1TOJA

Hydrocinnamic acid-bound structure of srhept mutant of e. coli aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
395
Chain Sequence
b'MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFALYNERVGACTLVAADSETVDRAFGQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 140
structure length 395
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1tojA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1tojA01
2VGWA 4MSOA 2YRIA 4WXGA 1QJ3A 1WYTB 4ADDA 1WSTA 2Q7WA 4AZJA 4GE9A 3AATA 2VMVA 3E2FA 5EIGB 3GETA 3FQ7A 1QISA 1WYTA 2DR1A 2W8VA 3B46A 4GE7A 1SZUA 3F9TA 2CJGA 1C7GA 3FCRA 3MAFB 1O61A 4WYFA 1LC8A 5EIGA 5DJ9A 1M0QA 2VMYA 5DX5A 4JEZA 4TN4A 3MAFA 5M4DA 4IXSA 1KMKA 1UKJA 4TV7A 3VK4A 2E7UA 4DBCA 1OATA 3CQ5A 3MC6A 4EFFA 2BI5A 1GDEA 2CFBA 4E3RA 1GEWA 2GMUA 4UHNA 2HOYA 2CH1A 4XJPA 3COGA 4ZDLA 3WX9A 1C9CA 1IX6A 4E3QA 1S0AA 2HUUA 1M4NA 4N0WA 3ZRRA 4A6UA 4F5FA 1CQ7A 1BJOB 4ZDOA 1QGNA 3A9XA 4UOYA 1ASLA 3M5UA 1QIRA 2VMQA 3A9YA 4AO4A 1AKCA 1ASDA 1BJOA 2Z1ZA 1JF9A 2HOZA 1P3WA 3BWNC 2CB1A 4QGRA 1TOKA 3HQTA 4WB0B 2OATA 1I41A 3LWSA 4XEWA 4XJOA 3NDNA 1AX4A 1UU0A 2D7ZA 2GMSA 4L0OA 3WY7A 2PO3A 4DGTA 2W7EA 3GZDA 4WB0A 4F5IA 1U08A 2W8WA 3L8AA 4PIWA 4M2KA 4A72A 4EU1A 1IX7A 3QM2A 1O69A 3GWPA 3A2BA 3ASBA 3BC8A 1AKBA 4XJLA 4LNJA 4GSAA 2CJHA 4ZAHA 1YAAA 1O62A 3QI6A 2W7MA 2VMPA 4OC9A 1KL2A 1GEXA 3BCAA 3AENB 2Z9WA 4OMAA 4WYAA 2YCNA 1RVYA 4Y0DA 4E77A 2Z1YA 3AENA 3ZRQA 2QLRA 1BT4A 3FQAA 3JWBA 3CQ4A 3RQ1A 3ZRPA 1AHYA 1AHGA 3LVJA 2CINA 1TATA 3DYDA 1ASGA 3LV2A 3NYTA 4IY7A 1AJRA 1ASMA 2ZUKA 1AY5A 3F0HA 2BIEA 4P3MA 4WXBA 3VK3A 3HDOA 3WGCA 5M4BA 4OBVA 4CBRA 4ISYA 4GE4A 3DXVA 1DKAA 4J8LA 3QN6A 1PFFA 2X5DA 2ZY2A 2VYCA 3H14A 1G4VA 5EUEA 2V1PA 2YCPA 4CXQA 3II0A 1D7UA 4K2IA 4F5JA 1SZSA 1X0MA 1GC3A 2VLFA 1BKGA 1AMAA 4MQQA 1X2AA 3FDDA 3AEJA 3TFTA 1VEFA 1RV4A 1ARGA 1V2FA 3I16A 5EAVA 3EZSA 4AOAA 2Z20A 1ASFA 3BCXA 3E2ZB 1GCKA 2X8UA 3MC6C 3QHXA 5E3KA 4AZKA 3PD6B 5HDMA 3P6KA 1E5FA 4GDYA 3CAIA 4RKCA 2HZPA 1YOOA 4XK1A 2BKWA 3E2ZA 1WYUB 4LNLA 3FSLA 1D7SA 2ZSMA 1AMQA 1B5OA 3PD6A 3D6KA 5E5IA 1B9IA 3W1IA 2Z67A 1IVRA 2YKXA 2Z9UA 1WYUA 3FQ8A 4FL0A 4JEXA 1MDOA 5G0AA 4MQPA 4AH3A 1AICA 3EIAA 3FTBA 2QBTA 5EQCA 2ZY4A 2PB2A 3AELA 1C4KA 1ELQA 2YHKA 2ZYJA 4ADBA 4HF8A 3NYUA 2ZC0A 2VGZA 2VGVA 3GZCA 3PAAA 1ASAA 2DGKA 3ATHA 4J5UA 4U2HA 4ZASA 2BI3A 1YNUA 3LY1A 3GZDC 3R4TA 2W7LA 1VJOA 4WYEA 3EI6A 1LKCA 2HP2A 1FG3A 3DR7A 1G4XA 3AOVA 4JF0A 2DGLA 5BJ3A 3VAXA 5D5SA 5DB5A 3EI8A 4ITGA 3G8MA 1OHYA 1SF2A 4ZM3A 3HT4A 1MGVA 1AKAA 2BWOA 2YOBA 5D95A 1G7WA 1CL1A 1WKHA 3DU4A 3G0TA 3PDXA 4W8IA 4OT8A 3K28A 2HUIA 4A0HA 3UE8A 2CANA 3JW9A 1LC7A 1DTYA 1TARA 1QJ5A 2CTZA 1KKJA 1LW4A 2E7IA 4W5KA 3KGXA 2BIAA 3OP7A 2XBNA 2ZJGA 4GEBA 1LK9A 2OQXA 4ADCA 3LG0A 1ARSA 2VMXA 3ASAA 1M32A 1EJIA 3F6TA 3BWOA 4K2BA 4AO9A 5E4ZA 1C0NA 2GB3A 3K40A 3EIBA 3NRAA 4JF1A 8AATA 2HUFA 1N2TA 3FZ8A 4Q75A 2CH2A 3DC1A 2NMPA 1GC0A 2EPJA 2BYLA 4LC3A 4B9BA 4OYTA 1J04A 3N5MA 2DKBA 1ZC9A 4WXFA 3DODA 1BJ4A 1YJZA 3AEPA 3N0LA 3FVUA 1MAPA 1CQ8A 4BQ0A 5BJ4A 2BIGA 3PJ0A 1I29A 1WKGA 2YKVA 3AEJC 1OHVA 2AY8A 1AHXA 1AJSB 2JJHA 2QMAA 3Q8NA 2YCTA 3BB8A 3E6GA 4JE5A 1I43A 1CQ6A 4P7YA 3WCNA 4ZM4A 1CZEA 3B1CA 1IUGA 1JG8A 4ZSWA 3JU7A 2BHXA 1AJSA 3NU7A 1W7MA 4UHOA 5HHYA 1X28A 1IAXA 4Q76A 4F4EA 1LS3A 1IJIA 1RV3A 4A0FA 2AATA 3EI5A 4EMYA 5EUNA 5G4IA 4UQVA 1D7VA 3RBFA 3VP6A 4ADEA 2GSAA 1AY8A 5G09A 2ZSLA 1XI9A 1DFOA 3B1DA 4M2MA 4CBSA 2D64A 2FYFA 2ORDA 1B5PA 2AEUA 1PMOA 1TOEA 1ELUA 1BQDA 1J32A 1IBJA 1W3UA 3EI7A 3HL2A 2AY3A 4R5ZA 3DR4A 1N31A 4LW4A 3BN1A 2C0RA 1LC5A 3AEMA 2OGEA 2WK9A 1QZ9A 1FC4A 2ZY3A 2O0RA 4Y0IA 4IX8A 3DRDA 3FVXA 1ASNA 3I5TA 1B4XA 1MDXA 1YIZA 2W8TA 3CBFA 4F5GA 3DZZA 1BS0A 4ATQA 1ZODA 5FT8A 3WLXA 1N8PA 1IX8A 2VMUA 4H51A 4NOGA 4F5HA 3MBBA 3NUBA 1W23A 3R9AA 3MADA 1H0CA 1RVUA 2AY5A 4U1TA 3FFHA 5G4JA 1M0OA 2Z9XA 2AY1A 4TMRA 3IHJA 1CS1A 1ZOBA 2W7JA 1AMRA 1WYVB 4RM1A 3K7YA 3G7QA 4EB7A 1ECXA 1V2EA 1X29A 2JGTA 4MKKA 4RKDA 2VGTA 3TQXA 4A6TA 4EB5A 2VMWA 1WYVA 1Z3ZA 1V72A 2BYJA 1ARTA 1UU1A 3FD0A 1ARHA 4BHDA 3ACZA 4IYOB 2WK8A 2PB0A 3PA9A 4W1VA 3KKIA 5AX8A 4WP0A 3KGWA 4IYOA 4MKJA 5I92A 2D66A 4XJMA 2JJFA 2AY6A 2DGMA 1UU2A 2FNIA 4WYDA 2VGUA 1PG8A 1OXOA 4R5FA 4XAUA 2OGAA 1AMSA 2EZ1A 2EO5A 1TASA 3FFRA 4R8DA 4B98A 1EQBA 5EAAA 2VMRA 3FVSA 1W7LA 3AEOA 2EZ2A 2HP1A 4RLGA 5EFSA 4ATPA 2VMZA 2D65A 3KE3A 2F8JA 4JEVA 3GJUA 2RFVA 1ASBA 2V0YA 1LW5A 2VMOA 1MAQA 2WKAA 4IXZA 2VMSA 4UHMA 3H7FA 2G6WA 3E9KA 1S08A 2W7GA 4BMKA 3FZ7A 3HLMA 3PPLA 1M7YA 2VLHA 2FQ6A 2HORA 2EH6A 4I8AA 2EGYA 3FDBA 5F8VA 4W1WA 1MLZA 3AOWA 2ZP7A 2JJGA 2ZY5A 1T3IA 4RJ0A 2R5EA 3DXWA 4WLHA 3RUYA 4ZWVA 1SPAA 3L44A 2YRRA 3RCHB 2VGSA 3VOMA 4A6RA 1MDZA 3LVLB 4CXRA 4E1OA 2CJDA 1D7RA 2W7FA 3AEMC 4Q6RA 4HVKA 1BJNA 2BI9A 3LVKA 2AY4A 3NUIA 2D5YA 2R0TA 3QPGA 3E77A 3RCHA 2O1BA 5FT4A 4ZLVA 4A00A 2Z61A 5G2QA 1AHEA 5TF5A 3EI9A 3MAUA 5J8QA 1QITA 3E2YA 4RAEA 3NYSA 3WCOA 1JS6A 4ITXA 1AIBA 3LVMA 4W91A 4DQ6A 5IWQA 1G7XA 1Y4IA 4FFCA 1MLYA 9AATA 2W7DA 4MQRA 2Z9VA 5FT5A 2CSTA 1DGDA 2WK7A 1CJ0A 4JE5D 