1TOGA

Hydrocinnamic acid-bound structure of srhept + a293d mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFALYNERVGACTLVAADSETVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 140
structure length 395
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1togA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1togA01
1X2AA 2X5DA 4CXQA 4W8IA 4ZSYA 3A8UX 1IAXA 3VK3A 2JJHA 2D65A 2AY5A 4ZDPA 1CL2A 3FQAA 3AEPA 1SZKA 1JG8A 3BWNC 1RV3A 4B9BA 1AKBA 2GMUA 2BI5A 1B9HA 2BI9A 3JU7A 1AICA 3CBFA 1UU2A 1S08A 2JJGA 1CL1A 3PD6A 2W7GA 4ZLVA 2GMSA 3HBXA 4PFFA 1Y4IA 3FZ7A 3AEMC 1E5EA 1LC5A 2OKKA 4A6TA 3BC8A 3LG0A 1KKPA 4OTLA 4F5FA 1LW5A 2VGTA 4W5KA 2VIAA 3WX9A 1WKHA 3IF2A 4W1VA 1WSTA 1M6SA 1QGNA 2PO3A 1CQ6A 2WK9A 1CQ7A 1YJSA 1TATA 4XQ2A 4AH3A 1WYTA 2VI8A 3CAIA 4JEVA 4M2KA 4MQPA 1QZ9A 5EUEA 4BHDA 3QM2A 4F5KA 4LNMA 4WYEA 3GBXA 3A2BA 1AMAA 1DFOA 1TPLA 3A9YA 2OGEA 1SFFA 2Z1YA 1LW4A 3E2ZA 2HOZA 1V2FA 4IXOA 4GSAA 1ASGA 2VMQA 4IYOB 3N5MA 4WB0B 3G8MA 3BN1A 2VGWA 1VJOA 4W91A 2WK8A 1ECXA 2FNUA 4J5UA 3FVUA 4RJYA 1UU0A 4XJMA 4M2JA 3QBOA 3IHJA 1V2EA 3TQXA 4MKKA 2YKYA 2YHKA 1KKJA 2FM1A 2Z9XA 4ZDLA 2HUIA 3MC6C 3NTJA 1X0MA 1S0AA 2DKJA 2CINA 3ACZA 4ADBA 4UHNA 5HHYA 1PMOA 4WYGA 4F5GA 4ZDOA 4MQRA 4LNJA 1MAPA 3EUCA 3GSBA 3ISLA 2VYCA 3LWSA 3WY7A 1DJUA 4P7YA 1ZC9A 2W7DA 2W7JA 3BS8A 4XEWA 3TCMA 2VI9A 5D5SA 1UU1A 4AOAA 1B4XA 5FT5A 1TASA 2ZY2A 3B8XA 2D7ZA 1S07A 1GD9A 3BCXA 2WKAA 3ZRQA 3F9TA 3DU4A 3RUYA 1OATA 5C6UA 1H0CA 4GE7A 2VMRA 3FDBA 2HUFA 1AMRA 3QPGA 1IAYA 1ASAA 3NDNA 3WZFA 2QB3A 4Y0DA 1B5OA 5FT4A 2V1PA 1ELQA 3VP6A 2HZPA 2OGAA 4OBUA 4AO4A 3VK4A 5D95A 4U1TA 3QN6A 5EUNA 1AY4A 1GEXA 1YOOA 4NOGA 4KAMA 2DOUA 3GWPA 3UE8A 1AMQA 1M0QA 3BB8A 2EPJA 2W7MA 1RV4A 4RKDA 2HP2A 3P6KA 2VMVA 1YIZA 3PGYA 4OC9A 1BT4A 3A9XA 1FG7A 1CZCA 3ZZKA 2D64A 3MC6A 1S06A 3B1EA 4A00A 1ZOBA 3A9ZA 4Y0HA 1TOGA 2FYFA 3B1CA 2CY8A 2YKVA 3FTBA 3HT4A 5EFSA 1BW0A 3AENA 1QITA 1BQDA 4ZM4A 3FQ7A 2BI2A 2AY8A 3EI7A 1Z3ZA 4AZJA 3H14A 2VMPA 1TARA 3AOVA 4LNLA 2GQNA 3AEJC 2O7CA 1BS0A 5EAAA 2VMNA 1IX6A 2YKXA 4ATQA 3ATHA 2XBNA 4MSOA 1YJYA 2ORDA 4UHMA 3NYUA 4WD2A 4BA5A 3K40A 2NMPA 1MGVA 3NNKA 3F6TA 4W1XA 3FZ8A 1ORDA 2CJHA 3WGCA 2OQXA 3PDBA 4N0BA 3L8AA 2AY7A 2CB1A 2CJGA 5JAYA 3T32A 2VLHA 2ZJGA 1FG3A 3L44A 3PPLA 4WBTA 2D5YA 4XJOA 5FT6A 1BJOB 1DGDA 2CFBA 2BWPA 1AY5A 2VMSA 3COGA 2DGKA 1N8PA 3DRDA 3I5TA 2EO5A 4UOYA 4ATPA 2R5EA 3FFRA 3NYSA 2W7LA 1G4VA 1TOKA 3EI5A 4JE5A 3ZRRA 2ZC0A 1C9CA 4N0WA 2EGYA 2XH1A 1AHFA 4K2BA 2VIBA 2ZUKA 1JS6A 1RVUA 4ZWMA 1AMSA 3QI6A 1WYVB 1E5FA 1TOJA 2DKBA 1M4NA 3EI9A 3G0TA 1IX7A 2JISA 3HQTA 2OKJA 1W7MA 1I29A 1KL1A 2RFVA 3NU8A 4ISYA 4ZASA 2V0YA 3TFUA 4ZM3A 4F4EA 2ZY3A 1C7GA 5AX8A 3RI6A 2ZSMA 2Z9WA 3MKJA 3NRAA 4WYAA 3FQ8A 1CQ8A 1OHYA 1SVVA 2AATA 2JJFA 2VMWA 3FVSA 3MBBA 4OMAA 2ZY5A 4JE5D 2FQ6A 5G4JA 1O61A 4H51A 9AATA 2YCTA 1J04A 2VMUA 3QHXA 4RAEA 1AAWA 1AJSB 3HMUA 1I43A 1PG8A 1SZSA 3AOWA 2TPLA 3MAFA 1LC7A 5DJ1A 4WP0A 1ARIA 1D2FA 3E2YA 3R9AA 5F8VA 3B1DA 3II0A 1O4SA 3NX3A 1GDEA 3CQ6A 4Q6RA 4Q31A 1GBNA 4MGRA 4R5ZA 1MAQA 3DXWA 4A0HA 2O1BA 2YOBA 3BWNA 1FC4A 4QGRA 2C81A 2EZ2A 4RM1A 2Z67A 4BA4A 3MADA 1MDOA 4DQ6A 1C7NA 5G09A 4A6RA 2ZYJA 3KKIA 2CSTA 1IUGA 3ASAA 3DC1A 3Q8NA 1OHVA 3KGXA 5DJ9A 2O0RA 2FNIA 3AEMA 4J8LA 1GC4A 1VP4A 3WCOA 3EZSA 5M46A 1B8GA 5TF5A 5M49A 3DR7A 2AY1A 1QJ3A 1WKGA 4JEZA 4L0OA 2JGTA 3W1IA 4HF8A 4ADDA 5LHAA 1QIRA 1AKCA 1LC8A 3BV0A 3AATA 3DXVA 2X3LA 1DKAA 1OXOA 1CS1A 1GC2A 2AY2A 3AV7A 3WKSA 1DJEA 3H7FA 5IWQA 5G0AA 1GCKA 3LY1A 2Z9VA 2VMZA 3RBFA 5G2QA 1QJ5A 4E77A 5M4DA 2OATA 2PB2A 1DGEA 1AJRA 2D63A 3ECDA 3G7QA 3JZLA 2E54A 1TOIA 4IYOA 4WLHA 1ARHA 3M5UA 3TFTA 4WB0A 3E77A 2HOXA 5EIGB 2CTZA 2YCNA 4OCAA 3LVLB 1W7LA 3OP7A 2CH1A 5BJ4A 2E7UA 2QMAA 1ASMA 2W7EA 4R8DA 4RLGA 4Q75A 3WCNA 2VGUA 2W7HA 1AX4A 4DGTA 1C0NA 3JW9A 1D7RA 2R0TA 4AZKA 3TATA 3P1TA 4A0FA 1YNUA 4CBSA 3K28A 3GZDC 4Y0IA 4ZSWA 4RKCA 1EJIA 3BCAA 5EQCA 3W1JA 5I92A 1QISA 4GDYA 3K7YA 1CZEA 1EQBA 1G4XA 3PIUA 1S09A 2CANA 4JF1A 5E4ZA 3AEOA 1ASDA 2YKUA 4WYDA 4WXFA 1T3IA 4KXKA 1GC3A 3UAKA 4F5LA 8AATA 3RCHB 3USFA 4IY7A 3PDXA 2E7IA 2FN6A 2EH6A 2HP1A 2X8UA 3ASBA 3JTXA 2JJEA 4HVKA 3JWAA 3FD0A 3FCRA 1W7NA 2ZP7A 1LKCA 5K8BA 3QGUA 3OKSA 4LW4A 4EU1A 2VMXA 1B9IA 1KL2A 1MDXA 4RJ0A 2VGZA 3BWOA 1V2DA 3N75A 1AY8A 2R5CB 2W8WA 2WK7A 3EI8A 3FVXA 1AKAA 1SZUA 1WYTB 4JEWA 4M2MA 1YJZA 2BI1A 3HDOA 1AIAA 4A72A 4A0GA 1BJNA 3FFHA 3E2ZB 5M4BA 5HXXA 4IXSA 1CJ0A 4A0RA 4BMKA 1AAMA 3I4JA 3ZZJA 2Z61A 1M32A 4JEYA 1IVRA 4W1WA 3VAXA 2AY9A 4IXZA 1GC0A 1N31A 2AY3A 3FZ6A 1ARGA 4XJLA 2ZY4A 4FFCA 2X5FA 1XEYA 3BCBA 1ASCA 1BQAA 3B46A 3HVYA 3N0LA 4ZWVA 1IX8A 1C7OA 2DR1A 2VMTA 4K2MA 1ARTA 3NU7A 2VMYA 4ADCA 2AY4A 4MKJA 2BKWA 4WXBA 1AHGA 3GETA 4XAUA 3GZDA 1AHXA 5LH9A 2BIAA 1VEFA 3W1HA 1J32A 1IBJA 4FL0A 4GE4A 1M0NA 3AEJA 3E2FA 1PMMA 2AY6A 1U08A 1D7VA 4P3MA 4XK1A 5F9SA 2YCPA 5HDMA 3NUIA 1M7YA 1Z7DA 3RCHA 2HORA 1B5PA 1D7UA 3ELEA 4WYCA 3EIAA 2BWNA 4OYTA 4UQVA 1C4KA 3CQ5A 4GE9A 4BQ0A 2VMOA 4PIWA 1OHWA 1P3WA 3HLMA 4IX8A 1X29A 4F5MA 1KMKA 3GZCA 4JF0A 3JWBA 1BJOA 4R5FA 2R5CA 3PAAA 3GR9A 1G7WA 4ITGA 1V72A 1JS3A 1OXPA 3I16A 1LS3A 4UHOA 3RQ1A 3PA9A 4CXRA 2C0RA 1XI9A 2ZSLA 4K2IA 4TV7A 5FT8A 1AIBA 1JF9A 3ZRPA 7AATA 2VGVA 1W23A 1N2TA 4WYFA 2BI3A 2D7YA 2G6WA 1WYVA 2YRIA 4RITA 2W7IA 4ZAHA 4TN4A 2AEUA 4EMYA 2Z20A 2YRRA 1O62A 3LV2A 3EZ1A 2HOYA 3E9KA 1X28A 4DBCA 1MDZA 3DZZA 1BJWA 3AELA 2QB2A 2W8VA 1I41A 4WXGA 5DX5A 1AHEA 2AEVA 4LC3A 4EFFA 1M0PA 4I8AA 1WYUB 2BHXA 1DTYA 2DGMA 2JG2A 1ASEA 5J8QA 1YIYA 3AENB 4A6UA 1ASNA 1BKGA 2C44A 1AJSA 3FKDA 4R2NA 5EUDA 2W8TA 3MAUA 3R4TA 1M0OA 2Q7WA 4RIZA 2BIGA 4U2HA 4XJPA 2Z1ZA 1H1CA 3UWCA 4GEBA 2CH2A 1PFFA 1ASFA 1MLZA 2BWOA 3FRKA 3KE3A 4JEXA 3MEBA 3GJUA 2QBTA 3EIBA 3DYDA 2DGLA 1W3UA 1EG5A 3NUBA 1GEYA 3PDBB 2QLRA 2W8JA 1GEWA 1ASBA 2W7KA 2Z9UA 3WLXA 4CVQA 3F0HA 2E7JA 2R2NA 1IJIA 2VLFA 5BJ3A 4O6ZA 4OT8A 3DODA 4E1OA 2EZ1A 1BJ4A 4LW2A 5DB5A 2C7TA 2D66A 2HUUA 4ITXA 1UKJA 2W8UA 3RBLA 4TMRA 3PJ0A 3CQ4A 1TOEA 4AO9A 1ASLA 1DJ9A 2BYJA 2PB0A 4CBRA 1AHYA 3PD6B 3DR4A 4F5IA 5EAVA 1YAAA 2BYLA 1SF2A 2VGSA 3ELPA 4WLJA 2QA3A 1KMJA 4PFNA 3KGWA 4OBVA 5G4IA 2GB3A 4KYOA 3D6KA 3VOMA 4IW7A 1WYUA 4PVFA 3HL2A 1ARSA 4MQQA 5E5IA 3LVKA 4ADEA 3WGBA 2W7FA 4GRXA 1ZODA 5G2PA 3FDDA 1G7XA 1I48A 3EI6A 3FSLA 3VK2A 4F5JA 2F8JA 3NYTA 1RVYA 3E6GA 1SPAA 4B98A 2D61A 2CJDA 4MY5A 1D7SA 1LK9A 1ELUA 5EIGA 4EB5A 2GSAA 3LVMA 4Q76A 1O69A 5E3KA 3WKRA 4E3RA 4EB7A 2BIEA 3MAFB 4E3QA 1MLYA 4F5HA 3LVJA
