1TOJA

Hydrocinnamic acid-bound structure of srhept mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFALYNERVGACTLVAADSETVDRAFGQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 140
structure length 395
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1tojA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1tojA01
1CQ8A 1AICA 2AY1A 1CL1A 1YJSA 5IWQA 4XEWA 1BW0A 3VAXA 3EIBA 3GSBA 1YIYA 5C6UA 1IAYA 5D95A 1YJZA 1JF9A 1AHXA 4WYDA 1AJRA 3RCHA 3GZDA 3B1EA 4Y0DA 4XJMA 3EUCA 2PB0A 3PDXA 1ASAA 2EH6A 5M46A 1KMKA 2CFBA 3EI5A 3EIAA 4BQ0A 3FVSA 3QPGA 3A8UX 4JF0A 1O4SA 7AATA 4F5MA 2JG2A 1H1CA 1Z7DA 1WYTB 3ASAA 2W7HA 2AATA 3AELA 3PDBA 4OTLA 4F5KA 1WKHA 3HVYA 1LC8A 3NU8A 4W1WA 2BIGA 4MGRA 2AY5A 2DGMA 1G4XA 3W1IA 3ASBA 5FT8A 2O7CA 2VGVA 2GSAA 4BA5A 1N31A 3NYUA 4ADCA 3AEPA 2W7JA 4DGTA 2QBTA 1WYVB 3B8XA 3PD6A 4LNJA 2CJHA 1C7NA 2W7KA 4DQ6A 1WYTA 1I48A 2X5DA 3BCAA 1LW4A 1M0QA 1ARHA 1E5EA 1V2EA 4WB0A 3NX3A 2E7IA 3JTXA 3F6TA 5EIGB 3FRKA 4HF8A 1AIBA 1AMRA 1OXPA 3FTBA 1AJSA 5EUDA 3FFHA 4ZWMA 3GR9A 1UKJA 2HUIA 4IYOA 1ORDA 2W8JA 1FG7A 1KMJA 2EZ2A 4JE5A 4J8LA 1RV3A 3I16A 3E2FA 3FFRA 1AKAA 2FN6A 1CJ0A 4PVFA 4OT8A 1QJ5A 2W8VA 2BI5A 1IUGA 3EI9A 1PFFA 4RIZA 2BI3A 2Z9UA 2VGTA 1LW5A 3QGUA 3K7YA 2ZUKA 1B8GA 5EUNA 3L44A 2CJGA 3DRDA 3E6GA 3DYDA 4CBSA 1BQAA 3PIUA 3QI6A 3ATHA 4WXGA 1OATA 3FQ8A 1LK9A 4AZKA 2OGEA 4RLGA 1GC2A 1GDEA 5E4ZA 3RBLA 1ZOBA 5FT5A 2DR1A 1LC7A 5F9SA 2CJDA 1C0NA 3JW9A 2AY2A 1B9IA 3AEJC 1IJIA 2X5FA 4RKCA 2W7GA 3E2ZA 3RBFA 4DBCA 2VMQA 4F5FA 4ZM4A 2QB3A 2XH1A 4CXQA 1ASFA 1TARA 2YKXA 3PAAA 5AX8A 2JJFA 3F0HA 3QHXA 1M0PA 2W8UA 5EAAA 2W7LA 1B5OA 2HOYA 3W1JA 1ARIA 1J04A 5LHAA 3LV2A 3AEMA 4E1OA 1S07A 2Z9XA 1JS6A 2QB2A 4PFFA 4UHOA 3MADA 2Z67A 3FDBA 3N0LA 3Q8NA 5EUEA 3FZ6A 1QIRA 3KGXA 1MGVA 4UOYA 4A6TA 2FNIA 4OC9A 1BT4A 1BJNA 3EI8A 3GZCA 2CH2A 4ZAHA 4EB7A 1DFOA 1BJOA 4LW4A 2EGYA 1XEYA 4L0OA 3VK2A 1MAPA 4WYAA 2V0YA 2Z20A 2BI1A 2D7ZA 1SZSA 2WKAA 3I4JA 2D63A 4KYOA 4W1XA 1RV4A 1Y4IA 1V72A 4LW2A 4CXRA 3FZ8A 1GC4A 4IW7A 3G7QA 1E5FA 4HVKA 5F8VA 2Z9WA 3OKSA 4OCAA 3OP7A 1CQ6A 5G4IA 3R4TA 4EU1A 2D65A 3DZZA 3G8MA 2BHXA 3COGA 1AY8A 1M4NA 4R5ZA 2AEVA 2OGAA 3PA9A 2W8TA 1OHYA 4F5GA 4GEBA 1QITA 2FM1A 4W91A 1WKGA 2ZJGA 3LVKA 4ITGA 5EFSA 2CINA 1JS3A 2HP1A 3BCXA 4XJOA 3FD0A 4ZLVA 2O0RA 1C4KA 3MC6C 2ZY5A 1GBNA 4BHDA 4K2MA 4R8DA 4TV7A 4AH3A 4EMYA 3ZRPA 2OATA 3BB8A 3PDBB 1ASDA 1TOKA 3PJ0A 1ASLA 4LC3A 3T32A 2AY7A 4Y0IA 2EO5A 2C0RA 3NRAA 5DJ9A 2Z1YA 4W5KA 3PPLA 1W7NA 1GC3A 1LS3A 2OKKA 5D5SA 3WGBA 1CQ7A 4Q31A 1BQDA 3PD6B 3A9ZA 3FVXA 1IBJA 5G2PA 1V2FA 3HDOA 3CBFA 2Q7WA 1U08A 2W7EA 3GWPA 3MBBA 1CZCA 4WB0B 1AAWA 3P1TA 3LVJA 1UU2A 1I43A 1UU1A 1O61A 1ELUA 2BI9A 1AJSB 1AMAA 1DJ9A 4AOAA 4N0BA 1FC4A 2G6WA 4ZDOA 3BN1A 2QA3A 4IYOB 2VGUA 4E77A 2GMUA 2F8JA 4GE9A 3TCMA 1YNUA 1IX6A 2R0TA 1LC5A 2D66A 3EI7A 2X8UA 4WBTA 4WYEA 1S06A 1TOGA 4RAEA 4CVQA 3WX9A 1M6SA 3ELEA 1IAXA 1AKCA 1YJYA 2VMTA 1M32A 3WGCA 2HOZA 4RITA 2DGKA 2W7IA 3CQ5A 1BKGA 3E77A 2QMAA 4AO9A 1ASNA 3PGYA 3B1DA 4U2HA 1C9CA 4E3QA 3RQ1A 4P7YA 1XI9A 3F9TA 3AATA 1DJEA 5HHYA 2VMYA 3QM2A 2X3LA 2V1PA 1JG8A 2Z61A 5K8BA 2VMSA 2DKBA 4WXFA 3KE3A 1X28A 1M0OA 1SFFA 2VMUA 4NOGA 3CQ4A 1S09A 2BI2A 4PFNA 3AV7A 3ZRRA 4ATPA 4ADBA 3E2YA 2AY6A 3NYSA 4IXZA 5EQCA 3E2ZB 2W8WA 3HQTA 3VK4A 1KKPA 4ZASA 4Y0HA 3A9YA 2OKJA 3HMUA 4RM1A 3WCNA 5DJ1A 4H51A 1AMSA 3WKSA 4N0WA 1LKCA 4A6RA 4B9BA 4BMKA 3BWNA 1QZ9A 2YCNA 3ELPA 2VIBA 1EQBA 2BWPA 1MDZA 3GZDC 4RJ0A 5DX5A 2CTZA 2VI8A 2VGSA 1TASA 1TOIA 3LWSA 3ZZJA 2QLRA 2JISA 2YCTA 2ZSMA 2W7MA 4W8IA 4AZJA 3EZ1A 2RFVA 2O1BA 1BJOB 1W3UA 2D64A 3CAIA 1GEXA 5E3KA 1WSTA 1C7OA 4M2MA 3BWOA 4XJLA 4XK1A 4EB5A 3DR4A 1ASEA 4GRXA 3A9XA 1MDXA 3RI6A 3WLXA 4RJYA 5TF5A 2BIAA 1ASMA 2E7UA 5HDMA 1BJ4A 4WLJA 1BS0A 1RVYA 4FL0A 4ZM3A 4A72A 1B4XA 3ECDA 1DJUA 3IHJA 4MQPA 1T3IA 1D7SA 1ARTA 2OQXA 2HUUA 3FSLA 2JJHA 3TFTA 3II0A 4WD2A 1N2TA 1AHFA 3AENA 2WK7A 2ZYJA 1MLZA 1DGDA 1VP4A 1GEYA 4JEXA 4P3MA 2YKVA 1AKBA 3MKJA 2WK8A 3VK3A 1YIZA 1OHWA 4F5IA 3FKDA 3EI6A 3NUBA 3TFUA 3KKIA 3GETA 3A2BA 2ZC0A 4WYCA 4MQRA 4IY7A 4R2NA 3GJUA 4MKKA 2R5CA 3UE8A 2AY3A 2VMWA 4OMAA 4JEZA 4MQQA 3WCOA 3MAFB 1SZKA 2VLHA 1AAMA 1RVUA 3HLMA 3JWAA 4F5JA 2PO3A 3K40A 4GDYA 1VJOA 2CY8A 4M2KA 1GCKA 2Z1ZA 3DXVA 1AX4A 2JJGA 2BWNA 2VMZA 1TATA 4JEWA 4OBUA 2TPLA 1EG5A 3IF2A 2DKJA 1D7RA 3ZRQA 1SPAA 3ZZKA 4ZDLA 1ASCA 4UHNA 4JEYA 2AY8A 1X0MA 4EFFA 4PIWA 1D7VA 2VGZA 3MAFA 2JGTA 1W23A 3QN6A 4KAMA 1AY5A 3WKRA 4LNMA 2PB2A 2D61A 2AY9A 1PMMA 2VIAA 3NDNA 4GSAA 3USFA 1I29A 2XBNA 2DOUA 3NUIA 4IXOA 2ORDA 4MKJA 4A6UA 2GQNA 4A0HA 2E54A 2ZY4A 1YOOA 5BJ3A 2YHKA 1ECXA 3AOVA 5BJ4A 4KXKA 2YRRA 4IXSA 4I8AA 4BA4A 4ADDA 2BWOA 1ARSA 5M49A 2W7FA 2ZSLA 4TMRA 4MSOA 3AEMC 5J8QA 2VMVA 3FCRA 2NMPA 2E7JA 3TQXA 3DU4A 4TN4A 1WYUA 1PG8A 3DXWA 4B98A 3AEJA 4K2BA 2CSTA 3P6KA 4Q75A 2ZP7A 3EZSA 2BYLA 3VP6A 3LVLB 1V2DA 4E3RA 3HL2A 1OHVA 2VMPA 3RUYA 3K28A 1G7XA 4IX8A 2VLFA 5G4JA 1CS1A 4ZSWA 2YRIA 2VI9A 2VMOA 3BS8A 1SZUA 4WP0A 1ELQA 4F4EA 1G4VA 2JJEA 4Q76A 5M4BA 2BKWA 1X29A 2HZPA 4GE4A 2CH1A 2YCPA 3UWCA 1I41A 1W7LA 4WYGA 3H14A 5FT4A 5HXXA 1D7UA 1CL2A 3MAUA 3H7FA 3HBXA 1UU0A 2FQ6A 5G2QA 1N8PA 2D7YA 3G0TA 4GE7A 3E9KA 4ZDPA 3UAKA 3CQ6A 3WZFA 3WY7A 5G0AA 4ADEA 1B5PA 1QGNA 2WK9A 3TATA 2VMXA 1O69A 2EZ1A 3D6KA 3NU7A 1GEWA 1WYVA 2R5EA 3GBXA 1ASBA 3MEBA 1X2AA 3I5TA 1YAAA 4A0GA 3FDDA 1P3WA 2VMRA 4M2JA 1M0NA 3HT4A 3JWBA 4JE5D 1C7GA 3LG0A 5EIGA 3MC6A 1D2FA 2HP2A 4ZWVA 4UQVA 4F5HA 1O62A 1TOEA 3DR7A 4UHMA 5EAVA 3DC1A 1OXOA 1TPLA 4WYFA 1Z3ZA 3AENB 3FQ7A 4LNLA 1AIAA 4ATQA 3JZLA 1AY4A 4ITXA 3QBOA 2VMNA 1MLYA 2ZY3A 1IVRA 1J32A 2D5YA 2FYFA 2W7DA 2AEUA 3ACZA 4FFCA 3N75A 3R9AA 3N5MA 2AY4A 3FQAA 1QISA 4J5UA 4ZSYA 4O6ZA 1G7WA 1AHYA 4F5LA 1SF2A 1MDOA 5DB5A 1AHEA 4R5FA 4MY5A 4AO4A 1ASGA 2R5CB 1QJ3A 1AHGA 2DGLA 4XAUA 1DKAA 2YKUA 2GB3A 3BV0A 2R2NA 2Z9VA 9AATA 4JF1A 2CANA 2C7TA 3B1CA 1BJWA 3VOMA 2YOBA 3DODA 5LH9A 2BYJA 2VGWA 4U1TA 2C44A 1KL2A 4ISYA 3AOWA 1S08A 3KGWA 1PMOA 1KL1A 4XQ2A 4A0RA 1DTYA 1KKJA 2HORA 2HOXA 2YKYA 3L8AA 3ISLA 1ZODA 3FZ7A 3AEOA 1W7MA 3M5UA 5M4DA 1S0AA 1VEFA 4RKDA 1DGEA 1AMQA 2FNUA 4QGRA 3LVMA 1ZC9A 4A00A 1WYUB 3FVUA 1H0CA 3NNKA 3JU7A 2GMSA 1MAQA 4XJPA 1TOJA 4WXBA 1IX7A 2ZY2A 4WLHA 1B9HA 1FG3A 4CBRA 5E5IA 3BCBA 1GC0A 5FT6A 3LY1A 2CB1A 5I92A 4A0FA 4W1VA 3B46A 1SVVA 5G09A 3NYTA 3RCHB 3W1HA 4OBVA 1M7YA 5JAYA 3BWNC 1IX8A 1ARGA 2EPJA 1CZEA 8AATA 3NTJA 4OYTA 1GD9A 1EJIA 2HUFA 4Q6RA 4K2IA 4JEVA 2BIEA 3BC8A 2VYCA 2C81A