1O4SA 1ORDA 4PVFA 2C44A 7AATA 1B9HA 1C7NA 2VMTA 3QBOA 5HXXA 3FRKA 3FKDA 2VMNA 4M2JA 3AV7A 5C6UA 2W7HA 3JWAA 4PFFA 1YIYA 1AY4A 1SVVA 1S09A 4KYOA 3WGBA 2DOUA 3A8UX 3ECDA 1C7OA 3NU8A 2AY9A 2AY7A 3GSBA 3QGUA 2TPLA 1B8GA 1PMMA 1S06A 1W7NA 3B1EA 2FN6A 1BW0A 5EUDA 2HOXA 4LW2A 3N75A 5K8BA 2YKUA 4LNMA 4CVQA 2E7JA 4OBUA 1H1CA 3WZFA 4KAMA 5FT6A 4XQ2A 3BS8A 3PIUA 1DGEA 4MY5A 3A9ZA 2C81A 3JZLA 3TCMA 4OCAA 2X5FA 5LHAA 2BWPA 2GQNA 2O7CA 3OKSA 4ZDPA 4RITA 1IAYA 2QB2A 4GRXA 5DJ1A 1SZKA 1KMJA 2CY8A 4BA5A 4F5LA 3GBXA 3P1TA 4WLJA 2AY2A 2C7TA 1ASEA 2W7KA 4WYGA 1CZCA 1DJ9A 2VI8A 5JAYA 2VIAA 1S07A 1GD9A 2D63A 2R5CB 3W1HA 1BJWA 1DJEA 1M0PA 2E54A 1BQAA 3ELEA 3WKRA 1FG7A 2AEVA 4Q31A 3MEBA 1XEYA 1ARIA 1M0NA 2R5CA 4F5KA 2BI2A 1EG5A 3JTXA 4OTLA 4WYCA 1TOGA 1DJUA 4K2MA 2OKKA 1M6SA 2W8UA 2DKJA 2OKJA 1AAWA 5M46A 1E5EA 1GC4A 2QA3A 1OHWA 1TPLA 1ASCA 2W7IA 2BI1A 4A0RA 4MGRA 3B8XA 3BV0A 3FZ6A 4JEYA 4BA4A 3EZ1A 1GC2A 1KL1A 5G2PA 1SFFA 2JJEA 3NTJA 4F5MA 4W1XA 3BWNA 3PDBB 3W1JA 1AAMA 2X3LA 2YKYA 3BCBA 1KKPA 3CQ6A 3PGYA 4R2NA 2D7YA 4IXOA 3PDBA 1AIAA 1VP4A 2W8JA 5M49A 3NX3A 3ISLA 2QB3A 3EUCA 3T32A 1Z7DA 1I48A 2D61A 4O6ZA 4ZSYA 3VK2A 3GR9A 2FM1A 2JG2A 2R2NA 2FNUA 2JISA 1GEYA 4WD2A 3WKSA 3HBXA 2VI9A 1GBNA 1TOIA 3RBLA 2VIBA 1OXPA 1AHFA 4Y0HA 3ZZKA 3I4JA 3USFA 1CL2A 4RJYA 3HVYA 1V2DA 3ZZJA 3TATA 1YJSA 1JS3A 4A0GA 4IW7A 4PFNA 2BWNA 4WBTA 4RIZA 3TFUA 3RI6A 3MKJA 5F9SA 4ZWMA 3UAKA 2XH1A 3NNKA 3UWCA 5LH9A 4KXKA 1TOJA 1D2FA 1YJYA 3HMUA 3ELPA 3IF2A 4N0BA 4JEWA
chains in the Genus database with same CATH superfamily
2VGWA 4MSOA 2YRIA 4WXGA 1QJ3A 1WYTB 4ADDA 1WSTA 2Q7WA 4AZJA 4GE9A 3AATA 2VMVA 3E2FA 5EIGB 3GETA 3FQ7A 1QISA 1WYTA 2DR1A 2W8VA 3B46A 4GE7A 1SZUA 3F9TA 3N4XA 2CJGA 1C7GA 3FCRA 3MAFB 1O61A 4WYFA 1LC8A 5EIGA 5DJ9A 1M0QA 2VMYA 5DX5A 4JEZA 4TN4A 3MAFA 5M4DA 4IXSA 1KMKA 1UKJA 4TV7A 3VK4A 2E7UA 4DBCA 1OATA 3CQ5A 3MC6A 4EFFA 2BI5A 1GDEA 2CFBA 4E3RA 1GEWA 2GMUA 4UHNA 2HOYA 2CH1A 4XJPA 3COGA 4ZDLA 3WX9A 1C9CA 1IX6A 4E3QA 1S0AA 4K05A 1KAFA 2HUUA 1M4NA 4N0WA 3ZRRA 4A6UA 4F5FA 1CQ7A 1BJOB 4ZDOA 1QGNA 3A9XA 4UOYA 1ASLA 3M5UA 1QIRA 2VMQA 3A9YA 4AO4A 1AKCA 1ASDA 1BJOA 2Z1ZA 1JF9A 2HOZA 1P3WA 3BWNC 2CB1A 4QGRA 1TOKA 3HQTA 4WB0B 2OATA 1I41A 3LWSA 4XEWA 4XJOA 3NDNA 1AX4A 1UU0A 2D7ZA 2GMSA 4L0OA 3WY7A 2PO3A 4DGTA 2W7EA 3GZDA 4WB0A 4F5IA 1U08A 2W8WA 3L8AA 4PIWA 4M2KA 4A72A 4EU1A 1IX7A 3QM2A 1O69A 3GWPA 3A2BA 3ASBA 3BC8A 1AKBA 4XJLA 4LNJA 4GSAA 2CJHA 4ZAHA 1YAAA 1O62A 3QI6A 2W7MA 2VMPA 4OC9A 1KL2A 1GEXA 3BCAA 3AENB 2Z9WA 4OMAA 4WYAA 2YCNA 1RVYA 4Y0DA 4E77A 2Z1YA 3AENA 3ZRQA 2QLRA 1BT4A 2QSRA 3FQAA 3JWBA 3CQ4A 3H9XA 3RQ1A 3ZRPA 1AHYA 1AHGA 3LVJA 2CINA 1TATA 3DYDA 1ASGA 3LV2A 3NYTA 4IY7A 1AJRA 1ASMA 2ZUKA 1AY5A 3F0HA 2BIEA 4P3MA 4WXBA 3VK3A 3HDOA 3WGCA 5M4BA 4OBVA 4CBRA 4ISYA 4GE4A 3DXVA 1DKAA 4J8LA 3QN6A 1PFFA 2X5DA 2ZY2A 2VYCA 3H14A 1G4VA 5EUEA 2V1PA 2YCPA 4CXQA 3II0A 1D7UA 4K2IA 4F5JA 1SZSA 1X0MA 1GC3A 2VLFA 1BKGA 1AMAA 4MQQA 1X2AA 3FDDA 3AEJA 3TFTA 1VEFA 1RV4A 1ARGA 1V2FA 3I16A 5EAVA 3EZSA 4AOAA 2Z20A 1ASFA 3BCXA 3E2ZB 1GCKA 2X8UA 3MC6C 3QHXA 5E3KA 4AZKA 3PD6B 3N4SA 5HDMA 3P6KA 1E5FA 4GDYA 3CAIA 4RKCA 2HZPA 1YOOA 4XK1A 2BKWA 3E2ZA 1WYUB 4LNLA 3FSLA 1D7SA 2ZSMA 1AMQA 1B5OA 3PD6A 3D6KA 5E5IA 1B9IA 3W1IA 2Z67A 1IVRA 2YKXA 2Z9UA 1WYUA 3FQ8A 4FL0A 4JEXA 1MDOA 5G0AA 4MQPA 4AH3A 1AICA 3EIAA 3FTBA 2QBTA 5EQCA 2ZY4A 2PB2A 3AELA 1C4KA 1ELQA 2YHKA 2ZYJA 4ADBA 4HF8A 3NYUA 2ZC0A 2VGZA 2VGVA 3GZCA 3PAAA 1ASAA 2DGKA 3ATHA 4J5UA 4U2HA 4ZASA 2BI3A 1YNUA 3LY1A 3GZDC 3R4TA 2W7LA 1VJOA 4WYEA 3EI6A 1LKCA 2HP2A 1FG3A 3DR7A 1G4XA 3AOVA 4JF0A 2DGLA 5BJ3A 3VAXA 5D5SA 5DB5A 3EI8A 4ITGA 3N7NA 3G8MA 1OHYA 1SF2A 4ZM3A 3HT4A 1MGVA 1AKAA 2BWOA 2YOBA 5D95A 1G7WA 1CL1A 1WKHA 3DU4A 3G0TA 3PDXA 4W8IA 4OT8A 3K28A 2HUIA 4A0HA 3UE8A 2CANA 3JW9A 1LC7A 1DTYA 1TARA 1QJ5A 2CTZA 1KKJA 1LW4A 2KFPA 2E7IA 4W5KA 3KGXA 2BIAA 3OP7A 2XBNA 2ZJGA 4GEBA 1LK9A 2OQXA 4ADCA 4H63Q 3LG0A 1ARSA 2VMXA 3ASAA 1M32A 1EJIA 3F6TA 3BWOA 4K2BA 4AO9A 2FKIA 5E4ZA 1C0NA 2GB3A 3K40A 3EIBA 3NRAA 4JF1A 8AATA 2HUFA 1N2TA 3FZ8A 4Q75A 2CH2A 3DC1A 2NMPA 1GC0A 2EPJA 2BYLA 4LC3A 4B9BA 4OYTA 1J04A 3N5MA 2DKBA 1ZC9A 4WXFA 3DODA 1BJ4A 1YJZA 3AEPA 3N0LA 3FVUA 1MAPA 1CQ8A 4BQ0A 5BJ4A 2BIGA 3PJ0A 1I29A 1WKGA 2YKVA 3AEJC 1OHVA 2AY8A 1AHXA 1AJSB 2JJHA 2QMAA 3Q8NA 2YCTA 3BB8A 3E6GA 4JE5A 1I43A 1CQ6A 4P7YA 3WCNA 4ZM4A 1CZEA 3B1CA 1IUGA 1JG8A 4ZSWA 3JU7A 2BHXA 1AJSA 3NU7A 1W7MA 4UHOA 5HHYA 1X28A 1IAXA 4Q76A 4F4EA 1LS3A 1IJIA 1RV3A 4A0FA 2AATA 3EI5A 4EMYA 5EUNA 5G4IA 4UQVA 1D7VA 3RBFA 3VP6A 4ADEA 2GSAA 1AY8A 5G09A 2ZSLA 1XI9A 1DFOA 3B1DA 4M2MA 4CBSA 2D64A 2FYFA 2ORDA 1B5PA 2AEUA 1PMOA 1TOEA 1ELUA 1BQDA 1J32A 1IBJA 1W3UA 3EI7A 3HL2A 2WB6A 2AY3A 4R5ZA 3DR4A 1N31A 4LW4A 3BN1A 2C0RA 1LC5A 3AEMA 2OGEA 2WK9A 1QZ9A 1FC4A 2ZY3A 2O0RA 4Y0IA 4IX8A 3DRDA 3FVXA 1ASNA 3I5TA 1B4XA 1MDXA 1YIZA 2W8TA 3CBFA 4F5GA 2G7JA 3DZZA 1BS0A 4ATQA 1ZODA 5FT8A 3WLXA 2EYQA 1N8PA 1IX8A 2VMUA 4H51A 4NOGA 4F5HA 3MBBA 3NUBA 1W23A 3R9AA 3MADA 1H0CA 1RVUA 2AY5A 4U1TA 3FFHA 5G4JA 