O62A 5HHYA 2D63A 4UQVA 3DRDA 2Z9XA 2W7KA 2QBTA 1WYUA 2VIAA 5LHAA 3DODA 4LNMA 2FM1A 1OXPA 1EQBA 2W8VA 3BB8A 1KMJA 2AY1A 1FG7A 2ORDA 4WB0A 2G6WA 3PPLA 2ZY5A 1SVVA 2OKKA 3WCOA 3AV7A 2DGLA 3FVUA 2XBNA 4TV7A 3FDDA 7AATA 2VLFA 3N4SA 2HZPA 3LVMA 3KGWA 1PMOA 1W7LA 1G7XA 3HT4A 3LVKA 2R0TA 1ARIA 4Y0DA 2YHKA 4RM1A 1IAYA 5EQCA 3HQTA 3H9XA 1ASBA 1WYTB 1VP4A 1YJYA 1UU2A 2X8UA 1ASMA 2VGUA 4OC9A 1ELUA 2V0YA 4W5KA 1E5FA 1GCKA 2FNIA 4CVQA 3GZCA 2BYJA 1H1CA 4DGTA 3JU7A 4XQ2A 1BJOA 3QHXA 3F6TA 5FT4A 2D7ZA 1S0AA 2AY9A 2GQNA 2VMPA 1BJOB 2VYCA 5EAAA 4MKJA 1MDXA 1GEXA 5FT6A 1O69A 5HXXA 2YKVA 3FFHA 3W1IA 3RQ1A 1KKJA 1AJRA 1ECXA 2C7TA 3HL2A 3COGA 5EUDA 1N8PA 3NU8A 4OTLA 5G2QA 2YCNA 1DFOA 2D66A 2YRRA 3L44A 2WK9A 1GEWA 5M46A 5HDMA 4Y0IA 2DGMA 3EI9A 1W3UA 2CY8A 1AJSA 1OHVA 2VMWA 2Z9VA 3A2BA 1T3IA 3QI6A 1LC7A 2E7IA 3AENB 5EFSA 4AO4A 4PIWA 1C7OA 3E2ZB 2HP2A 4MQPA 1BW0A 4E1OA 2W7DA 1I48A 4CXRA 3AENA 1UU1A 2BI5A 2ZP7A 4JEZA 5EIGB 2BI2A 2CJGA 4XJOA 2Z67A 2BWPA 4CXQA 2HOXA 4RIZA 1SF2A 3IF2A 3KGXA 2W7FA 4IYOB 4KXKA 2BIAA 3I5TA 4WXBA 3MAFB 4B9BA 3ACZA 5LH9A 1CZCA 4WYCA 3PIUA 3GZDC 3MBBA 3VOMA 1AKAA 2R5CA 4IYOA 3PA9A 1U08A 1ZODA 3MAFA 4W91A 2JG2A 3FZ6A 5BJ4A 4BQ0A 2AY7A 2HOYA 1B5OA 1ASNA 1GEYA 3GWPA 2PB0A 2CTZA 1RVYA 3NUIA 3PDXA 1GC2A 2QB2A 4RKCA 3AEMA 1YAAA 4IY7A 3WZFA 1FC4A 1P3WA 3E2YA 2ZJGA 2VMTA 3RCHB 4ZLVA 3T32A 3UWCA 3MC6C 3LVJA 3HDOA 5EUEA 4EU1A 5D95A 1DGDA 1AX4A 1X0MA 4ATPA 1CS1A 4RLGA 1AIAA 3NDNA 2GB3A 4O6ZA 4OT8A 3WLXA 8AATA 5FT8A 1M0PA 3W1HA 5J8QA 3DZZA 5JAYA 3UAKA 4MGRA 2R5EA 1CQ8A 2AY3A 3GZDA 4MY5A 4B98A 4JEXA 4JF0A 5AX8A 3GSBA 1BQDA 1CJ0A 4A0RA 3ELPA 3WKRA 4N0BA 1WYUB 1AICA 1YNUA 3FZ8A 4EFFA 4Q76A 1I29A 3NYUA 4MQRA 3WCNA 2AEUA 2ZSMA 3LVLB 4XJMA 4E3QA 3R9AA 4EMYA 4WLHA 1E5EA 1ASCA 4WXFA 4E77A 2ZUKA 4F5KA 2Z61A 3WGCA 3E9KA 1LS3A 1XEYA 2FNUA 1C0NA 2OATA 2Q7WA 4Q6RA 1C7GA 4FFCA 1MDOA 2A1VA 1AY5A 2OGAA 2VMYA 2C81A 3FQ8A 2Z20A 2CANA 5E5IA 2BHXA 1ZC9A 4UHOA 2VMUA 3H7FA 1AY8A 3IHJA 1LKCA 4JF1A 4RJYA 2D5YA 2EZ2A 4XAUA 1B9HA 2CSTA 3FZ7A 1G7WA 3M5UA 4GSAA 2ZC0A 1GBNA 4RKDA 4F5GA 3TQXA 1CL2A 2QMAA 2VMRA 5F8VA 3AELA 2VLHA 3I4JA 2W8UA 2VGTA 1B8GA 3NU7A 3WY7A 1JF9A 3ISLA 4OMAA 2VGVA 3BCBA 4GRXA 2WB6A 2O7CA 5I92A 3BV0A 1UKJA 1W7NA 3A9YA 1ZOBA 3USFA 4UHMA 4GEBA 1DTYA 3G7QA 1TOGA 2AY4A 4K2MA 4ZSYA 4XEWA 3FCRA 3ZRQA 2FYFA 4XJPA 5F9SA 2ZY2A 4WYDA 3DYDA 2VMXA 3EZSA 1TARA 1RVUA 1MDZA 1ASGA 1S07A 2BIEA 2YKUA 3N5MA 1GC0A 3WGBA 1RV4A 2JJFA 4KAMA 1G4VA 4AOAA 4GDYA 1OHYA 1IJIA 1CQ7A 3NUBA 2FQ6A 4A0FA 4BA4A 1D7RA 3BWOA 1Z7DA 1W23A 3ECDA 1AAMA 3Q8NA 2JJEA 4JE5D 2BIGA 2D7YA 2AY8A 2OKJA 1ELQA 1MGVA 3RUYA 3EI5A 3DXWA 2AY2A 1SZKA 1ASDA 4JEWA 1AY4A 1N31A 2Z9WA 4OCAA 1LC8A 4ZWVA 1GC4A 1TOJA 1WKHA 1SZUA 2YOBA 3ASBA 3K7YA 4LNLA 3OKSA 3TCMA 4BMKA 2QSRA 2CB1A 5TF5A 1ASEA 4K2BA 3JW9A 2R2NA 1IAXA 3PDBA 4AZJA 1YIZA 4HF8A 1SZSA 4CBRA 4W1WA 2W7HA 1GDEA 4UOYA 5G2PA 3PDBB 3W1JA 1AMRA 3RBFA 1AMAA 2C44A 3B46A 4GE9A 3JWBA 4F5HA 1BJ4A 1LW5A 4PFFA 3FQ7A 3LWSA 2X5FA 4ZDPA 5BJ3A 1GC3A 2GMSA 3EI7A 3HMUA 2PB2A 4F5MA 3CQ4A 3CAIA 2AY6A 4WD2A 1V2FA 2VGWA 1XI9A 2TPLA 3MKJA 4UHNA 3ELEA 1YJZA 2VMNA 4AZKA 3MC6A 1O4SA 1TPLA 3F9TA 1PMMA 2Z1YA 3AEMC 4OYTA 2KFPA 2BWNA 2W8JA 2OGEA 1M0QA 2AEVA 2JJGA 2W7JA 3EI8A 2O0RA 3MEBA 1LK9A 2BI1A 1RV3A 3NYSA 3DXVA 3FRKA 4JEYA 3LG0A 5G4JA 4OBVA 2YKXA 2NMPA 2YCTA 3AOWA 1ARTA 3ZZJA 3WX9A 4ITXA 1MAQA 1JS3A 2VMZA 3A9XA 1KAFA 2VGZA 1B4XA 3E77A 3HBXA 3A8UX 4LC3A 2WKAA 1BJNA 1WYTA 1ORDA 4DBCA 1LC5A 1IX6A 4F5FA 3NTJA 1AIBA 1ARHA 4IXOA 4W1XA 4WYAA 2JJHA 4R5FA 1V72A 4IXSA 2X5DA 2GMUA 2ZY3A 2D65A 3BN1A 3VAXA 3F0HA 1ASAA 2VI9A 2CFBA 4ISYA 5DJ1A 1KKPA 5M4BA 3K40A 4MKKA 2HP1A 2V1PA 3DU4A 3E2FA 2W7GA 5DB5A 5FT5A 3TFTA 4L0OA 4OBUA 4J5UA 3R4TA 2HOZA 5K8BA 2BI3A 1IVRA 4WBTA 3LY1A 3E6GA 2RFVA 1W7MA 2ZSLA 4AO9A 3EUCA 4WYGA 1IX8A 4R2NA 1EJIA 1D7SA 1DGEA 2VMQA 3FDBA 3FTBA 1MLZA 1SFFA 3QGUA 5IWQA 1GD9A 3EZ1A 4IX8A 3PGYA 3AATA 3EI6A 3G8MA 3JZLA 1SPAA 4ZWMA 2HORA 3AEJC 3BCAA 4RJ0A 4AH3A 2BYLA 3KKIA 5D5SA 3N7NA 4LW2A 4KYOA 1AMSA 3BWNA 2Z9UA 3B1EA 1ASLA 4Y0HA 1X29A 1QISA 3HVYA 3JTXA 4WXGA 4CBSA 2DOUA 1BQAA 4ITGA 4F5JA 2EO5A 1S09A 2QLRA 2QA3A 4PVFA 4U1TA 4ZM3A 3EIBA 2W8WA 1WYVA 4H51A 1PFFA 2D61A 2WK7A 3PD6A 4RITA 4WYEA 3ZRPA 1I41A 2DGKA 3AOVA 1DJ9A 3CQ6A 1C7NA 1QZ9A 3B1CA 3BC8A 2QB3A 3AEOA 3P6KA 3RBLA 4W1VA 1G4XA 4H63Q 4BHDA 1OATA 1I43A 1WKGA 4ADBA 1QGNA 2Z1ZA 4HVKA 5M49A 4JE5A 4A6UA 2R5CB 3NYTA 1AHYA 2DR1A 3TFUA
chains in the Genus database with same CATH topology