chains in the Genus database with same CATH superfamily
1X2AA 2X5DA 4CXQA 4W8IA 4ZSYA 3A8UX 1IAXA 3VK3A 2JJHA 2D65A 2AY5A 4ZDPA 1CL2A 3FQAA 3AEPA 1SZKA 1JG8A 3BWNC 1RV3A 4B9BA 1AKBA 2GMUA 2BI5A 1B9HA 2BI9A 3JU7A 1AICA 3CBFA 1UU2A 1S08A 2JJGA 1CL1A 3PD6A 2W7GA 4ZLVA 2GMSA 3HBXA 4PFFA 1Y4IA 3FZ7A 3AEMC 1E5EA 1LC5A 2OKKA 4A6TA 3BC8A 3LG0A 1KKPA 4OTLA 4F5FA 1LW5A 2VGTA 4W5KA 2VIAA 3WX9A 1WKHA 3IF2A 4W1VA 1WSTA 1M6SA 1QGNA 2PO3A 1CQ6A 2WK9A 1CQ7A 1YJSA 1TATA 4XQ2A 4AH3A 1WYTA 2VI8A 3CAIA 4JEVA 4M2KA 4MQPA 4K05A 1QZ9A 5EUEA 4BHDA 3QM2A 4F5KA 4LNMA 4WYEA 3GBXA 3A2BA 1AMAA 1DFOA 1TPLA 3A9YA 2OGEA 1SFFA 2Z1YA 1LW4A 3E2ZA 2HOZA 1V2FA 4IXOA 4GSAA 1ASGA 2VMQA 4IYOB 3N5MA 4WB0B 3G8MA 3BN1A 2VGWA 1VJOA 4W91A 2WK8A 1ECXA 2FNUA 4J5UA 3FVUA 4RJYA 1UU0A 4XJMA 4M2JA 3QBOA 3IHJA 1V2EA 3TQXA 4MKKA 2YKYA 2YHKA 1KKJA 2QSRA 2FM1A 2Z9XA 4ZDLA 2HUIA 3MC6C 3NTJA 1X0MA 1S0AA 2DKJA 2CINA 3ACZA 4ADBA 4UHNA 5HHYA 1PMOA 4WYGA 4F5GA 4ZDOA 4MQRA 4LNJA 1MAPA 3EUCA 3GSBA 3ISLA 2VYCA 3LWSA 3WY7A 1DJUA 4P7YA 1ZC9A 2W7DA 2W7JA 3BS8A 4XEWA 3TCMA 2VI9A 5D5SA 1UU1A 4AOAA 1B4XA 5FT5A 1TASA 2ZY2A 3B8XA 2D7ZA 1S07A 1GD9A 3BCXA 2WKAA 3ZRQA 3F9TA 3DU4A 3RUYA 1OATA 5C6UA 1H0CA 4GE7A 2VMRA 3FDBA 2HUFA 1AMRA 3QPGA 1IAYA 1ASAA 3NDNA 3WZFA 2QB3A 4Y0DA 1B5OA 5FT4A 2V1PA 1ELQA 3VP6A 2HZPA 2OGAA 4OBUA 4AO4A 3VK4A 5D95A 4U1TA 3H9XA 3QN6A 5EUNA 1AY4A 1GEXA 1YOOA 4NOGA 4KAMA 2DOUA 3GWPA 3UE8A 1AMQA 1M0QA 3BB8A 2EPJA 2W7MA 1RV4A 4RKDA 2HP2A 3P6KA 2VMVA 1YIZA 3PGYA 4OC9A 1BT4A 3A9XA 1FG7A 1CZCA 3ZZKA 2D64A 3MC6A 1S06A 3B1EA 4A00A 1ZOBA 3A9ZA 4Y0HA 1TOGA 2FYFA 3B1CA 2CY8A 2YKVA 3FTBA 3HT4A 5EFSA 1BW0A 3AENA 1QITA 1BQDA 4ZM4A 3FQ7A 2BI2A 2AY8A 3EI7A 1Z3ZA 4AZJA 3H14A 2VMPA 1TARA 3AOVA 4LNLA 2GQNA 3AEJC 2O7CA 1BS0A 5EAAA 2VMNA 1IX6A 2YKXA 4ATQA 3ATHA 2XBNA 4MSOA 1YJYA 2ORDA 4UHMA 3NYUA 4WD2A 4BA5A 3K40A 2NMPA 1MGVA 3NNKA 3F6TA 4W1XA 3FZ8A 1ORDA 2CJHA 3WGCA 2OQXA 3PDBA 4N0BA 3L8AA 2AY7A 2CB1A 2CJGA 5JAYA 3T32A 2VLHA 2ZJGA 1FG3A 3L44A 3N7NA 3PPLA 4WBTA 2D5YA 4XJOA 5FT6A 1BJOB 1DGDA 2CFBA 2BWPA 1AY5A 2VMSA 3COGA 2DGKA 1N8PA 3DRDA 3I5TA 2EO5A 4UOYA 4ATPA 2R5EA 3FFRA 3NYSA 2W7LA 1G4VA 1TOKA 3EI5A 4JE5A 3ZRRA 2ZC0A 1C9CA 4N0WA 2EGYA 2XH1A 1AHFA 4K2BA 2VIBA 2ZUKA 1JS6A 1RVUA 4ZWMA 1AMSA 3QI6A 1WYVB 1E5FA 1TOJA 2DKBA 1M4NA 3EI9A 3G0TA 1IX7A 2JISA 3HQTA 2OKJA 1W7MA 1I29A 1KL1A 2RFVA 3NU8A 4ISYA 4ZASA 2V0YA 3TFUA 4ZM3A 4F4EA 2ZY3A 1C7GA 5AX8A 3RI6A 2ZSMA 2Z9WA 3MKJA 3NRAA 4WYAA 3FQ8A 1CQ8A 1OHYA 1SVVA 2AATA 2JJFA 2VMWA 3FVSA 3MBBA 4OMAA 2ZY5A 4JE5D 2FQ6A 5G4JA 1O61A 4H51A 9AATA 2YCTA 1J04A 2VMUA 3QHXA 4RAEA 1AAWA 1AJSB 3HMUA 1I43A 1PG8A 1SZSA 3AOWA 2TPLA 3MAFA 1LC7A 5DJ1A 4WP0A 1ARIA 1D2FA 3E2YA 3R9AA 5F8VA 3B1DA 3II0A 1O4SA 3NX3A 1GDEA 3CQ6A 4Q6RA 4Q31A 1GBNA 4MGRA 4R5ZA 1MAQA 3DXWA 4A0HA 2O1BA 2YOBA 3BWNA 1FC4A 4QGRA 2C81A 2EZ2A 4RM1A 2FKIA 2Z67A 4BA4A 3MADA 1MDOA 4DQ6A 1C7NA 5G09A 2A1VA 4A6RA 2ZYJA 3KKIA 2CSTA 1IUGA 3ASAA 3DC1A 3Q8NA 1OHVA 3KGXA 5DJ9A 2O0RA 2FNIA 3AEMA 4J8LA 1GC4A 1VP4A 3WCOA 3EZSA 5M46A 1B8GA 5TF5A 5M49A 3DR7A 2AY1A 1QJ3A 1WKGA 4JEZA 4L0OA 2JGTA 3W1IA 4HF8A 4ADDA 5LHAA 1QIRA 1AKCA 1LC8A 3BV0A 3AATA 3DXVA 2X3LA 1DKAA 1OXOA 1CS1A 1GC2A 2AY2A 3AV7A 3WKSA 1DJEA 3H7FA 5IWQA 5G0AA 1GCKA 3LY1A 2Z9VA 2VMZA 3RBFA 5G2QA 1QJ5A 4E77A 5M4DA 2OATA 2PB2A 1DGEA 1AJRA 2D63A 3ECDA 3G7QA 3JZLA 2E54A 1TOIA 4IYOA 4WLHA 1ARHA 3M5UA 3TFTA 4WB0A 4H63Q 3E77A 2HOXA 5EIGB 2CTZA 2YCNA 4OCAA 3LVLB 1W7LA 3OP7A 2CH1A 5BJ4A 2E7UA 2QMAA 1ASMA 2W7EA 4R8DA 4RLGA 4Q75A 3WCNA 2VGUA 2W7HA 1AX4A 4DGTA 2EYQA 1C0NA 3JW9A 1D7RA 2R0TA 4AZKA 3TATA 3P1TA 4A0FA 1YNUA 4CBSA 3K28A 3GZDC 4Y0IA 4ZSWA 4RKCA 1EJIA 3BCAA 5EQCA 3W1JA 5I92A 1QISA 4GDYA 3K7YA 1CZEA 1EQBA 1G4XA 3PIUA 1S09A 2CANA 4JF1A 5E4ZA 3AEOA 1ASDA 2YKUA 4WYDA 4WXFA 1T3IA 4KXKA 1GC3A 3UAKA 4F5LA 8AATA 3RCHB 3USFA 4IY7A 1KAFA 3PDXA 2E7IA 2FN6A 2EH6A 2HP1A 2X8UA 3ASBA 3JTXA 2JJEA 4HVKA 3JWAA 3FD0A 3FCRA 1W7NA 2ZP7A 1LKCA 5K8BA 3QGUA 3OKSA 4LW4A 4EU1A 2VMXA 1B9IA 1KL2A 1MDXA 4RJ0A 2VGZA 3BWOA 1V2DA 3N75A 1AY8A 2R5CB 2W8WA 2WK7A 3EI8A 3FVXA 1AKAA 1SZUA 1WYTB 4JEWA 4M2MA 1YJZA 2BI1A 3HDOA 5KTBA 1AIAA 4A72A 4A0GA 1BJNA 3FFHA 3E2ZB 5M4BA 5HXXA 4IXSA 1CJ0A 4A0RA 4BMKA 1AAMA 3I4JA 3ZZJA 2Z61A 1M32A 4JEYA 1IVRA 4W1WA 3VAXA 2AY9A 3N4XA 4IXZA 1GC0A 1N31A 2AY3A 3FZ6A 1ARGA 4XJLA 2WB6A 2ZY4A 4FFCA 2X5FA 1XEYA 3BCBA 1ASCA 1BQAA 3B46A 3HVYA 3N0LA 4ZWVA 1IX8A 1C7OA 2DR1A 2VMTA 4K2MA 1ARTA 3NU7A 2VMYA 4ADCA 2AY4A 4MKJA 2BKWA 4WXBA 1AHGA 3GETA 4XAUA 3GZDA 1AHXA 5LH9A 2BIAA 1VEFA 3W1HA 1J32A 1IBJA 4FL0A 4GE4A 1M0NA 3AEJA 3E2FA 1PMMA 2AY6A 3N4RA 1U08A 1D7VA 4P3MA 4XK1A 5F9SA 2YCPA 5HDMA 3NUIA 1M7YA 1Z7DA 3RCHA 2HORA 1B5PA 1D7UA 3ELEA 4WYCA 3EIAA 2BWNA 4OYTA 4UQVA 1C4KA 3CQ5A 4GE9A 4BQ0A 2VMOA 4PIWA 1OHWA 1P3WA 3HLMA 4IX8A 1X29A 4F5MA 1KMKA 3GZCA 4JF0A 3JWBA 1BJOA 4R5FA 2R5CA 3PAAA 3GR9A 1G7WA 4ITGA 1V72A 1JS3A 1OXPA 3I16A 1LS3A 4UHOA 3RQ1A 2G7JA 3PA9A 4CXRA 2C0RA 1XI9A 2ZSLA 4K2IA 4TV7A 5FT8A 1AIBA 1JF9A 3ZRPA 7AATA 2VGVA 2KFPA 1W23A 1N2TA 4WYFA 2BI3A 2D7YA 2G6WA 1WYVA 2YRIA 4RITA 2W7IA 4ZAHA 4TN4A 2AEUA 4EMYA 2Z20A 2YRRA 1O62A 3LV2A 3EZ1A 2HOYA 3E9KA 1X28A 4DBCA 1MDZA 3DZZA 1BJWA 3AELA 2QB2A 2W8VA 1I41A 4WXGA 5DX5A 1AHEA 2AEVA 4LC3A 4EFFA 1M0PA 4I8AA 1WYUB 2BHXA 1DTYA 2DGMA 