1M0OA 2Z9XA 2AY1A 4TMRA 3IHJA 1CS1A 1ZOBA 2W7JA 1AMRA 1WYVB 4RM1A 3K7YA 3G7QA 4EB7A 1ECXA 1V2EA 1X29A 2JGTA 4MKKA 4RKDA 2VGTA 3TQXA 4A6TA 4EB5A 2VMWA 1WYVA 1Z3ZA 1V72A 2BYJA 1ARTA 1UU1A 3FD0A 1ARHA 4BHDA 3ACZA 4IYOB 2WK8A 2PB0A 3PA9A 4W1VA 3KKIA 5AX8A 4WP0A 3KGWA 4IYOA 4MKJA 5I92A 2D66A 4XJMA 2JJFA 2AY6A 2DGMA 1UU2A 2FNIA 4WYDA 2VGUA 1PG8A 1OXOA 4R5FA 4XAUA 2OGAA 1AMSA 2EZ1A 2EO5A 1TASA 3FFRA 4R8DA 4B98A 1EQBA 5EAAA 2VMRA 3FVSA 1W7LA 3AEOA 2EZ2A 2HP1A 4RLGA 5EFSA 4ATPA 2VMZA 2D65A 3KE3A 2F8JA 4JEVA 3GJUA 2RFVA 1ASBA 2V0YA 1LW5A 2VMOA 1MAQA 2WKAA 4IXZA 2VMSA 4UHMA 3H7FA 2G6WA 3E9KA 1S08A 2W7GA 4BMKA 3FZ7A 3HLMA 3PPLA 1M7YA 2VLHA 2FQ6A 2HORA 2EH6A 4I8AA 2EGYA 3FDBA 5F8VA 4W1WA 1MLZA 3AOWA 2ZP7A 2JJGA 2ZY5A 1T3IA 4RJ0A 2R5EA 3DXWA 4WLHA 3RUYA 4ZWVA 1SPAA 3L44A 2YRRA 3RCHB 2VGSA 3VOMA 4A6RA 1MDZA 3LVLB 4CXRA 4E1OA 2CJDA 1D7RA 2W7FA 3AEMC 4Q6RA 4HVKA 1BJNA 2BI9A 3LVKA 2AY4A 3NUIA 2D5YA 2R0TA 3QPGA 3E77A 3RCHA 2O1BA 5FT4A 4ZLVA 4A00A 2Z61A 5G2QA 1AHEA 5TF5A 3EI9A 3MAUA 5J8QA 1QITA 3E2YA 4RAEA 3NYSA 3WCOA 1JS6A 4ITXA 1AIBA 3LVMA 4W91A 4DQ6A 5IWQA 1G7XA 1Y4IA 4FFCA 1MLYA 9AATA 2W7DA 4MQRA 2Z9VA 5FT5A 2CSTA 1DGDA 2WK7A 1CJ0A 4JE5D 1O4SA 1ORDA 4PVFA 2C44A 7AATA 1B9HA 1C7NA 2VMTA 3QBOA 5HXXA 3FRKA 3FKDA 2VMNA 4M2JA 3AV7A 5C6UA 2W7HA 3JWAA 4PFFA 1YIYA 1AY4A 1SVVA 1S09A 4KYOA 3WGBA 2DOUA 3A8UX 3ECDA 1C7OA 3NU8A 2AY9A 2AY7A 3GSBA 3QGUA 2TPLA 1B8GA 1PMMA 1S06A 1W7NA 3B1EA 2FN6A 1BW0A 5EUDA 2HOXA 4LW2A 3N75A 5K8BA 2YKUA 4LNMA 4CVQA 2E7JA 4OBUA 1H1CA 3WZFA 4KAMA 5FT6A 4XQ2A 3BS8A 3PIUA 1DGEA 4MY5A 3A9ZA 2C81A 3JZLA 3TCMA 4OCAA 2X5FA 5LHAA 2BWPA 2GQNA 2O7CA 3OKSA 4ZDPA 4RITA 1IAYA 2QB2A 4GRXA 5DJ1A 1SZKA 1KMJA 2CY8A 4BA5A 4F5LA 3GBXA 3P1TA 4WLJA 2AY2A 2C7TA 1ASEA 2W7KA 4WYGA 1CZCA 1DJ9A 2VI8A 5JAYA 2VIAA 1S07A 1GD9A 2D63A 2R5CB 3W1HA 1BJWA 1DJEA 1M0PA 2E54A 1BQAA 3ELEA 3WKRA 1FG7A 2AEVA 4Q31A 3MEBA 1XEYA 1ARIA 1M0NA 2R5CA 4F5KA 2BI2A 1EG5A 3JTXA 4OTLA 4WYCA 1TOGA 1DJUA 4K2MA 2OKKA 1M6SA 2W8UA 2DKJA 2OKJA 1AAWA 5M46A 1E5EA 1GC4A 2QA3A 1OHWA 1TPLA 1ASCA 2W7IA 2BI1A 4A0RA 4MGRA 3B8XA 3BV0A 3FZ6A 4JEYA 4BA4A 3EZ1A 1GC2A 1KL1A 5G2PA 1SFFA 2JJEA 3NTJA 4F5MA 4W1XA 3BWNA 3PDBB 3W1JA 1AAMA 2X3LA 2YKYA 3BCBA 1KKPA 3CQ6A 3PGYA 4R2NA 2D7YA 4IXOA 3PDBA 1AIAA 1VP4A 2W8JA 5M49A 3NX3A 3ISLA 2QB3A 3EUCA 3T32A 1Z7DA 1I48A 2D61A 4O6ZA 2A1VA 4ZSYA 3VK2A 3GR9A 2FM1A 2JG2A 2R2NA 2FNUA 2JISA 1GEYA 4WD2A 3WKSA 3HBXA 2VI9A 1GBNA 1TOIA 3RBLA 2VIBA 1OXPA 1AHFA 4Y0HA 3ZZKA 3I4JA 3USFA 1CL2A 4RJYA 3HVYA 1V2DA 3ZZJA 3TATA 1YJSA 1JS3A 4A0GA 4IW7A 4PFNA 2BWNA 4WBTA 4RIZA 5KTBA 3N4RA 3TFUA 3RI6A 3MKJA 5F9SA 4ZWMA 3UAKA 2XH1A 3NNKA 3UWCA 5LH9A 4KXKA 1TOJA 1D2FA 1YJYA 3HMUA 3ELPA 3IF2A 4N0BA 4JEWA
chains in the Genus database with same CATH topology
2VGWA 4MSOA 2YRIA 4WXGA 1QJ3A 1WYTB 4ADDA 1WSTA 2Q7WA 4AZJA 4GE9A 3AATA 2VMVA 3E2FA 5EIGB 3GETA 3FQ7A 1QISA 1WYTA 2DR1A 2W8VA 3B46A 4GE7A 1SZUA 3F9TA 3N4XA 2CJGA 1C7GA 3FCRA 3MAFB 1O61A 4WYFA 1LC8A 5EIGA 5DJ9A 1M0QA 2VMYA 5DX5A 4JEZA 4TN4A 3MAFA 5M4DA 4IXSA 1KMKA 1UKJA 4TV7A 3VK4A 2E7UA 4DBCA 1OATA 3CQ5A 3MC6A 4EFFA 2BI5A 1GDEA 2CFBA 4E3RA 1GEWA 2GMUA 4UHNA 2HOYA 2CH1A 4XJPA 3COGA 4ZDLA 3WX9A 1C9CA 1IX6A 4E3QA 1S0AA 4K05A 2HUUA 1M4NA 4N0WA 3ZRRA 4A6UA 4F5FA 1CQ7A 1BJOB 4ZDOA 1QGNA 3A9XA 4UOYA 1ASLA 3M5UA 1QIRA 2VMQA 3A9YA 4AO4A 1AKCA 1ASDA 1BJOA 2Z1ZA 1JF9A 2HOZA 1P3WA 3BWNC 2CB1A 4QGRA 1TOKA 3HQTA 4WB0B 2OATA 1I41A 3LWSA 4XEWA 4XJOA 3NDNA 1AX4A 1UU0A 2D7ZA 2GMSA 4L0OA 3WY7A 2PO3A 4DGTA 2W7EA 3GZDA 4WB0A 4F5IA 1U08A 2W8WA 3L8AA 4PIWA 4M2KA 4A72A 4EU1A 1IX7A 3QM2A 1O69A 3GWPA 3A2BA 3ASBA 3BC8A 1AKBA 4XJLA 4LNJA 4GSAA 2CJHA 4ZAHA 1YAAA 1O62A 3QI6A 2W7MA 2VMPA 4OC9A 1KL2A 1GEXA 3BCAA 3AENB 2Z9WA 4OMAA 4WYAA 2YCNA 1RVYA 4Y0DA 4E77A 2Z1YA 3AENA 3ZRQA 2QLRA 1BT4A 2QSRA 3FQAA 3JWBA 3CQ4A 3H9XA 3RQ1A 3ZRPA 1AHYA 1AHGA 3LVJA 2CINA 1TATA 3DYDA 1ASGA 3LV2A 3NYTA 4IY7A 1AJRA 1ASMA 2ZUKA 1AY5A 3F0HA 2BIEA 4P3MA 4WXBA 3VK3A 3HDOA 3WGCA 5M4BA 4OBVA 4CBRA 4ISYA 4GE4A 3DXVA 1DKAA 4J8LA 3QN6A 1PFFA 2X5DA 2ZY2A 2VYCA 3H14A 1G4VA 5EUEA 2V1PA 2YCPA 4CXQA 3II0A 1D7UA 4K2IA 4F5JA 1SZSA 1X0MA 1GC3A 2VLFA 1BKGA 1AMAA 4MQQA 1X2AA 3FDDA 3AEJA 3TFTA 1VEFA 1RV4A 1ARGA 1V2FA 3I16A 5EAVA 3EZSA 4AOAA 2Z20A 1ASFA 3BCXA 3E2ZB 1GCKA 2X8UA 3MC6C 3QHXA 5E3KA 4AZKA 3PD6B 3N4SA 5HDMA 3P6KA 1E5FA 4GDYA 3CAIA 4RKCA 2HZPA 1YOOA 4XK1A 2BKWA 3E2ZA 1WYUB 4LNLA 3FSLA 1D7SA 2ZSMA 1AMQA 1B5OA 3PD6A 3D6KA 5E5IA 1B9IA 3W1IA 2Z67A 1IVRA 2YKXA 2Z9UA 1WYUA 3FQ8A 4FL0A 4JEXA 1MDOA 5G0AA 4MQPA 4AH3A 1AICA 3EIAA 3FTBA 2QBTA 5EQCA 2ZY4A 2PB2A 3AELA 1C4KA 1ELQA 2YHKA 2ZYJA 4ADBA 4HF8A 3NYUA 2ZC0A 2VGZA 2VGVA 3GZCA 3PAAA 1ASAA 2DGKA 3ATHA 4J5UA 4U2HA 4ZASA 2BI3A 1YNUA 3LY1A 3GZDC 3R4TA 2W7LA 1VJOA 4WYEA 3EI6A 1LKCA 2HP2A 1FG3A 3DR7A 1G4XA 3AOVA 4JF0A 2DGLA 5BJ3A 3VAXA 5D5SA 5DB5A 3EI8A 4ITGA 3N7NA 3G8MA 1OHYA 1SF2A 4ZM3A 3HT4A 1MGVA 1AKAA 2BWOA 2YOBA 5D95A 1G7WA 1CL1A 1WKHA 3DU4A 3G0TA 3PDXA 4W8IA 4OT8A 3K28A 2HUIA 4A0HA 3UE8A 2CANA 3JW9A 1LC7A 1DTYA 1TARA 