1KMKA 3RI6A 3D6KA 2VMSA 2BWOA 2EH6A 3EIAA 4I8AA 3I16A 3VK4A 4IW7A 1BS0A 2VI8A 3KE3A 4M2MA 3LV2A 4XK1A 4A0GA 1EG5A 1IBJA 2F8JA 2OQXA 3B1DA 1AKCA 2W8TA 1CQ6A 3L8AA 9AATA 4P7YA 1H0CA 5G4IA 4R5ZA 4ADDA 4M2KA 2DKJA 3FKDA 1DJUA 2AY5A 2YCPA 4LW4A 4Q31A 1VJOA 4TN4A 4WB0B 3GETA 1AKBA 4FL0A 2FN6A 4PFNA 4LNJA 3NNKA 3OP7A 1DJEA 3VP6A 4JEVA 1PG8A 1TASA 1ASFA 1OHWA 4Q75A 1ARSA 1BKGA 1M6SA 2HUUA 4ZSWA 4A72A 4NOGA 2FKIA 2GSAA 1J32A 3QBOA 2EYQA 2CH1A 1ARGA 1CZEA 2EZ1A 1QITA 4A0HA 1KL1A 3QM2A 4WYFA 1YOOA 2E54A 3FVSA 4F5LA 2CJDA 4GE7A 1TOKA 1JS6A 1Z3ZA 2X3LA 2C0RA 1TOEA 2O1BA 3G0TA 3QN6A 1D7UA 2AATA 1IX7A 3AEJA 1DKAA 1M32A 3CQ5A 2HUIA 1AHEA 1MAPA 2W7EA 4IXZA 4BA5A 4GE4A 4ATQA 1LW4A 5E4ZA 4K05A 1KL2A 2D64A 2YKYA 3N4XA 1B9IA 1VEFA 4E3RA 1TATA 4MSOA 3VK2A 5M4DA 3VK3A 1FG3A 1M0OA 1S08A 2CJHA 1D2FA 1C9CA 1AMQA 1CL1A 2JGTA 2VGSA 3JWAA 3N75A 4TMRA 5DJ9A 5EUNA 4ADCA 2BI9A 4ZASA 5DX5A 2VMOA 3TATA 1OXOA 5C6UA 3B8XA 2E7JA 1IUGA 4J8LA 2EPJA 3UE8A 3FQAA 4DQ6A 4R8DA 4F5IA 4A00A 2ZY4A 2XH1A 1YJSA 4W8IA 1WSTA 4K2IA 4M2JA 4EB7A 1AJSB 3DR4A 5EAVA 1J04A 1TOIA 3NX3A 2W7IA 3ZZKA 1S06A 4ADEA 4WP0A 1JG8A 1Y4IA 2YRIA 4ZDOA 3A9ZA 3BCXA 1QJ5A 4XJLA 1C4KA 3ZRRA 5E3KA 3BWNC 1O61A 3CBFA 4QGRA 2DKBA 2VIBA 2EGYA 3DC1A 3FVXA 1AAWA 1X28A 3PD6B 4MQQA 1YIYA 3K28A 3E2ZA 2BKWA 3P1TA 3ASAA 3BS8A 4ZDLA 4ZM4A 4A6RA 1AHXA 1AHGA 3H14A 2W7LA 2ZYJA 2G7JA 5G0AA 1BJWA 5EIGA 4N0WA 2CINA 1QJ3A 1WYVB 1AHFA 1V2EA 3GR9A 3PAAA 4P3MA 1D7VA 3QPGA 5KTBA 3FSLA 1B5PA 1M4NA 1M0NA 1X2AA 2JISA 5G09A 3II0A 4U2HA 4ZAHA 3AEPA 3FD0A 1QIRA 3MAUA 2VMVA 3N0LA 1BT4A 2PO3A 3NRAA 4RAEA 3RCHA 2CH2A 1MLYA 2W7MA 3MADA 3WKSA 1M7YA 3FFRA 3N4RA 3DR7A 3PJ0A 2E7UA 3HLMA 1N2TA 2HUFA 4EB5A 1V2DA 3GJUA 4A6TA 2WK8A 3ATHA 1UU0A 4WLJA 4F4EA 3GBXA 1O62A 5HHYA 2D63A 4UQVA 3DRDA 2Z9XA 2W7KA 2QBTA 1WYUA 2VIAA 5LHAA 3DODA 4LNMA 2FM1A 1OXPA 1EQBA 2W8VA 3BB8A 1KMJA 2AY1A 1FG7A 2ORDA 4WB0A 2G6WA 3PPLA 2ZY5A 1SVVA 2OKKA 3WCOA 3AV7A 2DGLA 3FVUA 2XBNA 4TV7A 3FDDA 7AATA 2VLFA 3N4SA 2HZPA 3LVMA 3KGWA 1PMOA 1W7LA 1G7XA 3HT4A 3LVKA 2R0TA 1ARIA 4Y0DA 2YHKA 4RM1A 1IAYA 5EQCA 3HQTA 3H9XA 1ASBA 1WYTB 1VP4A 1YJYA 1UU2A 2X8UA 1ASMA 2VGUA 4OC9A 1ELUA 2V0YA 4W5KA 1E5FA 1GCKA 2FNIA 4CVQA 3GZCA 2BYJA 1H1CA 4DGTA 3JU7A 4XQ2A 1BJOA 3QHXA 3F6TA 5FT4A 2D7ZA 1S0AA 2AY9A 2GQNA 2VMPA 1BJOB 2VYCA 5EAAA 4MKJA 1MDXA 1GEXA 5FT6A 1O69A 5HXXA 2YKVA 3FFHA 3W1IA 3RQ1A 1KKJA 1AJRA 1ECXA 2C7TA 3HL2A 3COGA 5EUDA 1N8PA 3NU8A 4OTLA 5G2QA 2YCNA 1DFOA 2D66A 2YRRA 3L44A 2WK9A 1GEWA 5M46A 5HDMA 4Y0IA 2DGMA 3EI9A 1W3UA 2CY8A 1AJSA 1OHVA 2VMWA 2Z9VA 3A2BA 1T3IA 3QI6A 1LC7A 2E7IA 3AENB 5EFSA 4AO4A 4PIWA 1C7OA 3E2ZB 2HP2A 4MQPA 1BW0A 4E1OA 2W7DA 1I48A 4CXRA 3AENA 1UU1A 2BI5A 2ZP7A 4JEZA 5EIGB 2BI2A 2CJGA 4XJOA 2Z67A 2BWPA 4CXQA 2HOXA 4RIZA 1SF2A 3IF2A 3KGXA 2W7FA 4IYOB 4KXKA 2BIAA 3I5TA 4WXBA 3MAFB 4B9BA 3ACZA 5LH9A 1CZCA 4WYCA 3PIUA 3GZDC 3MBBA 3VOMA 1AKAA 2R5CA 4IYOA 3PA9A 1U08A 1ZODA 3MAFA 4W91A 2JG2A 3FZ6A 5BJ4A 4BQ0A 2AY7A 2HOYA 1B5OA 1ASNA 1GEYA 3GWPA 2PB0A 2CTZA 1RVYA 3NUIA 3PDXA 1GC2A 2QB2A 4RKCA 3AEMA 1YAAA 4IY7A 3WZFA 1FC4A 1P3WA 3E2YA 2ZJGA 2VMTA 3RCHB 4ZLVA 3T32A 3UWCA 3MC6C 3LVJA 3HDOA 5EUEA 4EU1A 5D95A 1DGDA 1AX4A 1X0MA 4ATPA 1CS1A 4RLGA 1AIAA 3NDNA 2GB3A 4O6ZA 4OT8A 3WLXA 8AATA 5FT8A 1M0PA 3W1HA 5J8QA 3DZZA 5JAYA 3UAKA 4MGRA 2R5EA 1CQ8A 2AY3A 3GZDA 4MY5A 4B98A 4JEXA 4JF0A 5AX8A 3GSBA 1BQDA 1CJ0A 4A0RA 3ELPA 3WKRA 4N0BA 1WYUB 1AICA 1YNUA 3FZ8A 4EFFA 4Q76A 1I29A 3NYUA 4MQRA 3WCNA 2AEUA 2ZSMA 3LVLB 4XJMA 4E3QA 3R9AA 4EMYA 4WLHA 1E5EA 1ASCA 4WXFA 4E77A 2ZUKA 4F5KA 2Z61A 3WGCA 3E9KA 1LS3A 1XEYA 2FNUA 1C0NA 2OATA 2Q7WA 4Q6RA 1C7GA 4FFCA 1MDOA 2A1VA 1AY5A 2OGAA 2VMYA 2C81A 3FQ8A 2Z20A 2CANA 5E5IA 2BHXA 1ZC9A 4UHOA 2VMUA 3H7FA 1AY8A 3IHJA 1LKCA 4JF1A 4RJYA 2D5YA 2EZ2A 4XAUA 1B9HA 2CSTA 3FZ7A 1G7WA 3M5UA 4GSAA 2ZC0A 1GBNA 4RKDA 4F5GA 3TQXA 1CL2A 2QMAA 2VMRA 5F8VA 3AELA 2VLHA 3I4JA 2W8UA 2VGTA 1B8GA 3NU7A 3WY7A 1JF9A 3ISLA 4OMAA 2VGVA 3BCBA 4GRXA 2WB6A 2O7CA 5I92A 3BV0A 1UKJA 1W7NA 3A9YA 1ZOBA 3USFA 4UHMA 4GEBA 1DTYA 3G7QA 1TOGA 2AY4A 4K2MA 4ZSYA 4XEWA 3FCRA 3ZRQA 2FYFA 4XJPA 5F9SA 2ZY2A 4WYDA 3DYDA 2VMXA 3EZSA 1TARA 1RVUA 1MDZA 1ASGA 1S07A 2BIEA 2YKUA 3N5MA 1GC0A 3WGBA 1RV4A 2JJFA 4KAMA 1G4VA 4AOAA 4GDYA 1OHYA 1IJIA 1CQ7A 3NUBA 2FQ6A 4A0FA 4BA4A 1D7RA 3BWOA 1Z7DA 1W23A 3ECDA 1AAMA 3Q8NA 2JJEA 4JE5D 2BIGA 2D7YA 2AY8A 2OKJA 1ELQA 1MGVA 3RUYA 3EI5A 3DXWA 2AY2A 1SZKA 1ASDA 4JEWA 1AY4A 1N31A 2Z9WA 4OCAA 1LC8A 4ZWVA 1GC4A 1TOJA 1WKHA 1SZUA 2YOBA 3ASBA 3K7YA 4LNLA 3OKSA 3TCMA 4BMKA 2QSRA 2CB1A 5TF5A 1ASEA 4K2BA 3JW9A 2R2NA 1IAXA 3PDBA 4AZJA 1YIZA 4HF8A 1SZSA 4CBRA 4W1WA 2W7HA 1GDEA 4UOYA 5G2PA 3PDBB 3W1JA 1AMRA 3RBFA 1AMAA 2C44A 3B46A 4GE9A 3JWBA 4F5HA 1BJ4A 1LW5A 4PFFA 3FQ7A 3LWSA 2X5FA 4ZDPA 5BJ3A 1GC3A 2GMSA 3EI7A 3HMUA 2PB2A 4F5MA 3CQ4A 3CAIA 2AY6A 4WD2A 1V2FA 2VGWA 1XI9A 2TPLA 3MKJA 4UHNA 3ELEA 1YJZA 2VMNA 4AZKA 3MC6A 1O4SA 1TPLA 3F9TA 1PMMA 2Z1YA 3AEMC 4OYTA 2KFPA 2BWNA 2W8JA 2OGEA 1M0QA 2AEVA 2JJGA 2W7JA 3EI8A 2O0RA 3MEBA 1LK9A 2BI1A 1RV3A 3NYSA 3DXVA 3FRKA 4JEYA 3LG0A 5G4JA 4OBVA 2YKXA 2NMPA 2YCTA 3AOWA 1ARTA 3ZZJA 3WX9A 4ITXA 1MAQA 1JS3A 2VMZA 3A9XA 2VGZA 1B4XA 