chains in the Genus database with same CATH superfamily
1CQ8A 1AICA 1KAFA 2AY1A 1CL1A 1YJSA 5IWQA 4XEWA 1BW0A 3VAXA 3EIBA 3GSBA 1YIYA 5C6UA 1IAYA 5D95A 1YJZA 1JF9A 1AHXA 4WYDA 1AJRA 3RCHA 3GZDA 3B1EA 4Y0DA 4XJMA 3EUCA 2PB0A 3PDXA 1ASAA 2EH6A 5M46A 1KMKA 2CFBA 3EI5A 3EIAA 4BQ0A 3FVSA 3QPGA 3A8UX 4JF0A 1O4SA 7AATA 4F5MA 2JG2A 1H1CA 1Z7DA 1WYTB 3ASAA 2W7HA 2AATA 3AELA 3PDBA 4OTLA 4F5KA 1WKHA 3HVYA 1LC8A 3NU8A 4W1WA 2BIGA 4MGRA 2QSRA 2AY5A 2DGMA 1G4XA 3W1IA 3ASBA 5FT8A 2O7CA 2VGVA 2GSAA 4BA5A 1N31A 3NYUA 4ADCA 3AEPA 2W7JA 4DGTA 2QBTA 1WYVB 3B8XA 3PD6A 4LNJA 2CJHA 1C7NA 2W7KA 4DQ6A 1WYTA 1I48A 2X5DA 3BCAA 1LW4A 1M0QA 1ARHA 1E5EA 1V2EA 4WB0A 3NX3A 3N4SA 2E7IA 3JTXA 3F6TA 5EIGB 3FRKA 4HF8A 1AIBA 1AMRA 1OXPA 3FTBA 1AJSA 5EUDA 3FFHA 4ZWMA 3GR9A 1UKJA 2HUIA 4IYOA 1ORDA 2W8JA 1FG7A 1KMJA 2EZ2A 4JE5A 4J8LA 1RV3A 3I16A 3E2FA 3FFRA 1AKAA 2FN6A 1CJ0A 4PVFA 4OT8A 1QJ5A 2W8VA 2BI5A 1IUGA 3EI9A 1PFFA 4RIZA 2BI3A 2Z9UA 2VGTA 1LW5A 3QGUA 3K7YA 2ZUKA 1B8GA 5EUNA 3L44A 2CJGA 3DRDA 3E6GA 3DYDA 4CBSA 1BQAA 3PIUA 3QI6A 3ATHA 4WXGA 1OATA 3FQ8A 1LK9A 4AZKA 2OGEA 4RLGA 1GC2A 1GDEA 5E4ZA 3RBLA 1ZOBA 5FT5A 2DR1A 1LC7A 5F9SA 2CJDA 1C0NA 3JW9A 2AY2A 1B9IA 3AEJC 1IJIA 2X5FA 4RKCA 2W7GA 3E2ZA 3RBFA 4DBCA 2VMQA 4F5FA 4ZM4A 2QB3A 2XH1A 4CXQA 1ASFA 1TARA 2YKXA 3PAAA 5AX8A 2JJFA 3F0HA 3QHXA 1M0PA 2W8UA 5EAAA 2W7LA 1B5OA 2HOYA 3W1JA 1ARIA 1J04A 5LHAA 3LV2A 3AEMA 4E1OA 1S07A 2Z9XA 1JS6A 2QB2A 4PFFA 4UHOA 3MADA 2Z67A 3FDBA 3N0LA 3Q8NA 5EUEA 3FZ6A 1QIRA 3KGXA 1MGVA 4UOYA 4A6TA 2FNIA 4OC9A 1BT4A 1BJNA 3EI8A 3GZCA 2CH2A 4ZAHA 4EB7A 1DFOA 1BJOA 4LW4A 4H63Q 2EGYA 1XEYA 4L0OA 3VK2A 1MAPA 4WYAA 2V0YA 2Z20A 2BI1A 2D7ZA 1SZSA 2WKAA 3I4JA 2D63A 4KYOA 4W1XA 1RV4A 1Y4IA 1V72A 3N4RA 4LW2A 4CXRA 3FZ8A 1GC4A 4IW7A 3G7QA 1E5FA 4HVKA 5F8VA 2Z9WA 3OKSA 4OCAA 3OP7A 1CQ6A 5G4IA 3R4TA 4EU1A 2D65A 3DZZA 3G8MA 2BHXA 3COGA 1AY8A 1M4NA 4R5ZA 2AEVA 2OGAA 3PA9A 2W8TA 1OHYA 4F5GA 4GEBA 1QITA 2FM1A 4W91A 1WKGA 2ZJGA 3LVKA 4ITGA 5EFSA 2CINA 1JS3A 2HP1A 3BCXA 4XJOA 3FD0A 4ZLVA 2O0RA 1C4KA 3MC6C 2ZY5A 1GBNA 4BHDA 4K2MA 4R8DA 4TV7A 4AH3A 4EMYA 3ZRPA 2OATA 3BB8A 3PDBB 1ASDA 1TOKA 3PJ0A 1ASLA 4LC3A 3T32A 2AY7A 4Y0IA 2EO5A 2C0RA 3NRAA 5DJ9A 2Z1YA 4W5KA 3PPLA 2KFPA 1W7NA 1GC3A 1LS3A 2OKKA 5D5SA 3WGBA 1CQ7A 4Q31A 1BQDA 3PD6B 3A9ZA 3FVXA 1IBJA 5G2PA 1V2FA 3HDOA 3CBFA 3N7NA 2Q7WA 1U08A 2W7EA 3GWPA 3MBBA 1CZCA 4WB0B 1AAWA 3P1TA 3LVJA 1UU2A 1I43A 1UU1A 1O61A 1ELUA 2BI9A 1AJSB 1AMAA 1DJ9A 4AOAA 4N0BA 1FC4A 2G6WA 4ZDOA 3BN1A 2QA3A 4IYOB 2VGUA 4E77A 2GMUA 2F8JA 4GE9A 3TCMA 1YNUA 1IX6A 2R0TA 1LC5A 2D66A 3EI7A 2X8UA 4WBTA 4WYEA 1S06A 1TOGA 4RAEA 4CVQA 3WX9A 1M6SA 3ELEA 1IAXA 1AKCA 1YJYA 2VMTA 1M32A 3WGCA 5KTBA 2HOZA 4RITA 2DGKA 2W7IA 3CQ5A 1BKGA 3E77A 2QMAA 4AO9A 1ASNA 3PGYA 3B1DA 4U2HA 1C9CA 4E3QA 3RQ1A 4P7YA 1XI9A 3F9TA 3AATA 1DJEA 5HHYA 2VMYA 3QM2A 2X3LA 2V1PA 1JG8A 2Z61A 5K8BA 2VMSA 2DKBA 2EYQA 4WXFA 3KE3A 1X28A 1M0OA 1SFFA 2VMUA 4NOGA 3CQ4A 1S09A 2BI2A 4PFNA 3AV7A 3ZRRA 4ATPA 4ADBA 3E2YA 2AY6A 3NYSA 2A1VA 4IXZA 5EQCA 3E2ZB 2W8WA 2FKIA 3HQTA 3VK4A 1KKPA 4ZASA 4Y0HA 3A9YA 2OKJA 3HMUA 4RM1A 3WCNA 5DJ1A 4H51A 1AMSA 3WKSA 4N0WA 1LKCA 4A6RA 4B9BA 4BMKA 3BWNA 1QZ9A 2YCNA 3ELPA 2VIBA 1EQBA 2BWPA 1MDZA 3GZDC 4RJ0A 5DX5A 2CTZA 2VI8A 2VGSA 1TASA 1TOIA 3LWSA 3ZZJA 2QLRA 2JISA 2YCTA 2ZSMA 2W7MA 4W8IA 4AZJA 3EZ1A 2RFVA 2O1BA 1BJOB 1W3UA 2D64A 3CAIA 1GEXA 5E3KA 1WSTA 1C7OA 4M2MA 3BWOA 4XJLA 4XK1A 4EB5A 3DR4A 1ASEA 4GRXA 3A9XA 1MDXA 3RI6A 3WLXA 4RJYA 5TF5A 2BIAA 1ASMA 2E7UA 5HDMA 1BJ4A 4WLJA 1BS0A 1RVYA 4FL0A 4ZM3A 4A72A 1B4XA 3ECDA 1DJUA 3IHJA 4MQPA 1T3IA 1D7SA 1ARTA 2OQXA 2HUUA 3FSLA 2JJHA 3H9XA 3TFTA 3II0A 4WD2A 1N2TA 1AHFA 3AENA 2WK7A 2ZYJA 1MLZA 1DGDA 1VP4A 1GEYA 4JEXA 4P3MA 2YKVA 1AKBA 3MKJA 2WK8A 3VK3A 1YIZA 1OHWA 4F5IA 3FKDA 3EI6A 3NUBA 3TFUA 3KKIA 3GETA 3A2BA 2ZC0A 4WYCA 4MQRA 4IY7A 4R2NA 3GJUA 4MKKA 2R5CA 3UE8A 2AY3A 2VMWA 4OMAA 4JEZA 4MQQA 3WCOA 3MAFB 1SZKA 2VLHA 1AAMA 1RVUA 3HLMA 3JWAA 4F5JA 2PO3A 3K40A 2G7JA 4GDYA 1VJOA 2CY8A 4M2KA 1GCKA 2Z1ZA 3DXVA 1AX4A 2JJGA 2BWNA 2VMZA 1TATA 4JEWA 4OBUA 2TPLA 1EG5A 3IF2A 2DKJA 1D7RA 3ZRQA 1SPAA 3ZZKA 4ZDLA 1ASCA 4UHNA 4JEYA 2AY8A 1X0MA 4EFFA 4PIWA 1D7VA 2VGZA 3MAFA 2JGTA 1W23A 3QN6A 4KAMA 1AY5A 3WKRA 4LNMA 2PB2A 2D61A 2AY9A 1PMMA 2VIAA 3NDNA 4GSAA 3USFA 1I29A 2XBNA 2DOUA 3NUIA 4IXOA 2ORDA 4MKJA 4A6UA 4K05A 2GQNA 4A0HA 2E54A 2ZY4A 1YOOA 5BJ3A 2YHKA 1ECXA 3AOVA 5BJ4A 4KXKA 2YRRA 4IXSA 4I8AA 4BA4A 4ADDA 2BWOA 1ARSA 5M49A 2W7FA 2ZSLA 4TMRA 4MSOA 3AEMC 5J8QA 2VMVA 3FCRA 2NMPA 2E7JA 3TQXA 3DU4A 4TN4A 1WYUA 1PG8A 3DXWA 4B98A 3AEJA 4K2BA 2CSTA 3P6KA 4Q75A 2ZP7A 3EZSA 2BYLA 3VP6A 3LVLB 1V2DA 4E3RA 3HL2A 1OHVA 2VMPA 3RUYA 3K28A 1G7XA 4IX8A 2VLFA 5G4JA 1CS1A 4ZSWA 2YRIA 2VI9A 2VMOA 3BS8A 1SZUA 4WP0A 1ELQA 4F4EA 1G4VA 2JJEA 4Q76A 5M4BA 2BKWA 1X29A 2HZPA 4GE4A 2CH1A 2YCPA 3UWCA 1I41A 1W7LA 4WYGA 3H14A 5FT4A 5HXXA 1D7UA 1CL2A 3MAUA 3H7FA 3HBXA 1UU0A 2FQ6A 5G2QA 1N8PA 2D7YA 3G0TA 4GE7A 3E9KA 4ZDPA 3UAKA 3CQ6A 3WZFA 3WY7A 5G0AA 4ADEA 1B5PA 1QGNA 2WK9A 3TATA 2VMXA 1O69A 2EZ1A 3D6KA 3NU7A 1GEWA 1WYVA 2R5EA 3GBXA 1ASBA 3MEBA 1X2AA 3I5TA 1YAAA 4A0GA 3FDDA 1P3WA 2VMRA 4M2JA 1M0NA 3HT4A 3JWBA 4JE5D 1C7GA 3LG0A 5EIGA 3MC6A 1D2FA 2HP2A 4ZWVA 4UQVA 4F5HA 1O62A 1TOEA 3DR7A 4UHMA 5EAVA 3DC1A 