1QJ5A 2CTZA 1KKJA 1LW4A 2KFPA 2E7IA 4W5KA 3KGXA 2BIAA 3OP7A 2XBNA 2ZJGA 4GEBA 1LK9A 2OQXA 4ADCA 4H63Q 3LG0A 1ARSA 2VMXA 3ASAA 1M32A 1EJIA 3F6TA 3BWOA 4K2BA 4AO9A 2FKIA 5E4ZA 1C0NA 2GB3A 3K40A 3EIBA 3NRAA 4JF1A 8AATA 2HUFA 1N2TA 3FZ8A 4Q75A 2CH2A 3DC1A 2NMPA 1GC0A 2EPJA 2BYLA 4LC3A 4B9BA 4OYTA 1J04A 3N5MA 2DKBA 1ZC9A 4WXFA 3DODA 1BJ4A 1YJZA 3AEPA 3N0LA 3FVUA 1MAPA 1CQ8A 4BQ0A 5BJ4A 2BIGA 3PJ0A 1I29A 1WKGA 2YKVA 3AEJC 1OHVA 2AY8A 1AHXA 1AJSB 2JJHA 2QMAA 3Q8NA 2YCTA 3BB8A 3E6GA 4JE5A 1I43A 1CQ6A 4P7YA 3WCNA 4ZM4A 1CZEA 3B1CA 1IUGA 1JG8A 4ZSWA 3JU7A 2BHXA 1AJSA 3NU7A 1W7MA 4UHOA 5HHYA 1X28A 1IAXA 4Q76A 4F4EA 1LS3A 1IJIA 1RV3A 4A0FA 2AATA 3EI5A 4EMYA 5EUNA 5G4IA 4UQVA 1D7VA 3RBFA 3VP6A 4ADEA 2GSAA 1AY8A 5G09A 2ZSLA 1XI9A 1DFOA 3B1DA 4M2MA 4CBSA 2D64A 2FYFA 2ORDA 1B5PA 2AEUA 1PMOA 1TOEA 1ELUA 1BQDA 1J32A 1IBJA 1W3UA 3EI7A 3HL2A 2WB6A 2AY3A 4R5ZA 3DR4A 1N31A 4LW4A 3BN1A 2C0RA 1LC5A 3AEMA 2OGEA 2WK9A 1QZ9A 1FC4A 2ZY3A 2O0RA 4Y0IA 4IX8A 3DRDA 3FVXA 1ASNA 3I5TA 1B4XA 1MDXA 1YIZA 2W8TA 3CBFA 4F5GA 2G7JA 3DZZA 1BS0A 4ATQA 1ZODA 5FT8A 3WLXA 2EYQA 1N8PA 1IX8A 2VMUA 4H51A 4NOGA 4F5HA 3MBBA 3NUBA 1W23A 3R9AA 3MADA 1H0CA 1RVUA 2AY5A 4U1TA 3FFHA 5G4JA 1M0OA 2Z9XA 2AY1A 4TMRA 3IHJA 1CS1A 1ZOBA 2W7JA 1AMRA 1WYVB 4RM1A 3K7YA 3G7QA 4EB7A 1ECXA 1V2EA 1X29A 2JGTA 4MKKA 4RKDA 2VGTA 3TQXA 4A6TA 4EB5A 2VMWA 1WYVA 1Z3ZA 1V72A 2BYJA 1ARTA 1UU1A 3FD0A 1ARHA 4BHDA 3ACZA 4IYOB 2WK8A 2PB0A 3PA9A 4W1VA 3KKIA 5AX8A 4WP0A 3KGWA 4IYOA 4MKJA 5I92A 2D66A 4XJMA 2JJFA 2AY6A 2DGMA 1UU2A 2FNIA 4WYDA 2VGUA 1PG8A 1OXOA 4R5FA 4XAUA 2OGAA 1AMSA 2EZ1A 2EO5A 1TASA 3FFRA 4R8DA 4B98A 1EQBA 5EAAA 2VMRA 3FVSA 1W7LA 3AEOA 2EZ2A 2HP1A 4RLGA 5EFSA 4ATPA 2VMZA 2D65A 3KE3A 2F8JA 4JEVA 3GJUA 2RFVA 1ASBA 2V0YA 1LW5A 2VMOA 1MAQA 2WKAA 4IXZA 2VMSA 4UHMA 3H7FA 2G6WA 3E9KA 1S08A 2W7GA 4BMKA 3FZ7A 3HLMA 3PPLA 1M7YA 2VLHA 2FQ6A 2HORA 2EH6A 4I8AA 2EGYA 3FDBA 5F8VA 4W1WA 1MLZA 3AOWA 2ZP7A 2JJGA 2ZY5A 1T3IA 4RJ0A 2R5EA 3DXWA 4WLHA 3RUYA 4ZWVA 1SPAA 3L44A 2YRRA 3RCHB 2VGSA 3VOMA 4A6RA 1MDZA 3LVLB 4CXRA 4E1OA 2CJDA 1D7RA 2W7FA 3AEMC 4Q6RA 4HVKA 1BJNA 2BI9A 3LVKA 2AY4A 3NUIA 2D5YA 2R0TA 3QPGA 3E77A 3RCHA 2O1BA 5FT4A 4ZLVA 4A00A 2Z61A 5G2QA 1AHEA 5TF5A 3EI9A 3MAUA 5J8QA 1QITA 3E2YA 4RAEA 3NYSA 3WCOA 1JS6A 4ITXA 1AIBA 3LVMA 4W91A 4DQ6A 5IWQA 1G7XA 1Y4IA 4FFCA 1MLYA 9AATA 2W7DA 4MQRA 2Z9VA 5FT5A 2CSTA 1DGDA 2WK7A 1CJ0A 4JE5D 1O4SA 1ORDA 4PVFA 2C44A 7AATA 1B9HA 1C7NA 2VMTA 3QBOA 5HXXA 3FRKA 3FKDA 2VMNA 4M2JA 3AV7A 5C6UA 2W7HA 3JWAA 4PFFA 1YIYA 1AY4A 1SVVA 1S09A 4KYOA 3WGBA 2DOUA 3A8UX 3ECDA 1C7OA 3NU8A 2AY9A 2AY7A 3GSBA 3QGUA 2TPLA 1B8GA 1PMMA 1S06A 1W7NA 3B1EA 2FN6A 1BW0A 5EUDA 2HOXA 4LW2A 3N75A 5K8BA 2YKUA 4LNMA 4CVQA 2E7JA 4OBUA 1H1CA 3WZFA 4KAMA 5FT6A 4XQ2A 3BS8A 3PIUA 1DGEA 4MY5A 3A9ZA 2C81A 3JZLA 3TCMA 4OCAA 2X5FA 5LHAA 2BWPA 2GQNA 2O7CA 3OKSA 4ZDPA 4RITA 1IAYA 2QB2A 4GRXA 5DJ1A 1SZKA 1KMJA 2CY8A 4BA5A 4F5LA 3GBXA 3P1TA 4WLJA 2AY2A 2C7TA 1ASEA 2W7KA 4WYGA 1CZCA 1DJ9A 2VI8A 5JAYA 2VIAA 1S07A 1GD9A 2D63A 2R5CB 3W1HA 1BJWA 1DJEA 1M0PA 2E54A 1BQAA 3ELEA 3WKRA 1FG7A 2AEVA 4Q31A 3MEBA 1XEYA 1ARIA 1M0NA 2R5CA 4F5KA 2BI2A 1EG5A 3JTXA 4OTLA 4WYCA 1TOGA 1DJUA 4K2MA 2OKKA 1M6SA 2W8UA 2DKJA 2OKJA 1AAWA 5M46A 1E5EA 1GC4A 2QA3A 1OHWA 1TPLA 1ASCA 2W7IA 2BI1A 4A0RA 4MGRA 3B8XA 3BV0A 3FZ6A 4JEYA 4BA4A 3EZ1A 1GC2A 1KL1A 5G2PA 1SFFA 2JJEA 3NTJA 4F5MA 4W1XA 3BWNA 3PDBB 3W1JA 1AAMA 2X3LA 2YKYA 3BCBA 1KKPA 3CQ6A 3PGYA 4R2NA 2D7YA 4IXOA 3PDBA 1AIAA 1VP4A 2W8JA 5M49A 3NX3A 3ISLA 2QB3A 3EUCA 3T32A 1Z7DA 1I48A 2D61A 4O6ZA 2A1VA 4ZSYA 3VK2A 3GR9A 2FM1A 2JG2A 2R2NA 2FNUA 2JISA 1GEYA 4WD2A 3WKSA 3HBXA 2VI9A 1GBNA 1TOIA 3RBLA 2VIBA 1OXPA 1AHFA 4Y0HA 3ZZKA 3I4JA 3USFA 1CL2A 4RJYA 3HVYA 1V2DA 3ZZJA 3TATA 1YJSA 1JS3A 4A0GA 4IW7A 4PFNA 2BWNA 4WBTA 4RIZA 5KTBA 3N4RA 3TFUA 3RI6A 3MKJA 5F9SA 4ZWMA 3UAKA 2XH1A 3NNKA 3UWCA 5LH9A 4KXKA 1TOJA 1D2FA 1YJYA 3HMUA 3ELPA 3IF2A 4N0BA 4JEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGW A;  4MSO A;  2YRI A;  4WXG A;  1QJ3 A;  1WYT B;  4ADD A;  1WST A;  2Q7W A;  4AZJ A;  4GE9 A;  3AAT A;  2VMV A;  3E2F A;  5EIG B;  3GET A;  3FQ7 A;  1QIS A;  1WYT A;  2DR1 A;  2W8V A;  3B46 A;  4GE7 A;  1SZU A;  3F9T A;  2CJG A;  1C7G A;  3FCR A;  3MAF B;  1O61 A;  4WYF A;  1LC8 A;  5EIG A;  5DJ9 A;  1M0Q A;  2VMY A;  5DX5 A;  4JEZ A;  4TN4 A;  3MAF A;  5M4D A;  4IXS A;  1KMK A;  1UKJ A;  4TV7 A;  3VK4 A;  2E7U A;  4DBC A;  1OAT A;  3CQ5 A;  3MC6 A;  4EFF A;  2BI5 A;  1GDE A;  2CFB A;  4E3R A;  1GEW A;  2GMU A;  4UHN A;  2HOY A;  2CH1 A;  4XJP A;  3COG A;  4ZDL A;  3WX9 A;  1C9C A;  1IX6 A;  4E3Q A;  1S0A A;  2HUU A;  1M4N A;  4N0W A;  3ZRR A;  4A6U A;  4F5F A;  1CQ7 A;  1BJO B;  4ZDO A;  1QGN A;  3A9X A;  4UOY A;  1ASL A;  3M5U A;  1QIR A;  2VMQ A;  3A9Y A;  4AO4 A;  1AKC A;  1ASD A;  1BJO A;  2Z1Z A;  1JF9 A;  2HOZ A;  1P3W A;  3BWN C;  2CB1 A;  4QGR A;  1TOK A;  3HQT A;  4WB0 B;  2OAT A;  1I41 A;  3LWS A;  4XEW A;  4XJO A;  3NDN A;  1AX4 A;  1UU0 A;  2D7Z A;  2GMS A;  