3E77A 3HBXA 3A8UX 4LC3A 2WKAA 1BJNA 1WYTA 1ORDA 4DBCA 1LC5A 1IX6A 4F5FA 3NTJA 1AIBA 1ARHA 4IXOA 4W1XA 4WYAA 2JJHA 4R5FA 1V72A 4IXSA 2X5DA 2GMUA 2ZY3A 2D65A 3BN1A 3VAXA 3F0HA 1ASAA 2VI9A 2CFBA 4ISYA 5DJ1A 1KKPA 5M4BA 3K40A 4MKKA 2HP1A 2V1PA 3DU4A 3E2FA 2W7GA 5DB5A 5FT5A 3TFTA 4L0OA 4OBUA 4J5UA 3R4TA 2HOZA 5K8BA 2BI3A 1IVRA 4WBTA 3LY1A 3E6GA 2RFVA 1W7MA 2ZSLA 4AO9A 3EUCA 4WYGA 1IX8A 4R2NA 1EJIA 1D7SA 1DGEA 2VMQA 3FDBA 3FTBA 1MLZA 1SFFA 3QGUA 5IWQA 1GD9A 3EZ1A 4IX8A 3PGYA 3AATA 3EI6A 3G8MA 3JZLA 1SPAA 4ZWMA 2HORA 3AEJC 3BCAA 4RJ0A 4AH3A 2BYLA 3KKIA 5D5SA 3N7NA 4LW2A 4KYOA 1AMSA 3BWNA 2Z9UA 3B1EA 1ASLA 4Y0HA 1X29A 1QISA 3HVYA 3JTXA 4WXGA 4CBSA 2DOUA 1BQAA 4ITGA 4F5JA 2EO5A 1S09A 2QLRA 2QA3A 4PVFA 4U1TA 4ZM3A 3EIBA 2W8WA 1WYVA 4H51A 1PFFA 2D61A 2WK7A 3PD6A 4RITA 4WYEA 3ZRPA 1I41A 2DGKA 3AOVA 1DJ9A 3CQ6A 1C7NA 1QZ9A 3B1CA 3BC8A 2QB3A 3AEOA 3P6KA 3RBLA 4W1VA 1G4XA 4H63Q 4BHDA 1OATA 1I43A 1WKGA 4ADBA 1QGNA 2Z1ZA 4HVKA 5M49A 4JE5A 4A6UA 2R5CB 3NYTA 1AHYA 2DR1A 3TFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMK A;  3RI6 A;  3D6K A;  2VMS A;  2BWO A;  2EH6 A;  3EIA A;  4I8A A;  3I16 A;  3VK4 A;  4IW7 A;  1BS0 A;  2VI8 A;  3KE3 A;  4M2M A;  3LV2 A;  4XK1 A;  4A0G A;  1EG5 A;  1IBJ A;  2F8J A;  2OQX A;  3B1D A;  1AKC A;  2W8T A;  1CQ6 A;  3L8A A;  9AAT A;  4P7Y A;  1H0C A;  5G4I A;  4R5Z A;  4ADD A;  4M2K A;  2DKJ A;  3FKD A;  1DJU A;  2AY5 A;  2YCP A;  4LW4 A;  4Q31 A;  1VJO A;  4TN4 A;  4WB0 B;  3GET A;  1AKB A;  4FL0 A;  2FN6 A;  4PFN A;  4LNJ A;  3NNK A;  3OP7 A;  1DJE A;  3VP6 A;  4JEV A;  1PG8 A;  1TAS A;  1ASF A;  1OHW A;  4Q75 A;  1ARS A;  1BKG A;  1M6S A;  2HUU A;  4ZSW A;  4A72 A;  4NOG A;  2GSA A;  1J32 A;  3QBO A;  2CH1 A;  1ARG A;  1CZE A;  2EZ1 A;  1QIT A;  4A0H A;  1KL1 A;  3QM2 A;  4WYF A;  1YOO A;  2E54 A;  3FVS A;  4F5L A;  2CJD A;  4GE7 A;  1TOK A;  1JS6 A;  1Z3Z A;  2X3L A;  2C0R A;  1TOE A;  2O1B A;  3G0T A;  3QN6 A;  1D7U A;  2AAT A;  1IX7 A;  3AEJ A;  1DKA A;  1M32 A;  3CQ5 A;  2HUI A;  1AHE A;  1MAP A;  2W7E A;  4IXZ A;  4BA5 A;  4GE4 A;  4ATQ A;  1LW4 A;  5E4Z A;  1KL2 A;  2D64 A;  2YKY A;  1B9I A;  1VEF A;  4E3R A;  1TAT A;  4MSO A;  3VK2 A;  5M4D A;  3VK3 A;  1FG3 A;  1M0O A;  1S08 A;  2CJH A;  1D2F A;  1C9C A;  1AMQ A;  1CL1 A;  2JGT A;  2VGS A;  3JWA A;  3N75 A;  4TMR A;  5DJ9 A;  5EUN A;  4ADC A;  2BI9 A;  4ZAS A;  5DX5 A;  2VMO A;  3TAT A;  1OXO A;  5C6U A;  3B8X A;  2E7J A;  1IUG A;  4J8L A;  2EPJ A;  3UE8 A;  3FQA A;  4DQ6 A;  4R8D A;  4F5I A;  4A00 A;  2ZY4 A;  2XH1 A;  1YJS A;  4W8I A;  1WST A;  4K2I A;  4M2J A;  4EB7 A;  1AJS B;  3DR4 A;  5EAV A;  1J04 A;  1TOI A;  3NX3 A;  2W7I A;  3ZZK A;  1S06 A;  4ADE A;  4WP0 A;  1JG8 A;  1Y4I A;  2YRI A;  4ZDO A;  3A9Z A;  3BCX A;  1QJ5 A;  4XJL A;  1C4K A;  3ZRR A;  5E3K A;  3BWN C;  1O61 A;  3CBF A;  4QGR A;  2DKB A;  2VIB A;  2EGY A;  3DC1 A;  3FVX A;  1AAW A;  1X28 A;  3PD6 B;  4MQQ A;  1YIY A;  3K28 A;  3E2Z A;  2BKW A;  3P1T A;  3ASA A;  3BS8 A;  4ZDL A;  4ZM4 A;  4A6R A;  1AHX A;  1AHG A;  3H14 A;  2W7L A;  2ZYJ A;  5G0A A;  1BJW A;  5EIG A;  4N0W A;  2CIN A;  1QJ3 A;  1WYV B;  1AHF A;  1V2E A;  3GR9 A;  3PAA A;  4P3M A;  1D7V A;  3QPG A;  3FSL A;  1B5P A;  1M4N A;  1M0N A;  1X2A A;  2JIS A;  5G09 A;  3II0 A;  4U2H A;  4ZAH A;  3AEP A;  3FD0 A;  1QIR A;  3MAU A;  2VMV A;  3N0L A;  1BT4 A;  2PO3 A;  3NRA A;  4RAE A;  3RCH A;  2CH2 A;  1MLY A;  2W7M A;  3MAD A;  3WKS A;  1M7Y A;  3FFR A;  3DR7 A;  3PJ0 A;  2E7U A;  3HLM A;  1N2T A;  2HUF A;  4EB5 A;  1V2D A;  3GJU A;  4A6T A;  2WK8 A;  3ATH A;  1UU0 A;  4WLJ A;  4F4E A;  3GBX A;  1O62 A;  5HHY A;  2D63 A;  4UQV A;  3DRD A;  2Z9X A;  2W7K A;  2QBT A;  1WYU A;  2VIA A;  5LHA A;  3DOD A;  4LNM A;  2FM1 A;  1OXP A;  1EQB A;  2W8V A;  3BB8 A;  1KMJ A;  2AY1 A;  1FG7 A;  2ORD A;  4WB0 A;  2G6W A;  3PPL A;  2ZY5 A;  1SVV A;  2OKK A;  3WCO A;  3AV7 A;  2DGL A;  3FVU A;  2XBN A;  4TV7 A;  3FDD A;  7AAT A;  2VLF A;  2HZP A;  3LVM A;  3KGW A;  1PMO A;  1W7L A;  1G7X A;  3HT4 A;  3LVK A;  2R0T A;  1ARI A;  4Y0D A;  2YHK A;  4RM1 A;  1IAY A;  5EQC A;  3HQT A;  1ASB A;  1WYT B;  1VP4 A;  1YJY A;  1UU2 A;  2X8U A;  1ASM A;  2VGU A;  4OC9 A;  1ELU A;  2V0Y A;  4W5K A;  1E5F A;  1GCK A;  2FNI A;  4CVQ A;  3GZC A;  2BYJ A;  1H1C A;  4DGT A;  3JU7 A;  4XQ2 A;  1BJO A;  3QHX A;  3F6T A;  5FT4 A;  2D7Z A;  1S0A A;  2AY9 A;  2GQN A;  2VMP A;  1BJO B;  2VYC A;  5EAA A;  4MKJ A;  1MDX A;  1GEX A;  5FT6 A;  1O69 A;  5HXX A;  2YKV A;  3FFH A;  3W1I A;  3RQ1 A;  1KKJ A;  1AJR A;  1ECX A;  2C7T A;  3HL2 A;  3COG A;  5EUD A;  1N8P A;  3NU8 A;  4OTL A;  5G2Q A;  2YCN A;  1DFO A;  2D66 A;  2YRR A;  3L44 A;  2WK9 A;  1GEW A;  5M46 A;  5HDM A;  4Y0I A;  2DGM A;  3EI9 A;  1W3U A;  2CY8 A;  1AJS A;  1OHV A;  