2JG2A 1ASEA 5J8QA 1YIYA 3AENB 4A6UA 1ASNA 1BKGA 2C44A 1AJSA 3FKDA 4R2NA 5EUDA 2W8TA 3MAUA 3R4TA 1M0OA 2Q7WA 4RIZA 2BIGA 4U2HA 4XJPA 2Z1ZA 1H1CA 3UWCA 4GEBA 2CH2A 1PFFA 1ASFA 1MLZA 2BWOA 3FRKA 3KE3A 4JEXA 3MEBA 3GJUA 2QBTA 3EIBA 3DYDA 2DGLA 1W3UA 1EG5A 3NUBA 1GEYA 3PDBB 2QLRA 2W8JA 1GEWA 1ASBA 2W7KA 2Z9UA 3WLXA 4CVQA 3F0HA 2E7JA 2R2NA 1IJIA 2VLFA 5BJ3A 4O6ZA 4OT8A 3DODA 4E1OA 2EZ1A 1BJ4A 4LW2A 5DB5A 2C7TA 2D66A 2HUUA 4ITXA 1UKJA 2W8UA 3RBLA 4TMRA 3PJ0A 3CQ4A 1TOEA 4AO9A 1ASLA 1DJ9A 2BYJA 2PB0A 4CBRA 1AHYA 3PD6B 3DR4A 4F5IA 5EAVA 1YAAA 2BYLA 1SF2A 2VGSA 3ELPA 4WLJA 2QA3A 1KMJA 4PFNA 3KGWA 4OBVA 5G4IA 2GB3A 4KYOA 3D6KA 3VOMA 4IW7A 1WYUA 4PVFA 3HL2A 1ARSA 4MQQA 5E5IA 3LVKA 4ADEA 3WGBA 2W7FA 4GRXA 1ZODA 5G2PA 3FDDA 1G7XA 1I48A 3EI6A 3FSLA 3VK2A 4F5JA 2F8JA 3NYTA 1RVYA 3E6GA 1SPAA 4B98A 3N4SA 2D61A 2CJDA 4MY5A 1D7SA 1LK9A 1ELUA 5EIGA 4EB5A 2GSAA 3LVMA 4Q76A 1O69A 5E3KA 3WKRA 4E3RA 4EB7A 2BIEA 3MAFB 4E3QA 1MLYA 4F5HA 3LVJA
chains in the Genus database with same CATH topology
1X2AA 2X5DA 4CXQA 4W8IA 4ZSYA 3A8UX 1IAXA 3VK3A 2JJHA 2D65A 2AY5A 4ZDPA 1CL2A 3FQAA 3AEPA 1SZKA 1JG8A 3BWNC 1RV3A 4B9BA 1AKBA 2GMUA 2BI5A 1B9HA 2BI9A 3JU7A 1AICA 3CBFA 1UU2A 1S08A 2JJGA 1CL1A 3PD6A 2W7GA 4ZLVA 2GMSA 3HBXA 4PFFA 1Y4IA 3FZ7A 3AEMC 1E5EA 1LC5A 2OKKA 4A6TA 3BC8A 3LG0A 1KKPA 4OTLA 4F5FA 1LW5A 2VGTA 4W5KA 2VIAA 3WX9A 1WKHA 3IF2A 4W1VA 1WSTA 1M6SA 1QGNA 2PO3A 1CQ6A 2WK9A 1CQ7A 1YJSA 1TATA 4XQ2A 4AH3A 1WYTA 2VI8A 3CAIA 4JEVA 4M2KA 4MQPA 4K05A 1QZ9A 5EUEA 4BHDA 3QM2A 4F5KA 4LNMA 4WYEA 3GBXA 3A2BA 1AMAA 1DFOA 1TPLA 3A9YA 2OGEA 1SFFA 2Z1YA 1LW4A 3E2ZA 2HOZA 1V2FA 4IXOA 4GSAA 1ASGA 2VMQA 4IYOB 3N5MA 4WB0B 3G8MA 3BN1A 2VGWA 1VJOA 4W91A 2WK8A 1ECXA 2FNUA 4J5UA 3FVUA 4RJYA 1UU0A 4XJMA 4M2JA 3QBOA 3IHJA 1V2EA 3TQXA 4MKKA 2YKYA 2YHKA 1KKJA 2QSRA 2FM1A 2Z9XA 4ZDLA 2HUIA 3MC6C 3NTJA 1X0MA 1S0AA 2DKJA 2CINA 3ACZA 4ADBA 4UHNA 5HHYA 1PMOA 4WYGA 4F5GA 4ZDOA 4MQRA 4LNJA 1MAPA 3EUCA 3GSBA 3ISLA 2VYCA 3LWSA 3WY7A 1DJUA 4P7YA 1ZC9A 2W7DA 2W7JA 3BS8A 4XEWA 3TCMA 2VI9A 5D5SA 1UU1A 4AOAA 1B4XA 5FT5A 1TASA 2ZY2A 3B8XA 2D7ZA 1S07A 1GD9A 3BCXA 2WKAA 3ZRQA 3F9TA 3DU4A 3RUYA 1OATA 5C6UA 1H0CA 4GE7A 2VMRA 3FDBA 2HUFA 1AMRA 3QPGA 1IAYA 1ASAA 3NDNA 3WZFA 2QB3A 4Y0DA 1B5OA 5FT4A 2V1PA 1ELQA 3VP6A 2HZPA 2OGAA 4OBUA 4AO4A 3VK4A 5D95A 4U1TA 3H9XA 3QN6A 5EUNA 1AY4A 1GEXA 1YOOA 4NOGA 4KAMA 2DOUA 3GWPA 3UE8A 1AMQA 1M0QA 3BB8A 2EPJA 2W7MA 1RV4A 4RKDA 2HP2A 3P6KA 2VMVA 1YIZA 3PGYA 4OC9A 1BT4A 3A9XA 1FG7A 1CZCA 3ZZKA 2D64A 3MC6A 1S06A 3B1EA 4A00A 1ZOBA 3A9ZA 4Y0HA 1TOGA 2FYFA 3B1CA 2CY8A 2YKVA 3FTBA 3HT4A 5EFSA 1BW0A 3AENA 1QITA 1BQDA 4ZM4A 3FQ7A 2BI2A 2AY8A 3EI7A 1Z3ZA 4AZJA 3H14A 2VMPA 1TARA 3AOVA 4LNLA 2GQNA 3AEJC 2O7CA 1BS0A 5EAAA 2VMNA 1IX6A 2YKXA 4ATQA 3ATHA 2XBNA 4MSOA 1YJYA 2ORDA 4UHMA 3NYUA 4WD2A 4BA5A 3K40A 2NMPA 1MGVA 3NNKA 3F6TA 4W1XA 3FZ8A 1ORDA 2CJHA 3WGCA 2OQXA 3PDBA 4N0BA 3L8AA 2AY7A 2CB1A 2CJGA 5JAYA 3T32A 2VLHA 2ZJGA 1FG3A 3L44A 3N7NA 3PPLA 4WBTA 2D5YA 4XJOA 5FT6A 1BJOB 1DGDA 2CFBA 2BWPA 1AY5A 2VMSA 3COGA 2DGKA 1N8PA 3DRDA 3I5TA 2EO5A 4UOYA 4ATPA 2R5EA 3FFRA 3NYSA 2W7LA 1G4VA 1TOKA 3EI5A 4JE5A 3ZRRA 2ZC0A 1C9CA 4N0WA 2EGYA 2XH1A 1AHFA 4K2BA 2VIBA 2ZUKA 1JS6A 1RVUA 4ZWMA 1AMSA 3QI6A 1WYVB 1E5FA 1TOJA 2DKBA 1M4NA 3EI9A 3G0TA 1IX7A 2JISA 3HQTA 2OKJA 1W7MA 1I29A 1KL1A 2RFVA 3NU8A 4ISYA 4ZASA 2V0YA 3TFUA 4ZM3A 4F4EA 2ZY3A 1C7GA 5AX8A 3RI6A 2ZSMA 2Z9WA 3MKJA 3NRAA 4WYAA 3FQ8A 1CQ8A 1OHYA 1SVVA 2AATA 2JJFA 2VMWA 3FVSA 3MBBA 4OMAA 2ZY5A 4JE5D 2FQ6A 5G4JA 1O61A 4H51A 9AATA 2YCTA 1J04A 2VMUA 3QHXA 4RAEA 1AAWA 1AJSB 3HMUA 1I43A 1PG8A 1SZSA 3AOWA 2TPLA 3MAFA 1LC7A 5DJ1A 4WP0A 1ARIA 1D2FA 3E2YA 3R9AA 5F8VA 3B1DA 3II0A 1O4SA 3NX3A 1GDEA 3CQ6A 4Q6RA 4Q31A 1GBNA 4MGRA 4R5ZA 1MAQA 3DXWA 4A0HA 2O1BA 2YOBA 3BWNA 1FC4A 4QGRA 2C81A 2EZ2A 4RM1A 2FKIA 2Z67A 4BA4A 3MADA 1MDOA 4DQ6A 1C7NA 5G09A 2A1VA 4A6RA 2ZYJA 3KKIA 2CSTA 1IUGA 3ASAA 3DC1A 3Q8NA 1OHVA 3KGXA 5DJ9A 2O0RA 2FNIA 3AEMA 4J8LA 1GC4A 1VP4A 3WCOA 3EZSA 5M46A 1B8GA 5TF5A 5M49A 3DR7A 2AY1A 1QJ3A 1WKGA 4JEZA 4L0OA 2JGTA 3W1IA 4HF8A 4ADDA 5LHAA 1QIRA 1AKCA 1LC8A 3BV0A 3AATA 3DXVA 2X3LA 1DKAA 1OXOA 1CS1A 1GC2A 2AY2A 3AV7A 3WKSA 1DJEA 3H7FA 5IWQA 5G0AA 1GCKA 3LY1A 2Z9VA 2VMZA 3RBFA 5G2QA 1QJ5A 4E77A 5M4DA 2OATA 2PB2A 1DGEA 1AJRA 2D63A 3ECDA 3G7QA 3JZLA 2E54A 1TOIA 4IYOA 4WLHA 1ARHA 3M5UA 3TFTA 4WB0A 4H63Q 3E77A 2HOXA 5EIGB 2CTZA 2YCNA 4OCAA 3LVLB 1W7LA 3OP7A 2CH1A 5BJ4A 2E7UA 2QMAA 1ASMA 2W7EA 4R8DA 4RLGA 4Q75A 3WCNA 2VGUA 2W7HA 1AX4A 4DGTA 2EYQA 1C0NA 3JW9A 1D7RA 2R0TA 4AZKA 3TATA 3P1TA 4A0FA 1YNUA 4CBSA 3K28A 3GZDC 4Y0IA 4ZSWA 4RKCA 1EJIA 3BCAA 5EQCA 3W1JA 5I92A 1QISA 4GDYA 3K7YA 1CZEA 1EQBA 1G4XA 3PIUA 1S09A 2CANA 4JF1A 5E4ZA 3AEOA 1ASDA 2YKUA 4WYDA 4WXFA 1T3IA 4KXKA 1GC3A 3UAKA 4F5LA 8AATA 3RCHB 3USFA 4IY7A 3PDXA 2E7IA 2FN6A 2EH6A 2HP1A 2X8UA 3ASBA 3JTXA 2JJEA 4HVKA 3JWAA 3FD0A 3FCRA 1W7NA 2ZP7A 1LKCA 5K8BA 3QGUA 3OKSA 4LW4A 4EU1A 2VMXA 1B9IA 1KL2A 1MDXA 4RJ0A 2VGZA 3BWOA 1V2DA 3N75A 1AY8A 2R5CB 2W8WA 2WK7A 3EI8A 3FVXA 1AKAA 1SZUA 1WYTB 4JEWA 4M2MA 1YJZA 2BI1A 3HDOA 5KTBA 1AIAA 4A72A 4A0GA 1BJNA 3FFHA 3E2ZB 5M4BA 5HXXA 4IXSA 1CJ0A 4A0RA 4BMKA 1AAMA 3I4JA 3ZZJA 2Z61A 1M32A 4JEYA 1IVRA 4W1WA 3VAXA 2AY9A 3N4XA 4IXZA 1GC0A 1N31A 2AY3A 3FZ6A 1ARGA 4XJLA 2WB6A 2ZY4A 4FFCA 2X5FA 1XEYA 3BCBA 1ASCA 1BQAA 3B46A 3HVYA 3N0LA 4ZWVA 1IX8A 1C7OA 2DR1A 2VMTA 4K2MA 1ARTA 3NU7A 2VMYA 4ADCA 2AY4A 4MKJA 2BKWA 4WXBA 1AHGA 3GETA 4XAUA 3GZDA 1AHXA 5LH9A 2BIAA 1VEFA 3W1HA 1J32A 1IBJA 4FL0A 4GE4A 1M0NA 3AEJA 3E2FA 1PMMA 2AY6A 3N4RA 1U08A 1D7VA 4P3MA 4XK1A 5F9SA 2YCPA 5HDMA 3NUIA 1M7YA 1Z7DA 3RCHA 2HORA 1B5PA 1D7UA 3ELEA 4WYCA 3EIAA 2BWNA 4OYTA 4UQVA 1C4KA 3CQ5A 4GE9A 4BQ0A 2VMOA 4PIWA 1OHWA 1P3WA 3HLMA 4IX8A 1X29A 4F5MA 1KMKA 3GZCA 4JF0A 3JWBA 1BJOA 4R5FA 2R5CA 3PAAA 3GR9A 1G7WA 4ITGA 1V72A 1JS3A 1OXPA 