1OXOA 1TPLA 4WYFA 1Z3ZA 3AENB 3FQ7A 4LNLA 1AIAA 4ATQA 3JZLA 1AY4A 4ITXA 3QBOA 2VMNA 1MLYA 2ZY3A 1IVRA 1J32A 2D5YA 2FYFA 2W7DA 2AEUA 3ACZA 4FFCA 3N75A 3R9AA 3N5MA 2AY4A 3FQAA 1QISA 4J5UA 4ZSYA 4O6ZA 1G7WA 1AHYA 4F5LA 1SF2A 1MDOA 5DB5A 1AHEA 4R5FA 4MY5A 4AO4A 1ASGA 2R5CB 1QJ3A 3N4XA 1AHGA 2DGLA 4XAUA 1DKAA 2YKUA 2GB3A 3BV0A 2R2NA 2Z9VA 9AATA 4JF1A 2CANA 2C7TA 3B1CA 1BJWA 3VOMA 2YOBA 3DODA 5LH9A 2WB6A 2BYJA 2VGWA 4U1TA 2C44A 1KL2A 4ISYA 3AOWA 1S08A 3KGWA 1PMOA 1KL1A 4XQ2A 4A0RA 1DTYA 1KKJA 2HORA 2HOXA 2YKYA 3L8AA 3ISLA 1ZODA 3FZ7A 3AEOA 1W7MA 3M5UA 5M4DA 1S0AA 1VEFA 4RKDA 1DGEA 1AMQA 2FNUA 4QGRA 3LVMA 1ZC9A 4A00A 1WYUB 3FVUA 1H0CA 3NNKA 3JU7A 2GMSA 1MAQA 4XJPA 1TOJA 4WXBA 1IX7A 2ZY2A 4WLHA 1B9HA 1FG3A 4CBRA 5E5IA 3BCBA 1GC0A 5FT6A 3LY1A 2CB1A 5I92A 4A0FA 4W1VA 3B46A 1SVVA 5G09A 3NYTA 3RCHB 3W1HA 4OBVA 1M7YA 5JAYA 3BWNC 1IX8A 1ARGA 2EPJA 1CZEA 8AATA 3NTJA 4OYTA 1GD9A 1EJIA 2HUFA 4Q6RA 4K2IA 4JEVA 2BIEA 3BC8A 2VYCA 2C81A
chains in the Genus database with same CATH topology
1CQ8A 1AICA 2AY1A 1CL1A 1YJSA 5IWQA 4XEWA 1BW0A 3VAXA 3EIBA 3GSBA 1YIYA 5C6UA 1IAYA 5D95A 1YJZA 1JF9A 1AHXA 4WYDA 1AJRA 3RCHA 3GZDA 3B1EA 4Y0DA 4XJMA 3EUCA 2PB0A 3PDXA 1ASAA 2EH6A 5M46A 1KMKA 2CFBA 3EI5A 3EIAA 4BQ0A 3FVSA 3QPGA 3A8UX 4JF0A 1O4SA 7AATA 4F5MA 2JG2A 1H1CA 1Z7DA 1WYTB 3ASAA 2W7HA 2AATA 3AELA 3PDBA 4OTLA 4F5KA 1WKHA 3HVYA 1LC8A 3NU8A 4W1WA 2BIGA 4MGRA 2QSRA 2AY5A 2DGMA 1G4XA 3W1IA 3ASBA 5FT8A 2O7CA 2VGVA 2GSAA 4BA5A 1N31A 3NYUA 4ADCA 3AEPA 2W7JA 4DGTA 2QBTA 1WYVB 3B8XA 3PD6A 4LNJA 2CJHA 1C7NA 2W7KA 4DQ6A 1WYTA 1I48A 2X5DA 3BCAA 1LW4A 1M0QA 1ARHA 1E5EA 1V2EA 4WB0A 3NX3A 3N4SA 2E7IA 3JTXA 3F6TA 5EIGB 3FRKA 4HF8A 1AIBA 1AMRA 1OXPA 3FTBA 1AJSA 5EUDA 3FFHA 4ZWMA 3GR9A 1UKJA 2HUIA 4IYOA 1ORDA 2W8JA 1FG7A 1KMJA 2EZ2A 4JE5A 4J8LA 1RV3A 3I16A 3E2FA 3FFRA 1AKAA 2FN6A 1CJ0A 4PVFA 4OT8A 1QJ5A 2W8VA 2BI5A 1IUGA 3EI9A 1PFFA 4RIZA 2BI3A 2Z9UA 2VGTA 1LW5A 3QGUA 3K7YA 2ZUKA 1B8GA 5EUNA 3L44A 2CJGA 3DRDA 3E6GA 3DYDA 4CBSA 1BQAA 3PIUA 3QI6A 3ATHA 4WXGA 1OATA 3FQ8A 1LK9A 4AZKA 2OGEA 4RLGA 1GC2A 1GDEA 5E4ZA 3RBLA 1ZOBA 5FT5A 2DR1A 1LC7A 5F9SA 2CJDA 1C0NA 3JW9A 2AY2A 1B9IA 3AEJC 1IJIA 2X5FA 4RKCA 2W7GA 3E2ZA 3RBFA 4DBCA 2VMQA 4F5FA 4ZM4A 2QB3A 2XH1A 4CXQA 1ASFA 1TARA 2YKXA 3PAAA 5AX8A 2JJFA 3F0HA 3QHXA 1M0PA 2W8UA 5EAAA 2W7LA 1B5OA 2HOYA 3W1JA 1ARIA 1J04A 5LHAA 3LV2A 3AEMA 4E1OA 1S07A 2Z9XA 1JS6A 2QB2A 4PFFA 4UHOA 3MADA 2Z67A 3FDBA 3N0LA 3Q8NA 5EUEA 3FZ6A 1QIRA 3KGXA 1MGVA 4UOYA 4A6TA 2FNIA 4OC9A 1BT4A 1BJNA 3EI8A 3GZCA 2CH2A 4ZAHA 4EB7A 1DFOA 1BJOA 4LW4A 4H63Q 2EGYA 1XEYA 4L0OA 3VK2A 1MAPA 4WYAA 2V0YA 2Z20A 2BI1A 2D7ZA 1SZSA 2WKAA 3I4JA 2D63A 4KYOA 4W1XA 1RV4A 1Y4IA 1V72A 3N4RA 4LW2A 4CXRA 3FZ8A 1GC4A 4IW7A 3G7QA 1E5FA 4HVKA 5F8VA 2Z9WA 3OKSA 4OCAA 3OP7A 1CQ6A 5G4IA 3R4TA 4EU1A 2D65A 3DZZA 3G8MA 2BHXA 3COGA 1AY8A 1M4NA 4R5ZA 2AEVA 2OGAA 3PA9A 2W8TA 1OHYA 4F5GA 4GEBA 1QITA 2FM1A 4W91A 1WKGA 2ZJGA 3LVKA 4ITGA 5EFSA 2CINA 1JS3A 2HP1A 3BCXA 4XJOA 3FD0A 4ZLVA 2O0RA 1C4KA 3MC6C 2ZY5A 1GBNA 4BHDA 4K2MA 4R8DA 4TV7A 4AH3A 4EMYA 3ZRPA 2OATA 3BB8A 3PDBB 1ASDA 1TOKA 3PJ0A 1ASLA 4LC3A 3T32A 2AY7A 4Y0IA 2EO5A 2C0RA 3NRAA 5DJ9A 2Z1YA 4W5KA 3PPLA 2KFPA 1W7NA 1GC3A 1LS3A 2OKKA 5D5SA 3WGBA 1CQ7A 4Q31A 1BQDA 3PD6B 3A9ZA 3FVXA 1IBJA 5G2PA 1V2FA 3HDOA 3CBFA 3N7NA 2Q7WA 1U08A 2W7EA 3GWPA 3MBBA 1CZCA 4WB0B 1AAWA 3P1TA 3LVJA 1UU2A 1I43A 1UU1A 1O61A 1ELUA 2BI9A 1AJSB 1AMAA 1DJ9A 4AOAA 4N0BA 1FC4A 2G6WA 4ZDOA 3BN1A 2QA3A 4IYOB 2VGUA 4E77A 2GMUA 2F8JA 4GE9A 3TCMA 1YNUA 1IX6A 2R0TA 1LC5A 2D66A 3EI7A 2X8UA 4WBTA 4WYEA 1S06A 1TOGA 4RAEA 4CVQA 3WX9A 1M6SA 3ELEA 1IAXA 1AKCA 1YJYA 2VMTA 1M32A 3WGCA 5KTBA 2HOZA 4RITA 2DGKA 2W7IA 3CQ5A 1BKGA 3E77A 2QMAA 4AO9A 1ASNA 3PGYA 3B1DA 4U2HA 1C9CA 4E3QA 3RQ1A 4P7YA 1XI9A 3F9TA 3AATA 1DJEA 5HHYA 2VMYA 3QM2A 2X3LA 2V1PA 1JG8A 2Z61A 5K8BA 2VMSA 2DKBA 2EYQA 4WXFA 3KE3A 1X28A 1M0OA 1SFFA 2VMUA 4NOGA 3CQ4A 1S09A 2BI2A 4PFNA 3AV7A 3ZRRA 4ATPA 4ADBA 3E2YA 2AY6A 3NYSA 2A1VA 4IXZA 5EQCA 3E2ZB 2W8WA 2FKIA 3HQTA 3VK4A 1KKPA 4ZASA 4Y0HA 3A9YA 2OKJA 3HMUA 4RM1A 3WCNA 5DJ1A 4H51A 1AMSA 3WKSA 4N0WA 1LKCA 4A6RA 4B9BA 4BMKA 3BWNA 1QZ9A 2YCNA 3ELPA 2VIBA 1EQBA 2BWPA 1MDZA 3GZDC 4RJ0A 5DX5A 2CTZA 2VI8A 2VGSA 1TASA 1TOIA 3LWSA 3ZZJA 2QLRA 2JISA 2YCTA 2ZSMA 2W7MA 4W8IA 4AZJA 3EZ1A 2RFVA 2O1BA 1BJOB 1W3UA 2D64A 3CAIA 1GEXA 5E3KA 1WSTA 1C7OA 4M2MA 3BWOA 4XJLA 4XK1A 4EB5A 3DR4A 1ASEA 4GRXA 3A9XA 1MDXA 3RI6A 3WLXA 4RJYA 5TF5A 2BIAA 1ASMA 2E7UA 5HDMA 1BJ4A 4WLJA 1BS0A 1RVYA 4FL0A 4ZM3A 4A72A 1B4XA 3ECDA 1DJUA 3IHJA 4MQPA 1T3IA 1D7SA 1ARTA 2OQXA 2HUUA 3FSLA 2JJHA 3H9XA 3TFTA 3II0A 4WD2A 1N2TA 1AHFA 3AENA 2WK7A 2ZYJA 1MLZA 1DGDA 1VP4A 1GEYA 4JEXA 4P3MA 2YKVA 1AKBA 3MKJA 2WK8A 3VK3A 1YIZA 1OHWA 4F5IA 3FKDA 3EI6A 3NUBA 3TFUA 3KKIA 3GETA 3A2BA 2ZC0A 4WYCA 4MQRA 4IY7A 4R2NA 3GJUA 4MKKA 2R5CA 3UE8A 2AY3A 2VMWA 4OMAA 4JEZA 4MQQA 3WCOA 3MAFB 1SZKA 2VLHA 1AAMA 1RVUA 3HLMA 3JWAA 4F5JA 2PO3A 3K40A 2G7JA 4GDYA 1VJOA 2CY8A 4M2KA 1GCKA 2Z1ZA 3DXVA 1AX4A 2JJGA 2BWNA 2VMZA 1TATA 4JEWA 4OBUA 2TPLA 1EG5A 3IF2A 2DKJA 1D7RA 3ZRQA 1SPAA 3ZZKA 4ZDLA 1ASCA 4UHNA 4JEYA 2AY8A 1X0MA 4EFFA 4PIWA 1D7VA 2VGZA 3MAFA 2JGTA 1W23A 3QN6A 4KAMA 1AY5A 3WKRA 4LNMA 2PB2A 2D61A 2AY9A 1PMMA 2VIAA 3NDNA 4GSAA 3USFA 1I29A 2XBNA 2DOUA 3NUIA 4IXOA 2ORDA 4MKJA 4A6UA 4K05A 2GQNA 4A0HA 2E54A 2ZY4A 1YOOA 5BJ3A 2YHKA 1ECXA 3AOVA 5BJ4A 4KXKA 2YRRA 4IXSA 4I8AA 4BA4A 4ADDA 2BWOA 1ARSA 5M49A 2W7FA 2ZSLA 4TMRA 4MSOA 3AEMC 5J8QA 2VMVA 3FCRA 2NMPA 2E7JA 3TQXA 3DU4A 4TN4A 1WYUA 1PG8A 3DXWA 4B98A 3AEJA 4K2BA 2CSTA 3P6KA 4Q75A 2ZP7A 3EZSA 2BYLA 3VP6A 3LVLB 1V2DA 4E3RA 3HL2A 1OHVA 2VMPA 3RUYA 3K28A 1G7XA 4IX8A 2VLFA 5G4JA 1CS1A 4ZSWA 2YRIA 2VI9A 2VMOA 3BS8A 1SZUA 4WP0A 1ELQA 4F4EA 1G4VA 2JJEA 4Q76A 5M4BA 2BKWA 1X29A 2HZPA 4GE4A 2CH1A 2YCPA 3UWCA 1I41A 1W7LA 4WYGA 3H14A 5FT4A 5HXXA 1D7UA 