2VMW A;  2Z9V A;  3A2B A;  1T3I A;  3QI6 A;  1LC7 A;  2E7I A;  3AEN B;  5EFS A;  4AO4 A;  4PIW A;  1C7O A;  3E2Z B;  2HP2 A;  4MQP A;  1BW0 A;  4E1O A;  2W7D A;  1I48 A;  4CXR A;  3AEN A;  1UU1 A;  2BI5 A;  2ZP7 A;  4JEZ A;  5EIG B;  2BI2 A;  2CJG A;  4XJO A;  2Z67 A;  2BWP A;  4CXQ A;  2HOX A;  4RIZ A;  1SF2 A;  3IF2 A;  3KGX A;  2W7F A;  4IYO B;  4KXK A;  2BIA A;  3I5T A;  4WXB A;  3MAF B;  4B9B A;  3ACZ A;  5LH9 A;  1CZC A;  4WYC A;  3PIU A;  3GZD C;  3MBB A;  3VOM A;  1AKA A;  2R5C A;  4IYO A;  3PA9 A;  1U08 A;  1ZOD A;  3MAF A;  4W91 A;  2JG2 A;  3FZ6 A;  5BJ4 A;  4BQ0 A;  2AY7 A;  2HOY A;  1B5O A;  1ASN A;  1GEY A;  3GWP A;  2PB0 A;  2CTZ A;  1RVY A;  3NUI A;  3PDX A;  1GC2 A;  2QB2 A;  4RKC A;  3AEM A;  1YAA A;  4IY7 A;  3WZF A;  1FC4 A;  1P3W A;  3E2Y A;  2ZJG A;  2VMT A;  3RCH B;  4ZLV A;  3T32 A;  3UWC A;  3MC6 C;  3LVJ A;  3HDO A;  5EUE A;  4EU1 A;  5D95 A;  1DGD A;  1AX4 A;  1X0M A;  4ATP A;  1CS1 A;  4RLG A;  1AIA A;  3NDN A;  2GB3 A;  4O6Z A;  4OT8 A;  3WLX A;  8AAT A;  5FT8 A;  1M0P A;  3W1H A;  5J8Q A;  3DZZ A;  5JAY A;  3UAK A;  4MGR A;  2R5E A;  1CQ8 A;  2AY3 A;  3GZD A;  4MY5 A;  4B98 A;  4JEX A;  4JF0 A;  5AX8 A;  3GSB A;  1BQD A;  1CJ0 A;  4A0R A;  3ELP A;  3WKR A;  4N0B A;  1WYU B;  1AIC A;  1YNU A;  3FZ8 A;  4EFF A;  4Q76 A;  1I29 A;  3NYU A;  4MQR A;  3WCN A;  2AEU A;  2ZSM A;  3LVL B;  4XJM A;  4E3Q A;  3R9A A;  4EMY A;  4WLH A;  1E5E A;  1ASC A;  4WXF A;  4E77 A;  2ZUK A;  4F5K A;  2Z61 A;  3WGC A;  3E9K A;  1LS3 A;  1XEY A;  2FNU A;  1C0N A;  2OAT A;  2Q7W A;  4Q6R A;  1C7G A;  4FFC A;  1MDO A;  1AY5 A;  2OGA A;  2VMY A;  2C81 A;  3FQ8 A;  2Z20 A;  2CAN A;  5E5I A;  2BHX A;  1ZC9 A;  4UHO A;  2VMU A;  3H7F A;  1AY8 A;  3IHJ A;  1LKC A;  4JF1 A;  4RJY A;  2D5Y A;  2EZ2 A;  4XAU A;  1B9H A;  2CST A;  3FZ7 A;  1G7W A;  3M5U A;  4GSA A;  2ZC0 A;  1GBN A;  4RKD A;  4F5G A;  3TQX A;  1CL2 A;  2QMA A;  2VMR A;  5F8V A;  3AEL A;  2VLH A;  3I4J A;  2W8U A;  2VGT A;  1B8G A;  3NU7 A;  3WY7 A;  1JF9 A;  3ISL A;  4OMA A;  2VGV A;  3BCB A;  4GRX A;  2O7C A;  5I92 A;  3BV0 A;  1UKJ A;  1W7N A;  3A9Y A;  1ZOB A;  3USF A;  4UHM A;  4GEB A;  1DTY A;  3G7Q A;  1TOG A;  2AY4 A;  4K2M A;  4ZSY A;  4XEW A;  3FCR A;  3ZRQ A;  2FYF A;  4XJP A;  5F9S A;  2ZY2 A;  4WYD A;  3DYD A;  2VMX A;  3EZS A;  1TAR A;  1RVU A;  1MDZ A;  1ASG A;  1S07 A;  2BIE A;  2YKU A;  3N5M A;  1GC0 A;  3WGB A;  1RV4 A;  2JJF A;  4KAM A;  1G4V A;  4AOA A;  4GDY A;  1OHY A;  1IJI A;  1CQ7 A;  3NUB A;  2FQ6 A;  4A0F A;  4BA4 A;  1D7R A;  3BWO A;  1Z7D A;  1W23 A;  3ECD A;  1AAM A;  3Q8N A;  2JJE A;  4JE5 D;  2BIG A;  2D7Y A;  2AY8 A;  2OKJ A;  1ELQ A;  1MGV A;  3RUY A;  3EI5 A;  3DXW A;  2AY2 A;  1SZK A;  1ASD A;  4JEW A;  1AY4 A;  1N31 A;  2Z9W A;  4OCA A;  1LC8 A;  4ZWV A;  1GC4 A;  1TOJ A;  1WKH A;  1SZU A;  2YOB A;  3ASB A;  3K7Y A;  4LNL A;  3OKS A;  3TCM A;  4BMK A;  2CB1 A;  5TF5 A;  1ASE A;  4K2B A;  3JW9 A;  2R2N A;  1IAX A;  3PDB A;  4AZJ A;  1YIZ A;  4HF8 A;  1SZS A;  4CBR A;  4W1W A;  2W7H A;  1GDE A;  4UOY A;  5G2P A;  3PDB B;  3W1J A;  1AMR A;  3RBF A;  1AMA A;  2C44 A;  3B46 A;  4GE9 A;  3JWB A;  4F5H A;  1BJ4 A;  1LW5 A;  4PFF A;  3FQ7 A;  3LWS A;  2X5F A;  4ZDP A;  5BJ3 A;  1GC3 A;  2GMS A;  3EI7 A;  3HMU A;  2PB2 A;  4F5M A;  3CQ4 A;  3CAI A;  2AY6 A;  4WD2 A;  1V2F A;  2VGW A;  1XI9 A;  2TPL A;  3MKJ A;  4UHN A;  3ELE A;  1YJZ A;  2VMN A;  4AZK A;  3MC6 A;  1O4S A;  1TPL A;  3F9T A;  1PMM A;  2Z1Y A;  3AEM C;  4OYT A;  2BWN A;  2W8J A;  2OGE A;  1M0Q A;  2AEV A;  2JJG A;  2W7J A;  3EI8 A;  2O0R A;  3MEB A;  1LK9 A;  2BI1 A;  1RV3 A;  3NYS A;  3DXV A;  3FRK A;  4JEY A;  3LG0 A;  5G4J A;  4OBV A;  2YKX A;  2NMP A;  2YCT A;  3AOW A;  1ART A;  3ZZJ A;  3WX9 A;  4ITX A;  1MAQ A;  1JS3 A;  2VMZ A;  3A9X A;  2VGZ A;  1B4X A;  3E77 A;  3HBX A;  3A8U X;  4LC3 A;  2WKA A;  1BJN A;  1WYT A;  1ORD A;  4DBC A;  1LC5 A;  1IX6 A;  4F5F A;  3NTJ A;  1AIB A;  1ARH A;  4IXO A;  4W1X A;  4WYA A;  2JJH A;  4R5F A;  1V72 A;  4IXS A;  2X5D A;  2GMU A;  2ZY3 A;  2D65 A;  3BN1 A;  3VAX A;  3F0H A;  1ASA A;  2VI9 A;  2CFB A;  4ISY A;  5DJ1 A;  1KKP A;  5M4B A;  3K40 A;  4MKK A;  2HP1 A;  2V1P A;  3DU4 A;  3E2F A;  2W7G A;  5DB5 A;  5FT5 A;  3TFT A;  4L0O A;  4OBU A;  4J5U A;  3R4T A;  2HOZ A;  5K8B A;  2BI3 A;  1IVR A;  4WBT A;  3LY1 A;  3E6G A;  2RFV A;  1W7M A;  2ZSL A;  4AO9 A;  3EUC A;  4WYG A;  1IX8 A;  4R2N A;  1EJI A;  1D7S A;  1DGE A;  2VMQ A;  3FDB A;  3FTB A;  1MLZ A;  1SFF A;  3QGU A;  5IWQ A;  1GD9 A;  3EZ1 A;  4IX8 A;  3PGY A;  3AAT A;  3EI6 A;  3G8M A;  3JZL A;  1SPA A;  4ZWM A;  2HOR A;  3AEJ C;  3BCA A;  4RJ0 A;  4AH3 A;  2BYL A;  3KKI A;  5D5S A;  4LW2 A;  4KYO A;  1AMS A;  3BWN A;  2Z9U A;  3B1E A;  1ASL A;  4Y0H A;  1X29 A;  1QIS A;  3HVY A;  3JTX A;  4WXG A;  4CBS A;  2DOU A;  1BQA A;  4ITG A;  4F5J A;  2EO5 A;  1S09 A;  2QLR A;  2QA3 A;  4PVF A;  4U1T A;  4ZM3 A;  3EIB A;  2W8W A;  1WYV A;  4H51 A;  1PFF A;  2D61 A;  2WK7 A;  3PD6 A;  4RIT A;  4WYE A;  3ZRP A;  1I41 A;  2DGK A;  3AOV A;  1DJ9 A;  3CQ6 A;  1C7N A;  1QZ9 A;  3B1C A;  3BC8 A;  2QB3 A;  3AEO A;  3P6K A;  3RBL A;  4W1V A;  1G4X A;  4BHD A;  1OAT A;  1I43 A;  1WKG A;  4ADB A;  1QGN A;  2Z1Z A;  4HVK A;  5M49 A;  4JE5 A;  4A6U A;  2R5C B;  3NYT A;  1AHY A;  2DR1 A;  3TFU A; 