3I16A 1LS3A 4UHOA 3RQ1A 2G7JA 3PA9A 4CXRA 2C0RA 1XI9A 2ZSLA 4K2IA 4TV7A 5FT8A 1AIBA 1JF9A 3ZRPA 7AATA 2VGVA 2KFPA 1W23A 1N2TA 4WYFA 2BI3A 2D7YA 2G6WA 1WYVA 2YRIA 4RITA 2W7IA 4ZAHA 4TN4A 2AEUA 4EMYA 2Z20A 2YRRA 1O62A 3LV2A 3EZ1A 2HOYA 3E9KA 1X28A 4DBCA 1MDZA 3DZZA 1BJWA 3AELA 2QB2A 2W8VA 1I41A 4WXGA 5DX5A 1AHEA 2AEVA 4LC3A 4EFFA 1M0PA 4I8AA 1WYUB 2BHXA 1DTYA 2DGMA 2JG2A 1ASEA 5J8QA 1YIYA 3AENB 4A6UA 1ASNA 1BKGA 2C44A 1AJSA 3FKDA 4R2NA 5EUDA 2W8TA 3MAUA 3R4TA 1M0OA 2Q7WA 4RIZA 2BIGA 4U2HA 4XJPA 2Z1ZA 1H1CA 3UWCA 4GEBA 2CH2A 1PFFA 1ASFA 1MLZA 2BWOA 3FRKA 3KE3A 4JEXA 3MEBA 3GJUA 2QBTA 3EIBA 3DYDA 2DGLA 1W3UA 1EG5A 3NUBA 1GEYA 3PDBB 2QLRA 2W8JA 1GEWA 1ASBA 2W7KA 2Z9UA 3WLXA 4CVQA 3F0HA 2E7JA 2R2NA 1IJIA 2VLFA 5BJ3A 4O6ZA 4OT8A 3DODA 4E1OA 2EZ1A 1BJ4A 4LW2A 5DB5A 2C7TA 2D66A 2HUUA 4ITXA 1UKJA 2W8UA 3RBLA 4TMRA 3PJ0A 3CQ4A 1TOEA 4AO9A 1ASLA 1DJ9A 2BYJA 2PB0A 4CBRA 1AHYA 3PD6B 3DR4A 4F5IA 5EAVA 1YAAA 2BYLA 1SF2A 2VGSA 3ELPA 4WLJA 2QA3A 1KMJA 4PFNA 3KGWA 4OBVA 5G4IA 2GB3A 4KYOA 3D6KA 3VOMA 4IW7A 1WYUA 4PVFA 3HL2A 1ARSA 4MQQA 5E5IA 3LVKA 4ADEA 3WGBA 2W7FA 4GRXA 1ZODA 5G2PA 3FDDA 1G7XA 1I48A 3EI6A 3FSLA 3VK2A 4F5JA 2F8JA 3NYTA 1RVYA 3E6GA 1SPAA 4B98A 3N4SA 2D61A 2CJDA 4MY5A 1D7SA 1LK9A 1ELUA 5EIGA 4EB5A 2GSAA 3LVMA 4Q76A 1O69A 5E3KA 3WKRA 4E3RA 4EB7A 2BIEA 3MAFB 4E3QA 1MLYA 4F5HA 3LVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2A A;  2X5D A;  4CXQ A;  4W8I A;  4ZSY A;  3A8U X;  1IAX A;  3VK3 A;  2JJH A;  2D65 A;  2AY5 A;  4ZDP A;  1CL2 A;  3FQA A;  3AEP A;  1SZK A;  1JG8 A;  3BWN C;  1RV3 A;  4B9B A;  1AKB A;  2GMU A;  2BI5 A;  1B9H A;  2BI9 A;  3JU7 A;  1AIC A;  3CBF A;  1UU2 A;  1S08 A;  2JJG A;  1CL1 A;  3PD6 A;  2W7G A;  4ZLV A;  2GMS A;  3HBX A;  4PFF A;  1Y4I A;  3FZ7 A;  3AEM C;  1E5E A;  1LC5 A;  2OKK A;  4A6T A;  3BC8 A;  3LG0 A;  1KKP A;  4OTL A;  4F5F A;  1LW5 A;  2VGT A;  4W5K A;  2VIA A;  3WX9 A;  1WKH A;  3IF2 A;  4W1V A;  1WST A;  1M6S A;  1QGN A;  2PO3 A;  1CQ6 A;  2WK9 A;  1CQ7 A;  1YJS A;  1TAT A;  4XQ2 A;  4AH3 A;  1WYT A;  2VI8 A;  3CAI A;  4JEV A;  4M2K A;  4MQP A;  1QZ9 A;  5EUE A;  4BHD A;  3QM2 A;  4F5K A;  4LNM A;  4WYE A;  3GBX A;  3A2B A;  1AMA A;  1DFO A;  1TPL A;  3A9Y A;  2OGE A;  1SFF A;  2Z1Y A;  1LW4 A;  3E2Z A;  2HOZ A;  1V2F A;  4IXO A;  4GSA A;  1ASG A;  2VMQ A;  4IYO B;  3N5M A;  4WB0 B;  3G8M A;  3BN1 A;  2VGW A;  1VJO A;  4W91 A;  2WK8 A;  1ECX A;  2FNU A;  4J5U A;  3FVU A;  4RJY A;  1UU0 A;  4XJM A;  4M2J A;  3QBO A;  3IHJ A;  1V2E A;  3TQX A;  4MKK A;  2YKY A;  2YHK A;  1KKJ A;  2FM1 A;  2Z9X A;  4ZDL A;  2HUI A;  3MC6 C;  3NTJ A;  1X0M A;  1S0A A;  2DKJ A;  2CIN A;  3ACZ A;  4ADB A;  4UHN A;  5HHY A;  1PMO A;  4WYG A;  4F5G A;  4ZDO A;  4MQR A;  4LNJ A;  1MAP A;  3EUC A;  3GSB A;  3ISL A;  2VYC A;  3LWS A;  3WY7 A;  1DJU A;  4P7Y A;  1ZC9 A;  2W7D A;  2W7J A;  3BS8 A;  4XEW A;  3TCM A;  2VI9 A;  5D5S A;  1UU1 A;  4AOA A;  1B4X A;  5FT5 A;  1TAS A;  2ZY2 A;  3B8X A;  2D7Z A;  1S07 A;  1GD9 A;  3BCX A;  2WKA A;  3ZRQ A;  3F9T A;  3DU4 A;  3RUY A;  1OAT A;  5C6U A;  1H0C A;  4GE7 A;  2VMR A;  3FDB A;  2HUF A;  1AMR A;  3QPG A;  1IAY A;  1ASA A;  3NDN A;  3WZF A;  2QB3 A;  4Y0D A;  1B5O A;  5FT4 A;  2V1P A;  1ELQ A;  3VP6 A;  2HZP A;  2OGA A;  4OBU A;  4AO4 A;  3VK4 A;  5D95 A;  4U1T A;  3QN6 A;  5EUN A;  1AY4 A;  1GEX A;  1YOO A;  4NOG A;  4KAM A;  2DOU A;  3GWP A;  3UE8 A;  1AMQ A;  1M0Q A;  3BB8 A;  2EPJ A;  2W7M A;  1RV4 A;  4RKD A;  2HP2 A;  3P6K A;  2VMV A;  1YIZ A;  3PGY A;  4OC9 A;  1BT4 A;  3A9X A;  1FG7 A;  1CZC A;  3ZZK A;  2D64 A;  3MC6 A;  1S06 A;  3B1E A;  4A00 A;  1ZOB A;  3A9Z A;  4Y0H A;  1TOG A;  2FYF A;  3B1C A;  2CY8 A;  2YKV A;  3FTB A;  3HT4 A;  5EFS A;  1BW0 A;  3AEN A;  1QIT A;  1BQD A;  4ZM4 A;  3FQ7 A;  2BI2 A;  2AY8 A;  3EI7 A;  1Z3Z A;  4AZJ A;  3H14 A;  2VMP A;  1TAR A;  3AOV A;  4LNL A;  2GQN A;  3AEJ C;  2O7C A;  1BS0 A;  5EAA A;  2VMN A;  1IX6 A;  2YKX A;  4ATQ A;  3ATH A;  2XBN A;  4MSO A;  1YJY A;  2ORD A;  4UHM A;  3NYU A;  4WD2 A;  4BA5 A;  3K40 A;  2NMP A;  1MGV A;  3NNK A;  3F6T A;  4W1X A;  3FZ8 A;  1ORD A;  2CJH A;  3WGC A;  2OQX A;  3PDB A;  4N0B A;  3L8A A;  2AY7 A;  2CB1 A;  2CJG A;  5JAY A;  3T32 A;  2VLH A;  2ZJG A;  1FG3 A;  3L44 A;  3PPL A;  4WBT A;  2D5Y A;  4XJO A;  5FT6 A;  1BJO B;  1DGD A;  2CFB A;  2BWP A;  1AY5 A;  2VMS A;  3COG A;  2DGK A;  1N8P A;  3DRD A;  3I5T A;  2EO5 A;  4UOY A;  4ATP A;  2R5E A;  3FFR A;  3NYS A;  2W7L A;  1G4V A;  1TOK A;  3EI5 A;  4JE5 A;  3ZRR A;  2ZC0 A;  1C9C A;  4N0W A;  2EGY A;  2XH1 A;  1AHF A;  4K2B A;  2VIB A;  2ZUK A;  1JS6 A;  1RVU A;  4ZWM A;  1AMS A;  3QI6 A;  1WYV B;  1E5F A;  1TOJ A;  2DKB A;  1M4N A;  3EI9 A;  3G0T A;  1IX7 A;  2JIS A;  3HQT A;  2OKJ A;  1W7M A;  1I29 A;  1KL1 A;  2RFV A;  3NU8 A;  4ISY A;  4ZAS A;  2V0Y A;  3TFU A;  4ZM3 A;  4F4E A;  2ZY3 A;  1C7G A;  5AX8 A;  3RI6 A;  2ZSM A;  2Z9W A;  3MKJ A;  3NRA A;  4WYA A;  3FQ8 A;  1CQ8 A;  1OHY A;  1SVV A;  2AAT A;  2JJF A;  2VMW A;  3FVS A;  3MBB A;  4OMA A;  2ZY5 A;  4JE5 D;  2FQ6 A;  5G4J A;  1O61 A;  4H51 A;  9AAT A;  2YCT A;  1J04 A;  2VMU A;  3QHX A;  4RAE A;  1AAW A;  1AJS B;  3HMU A;  1I43 A;  1PG8 A;  1SZS A;  3AOW A;  2TPL A;  3MAF A;  1LC7 A;  5DJ1 A;  4WP0 A;  1ARI A;  1D2F A;  3E2Y A;  3R9A A;  5F8V A;  3B1D A;  3II0 A;  1O4S A;  3NX3 A;  1GDE A;  3CQ6 A;  4Q6R A;  4Q31 A;  1GBN A;  4MGR A;  4R5Z A;  1MAQ A;  3DXW A;  4A0H A;  2O1B A;  2YOB A;  3BWN A;  1FC4 A;  4QGR A;  2C81 A;  2EZ2 A;  4RM1 A;  2Z67 A;  4BA4 A;  3MAD A;  1MDO A;  4DQ6 A;  1C7N A;  5G09 A;  4A6R A;  2ZYJ A;  3KKI A;  2CST A;  1IUG A;  3ASA A;  3DC1 A;  3Q8N A;  1OHV A;  3KGX A;  5DJ9 A;  2O0R A;  2FNI A;  3AEM A;  4J8L A;  1GC4 A;  1VP4 A;  3WCO A;  3EZS A;  5M46 A;  1B8G A;  5TF5 A;  5M49 A;  3DR7 