4L0O A;  3WY7 A;  2PO3 A;  4DGT A;  2W7E A;  3GZD A;  4WB0 A;  4F5I A;  1U08 A;  2W8W A;  3L8A A;  4PIW A;  4M2K A;  4A72 A;  4EU1 A;  1IX7 A;  3QM2 A;  1O69 A;  3GWP A;  3A2B A;  3ASB A;  3BC8 A;  1AKB A;  4XJL A;  4LNJ A;  4GSA A;  2CJH A;  4ZAH A;  1YAA A;  1O62 A;  3QI6 A;  2W7M A;  2VMP A;  4OC9 A;  1KL2 A;  1GEX A;  3BCA A;  3AEN B;  2Z9W A;  4OMA A;  4WYA A;  2YCN A;  1RVY A;  4Y0D A;  4E77 A;  2Z1Y A;  3AEN A;  3ZRQ A;  2QLR A;  1BT4 A;  3FQA A;  3JWB A;  3CQ4 A;  3RQ1 A;  3ZRP A;  1AHY A;  1AHG A;  3LVJ A;  2CIN A;  1TAT A;  3DYD A;  1ASG A;  3LV2 A;  3NYT A;  4IY7 A;  1AJR A;  1ASM A;  2ZUK A;  1AY5 A;  3F0H A;  2BIE A;  4P3M A;  4WXB A;  3VK3 A;  3HDO A;  3WGC A;  5M4B A;  4OBV A;  4CBR A;  4ISY A;  4GE4 A;  3DXV A;  1DKA A;  4J8L A;  3QN6 A;  1PFF A;  2X5D A;  2ZY2 A;  2VYC A;  3H14 A;  1G4V A;  5EUE A;  2V1P A;  2YCP A;  4CXQ A;  3II0 A;  1D7U A;  4K2I A;  4F5J A;  1SZS A;  1X0M A;  1GC3 A;  2VLF A;  1BKG A;  1AMA A;  4MQQ A;  1X2A A;  3FDD A;  3AEJ A;  3TFT A;  1VEF A;  1RV4 A;  1ARG A;  1V2F A;  3I16 A;  5EAV A;  3EZS A;  4AOA A;  2Z20 A;  1ASF A;  3BCX A;  3E2Z B;  1GCK A;  2X8U A;  3MC6 C;  3QHX A;  5E3K A;  4AZK A;  3PD6 B;  5HDM A;  3P6K A;  1E5F A;  4GDY A;  3CAI A;  4RKC A;  2HZP A;  1YOO A;  4XK1 A;  2BKW A;  3E2Z A;  1WYU B;  4LNL A;  3FSL A;  1D7S A;  2ZSM A;  1AMQ A;  1B5O A;  3PD6 A;  3D6K A;  5E5I A;  1B9I A;  3W1I A;  2Z67 A;  1IVR A;  2YKX A;  2Z9U A;  1WYU A;  3FQ8 A;  4FL0 A;  4JEX A;  1MDO A;  5G0A A;  4MQP A;  4AH3 A;  1AIC A;  3EIA A;  3FTB A;  2QBT A;  5EQC A;  2ZY4 A;  2PB2 A;  3AEL A;  1C4K A;  1ELQ A;  2YHK A;  2ZYJ A;  4ADB A;  4HF8 A;  3NYU A;  2ZC0 A;  2VGZ A;  2VGV A;  3GZC A;  3PAA A;  1ASA A;  2DGK A;  3ATH A;  4J5U A;  4U2H A;  4ZAS A;  2BI3 A;  1YNU A;  3LY1 A;  3GZD C;  3R4T A;  2W7L A;  1VJO A;  4WYE A;  3EI6 A;  1LKC A;  2HP2 A;  1FG3 A;  3DR7 A;  1G4X A;  3AOV A;  4JF0 A;  2DGL A;  5BJ3 A;  3VAX A;  5D5S A;  5DB5 A;  3EI8 A;  4ITG A;  3G8M A;  1OHY A;  1SF2 A;  4ZM3 A;  3HT4 A;  1MGV A;  1AKA A;  2BWO A;  2YOB A;  5D95 A;  1G7W A;  1CL1 A;  1WKH A;  3DU4 A;  3G0T A;  3PDX A;  4W8I A;  4OT8 A;  3K28 A;  2HUI A;  4A0H A;  3UE8 A;  2CAN A;  3JW9 A;  1LC7 A;  1DTY A;  1TAR A;  1QJ5 A;  2CTZ A;  1KKJ A;  1LW4 A;  2E7I A;  4W5K A;  3KGX A;  2BIA A;  3OP7 A;  2XBN A;  2ZJG A;  4GEB A;  1LK9 A;  2OQX A;  4ADC A;  3LG0 A;  1ARS A;  2VMX A;  3ASA A;  1M32 A;  1EJI A;  3F6T A;  3BWO A;  4K2B A;  4AO9 A;  5E4Z A;  1C0N A;  2GB3 A;  3K40 A;  3EIB A;  3NRA A;  4JF1 A;  8AAT A;  2HUF A;  1N2T A;  3FZ8 A;  4Q75 A;  2CH2 A;  3DC1 A;  2NMP A;  1GC0 A;  2EPJ A;  2BYL A;  4LC3 A;  4B9B A;  4OYT A;  1J04 A;  3N5M A;  2DKB A;  1ZC9 A;  4WXF A;  3DOD A;  1BJ4 A;  1YJZ A;  3AEP A;  3N0L A;  3FVU A;  1MAP A;  1CQ8 A;  4BQ0 A;  5BJ4 A;  2BIG A;  3PJ0 A;  1I29 A;  1WKG A;  2YKV A;  3AEJ C;  1OHV A;  2AY8 A;  1AHX A;  1AJS B;  2JJH A;  2QMA A;  3Q8N A;  2YCT A;  3BB8 A;  3E6G A;  4JE5 A;  1I43 A;  1CQ6 A;  4P7Y A;  3WCN A;  4ZM4 A;  1CZE A;  3B1C A;  1IUG A;  1JG8 A;  4ZSW A;  3JU7 A;  2BHX A;  1AJS A;  3NU7 A;  1W7M A;  4UHO A;  5HHY A;  1X28 A;  1IAX A;  4Q76 A;  4F4E A;  1LS3 A;  1IJI A;  1RV3 A;  4A0F A;  2AAT A;  3EI5 A;  4EMY A;  5EUN A;  5G4I A;  4UQV A;  1D7V A;  3RBF A;  3VP6 A;  4ADE A;  2GSA A;  1AY8 A;  5G09 A;  2ZSL A;  1XI9 A;  1DFO A;  3B1D A;  4M2M A;  4CBS A;  2D64 A;  2FYF A;  2ORD A;  1B5P A;  2AEU A;  1PMO A;  1TOE A;  1ELU A;  1BQD A;  1J32 A;  1IBJ A;  1W3U A;  3EI7 A;  3HL2 A;  2AY3 A;  4R5Z A;  3DR4 A;  1N31 A;  4LW4 A;  3BN1 A;  2C0R A;  1LC5 A;  3AEM A;  2OGE A;  2WK9 A;  1QZ9 A;  1FC4 A;  2ZY3 A;  2O0R A;  4Y0I A;  4IX8 A;  3DRD A;  3FVX A;  1ASN A;  3I5T A;  1B4X A;  1MDX A;  1YIZ A;  2W8T A;  3CBF A;  4F5G A;  3DZZ A;  1BS0 A;  4ATQ A;  1ZOD A;  5FT8 A;  3WLX A;  1N8P A;  1IX8 A;  2VMU A;  4H51 A;  4NOG A;  4F5H A;  3MBB A;  3NUB A;  1W23 A;  3R9A A;  3MAD A;  1H0C A;  1RVU A;  2AY5 A;  4U1T A;  3FFH A;  5G4J A;  1M0O A;  2Z9X A;  2AY1 A;  4TMR A;  3IHJ A;  1CS1 A;  1ZOB A;  2W7J A;  1AMR A;  1WYV B;  4RM1 A;  3K7Y A;  3G7Q A;  4EB7 A;  1ECX A;  1V2E A;  1X29 A;  2JGT A;  4MKK A;  4RKD A;  2VGT A;  3TQX A;  4A6T A;  4EB5 A;  2VMW A;  1WYV A;  1Z3Z A;  1V72 A;  2BYJ A;  1ART A;  1UU1 A;  3FD0 A;  1ARH A;  4BHD A;  3ACZ A;  4IYO B;  2WK8 A;  2PB0 A;  3PA9 A;  4W1V A;  3KKI A;  5AX8 A;  4WP0 A;  3KGW A;  4IYO A;  4MKJ A;  5I92 A;  2D66 A;  4XJM A;  2JJF A;  2AY6 A;  2DGM A;  1UU2 A;  2FNI A;  4WYD A;  2VGU A;  1PG8 A;  1OXO A;  4R5F A;  4XAU A;  2OGA A;  1AMS A;  2EZ1 A;  2EO5 A;  1TAS A;  3FFR A;  4R8D A;  4B98 A;  1EQB A;  5EAA A;  2VMR A;  3FVS A;  1W7L A;  3AEO A;  2EZ2 A;  2HP1 A;  4RLG A;  5EFS A;  4ATP A;  2VMZ A;  2D65 A;  3KE3 A;  2F8J A;  4JEV A;  3GJU A;  2RFV A;  1ASB A;  2V0Y A;  1LW5 A;  2VMO A;  1MAQ A;  2WKA A;  4IXZ A;  2VMS A;  4UHM A;  3H7F A;  2G6W A;  3E9K A;  1S08 A;  2W7G A;  4BMK A;  3FZ7 A;  3HLM A;  3PPL A;  1M7Y A;  2VLH