#chains in the Genus database with same CATH topology
 1KMK A;  3RI6 A;  3D6K A;  2VMS A;  2BWO A;  2EH6 A;  3EIA A;  4I8A A;  3I16 A;  3VK4 A;  4IW7 A;  1BS0 A;  2VI8 A;  3KE3 A;  4M2M A;  3LV2 A;  4XK1 A;  4A0G A;  1EG5 A;  1IBJ A;  2F8J A;  2OQX A;  3B1D A;  1AKC A;  2W8T A;  1CQ6 A;  3L8A A;  9AAT A;  4P7Y A;  1H0C A;  5G4I A;  4R5Z A;  4ADD A;  4M2K A;  2DKJ A;  3FKD A;  1DJU A;  2AY5 A;  2YCP A;  4LW4 A;  4Q31 A;  1VJO A;  4TN4 A;  4WB0 B;  3GET A;  1AKB A;  4FL0 A;  2FN6 A;  4PFN A;  4LNJ A;  3NNK A;  3OP7 A;  1DJE A;  3VP6 A;  4JEV A;  1PG8 A;  1TAS A;  1ASF A;  1OHW A;  4Q75 A;  1ARS A;  1BKG A;  1M6S A;  2HUU A;  4ZSW A;  4A72 A;  4NOG A;  2FKI A;  2GSA A;  1J32 A;  3QBO A;  2EYQ A;  2CH1 A;  1ARG A;  1CZE A;  2EZ1 A;  1QIT A;  4A0H A;  1KL1 A;  3QM2 A;  4WYF A;  1YOO A;  2E54 A;  3FVS A;  4F5L A;  2CJD A;  4GE7 A;  1TOK A;  1JS6 A;  1Z3Z A;  2X3L A;  2C0R A;  1TOE A;  2O1B A;  3G0T A;  3QN6 A;  1D7U A;  2AAT A;  1IX7 A;  3AEJ A;  1DKA A;  1M32 A;  3CQ5 A;  2HUI A;  1AHE A;  1MAP A;  2W7E A;  4IXZ A;  4BA5 A;  4GE4 A;  4ATQ A;  1LW4 A;  5E4Z A;  4K05 A;  1KL2 A;  2D64 A;  2YKY A;  3N4X A;  1B9I A;  1VEF A;  4E3R A;  1TAT A;  4MSO A;  3VK2 A;  5M4D A;  3VK3 A;  1FG3 A;  1M0O A;  1S08 A;  2CJH A;  1D2F A;  1C9C A;  1AMQ A;  1CL1 A;  2JGT A;  2VGS A;  3JWA A;  3N75 A;  4TMR A;  5DJ9 A;  5EUN A;  4ADC A;  2BI9 A;  4ZAS A;  5DX5 A;  2VMO A;  3TAT A;  1OXO A;  5C6U A;  3B8X A;  2E7J A;  1IUG A;  4J8L A;  2EPJ A;  3UE8 A;  3FQA A;  4DQ6 A;  4R8D A;  4F5I A;  4A00 A;  2ZY4 A;  2XH1 A;  1YJS A;  4W8I A;  1WST A;  4K2I A;  4M2J A;  4EB7 A;  1AJS B;  3DR4 A;  5EAV A;  1J04 A;  1TOI A;  3NX3 A;  2W7I A;  3ZZK A;  1S06 A;  4ADE A;  4WP0 A;  1JG8 A;  1Y4I A;  2YRI A;  4ZDO A;  3A9Z A;  3BCX A;  1QJ5 A;  4XJL A;  1C4K A;  3ZRR A;  5E3K A;  3BWN C;  1O61 A;  3CBF A;  4QGR A;  2DKB A;  2VIB A;  2EGY A;  3DC1 A;  3FVX A;  1AAW A;  1X28 A;  3PD6 B;  4MQQ A;  1YIY A;  3K28 A;  3E2Z A;  2BKW A;  3P1T A;  3ASA A;  3BS8 A;  4ZDL A;  4ZM4 A;  4A6R A;  1AHX A;  1AHG A;  3H14 A;  2W7L A;  2ZYJ A;  2G7J A;  5G0A A;  1BJW A;  5EIG A;  4N0W A;  2CIN A;  1QJ3 A;  1WYV B;  1AHF A;  1V2E A;  3GR9 A;  3PAA A;  4P3M A;  1D7V A;  3QPG A;  5KTB A;  3FSL A;  1B5P A;  1M4N A;  1M0N A;  1X2A A;  2JIS A;  5G09 A;  3II0 A;  4U2H A;  4ZAH A;  3AEP A;  3FD0 A;  1QIR A;  3MAU A;  2VMV A;  3N0L A;  1BT4 A;  2PO3 A;  3NRA A;  4RAE A;  3RCH A;  2CH2 A;  1MLY A;  2W7M A;  3MAD A;  3WKS A;  1M7Y A;  3FFR A;  3N4R A;  3DR7 A;  3PJ0 A;  2E7U A;  3HLM A;  1N2T A;  2HUF A;  4EB5 A;  1V2D A;  3GJU A;  4A6T A;  2WK8 A;  3ATH A;  1UU0 A;  4WLJ A;  4F4E A;  3GBX A;  1O62 A;  5HHY A;  2D63 A;  4UQV A;  3DRD A;  2Z9X A;  2W7K A;  2QBT A;  1WYU A;  2VIA A;  5LHA A;  3DOD A;  4LNM A;  2FM1 A;  1OXP A;  1EQB A;  2W8V A;  3BB8 A;  1KMJ A;  2AY1 A;  1FG7 A;  2ORD A;  4WB0 A;  2G6W A;  3PPL A;  2ZY5 A;  1SVV A;  2OKK A;  3WCO A;  3AV7 A;  2DGL A;  3FVU A;  2XBN A;  4TV7 A;  3FDD A;  7AAT A;  2VLF A;  3N4S A;  2HZP A;  3LVM A;  3KGW A;  1PMO A;  1W7L A;  1G7X A;  3HT4 A;  3LVK A;  2R0T A;  1ARI A;  4Y0D A;  2YHK A;  4RM1 A;  1IAY A;  5EQC A;  3HQT A;  3H9X A;  1ASB A;  1WYT B;  1VP4 A;  1YJY A;  1UU2 A;  2X8U A;  1ASM A;  2VGU A;  4OC9 A;  1ELU A;  2V0Y A;  4W5K A;  1E5F A;  1GCK A;  2FNI A;  4CVQ A;  3GZC A;  2BYJ A;  1H1C A;  4DGT A;  3JU7 A;  4XQ2 A;  1BJO A;  3QHX A;  3F6T A;  5FT4 A;  2D7Z A;  1S0A A;  2AY9 A;  2GQN A;  2VMP A;  1BJO B;  2VYC A;  5EAA A;  4MKJ A;  1MDX A;  1GEX A;  5FT6 A;  1O69 A;  5HXX A;  2YKV A;  3FFH A;  3W1I A;  3RQ1 A;  1KKJ A;  1AJR A;  1ECX A;  2C7T A;  3HL2 A;  3COG A;  5EUD A;  1N8P A;  3NU8 A;  4OTL A;  5G2Q A;  2YCN A;  1DFO A;  2D66 A;  2YRR A;  3L44 A;  2WK9 A;  1GEW A;  5M46 A;  5HDM A;  4Y0I A;  2DGM A;  3EI9 A;  1W3U A;  2CY8 A;  1AJS A;  1OHV A;  2VMW A;  2Z9V A;  3A2B A;  1T3I A;  3QI6 A;  1LC7 A;  2E7I A;  3AEN B;  5EFS A;  4AO4 A;  4PIW A;  1C7O A;  3E2Z B;  2HP2 A;  4MQP A;  1BW0 A;  4E1O A;  2W7D A;  1I48 A;  4CXR A;  3AEN A;  1UU1 A;  2BI5 A;  2ZP7 A;  4JEZ A;  5EIG B;  2BI2 A;  2CJG A;  4XJO A;  2Z67 A;  2BWP A;  4CXQ A;  2HOX A;  4RIZ A;  1SF2 A;  3IF2 A;  3KGX A;  2W7F A;  4IYO B;  