A;  2AY1 A;  1QJ3 A;  1WKG A;  4JEZ A;  4L0O A;  2JGT A;  3W1I A;  4HF8 A;  4ADD A;  5LHA A;  1QIR A;  1AKC A;  1LC8 A;  3BV0 A;  3AAT A;  3DXV A;  2X3L A;  1DKA A;  1OXO A;  1CS1 A;  1GC2 A;  2AY2 A;  3AV7 A;  3WKS A;  1DJE A;  3H7F A;  5IWQ A;  5G0A A;  1GCK A;  3LY1 A;  2Z9V A;  2VMZ A;  3RBF A;  5G2Q A;  1QJ5 A;  4E77 A;  5M4D A;  2OAT A;  2PB2 A;  1DGE A;  1AJR A;  2D63 A;  3ECD A;  3G7Q A;  3JZL A;  2E54 A;  1TOI A;  4IYO A;  4WLH A;  1ARH A;  3M5U A;  3TFT A;  4WB0 A;  3E77 A;  2HOX A;  5EIG B;  2CTZ A;  2YCN A;  4OCA A;  3LVL B;  1W7L A;  3OP7 A;  2CH1 A;  5BJ4 A;  2E7U A;  2QMA A;  1ASM A;  2W7E A;  4R8D A;  4RLG A;  4Q75 A;  3WCN A;  2VGU A;  2W7H A;  1AX4 A;  4DGT A;  1C0N A;  3JW9 A;  1D7R A;  2R0T A;  4AZK A;  3TAT A;  3P1T A;  4A0F A;  1YNU A;  4CBS A;  3K28 A;  3GZD C;  4Y0I A;  4ZSW A;  4RKC A;  1EJI A;  3BCA A;  5EQC A;  3W1J A;  5I92 A;  1QIS A;  4GDY A;  3K7Y A;  1CZE A;  1EQB A;  1G4X A;  3PIU A;  1S09 A;  2CAN A;  4JF1 A;  5E4Z A;  3AEO A;  1ASD A;  2YKU A;  4WYD A;  4WXF A;  1T3I A;  4KXK A;  1GC3 A;  3UAK A;  4F5L A;  8AAT A;  3RCH B;  3USF A;  4IY7 A;  3PDX A;  2E7I A;  2FN6 A;  2EH6 A;  2HP1 A;  2X8U A;  3ASB A;  3JTX A;  2JJE A;  4HVK A;  3JWA A;  3FD0 A;  3FCR A;  1W7N A;  2ZP7 A;  1LKC A;  5K8B A;  3QGU A;  3OKS A;  4LW4 A;  4EU1 A;  2VMX A;  1B9I A;  1KL2 A;  1MDX A;  4RJ0 A;  2VGZ A;  3BWO A;  1V2D A;  3N75 A;  1AY8 A;  2R5C B;  2W8W A;  2WK7 A;  3EI8 A;  3FVX A;  1AKA A;  1SZU A;  1WYT B;  4JEW A;  4M2M A;  1YJZ A;  2BI1 A;  3HDO A;  1AIA A;  4A72 A;  4A0G A;  1BJN A;  3FFH A;  3E2Z B;  5M4B A;  5HXX A;  4IXS A;  1CJ0 A;  4A0R A;  4BMK A;  1AAM A;  3I4J A;  3ZZJ A;  2Z61 A;  1M32 A;  4JEY A;  1IVR A;  4W1W A;  3VAX A;  2AY9 A;  4IXZ A;  1GC0 A;  1N31 A;  2AY3 A;  3FZ6 A;  1ARG A;  4XJL A;  2ZY4 A;  4FFC A;  2X5F A;  1XEY A;  3BCB A;  1ASC A;  1BQA A;  3B46 A;  3HVY A;  3N0L A;  4ZWV A;  1IX8 A;  1C7O A;  2DR1 A;  2VMT A;  4K2M A;  1ART A;  3NU7 A;  2VMY A;  4ADC A;  2AY4 A;  4MKJ A;  2BKW A;  4WXB A;  1AHG A;  3GET A;  4XAU A;  3GZD A;  1AHX A;  5LH9 A;  2BIA A;  1VEF A;  3W1H A;  1J32 A;  1IBJ A;  4FL0 A;  4GE4 A;  1M0N A;  3AEJ A;  3E2F A;  1PMM A;  2AY6 A;  1U08 A;  1D7V A;  4P3M A;  4XK1 A;  5F9S A;  2YCP A;  5HDM A;  3NUI A;  1M7Y A;  1Z7D A;  3RCH A;  2HOR A;  1B5P A;  1D7U A;  3ELE A;  4WYC A;  3EIA A;  2BWN A;  4OYT A;  4UQV A;  1C4K A;  3CQ5 A;  4GE9 A;  4BQ0 A;  2VMO A;  4PIW A;  1OHW A;  1P3W A;  3HLM A;  4IX8 A;  1X29 A;  4F5M A;  1KMK A;  3GZC A;  4JF0 A;  3JWB A;  1BJO A;  4R5F A;  2R5C A;  3PAA A;  3GR9 A;  1G7W A;  4ITG A;  1V72 A;  1JS3 A;  1OXP A;  3I16 A;  1LS3 A;  4UHO A;  3RQ1 A;  3PA9 A;  4CXR A;  2C0R A;  1XI9 A;  2ZSL A;  4K2I A;  4TV7 A;  5FT8 A;  1AIB A;  1JF9 A;  3ZRP A;  7AAT A;  2VGV A;  1W23 A;  1N2T A;  4WYF A;  2BI3 A;  2D7Y A;  2G6W A;  1WYV A;  2YRI A;  4RIT A;  2W7I A;  4ZAH A;  4TN4 A;  2AEU A;  4EMY A;  2Z20 A;  2YRR A;  1O62 A;  3LV2 A;  3EZ1 A;  2HOY A;  3E9K A;  1X28 A;  4DBC A;  1MDZ A;  3DZZ A;  1BJW A;  3AEL A;  2QB2 A;  2W8V A;  1I41 A;  4WXG A;  5DX5 A;  1AHE A;  2AEV A;  4LC3 A;  4EFF A;  1M0P A;  4I8A A;  1WYU B;  2BHX A;  1DTY A;  2DGM A;  2JG2 A;  1ASE A;  5J8Q A;  1YIY A;  3AEN B;  4A6U A;  1ASN A;  1BKG A;  2C44 A;  1AJS A;  3FKD A;  4R2N A;  5EUD A;  2W8T A;  3MAU A;  3R4T A;  1M0O A;  2Q7W A;  4RIZ A;  2BIG A;  4U2H A;  4XJP A;  2Z1Z A;  1H1C A;  3UWC A;  4GEB A;  2CH2 A;  1PFF A;  1ASF A;  1MLZ A;  2BWO A;  3FRK A;  3KE3 A;  4JEX A;  3MEB A;  3GJU A;  2QBT A;  3EIB A;  3DYD A;  2DGL A;  1W3U A;  1EG5 A;  3NUB A;  1GEY A;  3PDB B;  2QLR A;  2W8J A;  1GEW A;  1ASB A;  2W7K A;  2Z9U A;  3WLX A;  4CVQ A;  3F0H A;  2E7J A;  2R2N A;  1IJI A;  2VLF A;  5BJ3 A;  4O6Z A;  4OT8 A;  3DOD A;  4E1O A;  2EZ1 A;  1BJ4 A;  4LW2 A;  5DB5 A;  2C7T A;  2D66 A;  2HUU A;  4ITX A;  1UKJ A;  2W8U A;  3RBL A;  4TMR A;  3PJ0 A;  3CQ4 A;  1TOE A;  4AO9 A;  1ASL A;  1DJ9 A;  2BYJ A;  2PB0 A;  4CBR A;  1AHY A;  3PD6 B;  3DR4 A;  4F5I A;  5EAV A;  1YAA A;  2BYL A;  1SF2 A;  2VGS A;  3ELP A;  4WLJ A;  2QA3 A;  1KMJ A;  4PFN A;  3KGW A;  4OBV A;  5G4I A;  2GB3 A;  4KYO A;  3D6K A;  3VOM A;  4IW7 A;  1WYU A;  4PVF A;  3HL2 A;  1ARS A;  4MQQ A;  5E5I A;  3LVK A;  4ADE A;  3WGB A;  2W7F A;  4GRX A;  1ZOD A;  5G2P A;  3FDD A;  1G7X A;  1I48 A;  3EI6 A;  3FSL A;  3VK2 A;  4F5J A;  2F8J A;  3NYT A;  1RVY A;  3E6G A;  1SPA A;  4B98 A;  2D61 A;  2CJD A;  4MY5 A;  1D7S A;  1LK9 A;  1ELU A;  5EIG A;  4EB5 A;  2GSA A;  3LVM A;  4Q76 A;  1O69 A;  5E3K A;  3WKR A;  4E3R A;  4EB7 A;  2BIE A;  3MAF B;  4E3Q A;  1MLY A;  4F5H A;  3LVJ A; 
#chains in the Genus database with same CATH topology
 1X2A A;  2X5D A;  4CXQ A;  4W8I A;  4ZSY A;  3A8U X;  1IAX A;  3VK3 A;  2JJH A;  2D65 A;  2AY5 A;  4ZDP A;  1CL2 A;  3FQA A;  3AEP A;  1SZK A;  1JG8 A;  3BWN C;  1RV3 A;  4B9B A;  1AKB A;  2GMU A;  2BI5 A;  1B9H A;  2BI9 A;  3JU7 A;  1AIC A;  3CBF A;  1UU2 A;  1S08 A;  2JJG A;  1CL1 A;  3PD6 A;  2W7G A;  4ZLV A;  2GMS A;  3HBX A;  4PFF A;  1Y4I A;  3FZ7 A;  3AEM C;  1E5E A;  1LC5 A;  2OKK A;  4A6T A;  3BC8 A;  3LG0 A;  1KKP A;  4OTL A;  4F5F A;  1LW5 A;  2VGT A;  4W5K A;  2VIA A;  3WX9 A;  1WKH A;  3IF2 A;  4W1V A;  1WST A;  1M6S A;  1QGN A;  2PO3 A;  1CQ6 A;  2WK9 A;  1CQ7 A;  1YJS A;  1TAT A;  4XQ2 A;  4AH3 A;  1WYT A;  2VI8 A;  3CAI A;  4JEV A;  4M2K A;  4MQP A;  4K05 A;  1QZ9 A;  5EUE A;  4BHD A;  3QM2 A;  4F5K A;  4LNM A;  4WYE A;  3GBX A;  3A2B A;  1AMA A;  1DFO A;  1TPL A;  3A9Y A;  2OGE A;  1SFF A;  2Z1Y A;  1LW4 A;  3E2Z A;  2HOZ A;  1V2F A;  4IXO A;  4GSA A;  1ASG A;  2VMQ A;  4IYO B;  3N5M A;  4WB0 B;  3G8M A;  3BN1 A;  2VGW A;  1VJO A;  4W91 A;  2WK8 A;  1ECX A;  2FNU A;  4J5U A;  3FVU A;  4RJY A;  1UU0 A;  4XJM A;  4M2J A;  