1CL2A 3MAUA 3H7FA 3HBXA 1UU0A 2FQ6A 5G2QA 1N8PA 2D7YA 3G0TA 4GE7A 3E9KA 4ZDPA 3UAKA 3CQ6A 3WZFA 3WY7A 5G0AA 4ADEA 1B5PA 1QGNA 2WK9A 3TATA 2VMXA 1O69A 2EZ1A 3D6KA 3NU7A 1GEWA 1WYVA 2R5EA 3GBXA 1ASBA 3MEBA 1X2AA 3I5TA 1YAAA 4A0GA 3FDDA 1P3WA 2VMRA 4M2JA 1M0NA 3HT4A 3JWBA 4JE5D 1C7GA 3LG0A 5EIGA 3MC6A 1D2FA 2HP2A 4ZWVA 4UQVA 4F5HA 1O62A 1TOEA 3DR7A 4UHMA 5EAVA 3DC1A 1OXOA 1TPLA 4WYFA 1Z3ZA 3AENB 3FQ7A 4LNLA 1AIAA 4ATQA 3JZLA 1AY4A 4ITXA 3QBOA 2VMNA 1MLYA 2ZY3A 1IVRA 1J32A 2D5YA 2FYFA 2W7DA 2AEUA 3ACZA 4FFCA 3N75A 3R9AA 3N5MA 2AY4A 3FQAA 1QISA 4J5UA 4ZSYA 4O6ZA 1G7WA 1AHYA 4F5LA 1SF2A 1MDOA 5DB5A 1AHEA 4R5FA 4MY5A 4AO4A 1ASGA 2R5CB 1QJ3A 3N4XA 1AHGA 2DGLA 4XAUA 1DKAA 2YKUA 2GB3A 3BV0A 2R2NA 2Z9VA 9AATA 4JF1A 2CANA 2C7TA 3B1CA 1BJWA 3VOMA 2YOBA 3DODA 5LH9A 2WB6A 2BYJA 2VGWA 4U1TA 2C44A 1KL2A 4ISYA 3AOWA 1S08A 3KGWA 1PMOA 1KL1A 4XQ2A 4A0RA 1DTYA 1KKJA 2HORA 2HOXA 2YKYA 3L8AA 3ISLA 1ZODA 3FZ7A 3AEOA 1W7MA 3M5UA 5M4DA 1S0AA 1VEFA 4RKDA 1DGEA 1AMQA 2FNUA 4QGRA 3LVMA 1ZC9A 4A00A 1WYUB 3FVUA 1H0CA 3NNKA 3JU7A 2GMSA 1MAQA 4XJPA 1TOJA 4WXBA 1IX7A 2ZY2A 4WLHA 1B9HA 1FG3A 4CBRA 5E5IA 3BCBA 1GC0A 5FT6A 3LY1A 2CB1A 5I92A 4A0FA 4W1VA 3B46A 1SVVA 5G09A 3NYTA 3RCHB 3W1HA 4OBVA 1M7YA 5JAYA 3BWNC 1IX8A 1ARGA 2EPJA 1CZEA 8AATA 3NTJA 4OYTA 1GD9A 1EJIA 2HUFA 4Q6RA 4K2IA 4JEVA 2BIEA 3BC8A 2VYCA 2C81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQ8 A;  1AIC A;  2AY1 A;  1CL1 A;  1YJS A;  5IWQ A;  4XEW A;  1BW0 A;  3VAX A;  3EIB A;  3GSB A;  1YIY A;  5C6U A;  1IAY A;  5D95 A;  1YJZ A;  1JF9 A;  1AHX A;  4WYD A;  1AJR A;  3RCH A;  3GZD A;  3B1E A;  4Y0D A;  4XJM A;  3EUC A;  2PB0 A;  3PDX A;  1ASA A;  2EH6 A;  5M46 A;  1KMK A;  2CFB A;  3EI5 A;  3EIA A;  4BQ0 A;  3FVS A;  3QPG A;  3A8U X;  4JF0 A;  1O4S A;  7AAT A;  4F5M A;  2JG2 A;  1H1C A;  1Z7D A;  1WYT B;  3ASA A;  2W7H A;  2AAT A;  3AEL A;  3PDB A;  4OTL A;  4F5K A;  1WKH A;  3HVY A;  1LC8 A;  3NU8 A;  4W1W A;  2BIG A;  4MGR A;  2AY5 A;  2DGM A;  1G4X A;  3W1I A;  3ASB A;  5FT8 A;  2O7C A;  2VGV A;  2GSA A;  4BA5 A;  1N31 A;  3NYU A;  4ADC A;  3AEP A;  2W7J A;  4DGT A;  2QBT A;  1WYV B;  3B8X A;  3PD6 A;  4LNJ A;  2CJH A;  1C7N A;  2W7K A;  4DQ6 A;  1WYT A;  1I48 A;  2X5D A;  3BCA A;  1LW4 A;  1M0Q A;  1ARH A;  1E5E A;  1V2E A;  4WB0 A;  3NX3 A;  2E7I A;  3JTX A;  3F6T A;  5EIG B;  3FRK A;  4HF8 A;  1AIB A;  1AMR A;  1OXP A;  3FTB A;  1AJS A;  5EUD A;  3FFH A;  4ZWM A;  3GR9 A;  1UKJ A;  2HUI A;  4IYO A;  1ORD A;  2W8J A;  1FG7 A;  1KMJ A;  2EZ2 A;  4JE5 A;  4J8L A;  1RV3 A;  3I16 A;  3E2F A;  3FFR A;  1AKA A;  2FN6 A;  1CJ0 A;  4PVF A;  4OT8 A;  1QJ5 A;  2W8V A;  2BI5 A;  1IUG A;  3EI9 A;  1PFF A;  4RIZ A;  2BI3 A;  2Z9U A;  2VGT A;  1LW5 A;  3QGU A;  3K7Y A;  2ZUK A;  1B8G A;  5EUN A;  3L44 A;  2CJG A;  3DRD A;  3E6G A;  3DYD A;  4CBS A;  1BQA A;  3PIU A;  3QI6 A;  3ATH A;  4WXG A;  1OAT A;  3FQ8 A;  1LK9 A;  4AZK A;  2OGE A;  4RLG A;  1GC2 A;  1GDE A;  5E4Z A;  3RBL A;  1ZOB A;  5FT5 A;  2DR1 A;  1LC7 A;  5F9S A;  2CJD A;  1C0N A;  3JW9 A;  2AY2 A;  1B9I A;  3AEJ C;  1IJI A;  2X5F A;  4RKC A;  2W7G A;  3E2Z A;  3RBF A;  4DBC A;  2VMQ A;  4F5F A;  4ZM4 A;  2QB3 A;  2XH1 A;  4CXQ A;  1ASF A;  1TAR A;  2YKX A;  3PAA A;  5AX8 A;  2JJF A;  3F0H A;  3QHX A;  1M0P A;  2W8U A;  5EAA A;  2W7L A;  1B5O A;  2HOY A;  3W1J A;  1ARI A;  1J04 A;  5LHA A;  3LV2 A;  3AEM A;  4E1O A;  1S07 A;  2Z9X A;  1JS6 A;  2QB2 A;  4PFF A;  4UHO A;  3MAD A;  2Z67 A;  3FDB A;  3N0L A;  3Q8N A;  5EUE A;  3FZ6 A;  1QIR A;  3KGX A;  1MGV A;  4UOY A;  4A6T A;  2FNI A;  4OC9 A;  1BT4 A;  1BJN A;  3EI8 A;  3GZC A;  2CH2 A;  4ZAH A;  4EB7 A;  1DFO A;  1BJO A;  4LW4 A;  2EGY A;  1XEY A;  4L0O A;  3VK2 A;  1MAP A;  4WYA A;  2V0Y A;  2Z20 A;  2BI1 A;  2D7Z A;  1SZS A;  2WKA A;  3I4J A;  2D63 A;  4KYO A;  4W1X A;  1RV4 A;  1Y4I A;  1V72 A;  4LW2 A;  4CXR A;  3FZ8 A;  1GC4 A;  4IW7 A;  3G7Q A;  1E5F A;  4HVK A;  5F8V A;  2Z9W A;  3OKS A;  4OCA A;  3OP7 A;  1CQ6 A;  5G4I A;  3R4T A;  4EU1 A;  2D65 A;  3DZZ A;  3G8M A;  2BHX A;  3COG A;  1AY8 A;  1M4N A;  4R5Z A;  2AEV A;  2OGA A;  3PA9 A;  2W8T A;  1OHY A;  4F5G A;  4GEB A;  1QIT A;  2FM1 A;  4W91 A;  1WKG A;  2ZJG A;  3LVK A;  4ITG A;  5EFS A;  2CIN A;  1JS3 A;  2HP1 A;  3BCX A;  4XJO A;  3FD0 A;  4ZLV A;  2O0R A;  1C4K A;  3MC6 C;  2ZY5 A;  1GBN A;  4BHD A;  4K2M A;  4R8D A;  4TV7 A;  4AH3 A;  4EMY A;  3ZRP A;  2OAT A;  3BB8 A;  3PDB B;  1ASD A;  1TOK A;  3PJ0 A;  1ASL A;  4LC3 A;  3T32 A;  2AY7 A;  4Y0I A;  2EO5 A;  2C0R A;  3NRA A;  5DJ9 A;  2Z1Y A;  4W5K A;  3PPL A;  1W7N A;  1GC3 A;  1LS3 A;  2OKK A;  5D5S A;  3WGB A;  1CQ7 A;  4Q31 A;  1BQD A;  3PD6 B;  3A9Z A;  3FVX A;  1IBJ A;  5G2P A;  1V2F A;  3HDO A;  3CBF A;  2Q7W A;  1U08 A;  2W7E A;  3GWP A;  3MBB A;  1CZC A;  4WB0 B;  1AAW A;  3P1T A;  3LVJ A;  1UU2 A;  1I43 A;  1UU1 A;  1O61 A;  1ELU A;  2BI9 A;  1AJS B;  1AMA A;  1DJ9 A;  4AOA A;  4N0B A;  1FC4 A;  2G6W A;  4ZDO A;  3BN1 A;  2QA3 A;  4IYO B;  2VGU A;  4E77 A;  2GMU A;  2F8J A;  4GE9 A;  3TCM A;  1YNU A;  1IX6 A;  2R0T A;  1LC5 A;  2D66 A;  3EI7 A;  2X8U A;  4WBT A;  4WYE A;  1S06 A;  1TOG A;  4RAE A;  4CVQ A;  3WX9 A;  1M6S A;  3ELE A;  1IAX A;  1AKC A;  1YJY A;  2VMT A;  1M32 A;  3WGC A;  2HOZ A;  4RIT A;  2DGK A;  2W7I A;  3CQ5 A;  1BKG A;  3E77 A;  2QMA A;  4AO9 A;  1ASN A;  3PGY A;  3B1D A;  4U2H A;  1C9C A;  4E3Q A;  3RQ1 A;  4P7Y A;  1XI9 A;  3F9T A;  3AAT A;  1DJE A;  5HHY A;  2VMY A;  3QM2 A;  2X3L A;  2V1P A;  1JG8 A;  2Z61 A;  5K8B A;  2VMS A;  2DKB A;  4WXF A;  3KE3 A;  1X28 A;  1M0O A;  1SFF A;  2VMU A;  4NOG A;  3CQ4 A;  1S09 A;  2BI2 A;  4PFN A;  3AV7 A;  3ZRR A;  4ATP A;  4ADB A;  3E2Y A;  2AY6 A;  3NYS A;  4IXZ A;  5EQC A;  3E2Z B;  2W8W A;  3HQT A;  3VK4 A;  1KKP A;  4ZAS A;  4Y0H A;  3A9Y