4KXK A;  2BIA A;  3I5T A;  4WXB A;  3MAF B;  4B9B A;  3ACZ A;  5LH9 A;  1CZC A;  4WYC A;  3PIU A;  3GZD C;  3MBB A;  3VOM A;  1AKA A;  2R5C A;  4IYO A;  3PA9 A;  1U08 A;  1ZOD A;  3MAF A;  4W91 A;  2JG2 A;  3FZ6 A;  5BJ4 A;  4BQ0 A;  2AY7 A;  2HOY A;  1B5O A;  1ASN A;  1GEY A;  3GWP A;  2PB0 A;  2CTZ A;  1RVY A;  3NUI A;  3PDX A;  1GC2 A;  2QB2 A;  4RKC A;  3AEM A;  1YAA A;  4IY7 A;  3WZF A;  1FC4 A;  1P3W A;  3E2Y A;  2ZJG A;  2VMT A;  3RCH B;  4ZLV A;  3T32 A;  3UWC A;  3MC6 C;  3LVJ A;  3HDO A;  5EUE A;  4EU1 A;  5D95 A;  1DGD A;  1AX4 A;  1X0M A;  4ATP A;  1CS1 A;  4RLG A;  1AIA A;  3NDN A;  2GB3 A;  4O6Z A;  4OT8 A;  3WLX A;  8AAT A;  5FT8 A;  1M0P A;  3W1H A;  5J8Q A;  3DZZ A;  5JAY A;  3UAK A;  4MGR A;  2R5E A;  1CQ8 A;  2AY3 A;  3GZD A;  4MY5 A;  4B98 A;  4JEX A;  4JF0 A;  5AX8 A;  3GSB A;  1BQD A;  1CJ0 A;  4A0R A;  3ELP A;  3WKR A;  4N0B A;  1WYU B;  1AIC A;  1YNU A;  3FZ8 A;  4EFF A;  4Q76 A;  1I29 A;  3NYU A;  4MQR A;  3WCN A;  2AEU A;  2ZSM A;  3LVL B;  4XJM A;  4E3Q A;  3R9A A;  4EMY A;  4WLH A;  1E5E A;  1ASC A;  4WXF A;  4E77 A;  2ZUK A;  4F5K A;  2Z61 A;  3WGC A;  3E9K A;  1LS3 A;  1XEY A;  2FNU A;  1C0N A;  2OAT A;  2Q7W A;  4Q6R A;  1C7G A;  4FFC A;  1MDO A;  2A1V A;  1AY5 A;  2OGA A;  2VMY A;  2C81 A;  3FQ8 A;  2Z20 A;  2CAN A;  5E5I A;  2BHX A;  1ZC9 A;  4UHO A;  2VMU A;  3H7F A;  1AY8 A;  3IHJ A;  1LKC A;  4JF1 A;  4RJY A;  2D5Y A;  2EZ2 A;  4XAU A;  1B9H A;  2CST A;  3FZ7 A;  1G7W A;  3M5U A;  4GSA A;  2ZC0 A;  1GBN A;  4RKD A;  4F5G A;  3TQX A;  1CL2 A;  2QMA A;  2VMR A;  5F8V A;  3AEL A;  2VLH A;  3I4J A;  2W8U A;  2VGT A;  1B8G A;  3NU7 A;  3WY7 A;  1JF9 A;  3ISL A;  4OMA A;  2VGV A;  3BCB A;  4GRX A;  2WB6 A;  2O7C A;  5I92 A;  3BV0 A;  1UKJ A;  1W7N A;  3A9Y A;  1ZOB A;  3USF A;  4UHM A;  4GEB A;  1DTY A;  3G7Q A;  1TOG A;  2AY4 A;  4K2M A;  4ZSY A;  4XEW A;  3FCR A;  3ZRQ A;  2FYF A;  4XJP A;  5F9S A;  2ZY2 A;  4WYD A;  3DYD A;  2VMX A;  3EZS A;  1TAR A;  1RVU A;  1MDZ A;  1ASG A;  1S07 A;  2BIE A;  2YKU A;  3N5M A;  1GC0 A;  3WGB A;  1RV4 A;  2JJF A;  4KAM A;  1G4V A;  4AOA A;  4GDY A;  1OHY A;  1IJI A;  1CQ7 A;  3NUB A;  2FQ6 A;  4A0F A;  4BA4 A;  1D7R A;  3BWO A;  1Z7D A;  1W23 A;  3ECD A;  1AAM A;  3Q8N A;  2JJE A;  4JE5 D;  2BIG A;  2D7Y A;  2AY8 A;  2OKJ A;  1ELQ A;  1MGV A;  3RUY A;  3EI5 A;  3DXW A;  2AY2 A;  1SZK A;  1ASD A;  4JEW A;  1AY4 A;  1N31 A;  2Z9W A;  4OCA A;  1LC8 A;  4ZWV A;  1GC4 A;  1TOJ A;  1WKH A;  1SZU A;  2YOB A;  3ASB A;  3K7Y A;  4LNL A;  3OKS A;  3TCM A;  4BMK A;  2QSR A;  2CB1 A;  5TF5 A;  1ASE A;  4K2B A;  3JW9 A;  2R2N A;  1IAX A;  3PDB A;  4AZJ A;  1YIZ A;  4HF8 A;  1SZS A;  4CBR A;  4W1W A;  2W7H A;  1GDE A;  4UOY A;  5G2P A;  3PDB B;  3W1J A;  1AMR A;  3RBF A;  1AMA A;  2C44 A;  3B46 A;  4GE9 A;  3JWB A;  4F5H A;  1BJ4 A;  1LW5 A;  4PFF A;  3FQ7 A;  3LWS A;  2X5F A;  4ZDP A;  5BJ3 A;  1GC3 A;  2GMS A;  3EI7 A;  3HMU A;  2PB2 A;  4F5M A;  3CQ4 A;  3CAI A;  2AY6 A;  4WD2 A;  1V2F A;  2VGW A;  1XI9 A;  2TPL A;  3MKJ A;  4UHN A;  3ELE A;  1YJZ A;  2VMN A;  4AZK A;  3MC6 A;  1O4S A;  1TPL A;  3F9T A;  1PMM A;  2Z1Y A;  3AEM C;  4OYT A;  2KFP A;  2BWN A;  2W8J A;  2OGE A;  1M0Q A;  2AEV A;  2JJG A;  2W7J A;  3EI8 A;  2O0R A;  3MEB A;  1LK9 A;  2BI1 A;  1RV3 A;  3NYS A;  3DXV A;  3FRK A;  4JEY A;  3LG0 A;  5G4J A;  4OBV A;  2YKX A;  2NMP A;  2YCT A;  3AOW A;  1ART A;  3ZZJ A;  3WX9 A;  4ITX A;  1MAQ A;  1JS3 A;  2VMZ A;  3A9X A;  1KAF A;  2VGZ A;  1B4X A;  3E77 A;  3HBX A;  3A8U X;  4LC3 A;  2WKA A;  1BJN A;  1WYT A;  1ORD A;  4DBC A;  1LC5 A;  1IX6 A;  4F5F A;  3NTJ A;  1AIB A;  1ARH A;  4IXO A;  4W1X A;  4WYA A;  2JJH A;  4R5F A;  1V72 A;  4IXS A;  2X5D A;  2GMU A;  2ZY3 A;  2D65 A;  3BN1 A;  3VAX A;  3F0H A;  1ASA A;  2VI9 A;  2CFB A;  4ISY A;  5DJ1 A;  1KKP A;  5M4B A;  3K40 A;  4MKK A;  2HP1 A;  2V1P A;  3DU4 A;  3E2F A;  2W7G A;  5DB5 A;  5FT5 A;  3TFT A;  4L0O A;  4OBU A;  4J5U A;  3R4T A;  2HOZ A;  5K8B A;  2BI3 A;  1IVR A;  4WBT A;  3LY1 A;  3E6G A;  2RFV A;  1W7M A;  2ZSL A;  4AO9 A;  3EUC A;  4WYG A;  1IX8 A;  4R2N A;  1EJI A;  1D7S A;  1DGE A;  2VMQ A;  3FDB A;  3FTB A;  1MLZ A;  1SFF A;  3QGU A;  5IWQ A;  1GD9 A;  3EZ1 A;  4IX8 A;  3PGY A;  3AAT A;  3EI6 A;  3G8M A;  3JZL A;  1SPA A;  4ZWM A;  2HOR A;  3AEJ C;  3BCA A;  4RJ0 A;  4AH3 A;  2BYL A;  3KKI A;  5D5S A;  3N7N A;  4LW2 A;  4KYO A;  1AMS A;  3BWN A;  2Z9U A;  3B1E A;  1ASL A;  4Y0H A;  1X29 A;  1QIS A;  3HVY A;  3JTX A;  4WXG A;  4CBS A;  2DOU A;  1BQA A;  4ITG A;  4F5J A;  2EO5 A;  1S09 A;  2QLR A;  2QA3 A;  4PVF A;  4U1T A;  4ZM3 A;  3EIB A;  2W8W A;  1WYV A;  4H51 A;  1PFF A;  2D61 A;  2WK7 A;  3PD6 A;  4RIT A;  4WYE A;  3ZRP A;  1I41 A;  2DGK A;  3AOV A;  1DJ9 A;  3CQ6 A;  1C7N A;  1QZ9 A;  3B1C A;  3BC8 A;  2QB3 A;  3AEO A;  3P6K A;  3RBL A;  4W1V A;  1G4X A;  4H63 Q;  4BHD A;  1OAT A;  1I43 A;  1WKG A;  4ADB A;  1QGN A;  2Z1Z A;  4HVK A;  5M49 A;  4JE5 A;  4A6U A;  2R5C B;  3NYT A;  1AHY A;  2DR1 A;  3TFU A; 