3QBO A;  3IHJ A;  1V2E A;  3TQX A;  4MKK A;  2YKY A;  2YHK A;  1KKJ A;  2QSR A;  2FM1 A;  2Z9X A;  4ZDL A;  2HUI A;  3MC6 C;  3NTJ A;  1X0M A;  1S0A A;  2DKJ A;  2CIN A;  3ACZ A;  4ADB A;  4UHN A;  5HHY A;  1PMO A;  4WYG A;  4F5G A;  4ZDO A;  4MQR A;  4LNJ A;  1MAP A;  3EUC A;  3GSB A;  3ISL A;  2VYC A;  3LWS A;  3WY7 A;  1DJU A;  4P7Y A;  1ZC9 A;  2W7D A;  2W7J A;  3BS8 A;  4XEW A;  3TCM A;  2VI9 A;  5D5S A;  1UU1 A;  4AOA A;  1B4X A;  5FT5 A;  1TAS A;  2ZY2 A;  3B8X A;  2D7Z A;  1S07 A;  1GD9 A;  3BCX A;  2WKA A;  3ZRQ A;  3F9T A;  3DU4 A;  3RUY A;  1OAT A;  5C6U A;  1H0C A;  4GE7 A;  2VMR A;  3FDB A;  2HUF A;  1AMR A;  3QPG A;  1IAY A;  1ASA A;  3NDN A;  3WZF A;  2QB3 A;  4Y0D A;  1B5O A;  5FT4 A;  2V1P A;  1ELQ A;  3VP6 A;  2HZP A;  2OGA A;  4OBU A;  4AO4 A;  3VK4 A;  5D95 A;  4U1T A;  3H9X A;  3QN6 A;  5EUN A;  1AY4 A;  1GEX A;  1YOO A;  4NOG A;  4KAM A;  2DOU A;  3GWP A;  3UE8 A;  1AMQ A;  1M0Q A;  3BB8 A;  2EPJ A;  2W7M A;  1RV4 A;  4RKD A;  2HP2 A;  3P6K A;  2VMV A;  1YIZ A;  3PGY A;  4OC9 A;  1BT4 A;  3A9X A;  1FG7 A;  1CZC A;  3ZZK A;  2D64 A;  3MC6 A;  1S06 A;  3B1E A;  4A00 A;  1ZOB A;  3A9Z A;  4Y0H A;  1TOG A;  2FYF A;  3B1C A;  2CY8 A;  2YKV A;  3FTB A;  3HT4 A;  5EFS A;  1BW0 A;  3AEN A;  1QIT A;  1BQD A;  4ZM4 A;  3FQ7 A;  2BI2 A;  2AY8 A;  3EI7 A;  1Z3Z A;  4AZJ A;  3H14 A;  2VMP A;  1TAR A;  3AOV A;  4LNL A;  2GQN A;  3AEJ C;  2O7C A;  1BS0 A;  5EAA A;  2VMN A;  1IX6 A;  2YKX A;  4ATQ A;  3ATH A;  2XBN A;  4MSO A;  1YJY A;  2ORD A;  4UHM A;  3NYU A;  4WD2 A;  4BA5 A;  3K40 A;  2NMP A;  1MGV A;  3NNK A;  3F6T A;  4W1X A;  3FZ8 A;  1ORD A;  2CJH A;  3WGC A;  2OQX A;  3PDB A;  4N0B A;  3L8A A;  2AY7 A;  2CB1 A;  2CJG A;  5JAY A;  3T32 A;  2VLH A;  2ZJG A;  1FG3 A;  3L44 A;  3N7N A;  3PPL A;  4WBT A;  2D5Y A;  4XJO A;  5FT6 A;  1BJO B;  1DGD A;  2CFB A;  2BWP A;  1AY5 A;  2VMS A;  3COG A;  2DGK A;  1N8P A;  3DRD A;  3I5T A;  2EO5 A;  4UOY A;  4ATP A;  2R5E A;  3FFR A;  3NYS A;  2W7L A;  1G4V A;  1TOK A;  3EI5 A;  4JE5 A;  3ZRR A;  2ZC0 A;  1C9C A;  4N0W A;  2EGY A;  2XH1 A;  1AHF A;  4K2B A;  2VIB A;  2ZUK A;  1JS6 A;  1RVU A;  4ZWM A;  1AMS A;  3QI6 A;  1WYV B;  1E5F A;  1TOJ A;  2DKB A;  1M4N A;  3EI9 A;  3G0T A;  1IX7 A;  2JIS A;  3HQT A;  2OKJ A;  1W7M A;  1I29 A;  1KL1 A;  2RFV A;  3NU8 A;  4ISY A;  4ZAS A;  2V0Y A;  3TFU A;  4ZM3 A;  4F4E A;  2ZY3 A;  1C7G A;  5AX8 A;  3RI6 A;  2ZSM A;  2Z9W A;  3MKJ A;  3NRA A;  4WYA A;  3FQ8 A;  1CQ8 A;  1OHY A;  1SVV A;  2AAT A;  2JJF A;  2VMW A;  3FVS A;  3MBB A;  4OMA A;  2ZY5 A;  4JE5 D;  2FQ6 A;  5G4J A;  1O61 A;  4H51 A;  9AAT A;  2YCT A;  1J04 A;  2VMU A;  3QHX A;  4RAE A;  1AAW A;  1AJS B;  3HMU A;  1I43 A;  1PG8 A;  1SZS A;  3AOW A;  2TPL A;  3MAF A;  1LC7 A;  5DJ1 A;  4WP0 A;  1ARI A;  1D2F A;  3E2Y A;  3R9A A;  5F8V A;  3B1D A;  3II0 A;  1O4S A;  3NX3 A;  1GDE A;  3CQ6 A;  4Q6R A;  4Q31 A;  1GBN A;  4MGR A;  4R5Z A;  1MAQ A;  3DXW A;  4A0H A;  2O1B A;  2YOB A;  3BWN A;  1FC4 A;  4QGR A;  2C81 A;  2EZ2 A;  4RM1 A;  2FKI A;  2Z67 A;  4BA4 A;  3MAD A;  1MDO A;  4DQ6 A;  1C7N A;  5G09 A;  2A1V A;  4A6R A;  2ZYJ A;  3KKI A;  2CST A;  1IUG A;  3ASA A;  3DC1 A;  3Q8N A;  1OHV A;  3KGX A;  5DJ9 A;  2O0R A;  2FNI A;  3AEM A;  4J8L A;  1GC4 A;  1VP4 A;  3WCO A;  3EZS A;  5M46 A;  1B8G A;  5TF5 A;  5M49 A;  3DR7 A;  2AY1 A;  1QJ3 A;  1WKG A;  4JEZ A;  4L0O A;  2JGT A;  3W1I A;  4HF8 A;  4ADD A;  5LHA A;  1QIR A;  1AKC A;  1LC8 A;  3BV0 A;  3AAT A;  3DXV A;  2X3L A;  1DKA A;  1OXO A;  1CS1 A;  1GC2 A;  2AY2 A;  3AV7 A;  3WKS A;  1DJE A;  3H7F A;  5IWQ A;  5G0A A;  1GCK A;  3LY1 A;  2Z9V A;  2VMZ A;  3RBF A;  5G2Q A;  1QJ5 A;  4E77 A;  5M4D A;  2OAT A;  2PB2 A;  1DGE A;  1AJR A;  2D63 A;  3ECD A;  3G7Q A;  3JZL A;  2E54 A;  1TOI A;  4IYO A;  4WLH A;  1ARH A;  3M5U A;  3TFT A;  4WB0 A;  4H63 Q;  3E77 A;  2HOX A;  5EIG B;  2CTZ A;  2YCN A;  4OCA A;  3LVL B;  1W7L A;  3OP7 A;  2CH1 A;  5BJ4 A;  2E7U A;  2QMA A;  1ASM A;  2W7E A;  4R8D A;  4RLG A;  4Q75 A;  3WCN A;  2VGU A;  2W7H A;  1AX4 A;  4DGT A;  2EYQ A;  1C0N A;  3JW9 A;  1D7R A;  2R0T A;  4AZK A;  3TAT A;  3P1T A;  4A0F A;  1YNU A;  4CBS A;  3K28 A;  3GZD C;  4Y0I A;  4ZSW A;  4RKC A;  1EJI A;  3BCA A;  5EQC A;  3W1J A;  5I92 A;  1QIS A;  4GDY A;  3K7Y A;  1CZE A;  1EQB A;  1G4X A;  3PIU A;  1S09 A;  2CAN A;  4JF1 A;  5E4Z A;  3AEO A;  1ASD A;  2YKU A;  4WYD A;  4WXF A;  1T3I A;  4KXK A;  1GC3 A;  3UAK A;  4F5L A;  8AAT A;  3RCH B;  3USF A;  4IY7 A;  1KAF A;  3PDX A;  2E7I A;  2FN6 A;  2EH6 A;  2HP1 A;  2X8U A;  3ASB A;  3JTX A;  2JJE A;  4HVK A;  3JWA A;  3FD0 A;  3FCR A;  1W7N A;  2ZP7 A;  1LKC A;  5K8B A;  3QGU A;  3OKS A;  4LW4 A;  4EU1 A;  2VMX A;  1B9I A;  1KL2 A;  1MDX A;  4RJ0 A;  2VGZ A;  3BWO A;  1V2D A;  3N75 A;  1AY8 A;  2R5C B;  2W8W A;  2WK7 A;  3EI8 A;  3FVX A;  1AKA A;  1SZU A;  1WYT B;  4JEW A;  4M2M A;  1YJZ A;  2BI1 A;  3HDO A;  5KTB A;  1AIA A;  4A72 A;  4A0G A;  1BJN A;  3FFH A;  3E2Z B;  5M4B A;  5HXX A;  4IXS A;  1CJ0 A;  4A0R A;  4BMK A;  1AAM A;  3I4J A;  3ZZJ A;  2Z61 A;  1M32 A;  4JEY A;  1IVR A;  4W1W A;  3VAX A;  2AY9 A;  3N4X A;  4IXZ A;  1GC0 A;  1N31 A;  2AY3 A;  3FZ6 A;  1ARG A;  4XJL A;  2WB6 A;  2ZY4 A;  4FFC A;  2X5F A;  1XEY A;  3BCB A;  1ASC A;  1BQA A;  3B46 A;  3HVY A;  3N0L A;  4ZWV A;  1IX8 A;  1C7O A;  2DR1 A;  2VMT A;  4K2M A;  1ART A;  3NU7 A;  2VMY A;  4ADC A;  2AY4 A;  4MKJ A;  2BKW A;  4WXB A;  1AHG A;  3GET A;  4XAU A;  3GZD A;  1AHX A;  5LH9 A;  2BIA A;  1VEF A;  3W1H A;  1J32 A;  1IBJ A;  4FL0 A;  4GE4 A;  1M0N A;  3AEJ A;  3E2F A;  1PMM A;  2AY6 A;  3N4R A;  1U08 A;  1D7V A;  4P3M A;  4XK1 A;  5F9S A;  2YCP A;  5HDM A;  3NUI A;  1M7Y A;  1Z7D A;  3RCH A;  2HOR A;  1B5P A;  1D7U A;  3ELE A;  4WYC A;  3EIA