A;  2OKJ A;  3HMU A;  4RM1 A;  3WCN A;  5DJ1 A;  4H51 A;  1AMS A;  3WKS A;  4N0W A;  1LKC A;  4A6R A;  4B9B A;  4BMK A;  3BWN A;  1QZ9 A;  2YCN A;  3ELP A;  2VIB A;  1EQB A;  2BWP A;  1MDZ A;  3GZD C;  4RJ0 A;  5DX5 A;  2CTZ A;  2VI8 A;  2VGS A;  1TAS A;  1TOI A;  3LWS A;  3ZZJ A;  2QLR A;  2JIS A;  2YCT A;  2ZSM A;  2W7M A;  4W8I A;  4AZJ A;  3EZ1 A;  2RFV A;  2O1B A;  1BJO B;  1W3U A;  2D64 A;  3CAI A;  1GEX A;  5E3K A;  1WST A;  1C7O A;  4M2M A;  3BWO A;  4XJL A;  4XK1 A;  4EB5 A;  3DR4 A;  1ASE A;  4GRX A;  3A9X A;  1MDX A;  3RI6 A;  3WLX A;  4RJY A;  5TF5 A;  2BIA A;  1ASM A;  2E7U A;  5HDM A;  1BJ4 A;  4WLJ A;  1BS0 A;  1RVY A;  4FL0 A;  4ZM3 A;  4A72 A;  1B4X A;  3ECD A;  1DJU A;  3IHJ A;  4MQP A;  1T3I A;  1D7S A;  1ART A;  2OQX A;  2HUU A;  3FSL A;  2JJH A;  3TFT A;  3II0 A;  4WD2 A;  1N2T A;  1AHF A;  3AEN A;  2WK7 A;  2ZYJ A;  1MLZ A;  1DGD A;  1VP4 A;  1GEY A;  4JEX A;  4P3M A;  2YKV A;  1AKB A;  3MKJ A;  2WK8 A;  3VK3 A;  1YIZ A;  1OHW A;  4F5I A;  3FKD A;  3EI6 A;  3NUB A;  3TFU A;  3KKI A;  3GET A;  3A2B A;  2ZC0 A;  4WYC A;  4MQR A;  4IY7 A;  4R2N A;  3GJU A;  4MKK A;  2R5C A;  3UE8 A;  2AY3 A;  2VMW A;  4OMA A;  4JEZ A;  4MQQ A;  3WCO A;  3MAF B;  1SZK A;  2VLH A;  1AAM A;  1RVU A;  3HLM A;  3JWA A;  4F5J A;  2PO3 A;  3K40 A;  4GDY A;  1VJO A;  2CY8 A;  4M2K A;  1GCK A;  2Z1Z A;  3DXV A;  1AX4 A;  2JJG A;  2BWN A;  2VMZ A;  1TAT A;  4JEW A;  4OBU A;  2TPL A;  1EG5 A;  3IF2 A;  2DKJ A;  1D7R A;  3ZRQ A;  1SPA A;  3ZZK A;  4ZDL A;  1ASC A;  4UHN A;  4JEY A;  2AY8 A;  1X0M A;  4EFF A;  4PIW A;  1D7V A;  2VGZ A;  3MAF A;  2JGT A;  1W23 A;  3QN6 A;  4KAM A;  1AY5 A;  3WKR A;  4LNM A;  2PB2 A;  2D61 A;  2AY9 A;  1PMM A;  2VIA A;  3NDN A;  4GSA A;  3USF A;  1I29 A;  2XBN A;  2DOU A;  3NUI A;  4IXO A;  2ORD A;  4MKJ A;  4A6U A;  2GQN A;  4A0H A;  2E54 A;  2ZY4 A;  1YOO A;  5BJ3 A;  2YHK A;  1ECX A;  3AOV A;  5BJ4 A;  4KXK A;  2YRR A;  4IXS A;  4I8A A;  4BA4 A;  4ADD A;  2BWO A;  1ARS A;  5M49 A;  2W7F A;  2ZSL A;  4TMR A;  4MSO A;  3AEM C;  5J8Q A;  2VMV A;  3FCR A;  2NMP A;  2E7J A;  3TQX A;  3DU4 A;  4TN4 A;  1WYU A;  1PG8 A;  3DXW A;  4B98 A;  3AEJ A;  4K2B A;  2CST A;  3P6K A;  4Q75 A;  2ZP7 A;  3EZS A;  2BYL A;  3VP6 A;  3LVL B;  1V2D A;  4E3R A;  3HL2 A;  1OHV A;  2VMP A;  3RUY A;  3K28 A;  1G7X A;  4IX8 A;  2VLF A;  5G4J A;  1CS1 A;  4ZSW A;  2YRI A;  2VI9 A;  2VMO A;  3BS8 A;  1SZU A;  4WP0 A;  1ELQ A;  4F4E A;  1G4V A;  2JJE A;  4Q76 A;  5M4B A;  2BKW A;  1X29 A;  2HZP A;  4GE4 A;  2CH1 A;  2YCP A;  3UWC A;  1I41 A;  1W7L A;  4WYG A;  3H14 A;  5FT4 A;  5HXX A;  1D7U A;  1CL2 A;  3MAU A;  3H7F A;  3HBX A;  1UU0 A;  2FQ6 A;  5G2Q A;  1N8P A;  2D7Y A;  3G0T A;  4GE7 A;  3E9K A;  4ZDP A;  3UAK A;  3CQ6 A;  3WZF A;  3WY7 A;  5G0A A;  4ADE A;  1B5P A;  1QGN A;  2WK9 A;  3TAT A;  2VMX A;  1O69 A;  2EZ1 A;  3D6K A;  3NU7 A;  1GEW A;  1WYV A;  2R5E A;  3GBX A;  1ASB A;  3MEB A;  1X2A A;  3I5T A;  1YAA A;  4A0G A;  3FDD A;  1P3W A;  2VMR A;  4M2J A;  1M0N A;  3HT4 A;  3JWB A;  4JE5 D;  1C7G A;  3LG0 A;  5EIG A;  3MC6 A;  1D2F A;  2HP2 A;  4ZWV A;  4UQV A;  4F5H A;  1O62 A;  1TOE A;  3DR7 A;  4UHM A;  5EAV A;  3DC1 A;  1OXO A;  1TPL A;  4WYF A;  1Z3Z A;  3AEN B;  3FQ7 A;  4LNL A;  1AIA A;  4ATQ A;  3JZL A;  1AY4 A;  4ITX A;  3QBO A;  2VMN A;  1MLY A;  2ZY3 A;  1IVR A;  1J32 A;  2D5Y A;  2FYF A;  2W7D A;  2AEU A;  3ACZ A;  4FFC A;  3N75 A;  3R9A A;  3N5M A;  2AY4 A;  3FQA A;  1QIS A;  4J5U A;  4ZSY A;  4O6Z A;  1G7W A;  1AHY A;  4F5L A;  1SF2 A;  1MDO A;  5DB5 A;  1AHE A;  4R5F A;  4MY5 A;  4AO4 A;  1ASG A;  2R5C B;  1QJ3 A;  1AHG A;  2DGL A;  4XAU A;  1DKA A;  2YKU A;  2GB3 A;  3BV0 A;  2R2N A;  2Z9V A;  9AAT A;  4JF1 A;  2CAN A;  2C7T A;  3B1C A;  1BJW A;  3VOM A;  2YOB A;  3DOD A;  5LH9 A;  2BYJ A;  2VGW A;  4U1T A;  2C44 A;  1KL2 A;  4ISY A;  3AOW A;  1S08 A;  3KGW A;  1PMO A;  1KL1 A;  4XQ2 A;  4A0R A;  1DTY A;  1KKJ A;  2HOR A;  2HOX A;  2YKY A;  3L8A A;  3ISL A;  1ZOD A;  3FZ7 A;  3AEO A;  1W7M A;  3M5U A;  5M4D A;  1S0A A;  1VEF A;  4RKD A;  1DGE A;  1AMQ A;  2FNU A;  4QGR A;  3LVM A;  1ZC9 A;  4A00 A;  1WYU B;  3FVU A;  1H0C A;  3NNK A;  3JU7 A;  2GMS A;  1MAQ A;  4XJP A;  1TOJ A;  4WXB A;  1IX7 A;  2ZY2 A;  4WLH A;  1B9H A;  1FG3 A;  4CBR A;  5E5I A;  3BCB A;  1GC0 A;  5FT6 A;  3LY1 A;  2CB1 A;  5I92 A;  4A0F A;  4W1V A;  3B46 A;  1SVV A;  5G09 A;  3NYT A;  3RCH B;  3W1H A;  4OBV A;  1M7Y A;  5JAY A;  3BWN C;  1IX8 A;  1ARG A;  2EPJ A;  1CZE A;  8AAT A;  3NTJ A;  4OYT A;  1GD9 A;  1EJI A;  2HUF A;  4Q6R A;  4K2I A;  4JEV A;  2BIE A;  3BC8 A;  2VYC A;  2C81 A; 
#chains in the Genus database with same CATH topology
 1CQ8 A;  1AIC A;  1KAF A;  2AY1 A;  1CL1 A;  1YJS A;  5IWQ A;  4XEW A;  1BW0 A;  3VAX A;  3EIB A;  3GSB A;  1YIY A;  5C6U A;  1IAY A;  5D95 A;  1YJZ A;  1JF9 A;  1AHX A;  4WYD A;  1AJR A;  3RCH A;  3GZD A;  3B1E A;  4Y0D A;  4XJM A;  3EUC A;  2PB0 A;  3PDX A;  1ASA A;  2EH6 A;  5M46 A;  1KMK A;  2CFB A;  3EI5 A;  3EIA A;  4BQ0 A;  3FVS A;  3QPG A;  3A8U X;  4JF0 A;  1O4S A;  7AAT A;  4F5M A;  2JG2 A;  1H1C A;  1Z7D A;  1WYT B;  3ASA A;  2W7H A;  2AAT A;  3AEL A;  3PDB A;  4OTL A;  4F5K A;  1WKH A;  3HVY A;  1LC8 A;  3NU8 A;  4W1W A;  2BIG A;  4MGR A;  2QSR A;  2AY5 A;  2DGM A;  1G4X A;  3W1I A;  3ASB A;  5FT8 A;  2O7C A;  2VGV A;  2GSA A;  4BA5 A;  1N31 A;  3NYU A;  4ADC A;  3AEP A;  2W7J A;  4DGT A;  2QBT A;  1WYV B;  3B8X A;  3PD6 A;  4LNJ A;  2CJH A;  1C7N A;  2W7K A;  4DQ6 A;  1WYT A;  1I48 A;  2X5D A;  3BCA A;  1LW4 A;  1M0Q A;  1ARH A;  1E5E A;  1V2E A;  4WB0 A;  3NX3 A;  3N4S A;  2E7I A;  3JTX A;  3F6T A;  5EIG B;  3FRK A;  4HF8 A;  1AIB A;  1AMR A;  1OXP A;  3FTB A;  1AJS A;  5EUD A;  3FFH A;  4ZWM A;  3GR9 A;  1UKJ A;  2HUI A;  