#chains in the Genus database with same CATH homology
 1KMK A;  3RI6 A;  3D6K A;  2VMS A;  2BWO A;  2EH6 A;  3EIA A;  4I8A A;  3I16 A;  3VK4 A;  4IW7 A;  1BS0 A;  2VI8 A;  3KE3 A;  4M2M A;  3LV2 A;  4XK1 A;  4A0G A;  1EG5 A;  1IBJ A;  2F8J A;  2OQX A;  3B1D A;  1AKC A;  2W8T A;  1CQ6 A;  3L8A A;  9AAT A;  4P7Y A;  1H0C A;  5G4I A;  4R5Z A;  4ADD A;  4M2K A;  2DKJ A;  3FKD A;  1DJU A;  2AY5 A;  2YCP A;  4LW4 A;  4Q31 A;  1VJO A;  4TN4 A;  4WB0 B;  3GET A;  1AKB A;  4FL0 A;  2FN6 A;  4PFN A;  4LNJ A;  3NNK A;  3OP7 A;  1DJE A;  3VP6 A;  4JEV A;  1PG8 A;  1TAS A;  1ASF A;  1OHW A;  4Q75 A;  1ARS A;  1BKG A;  1M6S A;  2HUU A;  4ZSW A;  4A72 A;  4NOG A;  2FKI A;  2GSA A;  1J32 A;  3QBO A;  2EYQ A;  2CH1 A;  1ARG A;  1CZE A;  2EZ1 A;  1QIT A;  4A0H A;  1KL1 A;  3QM2 A;  4WYF A;  1YOO A;  2E54 A;  3FVS A;  4F5L A;  2CJD A;  4GE7 A;  1TOK A;  1JS6 A;  1Z3Z A;  2X3L A;  2C0R A;  1TOE A;  2O1B A;  3G0T A;  3QN6 A;  1D7U A;  2AAT A;  1IX7 A;  3AEJ A;  1DKA A;  1M32 A;  3CQ5 A;  2HUI A;  1AHE A;  1MAP A;  2W7E A;  4IXZ A;  4BA5 A;  4GE4 A;  4ATQ A;  1LW4 A;  5E4Z A;  4K05 A;  1KL2 A;  2D64 A;  2YKY A;  3N4X A;  1B9I A;  1VEF A;  4E3R A;  1TAT A;  4MSO A;  3VK2 A;  5M4D A;  3VK3 A;  1FG3 A;  1M0O A;  1S08 A;  2CJH A;  1D2F A;  1C9C A;  1AMQ A;  1CL1 A;  2JGT A;  2VGS A;  3JWA A;  3N75 A;  4TMR A;  5DJ9 A;  5EUN A;  4ADC A;  2BI9 A;  4ZAS A;  5DX5 A;  2VMO A;  3TAT A;  1OXO A;  5C6U A;  3B8X A;  2E7J A;  1IUG A;  4J8L A;  2EPJ A;  3UE8 A;  3FQA A;  4DQ6 A;  4R8D A;  4F5I A;  4A00 A;  2ZY4 A;  2XH1 A;  1YJS A;  4W8I A;  1WST A;  4K2I A;  4M2J A;  4EB7 A;  1AJS B;  3DR4 A;  5EAV A;  1J04 A;  1TOI A;  3NX3 A;  2W7I A;  3ZZK A;  1S06 A;  4ADE A;  4WP0 A;  1JG8 A;  1Y4I A;  2YRI A;  4ZDO A;  3A9Z A;  3BCX A;  1QJ5 A;  4XJL A;  1C4K A;  3ZRR A;  5E3K A;  3BWN C;  1O61 A;  3CBF A;  4QGR A;  2DKB A;  2VIB A;  2EGY A;  3DC1 A;  3FVX A;  1AAW A;  1X28 A;  3PD6 B;  4MQQ A;  1YIY A;  3K28 A;  3E2Z A;  2BKW A;  3P1T A;  3ASA A;  3BS8 A;  4ZDL A;  4ZM4 A;  4A6R A;  1AHX A;  1AHG A;  3H14 A;  2W7L A;  2ZYJ A;  2G7J A;  5G0A A;  1BJW A;  5EIG A;  4N0W A;  2CIN A;  1QJ3 A;  1WYV B;  1AHF A;  1V2E A;  3GR9 A;  3PAA A;  4P3M A;  1D7V A;  3QPG A;  5KTB A;  3FSL A;  1B5P A;  1M4N A;  1M0N A;  1X2A A;  2JIS A;  5G09 A;  3II0 A;  4U2H A;  4ZAH A;  3AEP A;  3FD0 A;  1QIR A;  3MAU A;  2VMV A;  3N0L A;  1BT4 A;  2PO3 A;  3NRA A;  4RAE A;  3RCH A;  2CH2 A;  1MLY A;  2W7M A;  3MAD A;  3WKS A;  1M7Y A;  3FFR A;  3N4R A;  3DR7 A;  3PJ0 A;  2E7U A;  3HLM A;  1N2T A;  2HUF A;  4EB5 A;  1V2D A;  3GJU A;  4A6T A;  2WK8 A;  3ATH A;  1UU0 A;  4WLJ A;  4F4E A;  3GBX A;  1O62 A;  5HHY A;  2D63 A;  4UQV A;  3DRD A;  2Z9X A;  2W7K A;  2QBT A;  1WYU A;  2VIA A;  5LHA A;  3DOD A;  4LNM A;  2FM1 A;  1OXP A;  1EQB A;  2W8V A;  3BB8 A;  1KMJ A;  2AY1 A;  1FG7 A;  2ORD A;  4WB0 A;  2G6W A;  3PPL A;  2ZY5 A;  1SVV A;  2OKK A;  3WCO A;  3AV7 A;  2DGL A;  3FVU A;  2XBN A;  4TV7 A;  3FDD A;  7AAT A;  2VLF A;  3N4S A;  2HZP A;  3LVM A;  3KGW A;  1PMO A;  1W7L A;  1G7X A;  3HT4 A;  3LVK A;  2R0T A;  1ARI A;  4Y0D A;  2YHK A;  4RM1 A;  1IAY A;  5EQC A;  3HQT A;  3H9X A;  1ASB A;  1WYT B;  1VP4 A;  1YJY A;  1UU2 A;  2X8U A;  1ASM A;  2VGU A;  4OC9 A;  1ELU A;  2V0Y A;  4W5K A;  1E5F A;  1GCK A;  2FNI A;  4CVQ A;  3GZC A;  2BYJ A;  1H1C A;  4DGT A;  3JU7 A;  4XQ2 A;  1BJO A;  3QHX A;  3F6T A;  5FT4 A;  2D7Z A;  1S0A A;  2AY9 A;  2GQN A;  2VMP A;  1BJO B;  2VYC A;  5EAA A;  4MKJ A;  1MDX A;  1GEX A;  5FT6 A;  1O69 A;  5HXX A;  2YKV A;  3FFH A;  3W1I A;  3RQ1 A;  1KKJ A;  1AJR A;  1ECX A;  2C7T A;  3HL2 A;  3COG A;  5EUD A;  1N8P A;  3NU8 A;  4OTL A;  5G2Q A;  2YCN A;  1DFO A;  2D66 A;  2YRR A;  3L44 A;  2WK9 A;  1GEW A;  5M46 A;  5HDM A;  4Y0I A;  2DGM A;  3EI9 A;  1W3U A;  2CY8 A;  1AJS A;  1OHV A;  2VMW A;  2Z9V A;  3A2B A;  1T3I A;  3QI6 A;  1LC7 A;  2E7I A;  3AEN B;  5EFS A;  4AO4 A;  4PIW A;  1C7O A;  3E2Z B;  2HP2 A;  4MQP A;  1BW0 A;  4E1O A;  2W7D A;  1I48 A;  4CXR A;  3AEN A;  1UU1 A;  2BI5 A;  2ZP7 A;  4JEZ A;  5EIG B;  2BI2 A;  2CJG A;  4XJO A;  2Z67 A;  2BWP A;  4CXQ A;  2HOX A;  4RIZ A;  1SF2 A;  3IF2 A;  3KGX A;  2W7F A;  4IYO B;  4KXK A;  2BIA A;  3I5T A;  4WXB A;  3MAF B;  4B9B A;  3ACZ A;  5LH9 A;  1CZC A;  4WYC A;  3PIU A;  3GZD C;  3MBB A;  3VOM A;  1AKA A;  2R5C A;  4IYO A;  3PA9 A;  1U08 A;  1ZOD A;  3MAF A;  4W91 A;  2JG2 A;  3FZ6 A;  5BJ4 A;  4BQ0 A;  2AY7 A;  2HOY A;  1B5O A;  1ASN A;  1GEY A;  3GWP A;  