A;  2BWN A;  4OYT A;  4UQV A;  1C4K A;  3CQ5 A;  4GE9 A;  4BQ0 A;  2VMO A;  4PIW A;  1OHW A;  1P3W A;  3HLM A;  4IX8 A;  1X29 A;  4F5M A;  1KMK A;  3GZC A;  4JF0 A;  3JWB A;  1BJO A;  4R5F A;  2R5C A;  3PAA A;  3GR9 A;  1G7W A;  4ITG A;  1V72 A;  1JS3 A;  1OXP A;  3I16 A;  1LS3 A;  4UHO A;  3RQ1 A;  2G7J A;  3PA9 A;  4CXR A;  2C0R A;  1XI9 A;  2ZSL A;  4K2I A;  4TV7 A;  5FT8 A;  1AIB A;  1JF9 A;  3ZRP A;  7AAT A;  2VGV A;  2KFP A;  1W23 A;  1N2T A;  4WYF A;  2BI3 A;  2D7Y A;  2G6W A;  1WYV A;  2YRI A;  4RIT A;  2W7I A;  4ZAH A;  4TN4 A;  2AEU A;  4EMY A;  2Z20 A;  2YRR A;  1O62 A;  3LV2 A;  3EZ1 A;  2HOY A;  3E9K A;  1X28 A;  4DBC A;  1MDZ A;  3DZZ A;  1BJW A;  3AEL A;  2QB2 A;  2W8V A;  1I41 A;  4WXG A;  5DX5 A;  1AHE A;  2AEV A;  4LC3 A;  4EFF A;  1M0P A;  4I8A A;  1WYU B;  2BHX A;  1DTY A;  2DGM A;  2JG2 A;  1ASE A;  5J8Q A;  1YIY A;  3AEN B;  4A6U A;  1ASN A;  1BKG A;  2C44 A;  1AJS A;  3FKD A;  4R2N A;  5EUD A;  2W8T A;  3MAU A;  3R4T A;  1M0O A;  2Q7W A;  4RIZ A;  2BIG A;  4U2H A;  4XJP A;  2Z1Z A;  1H1C A;  3UWC A;  4GEB A;  2CH2 A;  1PFF A;  1ASF A;  1MLZ A;  2BWO A;  3FRK A;  3KE3 A;  4JEX A;  3MEB A;  3GJU A;  2QBT A;  3EIB A;  3DYD A;  2DGL A;  1W3U A;  1EG5 A;  3NUB A;  1GEY A;  3PDB B;  2QLR A;  2W8J A;  1GEW A;  1ASB A;  2W7K A;  2Z9U A;  3WLX A;  4CVQ A;  3F0H A;  2E7J A;  2R2N A;  1IJI A;  2VLF A;  5BJ3 A;  4O6Z A;  4OT8 A;  3DOD A;  4E1O A;  2EZ1 A;  1BJ4 A;  4LW2 A;  5DB5 A;  2C7T A;  2D66 A;  2HUU A;  4ITX A;  1UKJ A;  2W8U A;  3RBL A;  4TMR A;  3PJ0 A;  3CQ4 A;  1TOE A;  4AO9 A;  1ASL A;  1DJ9 A;  2BYJ A;  2PB0 A;  4CBR A;  1AHY A;  3PD6 B;  3DR4 A;  4F5I A;  5EAV A;  1YAA A;  2BYL A;  1SF2 A;  2VGS A;  3ELP A;  4WLJ A;  2QA3 A;  1KMJ A;  4PFN A;  3KGW A;  4OBV A;  5G4I A;  2GB3 A;  4KYO A;  3D6K A;  3VOM A;  4IW7 A;  1WYU A;  4PVF A;  3HL2 A;  1ARS A;  4MQQ A;  5E5I A;  3LVK A;  4ADE A;  3WGB A;  2W7F A;  4GRX A;  1ZOD A;  5G2P A;  3FDD A;  1G7X A;  1I48 A;  3EI6 A;  3FSL A;  3VK2 A;  4F5J A;  2F8J A;  3NYT A;  1RVY A;  3E6G A;  1SPA A;  4B98 A;  3N4S A;  2D61 A;  2CJD A;  4MY5 A;  1D7S A;  1LK9 A;  1ELU A;  5EIG A;  4EB5 A;  2GSA A;  3LVM A;  4Q76 A;  1O69 A;  5E3K A;  3WKR A;  4E3R A;  4EB7 A;  2BIE A;  3MAF B;  4E3Q A;  1MLY A;  4F5H A;  3LVJ A; 
#chains in the Genus database with same CATH homology
 1X2A A;  2X5D A;  4CXQ A;  4W8I A;  4ZSY A;  3A8U X;  1IAX A;  3VK3 A;  2JJH A;  2D65 A;  2AY5 A;  4ZDP A;  1CL2 A;  3FQA A;  3AEP A;  1SZK A;  1JG8 A;  3BWN C;  1RV3 A;  4B9B A;  1AKB A;  2GMU A;  2BI5 A;  1B9H A;  2BI9 A;  3JU7 A;  1AIC A;  3CBF A;  1UU2 A;  1S08 A;  2JJG A;  1CL1 A;  3PD6 A;  2W7G A;  4ZLV A;  2GMS A;  3HBX A;  4PFF A;  1Y4I A;  3FZ7 A;  3AEM C;  1E5E A;  1LC5 A;  2OKK A;  4A6T A;  3BC8 A;  3LG0 A;  1KKP A;  4OTL A;  4F5F A;  1LW5 A;  2VGT A;  4W5K A;  2VIA A;  3WX9 A;  1WKH A;  3IF2 A;  4W1V A;  1WST A;  1M6S A;  1QGN A;  2PO3 A;  1CQ6 A;  2WK9 A;  1CQ7 A;  1YJS A;  1TAT A;  4XQ2 A;  4AH3 A;  1WYT A;  2VI8 A;  3CAI A;  4JEV A;  4M2K A;  4MQP A;  4K05 A;  1QZ9 A;  5EUE A;  4BHD A;  3QM2 A;  4F5K A;  4LNM A;  4WYE A;  3GBX A;  3A2B A;  1AMA A;  1DFO A;  1TPL A;  3A9Y A;  2OGE A;  1SFF A;  2Z1Y A;  1LW4 A;  3E2Z A;  2HOZ A;  1V2F A;  4IXO A;  4GSA A;  1ASG A;  2VMQ A;  4IYO B;  3N5M A;  4WB0 B;  3G8M A;  3BN1 A;  2VGW A;  1VJO A;  4W91 A;  2WK8 A;  1ECX A;  2FNU A;  4J5U A;  3FVU A;  4RJY A;  1UU0 A;  4XJM A;  4M2J A;  3QBO A;  3IHJ A;  1V2E A;  3TQX A;  4MKK A;  2YKY A;  2YHK A;  1KKJ A;  2QSR A;  2FM1 A;  2Z9X A;  4ZDL A;  2HUI A;  3MC6 C;  3NTJ A;  1X0M A;  1S0A A;  2DKJ A;  2CIN A;  3ACZ A;  4ADB A;  4UHN A;  5HHY A;  1PMO A;  4WYG A;  4F5G A;  4ZDO A;  4MQR A;  4LNJ A;  1MAP A;  3EUC A;  3GSB A;  3ISL A;  2VYC A;  3LWS A;  3WY7 A;  1DJU A;  4P7Y A;  1ZC9 A;  2W7D A;  2W7J A;  3BS8 A;  4XEW A;  3TCM A;  2VI9 A;  5D5S A;  1UU1 A;  4AOA A;  1B4X A;  5FT5 A;  1TAS A;  2ZY2 A;  3B8X A;  2D7Z A;  1S07 A;  1GD9 A;  3BCX A;  2WKA A;  3ZRQ A;  3F9T A;  3DU4 A;  3RUY A;  1OAT A;  5C6U A;  1H0C A;  4GE7 A;  2VMR A;  3FDB A;  2HUF A;  1AMR A;  3QPG A;  1IAY A;  1ASA A;  3NDN A;  3WZF A;  2QB3 A;  4Y0D A;  1B5O A;  5FT4 A;  2V1P A;  1ELQ A;  3VP6 A;  2HZP A;  2OGA A;  4OBU A;  4AO4 A;  3VK4 A;  5D95 A;  4U1T A;  3H9X A;  3QN6 A;  5EUN A;  1AY4 A;  1GEX A;  1YOO A;  4NOG A;  4KAM A;  2DOU A;  3GWP A;  3UE8 A;  1AMQ A;  1M0Q A;  3BB8 A;  2EPJ A;  2W7M A;  1RV4 A;  4RKD A;  2HP2 A;  3P6K A;  2VMV A;  1YIZ A;  3PGY A;  4OC9 A;  1BT4 A;  3A9X A;  1FG7 A;  1CZC A;  3ZZK A;  2D64 A;  3MC6 A;  1S06 A;  3B1E A;  4A00 A;  1ZOB A;  3A9Z A;  4Y0H A;  1TOG A;  2FYF A;  3B1C A;  2CY8 A;  2YKV A;  3FTB A;  3HT4 A;  5EFS A;  1BW0 A;  3AEN A;  1QIT A;  1BQD A;  4ZM4 A;  3FQ7 A;  2BI2 A;  2AY8 A;  3EI7 A;  1Z3Z A;  4AZJ A;  3H14 A;  2VMP A;  1TAR A;  3AOV A;  4LNL A;  2GQN A;  3AEJ C;  2O7C A;  1BS0 A;  5EAA A;  2VMN A;  1IX6 A;  2YKX A;  4ATQ A;  3ATH A;  2XBN A;  4MSO A;  1YJY A;  2ORD A;  4UHM A;  3NYU A;  4WD2 A;  4BA5 A;  3K40 A;  2NMP A;  1MGV A;  3NNK A;  3F6T A;  4W1X A;  3FZ8 A;  1ORD A;  2CJH A;  3WGC A;  2OQX A;  3PDB A;  4N0B A;  3L8A A;  2AY7 A;  2CB1 A;  2CJG A;  5JAY A;  3T32 A;  2VLH A;  2ZJG A;  1FG3 A;  3L44 A;  3N7N A;  3PPL A;  4WBT A;  2D5Y A;  4XJO A;  5FT6 A;  1BJO B;  1DGD A;  2CFB A;  2BWP A;  1AY5 A;  2VMS A;  3COG A;  2DGK A;  1N8P A;  3DRD A;  3I5T A;  2EO5 A;  4UOY A;  4ATP A;  2R5E A;  3FFR A;  3NYS A;  2W7L A;  1G4V A;  1TOK A;  3EI5 A;  4JE5 A;  3ZRR A;  2ZC0 A;  1C9C A;  4N0W A;  2EGY A;  2XH1 A;  1AHF A;  4K2B A;  2VIB A;  2ZUK A;  1JS6 A;  1RVU A;  4ZWM A;  1AMS A;  3QI6 A;  1WYV B;  1E5F A;  1TOJ A;  2DKB A;  1M4N A;  3EI9 A;  3G0T A;  1IX7 A;  2JIS A;  3HQT A;  2OKJ A;  1W7M A;  1I29 A;  1KL1 A;  2RFV A;  3NU8 A;  