4IYO A;  1ORD A;  2W8J A;  1FG7 A;  1KMJ A;  2EZ2 A;  4JE5 A;  4J8L A;  1RV3 A;  3I16 A;  3E2F A;  3FFR A;  1AKA A;  2FN6 A;  1CJ0 A;  4PVF A;  4OT8 A;  1QJ5 A;  2W8V A;  2BI5 A;  1IUG A;  3EI9 A;  1PFF A;  4RIZ A;  2BI3 A;  2Z9U A;  2VGT A;  1LW5 A;  3QGU A;  3K7Y A;  2ZUK A;  1B8G A;  5EUN A;  3L44 A;  2CJG A;  3DRD A;  3E6G A;  3DYD A;  4CBS A;  1BQA A;  3PIU A;  3QI6 A;  3ATH A;  4WXG A;  1OAT A;  3FQ8 A;  1LK9 A;  4AZK A;  2OGE A;  4RLG A;  1GC2 A;  1GDE A;  5E4Z A;  3RBL A;  1ZOB A;  5FT5 A;  2DR1 A;  1LC7 A;  5F9S A;  2CJD A;  1C0N A;  3JW9 A;  2AY2 A;  1B9I A;  3AEJ C;  1IJI A;  2X5F A;  4RKC A;  2W7G A;  3E2Z A;  3RBF A;  4DBC A;  2VMQ A;  4F5F A;  4ZM4 A;  2QB3 A;  2XH1 A;  4CXQ A;  1ASF A;  1TAR A;  2YKX A;  3PAA A;  5AX8 A;  2JJF A;  3F0H A;  3QHX A;  1M0P A;  2W8U A;  5EAA A;  2W7L A;  1B5O A;  2HOY A;  3W1J A;  1ARI A;  1J04 A;  5LHA A;  3LV2 A;  3AEM A;  4E1O A;  1S07 A;  2Z9X A;  1JS6 A;  2QB2 A;  4PFF A;  4UHO A;  3MAD A;  2Z67 A;  3FDB A;  3N0L A;  3Q8N A;  5EUE A;  3FZ6 A;  1QIR A;  3KGX A;  1MGV A;  4UOY A;  4A6T A;  2FNI A;  4OC9 A;  1BT4 A;  1BJN A;  3EI8 A;  3GZC A;  2CH2 A;  4ZAH A;  4EB7 A;  1DFO A;  1BJO A;  4LW4 A;  4H63 Q;  2EGY A;  1XEY A;  4L0O A;  3VK2 A;  1MAP A;  4WYA A;  2V0Y A;  2Z20 A;  2BI1 A;  2D7Z A;  1SZS A;  2WKA A;  3I4J A;  2D63 A;  4KYO A;  4W1X A;  1RV4 A;  1Y4I A;  1V72 A;  3N4R A;  4LW2 A;  4CXR A;  3FZ8 A;  1GC4 A;  4IW7 A;  3G7Q A;  1E5F A;  4HVK A;  5F8V A;  2Z9W A;  3OKS A;  4OCA A;  3OP7 A;  1CQ6 A;  5G4I A;  3R4T A;  4EU1 A;  2D65 A;  3DZZ A;  3G8M A;  2BHX A;  3COG A;  1AY8 A;  1M4N A;  4R5Z A;  2AEV A;  2OGA A;  3PA9 A;  2W8T A;  1OHY A;  4F5G A;  4GEB A;  1QIT A;  2FM1 A;  4W91 A;  1WKG A;  2ZJG A;  3LVK A;  4ITG A;  5EFS A;  2CIN A;  1JS3 A;  2HP1 A;  3BCX A;  4XJO A;  3FD0 A;  4ZLV A;  2O0R A;  1C4K A;  3MC6 C;  2ZY5 A;  1GBN A;  4BHD A;  4K2M A;  4R8D A;  4TV7 A;  4AH3 A;  4EMY A;  3ZRP A;  2OAT A;  3BB8 A;  3PDB B;  1ASD A;  1TOK A;  3PJ0 A;  1ASL A;  4LC3 A;  3T32 A;  2AY7 A;  4Y0I A;  2EO5 A;  2C0R A;  3NRA A;  5DJ9 A;  2Z1Y A;  4W5K A;  3PPL A;  2KFP A;  1W7N A;  1GC3 A;  1LS3 A;  2OKK A;  5D5S A;  3WGB A;  1CQ7 A;  4Q31 A;  1BQD A;  3PD6 B;  3A9Z A;  3FVX A;  1IBJ A;  5G2P A;  1V2F A;  3HDO A;  3CBF A;  3N7N A;  2Q7W A;  1U08 A;  2W7E A;  3GWP A;  3MBB A;  1CZC A;  4WB0 B;  1AAW A;  3P1T A;  3LVJ A;  1UU2 A;  1I43 A;  1UU1 A;  1O61 A;  1ELU A;  2BI9 A;  1AJS B;  1AMA A;  1DJ9 A;  4AOA A;  4N0B A;  1FC4 A;  2G6W A;  4ZDO A;  3BN1 A;  2QA3 A;  4IYO B;  2VGU A;  4E77 A;  2GMU A;  2F8J A;  4GE9 A;  3TCM A;  1YNU A;  1IX6 A;  2R0T A;  1LC5 A;  2D66 A;  3EI7 A;  2X8U A;  4WBT A;  4WYE A;  1S06 A;  1TOG A;  4RAE A;  4CVQ A;  3WX9 A;  1M6S A;  3ELE A;  1IAX A;  1AKC A;  1YJY A;  2VMT A;  1M32 A;  3WGC A;  5KTB A;  2HOZ A;  4RIT A;  2DGK A;  2W7I A;  3CQ5 A;  1BKG A;  3E77 A;  2QMA A;  4AO9 A;  1ASN A;  3PGY A;  3B1D A;  4U2H A;  1C9C A;  4E3Q A;  3RQ1 A;  4P7Y A;  1XI9 A;  3F9T A;  3AAT A;  1DJE A;  5HHY A;  2VMY A;  3QM2 A;  2X3L A;  2V1P A;  1JG8 A;  2Z61 A;  5K8B A;  2VMS A;  2DKB A;  2EYQ A;  4WXF A;  3KE3 A;  1X28 A;  1M0O A;  1SFF A;  2VMU A;  4NOG A;  3CQ4 A;  1S09 A;  2BI2 A;  4PFN A;  3AV7 A;  3ZRR A;  4ATP A;  4ADB A;  3E2Y A;  2AY6 A;  3NYS A;  2A1V A;  4IXZ A;  5EQC A;  3E2Z B;  2W8W A;  2FKI A;  3HQT A;  3VK4 A;  1KKP A;  4ZAS A;  4Y0H A;  3A9Y A;  2OKJ A;  3HMU A;  4RM1 A;  3WCN A;  5DJ1 A;  4H51 A;  1AMS A;  3WKS A;  4N0W A;  1LKC A;  4A6R A;  4B9B A;  4BMK A;  3BWN A;  1QZ9 A;  2YCN A;  3ELP A;  2VIB A;  1EQB A;  2BWP A;  1MDZ A;  3GZD C;  4RJ0 A;  5DX5 A;  2CTZ A;  2VI8 A;  2VGS A;  1TAS A;  1TOI A;  3LWS A;  3ZZJ A;  2QLR A;  2JIS A;  2YCT A;  2ZSM A;  2W7M A;  4W8I A;  4AZJ A;  3EZ1 A;  2RFV A;  2O1B A;  1BJO B;  1W3U A;  2D64 A;  3CAI A;  1GEX A;  5E3K A;  1WST A;  1C7O A;  4M2M A;  3BWO A;  4XJL A;  4XK1 A;  4EB5 A;  3DR4 A;  1ASE A;  4GRX A;  3A9X A;  1MDX A;  3RI6 A;  3WLX A;  4RJY A;  5TF5 A;  2BIA A;  1ASM A;  2E7U A;  5HDM A;  1BJ4 A;  4WLJ A;  1BS0 A;  1RVY A;  4FL0 A;  4ZM3 A;  4A72 A;  1B4X A;  3ECD A;  1DJU A;  3IHJ A;  4MQP A;  1T3I A;  1D7S A;  1ART A;  2OQX A;  2HUU A;  3FSL A;  2JJH A;  3H9X A;  3TFT A;  3II0 A;  4WD2 A;  1N2T A;  1AHF A;  3AEN A;  2WK7 A;  2ZYJ A;  1MLZ A;  1DGD A;  1VP4 A;  1GEY A;  4JEX A;  4P3M A;  2YKV A;  1AKB A;  3MKJ A;  2WK8 A;  3VK3 A;  1YIZ A;  1OHW A;  4F5I A;  3FKD A;  3EI6 A;  3NUB A;  3TFU A;  3KKI A;  3GET A;  3A2B A;  2ZC0 A;  4WYC A;  4MQR A;  4IY7 A;  4R2N A;  3GJU A;  4MKK A;  2R5C A;  3UE8 A;  2AY3 A;  2VMW A;  4OMA A;  4JEZ A;  4MQQ A;  3WCO A;  3MAF B;  1SZK A;  2VLH A;  1AAM A;  1RVU A;  3HLM A;  3JWA A;  4F5J A;  2PO3 A;  3K40 A;  2G7J A;  4GDY A;  1VJO A;  2CY8 A;  4M2K A;  1GCK A;  2Z1Z A;  3DXV A;  1AX4 A;  2JJG A;  2BWN A;  2VMZ A;  1TAT A;  4JEW A;  4OBU A;  2TPL A;  1EG5 A;  3IF2 A;  2DKJ A;  1D7R A;  3ZRQ A;  1SPA A;  3ZZK A;  4ZDL A;  1ASC A;  4UHN A;  4JEY A;  2AY8 A;  1X0M A;  4EFF A;  4PIW A;  1D7V A;  2VGZ A;  3MAF A;  2JGT A;  1W23 A;  3QN6 A;  4KAM A;  1AY5 A;  3WKR A;  4LNM A;  2PB2 A;  2D61 A;  2AY9 A;  1PMM A;  2VIA A;  3NDN A;  4GSA A;  3USF A;  1I29 A;  2XBN A;  2DOU A;  3NUI A;  4IXO A;  2ORD A;  4MKJ A;  4A6U A;  4K05 A;  2GQN A;  4A0H A;  2E54 A;  2ZY4 A;  1YOO A;  5BJ3 A;  2YHK A;  1ECX A;  3AOV A;  5BJ4 A;  4KXK A;  2YRR A;  4IXS A;  4I8A A;  4BA4 A;  4ADD A;  2BWO A;  1ARS A;  5M49 A;  2W7F A;  2ZSL A;  4TMR A;  4MSO A;  3AEM C;  5J8Q A;  2VMV A;  3FCR A;  2NMP A;  2E7J A;  3TQX A;  3DU4 A;  4TN4 A;  1WYU A;  1PG8 A;  3DXW A;  4B98 A;  3AEJ A;  4K2B A;  2CST A;  3P6K A;  4Q75 A;  2ZP7 A;  3EZS A;  2BYL A;  3VP6 A;  3LVL B;  1V2D A;  4E3R A;  3HL2 A;  1OHV A;  2VMP A;  3RUY A;  3K28 A;  1G7X A;  4IX8 A;  2VLF