A;  2FQ6 A;  2HOR A;  2EH6 A;  4I8A A;  2EGY A;  3FDB A;  5F8V A;  4W1W A;  1MLZ A;  3AOW A;  2ZP7 A;  2JJG A;  2ZY5 A;  1T3I A;  4RJ0 A;  2R5E A;  3DXW A;  4WLH A;  3RUY A;  4ZWV A;  1SPA A;  3L44 A;  2YRR A;  3RCH B;  2VGS A;  3VOM A;  4A6R A;  1MDZ A;  3LVL B;  4CXR A;  4E1O A;  2CJD A;  1D7R A;  2W7F A;  3AEM C;  4Q6R A;  4HVK A;  1BJN A;  2BI9 A;  3LVK A;  2AY4 A;  3NUI A;  2D5Y A;  2R0T A;  3QPG A;  3E77 A;  3RCH A;  2O1B A;  5FT4 A;  4ZLV A;  4A00 A;  2Z61 A;  5G2Q A;  1AHE A;  5TF5 A;  3EI9 A;  3MAU A;  5J8Q A;  1QIT A;  3E2Y A;  4RAE A;  3NYS A;  3WCO A;  1JS6 A;  4ITX A;  1AIB A;  3LVM A;  4W91 A;  4DQ6 A;  5IWQ A;  1G7X A;  1Y4I A;  4FFC A;  1MLY A;  9AAT A;  2W7D A;  4MQR A;  2Z9V A;  5FT5 A;  2CST A;  1DGD A;  2WK7 A;  1CJ0 A;  4JE5 D;  1O4S A;  1ORD A;  4PVF A;  2C44 A;  7AAT A;  1B9H A;  1C7N A;  2VMT A;  3QBO A;  5HXX A;  3FRK A;  3FKD A;  2VMN A;  4M2J A;  3AV7 A;  5C6U A;  2W7H A;  3JWA A;  4PFF A;  1YIY A;  1AY4 A;  1SVV A;  1S09 A;  4KYO A;  3WGB A;  2DOU A;  3A8U X;  3ECD A;  1C7O A;  3NU8 A;  2AY9 A;  2AY7 A;  3GSB A;  3QGU A;  2TPL A;  1B8G A;  1PMM A;  1S06 A;  1W7N A;  3B1E A;  2FN6 A;  1BW0 A;  5EUD A;  2HOX A;  4LW2 A;  3N75 A;  5K8B A;  2YKU A;  4LNM A;  4CVQ A;  2E7J A;  4OBU A;  1H1C A;  3WZF A;  4KAM A;  5FT6 A;  4XQ2 A;  3BS8 A;  3PIU A;  1DGE A;  4MY5 A;  3A9Z A;  2C81 A;  3JZL A;  3TCM A;  4OCA A;  2X5F A;  5LHA A;  2BWP A;  2GQN A;  2O7C A;  3OKS A;  4ZDP A;  4RIT A;  1IAY A;  2QB2 A;  4GRX A;  5DJ1 A;  1SZK A;  1KMJ A;  2CY8 A;  4BA5 A;  4F5L A;  3GBX A;  3P1T A;  4WLJ A;  2AY2 A;  2C7T A;  1ASE A;  2W7K A;  4WYG A;  1CZC A;  1DJ9 A;  2VI8 A;  5JAY A;  2VIA A;  1S07 A;  1GD9 A;  2D63 A;  2R5C B;  3W1H A;  1BJW A;  1DJE A;  1M0P A;  2E54 A;  1BQA A;  3ELE A;  3WKR A;  1FG7 A;  2AEV A;  4Q31 A;  3MEB A;  1XEY A;  1ARI A;  1M0N A;  2R5C A;  4F5K A;  2BI2 A;  1EG5 A;  3JTX A;  4OTL A;  4WYC A;  1TOG A;  1DJU A;  4K2M A;  2OKK A;  1M6S A;  2W8U A;  2DKJ A;  2OKJ A;  1AAW A;  5M46 A;  1E5E A;  1GC4 A;  2QA3 A;  1OHW A;  1TPL A;  1ASC A;  2W7I A;  2BI1 A;  4A0R A;  4MGR A;  3B8X A;  3BV0 A;  3FZ6 A;  4JEY A;  4BA4 A;  3EZ1 A;  1GC2 A;  1KL1 A;  5G2P A;  1SFF A;  2JJE A;  3NTJ A;  4F5M A;  4W1X A;  3BWN A;  3PDB B;  3W1J A;  1AAM A;  2X3L A;  2YKY A;  3BCB A;  1KKP A;  3CQ6 A;  3PGY A;  4R2N A;  2D7Y A;  4IXO A;  3PDB A;  1AIA A;  1VP4 A;  2W8J A;  5M49 A;  3NX3 A;  3ISL A;  2QB3 A;  3EUC A;  3T32 A;  1Z7D A;  1I48 A;  2D61 A;  4O6Z A;  4ZSY A;  3VK2 A;  3GR9 A;  2FM1 A;  2JG2 A;  2R2N A;  2FNU A;  2JIS A;  1GEY A;  4WD2 A;  3WKS A;  3HBX A;  2VI9 A;  1GBN A;  1TOI A;  3RBL A;  2VIB A;  1OXP A;  1AHF A;  4Y0H A;  3ZZK A;  3I4J A;  3USF A;  1CL2 A;  4RJY A;  3HVY A;  1V2D A;  3ZZJ A;  3TAT A;  1YJS A;  1JS3 A;  4A0G A;  4IW7 A;  4PFN A;  2BWN A;  4WBT A;  4RIZ A;  3TFU A;  3RI6 A;  3MKJ A;  5F9S A;  4ZWM A;  3UAK A;  2XH1 A;  3NNK A;  3UWC A;  5LH9 A;  4KXK A;  1TOJ A;  1D2F A;  1YJY A;  3HMU A;  3ELP A;  3IF2 A;  4N0B A;  4JEW A; 
#chains in the Genus database with same CATH topology
 2VGW A;  4MSO A;  2YRI A;  4WXG A;  1QJ3 A;  1WYT B;  4ADD A;  1WST A;  2Q7W A;  4AZJ A;  4GE9 A;  3AAT A;  2VMV A;  3E2F A;  5EIG B;  3GET A;  3FQ7 A;  1QIS A;  1WYT A;  2DR1 A;  2W8V A;  3B46 A;  4GE7 A;  1SZU A;  3F9T A;  3N4X A;  2CJG A;  1C7G A;  3FCR A;  3MAF B;  1O61 A;  4WYF A;  1LC8 A;  5EIG A;  5DJ9 A;  1M0Q A;  2VMY A;  5DX5 A;  4JEZ A;  4TN4 A;  3MAF A;  5M4D A;  4IXS A;  1KMK A;  1UKJ A;  4TV7 A;  3VK4 A;  2E7U A;  4DBC A;  1OAT A;  3CQ5 A;  3MC6 A;  4EFF A;  2BI5 A;  1GDE A;  2CFB A;  4E3R A;  1GEW A;  2GMU A;  4UHN A;  2HOY A;  2CH1 A;  4XJP A;  3COG A;  4ZDL A;  3WX9 A;  1C9C A;  1IX6 A;  4E3Q A;  1S0A A;  4K05 A;  1KAF A;  2HUU A;  1M4N A;  4N0W A;  3ZRR A;  4A6U A;  4F5F A;  1CQ7 A;  1BJO B;  4ZDO A;  1QGN A;  3A9X A;  4UOY A;  1ASL A;  3M5U A;  1QIR A;  2VMQ A;  3A9Y A;  4AO4 A;  1AKC A;  1ASD A;  1BJO A;  2Z1Z A;  1JF9 A;  2HOZ A;  1P3W A;  3BWN C;  2CB1 A;  4QGR A;  1TOK A;  3HQT A;  4WB0 B;  2OAT A;  1I41 A;  3LWS A;  4XEW A;  4XJO A;  3NDN A;  1AX4 A;  1UU0 A;  2D7Z A;  2GMS A;  4L0O A;  3WY7 A;  2PO3 A;  4DGT A;  2W7E A;  3GZD A;  4WB0 A;  4F5I A;  1U08 A;  2W8W A;  3L8A A;  4PIW A;  4M2K A;  4A72 A;  4EU1 A;  1IX7 A;  3QM2 A;  1O69 A;  3GWP A;  3A2B A;  3ASB A;  3BC8 A;  1AKB A;  4XJL A;  4LNJ A;  4GSA A;  2CJH A;  4ZAH A;  1YAA A;  1O62 A;  3QI6 A;  2W7M A;  2VMP A;  4OC9 A;  1KL2 A;  1GEX A;  3BCA A;  3AEN B;  2Z9W A;  4OMA A;  4WYA A;  2YCN A;  1RVY A;  4Y0D A;  4E77 A;  2Z1Y A;  3AEN A;  3ZRQ A;  2QLR A;  1BT4 A;  2QSR A;  3FQA A;  3JWB A;  3CQ4 A;  3H9X A;  3RQ1 A;  3ZRP A;  1AHY A;  1AHG A;  3LVJ A;  2CIN A;  1TAT A;  3DYD A;  1ASG A;  3LV2 A;  3NYT A;  4IY7 A;  1AJR A;  1ASM A;  2ZUK A;  1AY5 A;  3F0H A;  2BIE A;  4P3M A;  4WXB A;  3VK3 A;  3HDO A;  3WGC A;  5M4B A;  4OBV A;  4CBR A;  4ISY A;  4GE4 A;  3DXV A;  1DKA A;  4J8L A;  3QN6 A;  1PFF A;  2X5D