2PB0 A;  2CTZ A;  1RVY A;  3NUI A;  3PDX A;  1GC2 A;  2QB2 A;  4RKC A;  3AEM A;  1YAA A;  4IY7 A;  3WZF A;  1FC4 A;  1P3W A;  3E2Y A;  2ZJG A;  2VMT A;  3RCH B;  4ZLV A;  3T32 A;  3UWC A;  3MC6 C;  3LVJ A;  3HDO A;  5EUE A;  4EU1 A;  5D95 A;  1DGD A;  1AX4 A;  1X0M A;  4ATP A;  1CS1 A;  4RLG A;  1AIA A;  3NDN A;  2GB3 A;  4O6Z A;  4OT8 A;  3WLX A;  8AAT A;  5FT8 A;  1M0P A;  3W1H A;  5J8Q A;  3DZZ A;  5JAY A;  3UAK A;  4MGR A;  2R5E A;  1CQ8 A;  2AY3 A;  3GZD A;  4MY5 A;  4B98 A;  4JEX A;  4JF0 A;  5AX8 A;  3GSB A;  1BQD A;  1CJ0 A;  4A0R A;  3ELP A;  3WKR A;  4N0B A;  1WYU B;  1AIC A;  1YNU A;  3FZ8 A;  4EFF A;  4Q76 A;  1I29 A;  3NYU A;  4MQR A;  3WCN A;  2AEU A;  2ZSM A;  3LVL B;  4XJM A;  4E3Q A;  3R9A A;  4EMY A;  4WLH A;  1E5E A;  1ASC A;  4WXF A;  4E77 A;  2ZUK A;  4F5K A;  2Z61 A;  3WGC A;  3E9K A;  1LS3 A;  1XEY A;  2FNU A;  1C0N A;  2OAT A;  2Q7W A;  4Q6R A;  1C7G A;  4FFC A;  1MDO A;  2A1V A;  1AY5 A;  2OGA A;  2VMY A;  2C81 A;  3FQ8 A;  2Z20 A;  2CAN A;  5E5I A;  2BHX A;  1ZC9 A;  4UHO A;  2VMU A;  3H7F A;  1AY8 A;  3IHJ A;  1LKC A;  4JF1 A;  4RJY A;  2D5Y A;  2EZ2 A;  4XAU A;  1B9H A;  2CST A;  3FZ7 A;  1G7W A;  3M5U A;  4GSA A;  2ZC0 A;  1GBN A;  4RKD A;  4F5G A;  3TQX A;  1CL2 A;  2QMA A;  2VMR A;  5F8V A;  3AEL A;  2VLH A;  3I4J A;  2W8U A;  2VGT A;  1B8G A;  3NU7 A;  3WY7 A;  1JF9 A;  3ISL A;  4OMA A;  2VGV A;  3BCB A;  4GRX A;  2WB6 A;  2O7C A;  5I92 A;  3BV0 A;  1UKJ A;  1W7N A;  3A9Y A;  1ZOB A;  3USF A;  4UHM A;  4GEB A;  1DTY A;  3G7Q A;  1TOG A;  2AY4 A;  4K2M A;  4ZSY A;  4XEW A;  3FCR A;  3ZRQ A;  2FYF A;  4XJP A;  5F9S A;  2ZY2 A;  4WYD A;  3DYD A;  2VMX A;  3EZS A;  1TAR A;  1RVU A;  1MDZ A;  1ASG A;  1S07 A;  2BIE A;  2YKU A;  3N5M A;  1GC0 A;  3WGB A;  1RV4 A;  2JJF A;  4KAM A;  1G4V A;  4AOA A;  4GDY A;  1OHY A;  1IJI A;  1CQ7 A;  3NUB A;  2FQ6 A;  4A0F A;  4BA4 A;  1D7R A;  3BWO A;  1Z7D A;  1W23 A;  3ECD A;  1AAM A;  3Q8N A;  2JJE A;  4JE5 D;  2BIG A;  2D7Y A;  2AY8 A;  2OKJ A;  1ELQ A;  1MGV A;  3RUY A;  3EI5 A;  3DXW A;  2AY2 A;  1SZK A;  1ASD A;  4JEW A;  1AY4 A;  1N31 A;  2Z9W A;  4OCA A;  1LC8 A;  4ZWV A;  1GC4 A;  1TOJ A;  1WKH A;  1SZU A;  2YOB A;  3ASB A;  3K7Y A;  4LNL A;  3OKS A;  3TCM A;  4BMK A;  2QSR A;  2CB1 A;  5TF5 A;  1ASE A;  4K2B A;  3JW9 A;  2R2N A;  1IAX A;  3PDB A;  4AZJ A;  1YIZ A;  4HF8 A;  1SZS A;  4CBR A;  4W1W A;  2W7H A;  1GDE A;  4UOY A;  5G2P A;  3PDB B;  3W1J A;  1AMR A;  3RBF A;  1AMA A;  2C44 A;  3B46 A;  4GE9 A;  3JWB A;  4F5H A;  1BJ4 A;  1LW5 A;  4PFF A;  3FQ7 A;  3LWS A;  2X5F A;  4ZDP A;  5BJ3 A;  1GC3 A;  2GMS A;  3EI7 A;  3HMU A;  2PB2 A;  4F5M A;  3CQ4 A;  3CAI A;  2AY6 A;  4WD2 A;  1V2F A;  2VGW A;  1XI9 A;  2TPL A;  3MKJ A;  4UHN A;  3ELE A;  1YJZ A;  2VMN A;  4AZK A;  3MC6 A;  1O4S A;  1TPL A;  3F9T A;  1PMM A;  2Z1Y A;  3AEM C;  4OYT A;  2KFP A;  2BWN A;  2W8J A;  2OGE A;  1M0Q A;  2AEV A;  2JJG A;  2W7J A;  3EI8 A;  2O0R A;  3MEB A;  1LK9 A;  2BI1 A;  1RV3 A;  3NYS A;  3DXV A;  3FRK A;  4JEY A;  3LG0 A;  5G4J A;  4OBV A;  2YKX A;  2NMP A;  2YCT A;  3AOW A;  1ART A;  3ZZJ A;  3WX9 A;  4ITX A;  1MAQ A;  1JS3 A;  2VMZ A;  3A9X A;  2VGZ A;  1B4X A;  3E77 A;  3HBX A;  3A8U X;  4LC3 A;  2WKA A;  1BJN A;  1WYT A;  1ORD A;  4DBC A;  1LC5 A;  1IX6 A;  4F5F A;  3NTJ A;  1AIB A;  1ARH A;  4IXO A;  4W1X A;  4WYA A;  2JJH A;  4R5F A;  1V72 A;  4IXS A;  2X5D A;  2GMU A;  2ZY3 A;  2D65 A;  3BN1 A;  3VAX A;  3F0H A;  1ASA A;  2VI9 A;  2CFB A;  4ISY A;  5DJ1 A;  1KKP A;  5M4B A;  3K40 A;  4MKK A;  2HP1 A;  2V1P A;  3DU4 A;  3E2F A;  2W7G A;  5DB5 A;  5FT5 A;  3TFT A;  4L0O A;  4OBU A;  4J5U A;  3R4T A;  2HOZ A;  5K8B A;  2BI3 A;  1IVR A;  4WBT A;  3LY1 A;  3E6G A;  2RFV A;  1W7M A;  2ZSL A;  4AO9 A;  3EUC A;  4WYG A;  1IX8 A;  4R2N A;  1EJI A;  1D7S A;  1DGE A;  2VMQ A;  3FDB A;  3FTB A;  1MLZ A;  1SFF A;  3QGU A;  5IWQ A;  1GD9 A;  3EZ1 A;  4IX8 A;  3PGY A;  3AAT A;  3EI6 A;  3G8M A;  3JZL A;  1SPA A;  4ZWM A;  2HOR A;  3AEJ C;  3BCA A;  4RJ0 A;  4AH3 A;  2BYL A;  3KKI A;  5D5S A;  3N7N A;  4LW2 A;  4KYO A;  1AMS A;  3BWN A;  2Z9U A;  3B1E A;  1ASL A;  4Y0H A;  1X29 A;  1QIS A;  3HVY A;  3JTX A;  4WXG A;  4CBS A;  2DOU A;  1BQA A;  4ITG A;  4F5J A;  2EO5 A;  1S09 A;  2QLR A;  2QA3 A;  4PVF A;  4U1T A;  4ZM3 A;  3EIB A;  2W8W A;  1WYV A;  4H51 A;  1PFF A;  2D61 A;  2WK7 A;  3PD6 A;  4RIT A;  4WYE A;  3ZRP A;  1I41 A;  2DGK A;  3AOV A;  1DJ9 A;  3CQ6 A;  1C7N A;  1QZ9 A;  3B1C A;  3BC8 A;  2QB3 A;  3AEO A;  3P6K A;  3RBL A;  4W1V A;  1G4X A;  4H63 Q;  4BHD A;  1OAT A;  1I43 A;  1WKG A;  4ADB A;  1QGN A;  2Z1Z A;  4HVK A;  5M49 A;  4JE5 A;  4A6U A;  2R5C B;  3NYT A;  1AHY A;  2DR1 A;  3TFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...