A;  5G4J A;  1CS1 A;  4ZSW A;  2YRI A;  2VI9 A;  2VMO A;  3BS8 A;  1SZU A;  4WP0 A;  1ELQ A;  4F4E A;  1G4V A;  2JJE A;  4Q76 A;  5M4B A;  2BKW A;  1X29 A;  2HZP A;  4GE4 A;  2CH1 A;  2YCP A;  3UWC A;  1I41 A;  1W7L A;  4WYG A;  3H14 A;  5FT4 A;  5HXX A;  1D7U A;  1CL2 A;  3MAU A;  3H7F A;  3HBX A;  1UU0 A;  2FQ6 A;  5G2Q A;  1N8P A;  2D7Y A;  3G0T A;  4GE7 A;  3E9K A;  4ZDP A;  3UAK A;  3CQ6 A;  3WZF A;  3WY7 A;  5G0A A;  4ADE A;  1B5P A;  1QGN A;  2WK9 A;  3TAT A;  2VMX A;  1O69 A;  2EZ1 A;  3D6K A;  3NU7 A;  1GEW A;  1WYV A;  2R5E A;  3GBX A;  1ASB A;  3MEB A;  1X2A A;  3I5T A;  1YAA A;  4A0G A;  3FDD A;  1P3W A;  2VMR A;  4M2J A;  1M0N A;  3HT4 A;  3JWB A;  4JE5 D;  1C7G A;  3LG0 A;  5EIG A;  3MC6 A;  1D2F A;  2HP2 A;  4ZWV A;  4UQV A;  4F5H A;  1O62 A;  1TOE A;  3DR7 A;  4UHM A;  5EAV A;  3DC1 A;  1OXO A;  1TPL A;  4WYF A;  1Z3Z A;  3AEN B;  3FQ7 A;  4LNL A;  1AIA A;  4ATQ A;  3JZL A;  1AY4 A;  4ITX A;  3QBO A;  2VMN A;  1MLY A;  2ZY3 A;  1IVR A;  1J32 A;  2D5Y A;  2FYF A;  2W7D A;  2AEU A;  3ACZ A;  4FFC A;  3N75 A;  3R9A A;  3N5M A;  2AY4 A;  3FQA A;  1QIS A;  4J5U A;  4ZSY A;  4O6Z A;  1G7W A;  1AHY A;  4F5L A;  1SF2 A;  1MDO A;  5DB5 A;  1AHE A;  4R5F A;  4MY5 A;  4AO4 A;  1ASG A;  2R5C B;  1QJ3 A;  3N4X A;  1AHG A;  2DGL A;  4XAU A;  1DKA A;  2YKU A;  2GB3 A;  3BV0 A;  2R2N A;  2Z9V A;  9AAT A;  4JF1 A;  2CAN A;  2C7T A;  3B1C A;  1BJW A;  3VOM A;  2YOB A;  3DOD A;  5LH9 A;  2WB6 A;  2BYJ A;  2VGW A;  4U1T A;  2C44 A;  1KL2 A;  4ISY A;  3AOW A;  1S08 A;  3KGW A;  1PMO A;  1KL1 A;  4XQ2 A;  4A0R A;  1DTY A;  1KKJ A;  2HOR A;  2HOX A;  2YKY A;  3L8A A;  3ISL A;  1ZOD A;  3FZ7 A;  3AEO A;  1W7M A;  3M5U A;  5M4D A;  1S0A A;  1VEF A;  4RKD A;  1DGE A;  1AMQ A;  2FNU A;  4QGR A;  3LVM A;  1ZC9 A;  4A00 A;  1WYU B;  3FVU A;  1H0C A;  3NNK A;  3JU7 A;  2GMS A;  1MAQ A;  4XJP A;  1TOJ A;  4WXB A;  1IX7 A;  2ZY2 A;  4WLH A;  1B9H A;  1FG3 A;  4CBR A;  5E5I A;  3BCB A;  1GC0 A;  5FT6 A;  3LY1 A;  2CB1 A;  5I92 A;  4A0F A;  4W1V A;  3B46 A;  1SVV A;  5G09 A;  3NYT A;  3RCH B;  3W1H A;  4OBV A;  1M7Y A;  5JAY A;  3BWN C;  1IX8 A;  1ARG A;  2EPJ A;  1CZE A;  8AAT A;  3NTJ A;  4OYT A;  1GD9 A;  1EJI A;  2HUF A;  4Q6R A;  4K2I A;  4JEV A;  2BIE A;  3BC8 A;  2VYC A;  2C81 A; 
#chains in the Genus database with same CATH homology
 1CQ8 A;  1AIC A;  2AY1 A;  1CL1 A;  1YJS A;  5IWQ A;  4XEW A;  1BW0 A;  3VAX A;  3EIB A;  3GSB A;  1YIY A;  5C6U A;  1IAY A;  5D95 A;  1YJZ A;  1JF9 A;  1AHX A;  4WYD A;  1AJR A;  3RCH A;  3GZD A;  3B1E A;  4Y0D A;  4XJM A;  3EUC A;  2PB0 A;  3PDX A;  1ASA A;  2EH6 A;  5M46 A;  1KMK A;  2CFB A;  3EI5 A;  3EIA A;  4BQ0 A;  3FVS A;  3QPG A;  3A8U X;  4JF0 A;  1O4S A;  7AAT A;  4F5M A;  2JG2 A;  1H1C A;  1Z7D A;  1WYT B;  3ASA A;  2W7H A;  2AAT A;  3AEL A;  3PDB A;  4OTL A;  4F5K A;  1WKH A;  3HVY A;  1LC8 A;  3NU8 A;  4W1W A;  2BIG A;  4MGR A;  2QSR A;  2AY5 A;  2DGM A;  1G4X A;  3W1I A;  3ASB A;  5FT8 A;  2O7C A;  2VGV A;  2GSA A;  4BA5 A;  1N31 A;  3NYU A;  4ADC A;  3AEP A;  2W7J A;  4DGT A;  2QBT A;  1WYV B;  3B8X A;  3PD6 A;  4LNJ A;  2CJH A;  1C7N A;  2W7K A;  4DQ6 A;  1WYT A;  1I48 A;  2X5D A;  3BCA A;  1LW4 A;  1M0Q A;  1ARH A;  1E5E A;  1V2E A;  4WB0 A;  3NX3 A;  3N4S A;  2E7I A;  3JTX A;  3F6T A;  5EIG B;  3FRK A;  4HF8 A;  1AIB A;  1AMR A;  1OXP A;  3FTB A;  1AJS A;  5EUD A;  3FFH A;  4ZWM A;  3GR9 A;  1UKJ A;  2HUI A;  4IYO A;  1ORD A;  2W8J A;  1FG7 A;  1KMJ A;  2EZ2 A;  4JE5 A;  4J8L A;  1RV3 A;  3I16 A;  3E2F A;  3FFR A;  1AKA A;  2FN6 A;  1CJ0 A;  4PVF A;  4OT8 A;  1QJ5 A;  2W8V A;  2BI5 A;  1IUG A;  3EI9 A;  1PFF A;  4RIZ A;  2BI3 A;  2Z9U A;  2VGT A;  1LW5 A;  3QGU A;  3K7Y A;  2ZUK A;  1B8G A;  5EUN A;  3L44 A;  2CJG A;  3DRD A;  3E6G A;  3DYD A;  4CBS A;  1BQA A;  3PIU A;  3QI6 A;  3ATH A;  4WXG A;  1OAT A;  3FQ8 A;  1LK9 A;  4AZK A;  2OGE A;  4RLG A;  1GC2 A;  1GDE A;  5E4Z A;  3RBL A;  1ZOB A;  5FT5 A;  2DR1 A;  1LC7 A;  5F9S A;  2CJD A;  1C0N A;  3JW9 A;  2AY2 A;  1B9I A;  3AEJ C;  1IJI A;  2X5F A;  4RKC A;  2W7G A;  3E2Z A;  3RBF A;  4DBC A;  2VMQ A;  4F5F A;  4ZM4 A;  2QB3 A;  2XH1 A;  4CXQ A;  1ASF A;  1TAR A;  2YKX A;  3PAA A;  5AX8 A;  2JJF A;  3F0H A;  3QHX A;  1M0P A;  2W8U A;  5EAA A;  2W7L A;  1B5O A;  2HOY A;  3W1J A;  1ARI A;  1J04 A;  5LHA A;  3LV2 A;  3AEM A;  4E1O A;  1S07 A;  2Z9X A;  1JS6 A;  2QB2 A;  4PFF A;  4UHO A;  3MAD A;  2Z67 A;  3FDB A;  3N0L A;  3Q8N A;  5EUE A;  3FZ6 A;  1QIR A;  3KGX A;  1MGV A;  4UOY A;  4A6T A;  2FNI A;  4OC9 A;  1BT4 A;  1BJN A;  3EI8 A;  3GZC A;  2CH2 A;  4ZAH A;  4EB7 A;  1DFO A;  1BJO A;  4LW4 A;  4H63 Q;  2EGY A;  1XEY A;  4L0O A;  3VK2 A;  1MAP A;  4WYA A;  2V0Y A;  2Z20 A;  2BI1 A;  2D7Z A;  1SZS A;  2WKA A;  3I4J A;  2D63 A;  4KYO A;  4W1X A;  1RV4 A;  1Y4I A;  1V72 A;  3N4R A;  4LW2 A;  4CXR A;  3FZ8 A;  1GC4 A;  4IW7 A;  3G7Q A;  1E5F A;  4HVK A;  5F8V A;  2Z9W A;  3OKS A;  4OCA A;  3OP7 A;  1CQ6 A;  5G4I A;  3R4T A;  4EU1 A;  2D65 A;  3DZZ A;  3G8M A;  2BHX A;  3COG A;  1AY8 A;  1M4N A;  4R5Z A;  2AEV A;  2OGA A;  3PA9 A;  2W8T A;  1OHY A;  4F5G A;  4GEB A;  1QIT A;  2FM1 A;  4W91 A;  1WKG A;  2ZJG A;  3LVK A;  4ITG A;  5EFS A;  2CIN A;  1JS3 A;  2HP1 A;  3BCX A;  4XJO A;  3FD0 A;  4ZLV A;  2O0R A;  1C4K A;  3MC6 C;  2ZY5 A;  1GBN A;  4BHD A;  4K2M A;  4R8D A;  4TV7 A;  4AH3 A;  4EMY A;  3ZRP A;  2OAT A;  3BB8 A;  3PDB B;  1ASD A;  1TOK A;  3PJ0 A;  1ASL A;  4LC3 A;  3T32 A;  2AY7 A;  4Y0I A;  2EO5 A;  2C0R A;  3NRA A;  5DJ9 A;  2Z1Y A;  4W5K A;  3PPL A;  2KFP A;  1W7N A;  1GC3 A;  1LS3 A;  2OKK A;  5D5S A;  3WGB A;  1CQ7 A;  4Q31 A;  1BQD A;  3PD6 B;  3A9Z A;  3FVX A;  1IBJ A;  5G2P A;  1V2F A;  3HDO A;  3CBF A;  3N7N A;  2Q7W A;  1U08 A;  2W7E A;  3GWP A;  3MBB A;  