A;  2ZY2 A;  2VYC A;  3H14 A;  1G4V A;  5EUE A;  2V1P A;  2YCP A;  4CXQ A;  3II0 A;  1D7U A;  4K2I A;  4F5J A;  1SZS A;  1X0M A;  1GC3 A;  2VLF A;  1BKG A;  1AMA A;  4MQQ A;  1X2A A;  3FDD A;  3AEJ A;  3TFT A;  1VEF A;  1RV4 A;  1ARG A;  1V2F A;  3I16 A;  5EAV A;  3EZS A;  4AOA A;  2Z20 A;  1ASF A;  3BCX A;  3E2Z B;  1GCK A;  2X8U A;  3MC6 C;  3QHX A;  5E3K A;  4AZK A;  3PD6 B;  3N4S A;  5HDM A;  3P6K A;  1E5F A;  4GDY A;  3CAI A;  4RKC A;  2HZP A;  1YOO A;  4XK1 A;  2BKW A;  3E2Z A;  1WYU B;  4LNL A;  3FSL A;  1D7S A;  2ZSM A;  1AMQ A;  1B5O A;  3PD6 A;  3D6K A;  5E5I A;  1B9I A;  3W1I A;  2Z67 A;  1IVR A;  2YKX A;  2Z9U A;  1WYU A;  3FQ8 A;  4FL0 A;  4JEX A;  1MDO A;  5G0A A;  4MQP A;  4AH3 A;  1AIC A;  3EIA A;  3FTB A;  2QBT A;  5EQC A;  2ZY4 A;  2PB2 A;  3AEL A;  1C4K A;  1ELQ A;  2YHK A;  2ZYJ A;  4ADB A;  4HF8 A;  3NYU A;  2ZC0 A;  2VGZ A;  2VGV A;  3GZC A;  3PAA A;  1ASA A;  2DGK A;  3ATH A;  4J5U A;  4U2H A;  4ZAS A;  2BI3 A;  1YNU A;  3LY1 A;  3GZD C;  3R4T A;  2W7L A;  1VJO A;  4WYE A;  3EI6 A;  1LKC A;  2HP2 A;  1FG3 A;  3DR7 A;  1G4X A;  3AOV A;  4JF0 A;  2DGL A;  5BJ3 A;  3VAX A;  5D5S A;  5DB5 A;  3EI8 A;  4ITG A;  3N7N A;  3G8M A;  1OHY A;  1SF2 A;  4ZM3 A;  3HT4 A;  1MGV A;  1AKA A;  2BWO A;  2YOB A;  5D95 A;  1G7W A;  1CL1 A;  1WKH A;  3DU4 A;  3G0T A;  3PDX A;  4W8I A;  4OT8 A;  3K28 A;  2HUI A;  4A0H A;  3UE8 A;  2CAN A;  3JW9 A;  1LC7 A;  1DTY A;  1TAR A;  1QJ5 A;  2CTZ A;  1KKJ A;  1LW4 A;  2KFP A;  2E7I A;  4W5K A;  3KGX A;  2BIA A;  3OP7 A;  2XBN A;  2ZJG A;  4GEB A;  1LK9 A;  2OQX A;  4ADC A;  4H63 Q;  3LG0 A;  1ARS A;  2VMX A;  3ASA A;  1M32 A;  1EJI A;  3F6T A;  3BWO A;  4K2B A;  4AO9 A;  2FKI A;  5E4Z A;  1C0N A;  2GB3 A;  3K40 A;  3EIB A;  3NRA A;  4JF1 A;  8AAT A;  2HUF A;  1N2T A;  3FZ8 A;  4Q75 A;  2CH2 A;  3DC1 A;  2NMP A;  1GC0 A;  2EPJ A;  2BYL A;  4LC3 A;  4B9B A;  4OYT A;  1J04 A;  3N5M A;  2DKB A;  1ZC9 A;  4WXF A;  3DOD A;  1BJ4 A;  1YJZ A;  3AEP A;  3N0L A;  3FVU A;  1MAP A;  1CQ8 A;  4BQ0 A;  5BJ4 A;  2BIG A;  3PJ0 A;  1I29 A;  1WKG A;  2YKV A;  3AEJ C;  1OHV A;  2AY8 A;  1AHX A;  1AJS B;  2JJH A;  2QMA A;  3Q8N A;  2YCT A;  3BB8 A;  3E6G A;  4JE5 A;  1I43 A;  1CQ6 A;  4P7Y A;  3WCN A;  4ZM4 A;  1CZE A;  3B1C A;  1IUG A;  1JG8 A;  4ZSW A;  3JU7 A;  2BHX A;  1AJS A;  3NU7 A;  1W7M A;  4UHO A;  5HHY A;  1X28 A;  1IAX A;  4Q76 A;  4F4E A;  1LS3 A;  1IJI A;  1RV3 A;  4A0F A;  2AAT A;  3EI5 A;  4EMY A;  5EUN A;  5G4I A;  4UQV A;  1D7V A;  3RBF A;  3VP6 A;  4ADE A;  2GSA A;  1AY8 A;  5G09 A;  2ZSL A;  1XI9 A;  1DFO A;  3B1D A;  4M2M A;  4CBS A;  2D64 A;  2FYF A;  2ORD A;  1B5P A;  2AEU A;  1PMO A;  1TOE A;  1ELU A;  1BQD A;  1J32 A;  1IBJ A;  1W3U A;  3EI7 A;  3HL2 A;  2WB6 A;  2AY3 A;  4R5Z A;  3DR4 A;  1N31 A;  4LW4 A;  3BN1 A;  2C0R A;  1LC5 A;  3AEM A;  2OGE A;  2WK9 A;  1QZ9 A;  1FC4 A;  2ZY3 A;  2O0R A;  4Y0I A;  4IX8 A;  3DRD A;  3FVX A;  1ASN A;  3I5T A;  1B4X A;  1MDX A;  1YIZ A;  2W8T A;  3CBF A;  4F5G A;  2G7J A;  3DZZ A;  1BS0 A;  4ATQ A;  1ZOD A;  5FT8 A;  3WLX A;  2EYQ A;  1N8P A;  1IX8 A;  2VMU A;  4H51 A;  4NOG A;  4F5H A;  3MBB A;  3NUB A;  1W23 A;  3R9A A;  3MAD A;  1H0C A;  1RVU A;  2AY5 A;  4U1T A;  3FFH A;  5G4J A;  1M0O A;  2Z9X A;  2AY1 A;  4TMR A;  3IHJ A;  1CS1 A;  1ZOB A;  2W7J A;  1AMR A;  1WYV B;  4RM1 A;  3K7Y A;  3G7Q A;  4EB7 A;  1ECX A;  1V2E A;  1X29 A;  2JGT A;  4MKK A;  4RKD A;  2VGT A;  3TQX A;  4A6T A;  4EB5 A;  2VMW A;  1WYV A;  1Z3Z A;  1V72 A;  2BYJ A;  1ART A;  1UU1 A;  3FD0 A;  1ARH A;  4BHD A;  3ACZ A;  4IYO B;  2WK8 A;  2PB0 A;  3PA9 A;  4W1V A;  3KKI A;  5AX8 A;  4WP0 A;  3KGW A;  4IYO A;  4MKJ A;  5I92 A;  2D66 A;  4XJM A;  2JJF A;  2AY6 A;  2DGM A;  1UU2 A;  2FNI A;  4WYD A;  2VGU A;  1PG8 A;  1OXO A;  4R5F A;  4XAU A;  2OGA A;  1AMS A;  2EZ1 A;  2EO5 A;  1TAS A;  3FFR A;  4R8D A;  4B98 A;  1EQB A;  5EAA A;  2VMR A;  3FVS A;  1W7L A;  3AEO A;  2EZ2 A;  2HP1 A;  4RLG A;  5EFS A;  4ATP A;  2VMZ A;  2D65 A;  3KE3 A;  2F8J A;  4JEV A;  3GJU A;  2RFV A;  1ASB A;  2V0Y A;  1LW5 A;  2VMO A;  1MAQ A;  2WKA A;  4IXZ A;  2VMS A;  4UHM A;  3H7F A;  2G6W A;  3E9K A;  1S08 A;  2W7G A;  4BMK A;  3FZ7 A;  3HLM A;  3PPL A;  1M7Y A;  2VLH A;  2FQ6 A;  2HOR A;  2EH6 A;  4I8A A;  2EGY A;  3FDB A;  5F8V A;  4W1W A;  1MLZ A;  3AOW A;  2ZP7 A;  2JJG A;  2ZY5 A;  1T3I A;  4RJ0 A;  2R5E A;  3DXW A;  4WLH A;  3RUY A;  4ZWV A;  1SPA A;  3L44 A;  2YRR A;  3RCH B;  2VGS A;  3VOM A;  4A6R A;  1MDZ A;  3LVL B;  4CXR A;  4E1O A;  2CJD A;  1D7R A;  2W7F A;  3AEM C;  4Q6R A;  4HVK A;  1BJN A;  2BI9 A;  3LVK A;  2AY4 A;  3NUI A;  2D5Y A;  2R0T A;  3QPG A;  3E77 A;  3RCH A;  2O1B A;  5FT4 A;  4ZLV A;  4A00 A;  2Z61 A;  5G2Q A;  1AHE A;  5TF5 A;  3EI9 A;  3MAU A;  5J8Q A;  1QIT A;  3E2Y A;  4RAE A;  3NYS A;  3WCO A;  1JS6 A;  4ITX A;  1AIB A;  3LVM A;  4W91 A;  4DQ6 A;  5IWQ A;  1G7X A;  1Y4I A;  4FFC A;  1MLY A;  9AAT A;  2W7D A;  4MQR A;  2Z9V A;  