4ISY A;  4ZAS A;  2V0Y A;  3TFU A;  4ZM3 A;  4F4E A;  2ZY3 A;  1C7G A;  5AX8 A;  3RI6 A;  2ZSM A;  2Z9W A;  3MKJ A;  3NRA A;  4WYA A;  3FQ8 A;  1CQ8 A;  1OHY A;  1SVV A;  2AAT A;  2JJF A;  2VMW A;  3FVS A;  3MBB A;  4OMA A;  2ZY5 A;  4JE5 D;  2FQ6 A;  5G4J A;  1O61 A;  4H51 A;  9AAT A;  2YCT A;  1J04 A;  2VMU A;  3QHX A;  4RAE A;  1AAW A;  1AJS B;  3HMU A;  1I43 A;  1PG8 A;  1SZS A;  3AOW A;  2TPL A;  3MAF A;  1LC7 A;  5DJ1 A;  4WP0 A;  1ARI A;  1D2F A;  3E2Y A;  3R9A A;  5F8V A;  3B1D A;  3II0 A;  1O4S A;  3NX3 A;  1GDE A;  3CQ6 A;  4Q6R A;  4Q31 A;  1GBN A;  4MGR A;  4R5Z A;  1MAQ A;  3DXW A;  4A0H A;  2O1B A;  2YOB A;  3BWN A;  1FC4 A;  4QGR A;  2C81 A;  2EZ2 A;  4RM1 A;  2FKI A;  2Z67 A;  4BA4 A;  3MAD A;  1MDO A;  4DQ6 A;  1C7N A;  5G09 A;  2A1V A;  4A6R A;  2ZYJ A;  3KKI A;  2CST A;  1IUG A;  3ASA A;  3DC1 A;  3Q8N A;  1OHV A;  3KGX A;  5DJ9 A;  2O0R A;  2FNI A;  3AEM A;  4J8L A;  1GC4 A;  1VP4 A;  3WCO A;  3EZS A;  5M46 A;  1B8G A;  5TF5 A;  5M49 A;  3DR7 A;  2AY1 A;  1QJ3 A;  1WKG A;  4JEZ A;  4L0O A;  2JGT A;  3W1I A;  4HF8 A;  4ADD A;  5LHA A;  1QIR A;  1AKC A;  1LC8 A;  3BV0 A;  3AAT A;  3DXV A;  2X3L A;  1DKA A;  1OXO A;  1CS1 A;  1GC2 A;  2AY2 A;  3AV7 A;  3WKS A;  1DJE A;  3H7F A;  5IWQ A;  5G0A A;  1GCK A;  3LY1 A;  2Z9V A;  2VMZ A;  3RBF A;  5G2Q A;  1QJ5 A;  4E77 A;  5M4D A;  2OAT A;  2PB2 A;  1DGE A;  1AJR A;  2D63 A;  3ECD A;  3G7Q A;  3JZL A;  2E54 A;  1TOI A;  4IYO A;  4WLH A;  1ARH A;  3M5U A;  3TFT A;  4WB0 A;  4H63 Q;  3E77 A;  2HOX A;  5EIG B;  2CTZ A;  2YCN A;  4OCA A;  3LVL B;  1W7L A;  3OP7 A;  2CH1 A;  5BJ4 A;  2E7U A;  2QMA A;  1ASM A;  2W7E A;  4R8D A;  4RLG A;  4Q75 A;  3WCN A;  2VGU A;  2W7H A;  1AX4 A;  4DGT A;  2EYQ A;  1C0N A;  3JW9 A;  1D7R A;  2R0T A;  4AZK A;  3TAT A;  3P1T A;  4A0F A;  1YNU A;  4CBS A;  3K28 A;  3GZD C;  4Y0I A;  4ZSW A;  4RKC A;  1EJI A;  3BCA A;  5EQC A;  3W1J A;  5I92 A;  1QIS A;  4GDY A;  3K7Y A;  1CZE A;  1EQB A;  1G4X A;  3PIU A;  1S09 A;  2CAN A;  4JF1 A;  5E4Z A;  3AEO A;  1ASD A;  2YKU A;  4WYD A;  4WXF A;  1T3I A;  4KXK A;  1GC3 A;  3UAK A;  4F5L A;  8AAT A;  3RCH B;  3USF A;  4IY7 A;  3PDX A;  2E7I A;  2FN6 A;  2EH6 A;  2HP1 A;  2X8U A;  3ASB A;  3JTX A;  2JJE A;  4HVK A;  3JWA A;  3FD0 A;  3FCR A;  1W7N A;  2ZP7 A;  1LKC A;  5K8B A;  3QGU A;  3OKS A;  4LW4 A;  4EU1 A;  2VMX A;  1B9I A;  1KL2 A;  1MDX A;  4RJ0 A;  2VGZ A;  3BWO A;  1V2D A;  3N75 A;  1AY8 A;  2R5C B;  2W8W A;  2WK7 A;  3EI8 A;  3FVX A;  1AKA A;  1SZU A;  1WYT B;  4JEW A;  4M2M A;  1YJZ A;  2BI1 A;  3HDO A;  5KTB A;  1AIA A;  4A72 A;  4A0G A;  1BJN A;  3FFH A;  3E2Z B;  5M4B A;  5HXX A;  4IXS A;  1CJ0 A;  4A0R A;  4BMK A;  1AAM A;  3I4J A;  3ZZJ A;  2Z61 A;  1M32 A;  4JEY A;  1IVR A;  4W1W A;  3VAX A;  2AY9 A;  3N4X A;  4IXZ A;  1GC0 A;  1N31 A;  2AY3 A;  3FZ6 A;  1ARG A;  4XJL A;  2WB6 A;  2ZY4 A;  4FFC A;  2X5F A;  1XEY A;  3BCB A;  1ASC A;  1BQA A;  3B46 A;  3HVY A;  3N0L A;  4ZWV A;  1IX8 A;  1C7O A;  2DR1 A;  2VMT A;  4K2M A;  1ART A;  3NU7 A;  2VMY A;  4ADC A;  2AY4 A;  4MKJ A;  2BKW A;  4WXB A;  1AHG A;  3GET A;  4XAU A;  3GZD A;  1AHX A;  5LH9 A;  2BIA A;  1VEF A;  3W1H A;  1J32 A;  1IBJ A;  4FL0 A;  4GE4 A;  1M0N A;  3AEJ A;  3E2F A;  1PMM A;  2AY6 A;  3N4R A;  1U08 A;  1D7V A;  4P3M A;  4XK1 A;  5F9S A;  2YCP A;  5HDM A;  3NUI A;  1M7Y A;  1Z7D A;  3RCH A;  2HOR A;  1B5P A;  1D7U A;  3ELE A;  4WYC A;  3EIA A;  2BWN A;  4OYT A;  4UQV A;  1C4K A;  3CQ5 A;  4GE9 A;  4BQ0 A;  2VMO A;  4PIW A;  1OHW A;  1P3W A;  3HLM A;  4IX8 A;  1X29 A;  4F5M A;  1KMK A;  3GZC A;  4JF0 A;  3JWB A;  1BJO A;  4R5F A;  2R5C A;  3PAA A;  3GR9 A;  1G7W A;  4ITG A;  1V72 A;  1JS3 A;  1OXP A;  3I16 A;  1LS3 A;  4UHO A;  3RQ1 A;  2G7J A;  3PA9 A;  4CXR A;  2C0R A;  1XI9 A;  2ZSL A;  4K2I A;  4TV7 A;  5FT8 A;  1AIB A;  1JF9 A;  3ZRP A;  7AAT A;  2VGV A;  2KFP A;  1W23 A;  1N2T A;  4WYF A;  2BI3 A;  2D7Y A;  2G6W A;  1WYV A;  2YRI A;  4RIT A;  2W7I A;  4ZAH A;  4TN4 A;  2AEU A;  4EMY A;  2Z20 A;  2YRR A;  1O62 A;  3LV2 A;  3EZ1 A;  2HOY A;  3E9K A;  1X28 A;  4DBC A;  1MDZ A;  3DZZ A;  1BJW A;  3AEL A;  2QB2 A;  2W8V A;  1I41 A;  4WXG A;  5DX5 A;  1AHE A;  2AEV A;  4LC3 A;  4EFF A;  1M0P A;  4I8A A;  1WYU B;  2BHX A;  1DTY A;  2DGM A;  2JG2 A;  1ASE A;  5J8Q A;  1YIY A;  3AEN B;  4A6U A;  1ASN A;  1BKG A;  2C44 A;  1AJS A;  3FKD A;  4R2N A;  5EUD A;  2W8T A;  3MAU A;  3R4T A;  1M0O A;  2Q7W A;  4RIZ A;  2BIG A;  4U2H A;  4XJP A;  2Z1Z A;  1H1C A;  3UWC A;  4GEB A;  2CH2 A;  1PFF A;  1ASF A;  1MLZ A;  2BWO A;  3FRK A;  3KE3 A;  4JEX A;  3MEB A;  3GJU A;  2QBT A;  3EIB A;  3DYD A;  2DGL A;  1W3U A;  1EG5 A;  3NUB A;  1GEY A;  3PDB B;  2QLR A;  2W8J A;  1GEW A;  1ASB A;  2W7K A;  2Z9U A;  3WLX A;  4CVQ A;  3F0H A;  2E7J A;  2R2N A;  1IJI A;  2VLF A;  5BJ3 A;  4O6Z A;  4OT8 A;  3DOD A;  4E1O A;  2EZ1 A;  1BJ4 A;  4LW2 A;  5DB5 A;  2C7T A;  2D66 A;  2HUU A;  4ITX A;  1UKJ A;  2W8U A;  3RBL A;  4TMR A;  3PJ0 A;  3CQ4 A;  1TOE A;  4AO9 A;  1ASL A;  1DJ9 A;  2BYJ A;  2PB0 A;  4CBR A;  1AHY A;  3PD6 B;  3DR4 A;  4F5I A;  5EAV A;  1YAA A;  2BYL A;  1SF2 A;  2VGS A;  3ELP A;  4WLJ A;  2QA3 A;  1KMJ A;  4PFN A;  3KGW A;  4OBV A;  5G4I A;  2GB3 A;  4KYO A;  3D6K A;  3VOM A;  4IW7 A;  1WYU A;  4PVF A;  3HL2 A;  1ARS A;  4MQQ A;  5E5I A;  3LVK A;  4ADE A;  3WGB A;  2W7F A;  4GRX A;  1ZOD A;  5G2P A;  3FDD A;  1G7X A;  1I48 A;  3EI6 A;  3FSL A;  3VK2 A;  4F5J A;  2F8J A;  3NYT A;  1RVY A;  3E6G A;  1SPA A;  4B98 A;  3N4S A;  2D61 A;  2CJD A;  4MY5 A;  1D7S A;  1LK9 A;  1ELU A;  5EIG A;  4EB5 A;  2GSA A;  3LVM A;  4Q76 A;  1O69 A;  5E3K A;  3WKR A;  4E3R A;  4EB7 A;  2BIE A;  3MAF B;  4E3Q A;  1MLY A;  4F5H A;  3LVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...