1CZC A;  4WB0 B;  1AAW A;  3P1T A;  3LVJ A;  1UU2 A;  1I43 A;  1UU1 A;  1O61 A;  1ELU A;  2BI9 A;  1AJS B;  1AMA A;  1DJ9 A;  4AOA A;  4N0B A;  1FC4 A;  2G6W A;  4ZDO A;  3BN1 A;  2QA3 A;  4IYO B;  2VGU A;  4E77 A;  2GMU A;  2F8J A;  4GE9 A;  3TCM A;  1YNU A;  1IX6 A;  2R0T A;  1LC5 A;  2D66 A;  3EI7 A;  2X8U A;  4WBT A;  4WYE A;  1S06 A;  1TOG A;  4RAE A;  4CVQ A;  3WX9 A;  1M6S A;  3ELE A;  1IAX A;  1AKC A;  1YJY A;  2VMT A;  1M32 A;  3WGC A;  5KTB A;  2HOZ A;  4RIT A;  2DGK A;  2W7I A;  3CQ5 A;  1BKG A;  3E77 A;  2QMA A;  4AO9 A;  1ASN A;  3PGY A;  3B1D A;  4U2H A;  1C9C A;  4E3Q A;  3RQ1 A;  4P7Y A;  1XI9 A;  3F9T A;  3AAT A;  1DJE A;  5HHY A;  2VMY A;  3QM2 A;  2X3L A;  2V1P A;  1JG8 A;  2Z61 A;  5K8B A;  2VMS A;  2DKB A;  2EYQ A;  4WXF A;  3KE3 A;  1X28 A;  1M0O A;  1SFF A;  2VMU A;  4NOG A;  3CQ4 A;  1S09 A;  2BI2 A;  4PFN A;  3AV7 A;  3ZRR A;  4ATP A;  4ADB A;  3E2Y A;  2AY6 A;  3NYS A;  2A1V A;  4IXZ A;  5EQC A;  3E2Z B;  2W8W A;  2FKI A;  3HQT A;  3VK4 A;  1KKP A;  4ZAS A;  4Y0H A;  3A9Y A;  2OKJ A;  3HMU A;  4RM1 A;  3WCN A;  5DJ1 A;  4H51 A;  1AMS A;  3WKS A;  4N0W A;  1LKC A;  4A6R A;  4B9B A;  4BMK A;  3BWN A;  1QZ9 A;  2YCN A;  3ELP A;  2VIB A;  1EQB A;  2BWP A;  1MDZ A;  3GZD C;  4RJ0 A;  5DX5 A;  2CTZ A;  2VI8 A;  2VGS A;  1TAS A;  1TOI A;  3LWS A;  3ZZJ A;  2QLR A;  2JIS A;  2YCT A;  2ZSM A;  2W7M A;  4W8I A;  4AZJ A;  3EZ1 A;  2RFV A;  2O1B A;  1BJO B;  1W3U A;  2D64 A;  3CAI A;  1GEX A;  5E3K A;  1WST A;  1C7O A;  4M2M A;  3BWO A;  4XJL A;  4XK1 A;  4EB5 A;  3DR4 A;  1ASE A;  4GRX A;  3A9X A;  1MDX A;  3RI6 A;  3WLX A;  4RJY A;  5TF5 A;  2BIA A;  1ASM A;  2E7U A;  5HDM A;  1BJ4 A;  4WLJ A;  1BS0 A;  1RVY A;  4FL0 A;  4ZM3 A;  4A72 A;  1B4X A;  3ECD A;  1DJU A;  3IHJ A;  4MQP A;  1T3I A;  1D7S A;  1ART A;  2OQX A;  2HUU A;  3FSL A;  2JJH A;  3H9X A;  3TFT A;  3II0 A;  4WD2 A;  1N2T A;  1AHF A;  3AEN A;  2WK7 A;  2ZYJ A;  1MLZ A;  1DGD A;  1VP4 A;  1GEY A;  4JEX A;  4P3M A;  2YKV A;  1AKB A;  3MKJ A;  2WK8 A;  3VK3 A;  1YIZ A;  1OHW A;  4F5I A;  3FKD A;  3EI6 A;  3NUB A;  3TFU A;  3KKI A;  3GET A;  3A2B A;  2ZC0 A;  4WYC A;  4MQR A;  4IY7 A;  4R2N A;  3GJU A;  4MKK A;  2R5C A;  3UE8 A;  2AY3 A;  2VMW A;  4OMA A;  4JEZ A;  4MQQ A;  3WCO A;  3MAF B;  1SZK A;  2VLH A;  1AAM A;  1RVU A;  3HLM A;  3JWA A;  4F5J A;  2PO3 A;  3K40 A;  2G7J A;  4GDY A;  1VJO A;  2CY8 A;  4M2K A;  1GCK A;  2Z1Z A;  3DXV A;  1AX4 A;  2JJG A;  2BWN A;  2VMZ A;  1TAT A;  4JEW A;  4OBU A;  2TPL A;  1EG5 A;  3IF2 A;  2DKJ A;  1D7R A;  3ZRQ A;  1SPA A;  3ZZK A;  4ZDL A;  1ASC A;  4UHN A;  4JEY A;  2AY8 A;  1X0M A;  4EFF A;  4PIW A;  1D7V A;  2VGZ A;  3MAF A;  2JGT A;  1W23 A;  3QN6 A;  4KAM A;  1AY5 A;  3WKR A;  4LNM A;  2PB2 A;  2D61 A;  2AY9 A;  1PMM A;  2VIA A;  3NDN A;  4GSA A;  3USF A;  1I29 A;  2XBN A;  2DOU A;  3NUI A;  4IXO A;  2ORD A;  4MKJ A;  4A6U A;  4K05 A;  2GQN A;  4A0H A;  2E54 A;  2ZY4 A;  1YOO A;  5BJ3 A;  2YHK A;  1ECX A;  3AOV A;  5BJ4 A;  4KXK A;  2YRR A;  4IXS A;  4I8A A;  4BA4 A;  4ADD A;  2BWO A;  1ARS A;  5M49 A;  2W7F A;  2ZSL A;  4TMR A;  4MSO A;  3AEM C;  5J8Q A;  2VMV A;  3FCR A;  2NMP A;  2E7J A;  3TQX A;  3DU4 A;  4TN4 A;  1WYU A;  1PG8 A;  3DXW A;  4B98 A;  3AEJ A;  4K2B A;  2CST A;  3P6K A;  4Q75 A;  2ZP7 A;  3EZS A;  2BYL A;  3VP6 A;  3LVL B;  1V2D A;  4E3R A;  3HL2 A;  1OHV A;  2VMP A;  3RUY A;  3K28 A;  1G7X A;  4IX8 A;  2VLF A;  5G4J A;  1CS1 A;  4ZSW A;  2YRI A;  2VI9 A;  2VMO A;  3BS8 A;  1SZU A;  4WP0 A;  1ELQ A;  4F4E A;  1G4V A;  2JJE A;  4Q76 A;  5M4B A;  2BKW A;  1X29 A;  2HZP A;  4GE4 A;  2CH1 A;  2YCP A;  3UWC A;  1I41 A;  1W7L A;  4WYG A;  3H14 A;  5FT4 A;  5HXX A;  1D7U A;  1CL2 A;  3MAU A;  3H7F A;  3HBX A;  1UU0 A;  2FQ6 A;  5G2Q A;  1N8P A;  2D7Y A;  3G0T A;  4GE7 A;  3E9K A;  4ZDP A;  3UAK A;  3CQ6 A;  3WZF A;  3WY7 A;  5G0A A;  4ADE A;  1B5P A;  1QGN A;  2WK9 A;  3TAT A;  2VMX A;  1O69 A;  2EZ1 A;  3D6K A;  3NU7 A;  1GEW A;  1WYV A;  2R5E A;  3GBX A;  1ASB A;  3MEB A;  1X2A A;  3I5T A;  1YAA A;  4A0G A;  3FDD A;  1P3W A;  2VMR A;  4M2J A;  1M0N A;  3HT4 A;  3JWB A;  4JE5 D;  1C7G A;  3LG0 A;  5EIG A;  3MC6 A;  1D2F A;  2HP2 A;  4ZWV A;  4UQV A;  4F5H A;  1O62 A;  1TOE A;  3DR7 A;  4UHM A;  5EAV A;  3DC1 A;  1OXO A;  1TPL A;  4WYF A;  1Z3Z A;  3AEN B;  3FQ7 A;  4LNL A;  1AIA A;  4ATQ A;  3JZL A;  1AY4 A;  4ITX A;  3QBO A;  2VMN A;  1MLY A;  2ZY3 A;  1IVR A;  1J32 A;  2D5Y A;  2FYF A;  2W7D A;  2AEU A;  3ACZ A;  4FFC A;  3N75 A;  3R9A A;  3N5M A;  2AY4 A;  3FQA A;  1QIS A;  4J5U A;  4ZSY A;  4O6Z A;  1G7W A;  1AHY A;  4F5L A;  1SF2 A;  1MDO A;  5DB5 A;  1AHE A;  4R5F A;  4MY5 A;  4AO4 A;  1ASG A;  2R5C B;  1QJ3 A;  3N4X A;  1AHG A;  2DGL A;  4XAU A;  1DKA A;  2YKU A;  2GB3 A;  3BV0 A;  2R2N A;  2Z9V A;  9AAT A;  4JF1 A;  2CAN A;  2C7T A;  3B1C A;  1BJW A;  3VOM A;  2YOB A;  3DOD A;  5LH9 A;  2WB6 A;  2BYJ A;  2VGW A;  4U1T A;  2C44 A;  1KL2 A;  4ISY A;  3AOW A;  1S08 A;  3KGW A;  1PMO A;  1KL1 A;  4XQ2 A;  4A0R A;  1DTY A;  1KKJ A;  2HOR A;  2HOX A;  2YKY A;  3L8A A;  3ISL A;  1ZOD A;  3FZ7 A;  3AEO A;  1W7M A;  3M5U A;  5M4D A;  1S0A A;  1VEF A;  4RKD A;  1DGE A;  1AMQ A;  2FNU A;  4QGR A;  3LVM A;  1ZC9 A;  4A00 A;  1WYU B;  3FVU A;  1H0C A;  3NNK A;  3JU7 A;  2GMS A;  1MAQ A;  4XJP A;  1TOJ A;  4WXB A;  1IX7 A;  2ZY2 A;  4WLH A;  1B9H A;  1FG3 A;  4CBR A;  5E5I A;  3BCB A;  1GC0 A;  5FT6 A;  3LY1 A;  2CB1 A;  5I92 A;  4A0F A;  4W1V A;  3B46 A;  1SVV A;  5G09 A;  3NYT A;  3RCH B;  3W1H A;  4OBV A;  1M7Y A;  5JAY A;  3BWN C;  1IX8 A;  1ARG A;  2EPJ A;  1CZE A;  8AAT A;  3NTJ A;  4OYT A;  1GD9 A;  1EJI A;  2HUF A;  4Q6R A;  4K2I A;  4JEV A;  2BIE A;  3BC8 A;  2VYC A;  2C81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...