5FT5 A;  2CST A;  1DGD A;  2WK7 A;  1CJ0 A;  4JE5 D;  1O4S A;  1ORD A;  4PVF A;  2C44 A;  7AAT A;  1B9H A;  1C7N A;  2VMT A;  3QBO A;  5HXX A;  3FRK A;  3FKD A;  2VMN A;  4M2J A;  3AV7 A;  5C6U A;  2W7H A;  3JWA A;  4PFF A;  1YIY A;  1AY4 A;  1SVV A;  1S09 A;  4KYO A;  3WGB A;  2DOU A;  3A8U X;  3ECD A;  1C7O A;  3NU8 A;  2AY9 A;  2AY7 A;  3GSB A;  3QGU A;  2TPL A;  1B8G A;  1PMM A;  1S06 A;  1W7N A;  3B1E A;  2FN6 A;  1BW0 A;  5EUD A;  2HOX A;  4LW2 A;  3N75 A;  5K8B A;  2YKU A;  4LNM A;  4CVQ A;  2E7J A;  4OBU A;  1H1C A;  3WZF A;  4KAM A;  5FT6 A;  4XQ2 A;  3BS8 A;  3PIU A;  1DGE A;  4MY5 A;  3A9Z A;  2C81 A;  3JZL A;  3TCM A;  4OCA A;  2X5F A;  5LHA A;  2BWP A;  2GQN A;  2O7C A;  3OKS A;  4ZDP A;  4RIT A;  1IAY A;  2QB2 A;  4GRX A;  5DJ1 A;  1SZK A;  1KMJ A;  2CY8 A;  4BA5 A;  4F5L A;  3GBX A;  3P1T A;  4WLJ A;  2AY2 A;  2C7T A;  1ASE A;  2W7K A;  4WYG A;  1CZC A;  1DJ9 A;  2VI8 A;  5JAY A;  2VIA A;  1S07 A;  1GD9 A;  2D63 A;  2R5C B;  3W1H A;  1BJW A;  1DJE A;  1M0P A;  2E54 A;  1BQA A;  3ELE A;  3WKR A;  1FG7 A;  2AEV A;  4Q31 A;  3MEB A;  1XEY A;  1ARI A;  1M0N A;  2R5C A;  4F5K A;  2BI2 A;  1EG5 A;  3JTX A;  4OTL A;  4WYC A;  1TOG A;  1DJU A;  4K2M A;  2OKK A;  1M6S A;  2W8U A;  2DKJ A;  2OKJ A;  1AAW A;  5M46 A;  1E5E A;  1GC4 A;  2QA3 A;  1OHW A;  1TPL A;  1ASC A;  2W7I A;  2BI1 A;  4A0R A;  4MGR A;  3B8X A;  3BV0 A;  3FZ6 A;  4JEY A;  4BA4 A;  3EZ1 A;  1GC2 A;  1KL1 A;  5G2P A;  1SFF A;  2JJE A;  3NTJ A;  4F5M A;  4W1X A;  3BWN A;  3PDB B;  3W1J A;  1AAM A;  2X3L A;  2YKY A;  3BCB A;  1KKP A;  3CQ6 A;  3PGY A;  4R2N A;  2D7Y A;  4IXO A;  3PDB A;  1AIA A;  1VP4 A;  2W8J A;  5M49 A;  3NX3 A;  3ISL A;  2QB3 A;  3EUC A;  3T32 A;  1Z7D A;  1I48 A;  2D61 A;  4O6Z A;  2A1V A;  4ZSY A;  3VK2 A;  3GR9 A;  2FM1 A;  2JG2 A;  2R2N A;  2FNU A;  2JIS A;  1GEY A;  4WD2 A;  3WKS A;  3HBX A;  2VI9 A;  1GBN A;  1TOI A;  3RBL A;  2VIB A;  1OXP A;  1AHF A;  4Y0H A;  3ZZK A;  3I4J A;  3USF A;  1CL2 A;  4RJY A;  3HVY A;  1V2D A;  3ZZJ A;  3TAT A;  1YJS A;  1JS3 A;  4A0G A;  4IW7 A;  4PFN A;  2BWN A;  4WBT A;  4RIZ A;  5KTB A;  3N4R A;  3TFU A;  3RI6 A;  3MKJ A;  5F9S A;  4ZWM A;  3UAK A;  2XH1 A;  3NNK A;  3UWC A;  5LH9 A;  4KXK A;  1TOJ A;  1D2F A;  1YJY A;  3HMU A;  3ELP A;  3IF2 A;  4N0B A;  4JEW A; 
#chains in the Genus database with same CATH homology
 2VGW A;  4MSO A;  2YRI A;  4WXG A;  1QJ3 A;  1WYT B;  4ADD A;  1WST A;  2Q7W A;  4AZJ A;  4GE9 A;  3AAT A;  2VMV A;  3E2F A;  5EIG B;  3GET A;  3FQ7 A;  1QIS A;  1WYT A;  2DR1 A;  2W8V A;  3B46 A;  4GE7 A;  1SZU A;  3F9T A;  3N4X A;  2CJG A;  1C7G A;  3FCR A;  3MAF B;  1O61 A;  4WYF A;  1LC8 A;  5EIG A;  5DJ9 A;  1M0Q A;  2VMY A;  5DX5 A;  4JEZ A;  4TN4 A;  3MAF A;  5M4D A;  4IXS A;  1KMK A;  1UKJ A;  4TV7 A;  3VK4 A;  2E7U A;  4DBC A;  1OAT A;  3CQ5 A;  3MC6 A;  4EFF A;  2BI5 A;  1GDE A;  2CFB A;  4E3R A;  1GEW A;  2GMU A;  4UHN A;  2HOY A;  2CH1 A;  4XJP A;  3COG A;  4ZDL A;  3WX9 A;  1C9C A;  1IX6 A;  4E3Q A;  1S0A A;  4K05 A;  2HUU A;  1M4N A;  4N0W A;  3ZRR A;  4A6U A;  4F5F A;  1CQ7 A;  1BJO B;  4ZDO A;  1QGN A;  3A9X A;  4UOY A;  1ASL A;  3M5U A;  1QIR A;  2VMQ A;  3A9Y A;  4AO4 A;  1AKC A;  1ASD A;  1BJO A;  2Z1Z A;  1JF9 A;  2HOZ A;  1P3W A;  3BWN C;  2CB1 A;  4QGR A;  1TOK A;  3HQT A;  4WB0 B;  2OAT A;  1I41 A;  3LWS A;  4XEW A;  4XJO A;  3NDN A;  1AX4 A;  1UU0 A;  2D7Z A;  2GMS A;  4L0O A;  3WY7 A;  2PO3 A;  4DGT A;  2W7E A;  3GZD A;  4WB0 A;  4F5I A;  1U08 A;  2W8W A;  3L8A A;  4PIW A;  4M2K A;  4A72 A;  4EU1 A;  1IX7 A;  3QM2 A;  1O69 A;  3GWP A;  3A2B A;  3ASB A;  3BC8 A;  1AKB A;  4XJL A;  4LNJ A;  4GSA A;  2CJH A;  4ZAH A;  1YAA A;  1O62 A;  3QI6 A;  2W7M A;  2VMP A;  4OC9 A;  1KL2 A;  1GEX A;  3BCA A;  3AEN B;  2Z9W A;  4OMA A;  4WYA A;  2YCN A;  1RVY A;  4Y0D A;  4E77 A;  2Z1Y A;  3AEN A;  3ZRQ A;  2QLR A;  1BT4 A;  2QSR A;  3FQA A;  3JWB A;  3CQ4 A;  3H9X A;  3RQ1 A;  3ZRP A;  1AHY A;  1AHG A;  3LVJ A;  2CIN A;  1TAT A;  3DYD A;  1ASG A;  3LV2 A;  3NYT A;  4IY7 A;  1AJR A;  1ASM A;  2ZUK A;  1AY5 A;  3F0H A;  2BIE A;  4P3M A;  4WXB A;  3VK3 A;  3HDO A;  3WGC A;  5M4B A;  4OBV A;  4CBR A;  4ISY A;  4GE4 A;  3DXV A;  1DKA A;  4J8L A;  3QN6 A;  1PFF A;  2X5D A;  2ZY2 A;  2VYC A;  3H14 A;  1G4V A;  5EUE A;  2V1P A;  2YCP A;  4CXQ A;  3II0 A;  1D7U A;  4K2I A;  4F5J A;  1SZS A;  1X0M A;  1GC3 A;  2VLF A;  1BKG A;  1AMA A;  4MQQ A;  1X2A A;  3FDD A;  3AEJ A;  3TFT A;  1VEF A;  1RV4 A;  1ARG A;  1V2F A;  3I16 A;  5EAV A;  3EZS A;  4AOA A;  2Z20 A;  1ASF A;  3BCX A;  3E2Z B;  1GCK A;  2X8U A;  3MC6 C;  3QHX A;  5E3K A;  4AZK A;  3PD6 B;  3N4S A;  5HDM A;  3P6K A;  1E5F A;  4GDY A;  3CAI A;  4RKC A;  2HZP A;  1YOO A;  4XK1 A;  2BKW A;  3E2Z A;  1WYU B;  4LNL A;  3FSL A;  1D7S A;  2ZSM A;  1AMQ A;  1B5O A;  3PD6 A;  3D6K A;  5E5I A;  1B9I A;  3W1I A;  2Z67 A;  1IVR A;  2YKX A;  2Z9U A;  1WYU A;  3FQ8 A;  4FL0 A;  4JEX A;  1MDO A;  5G0A A;  4MQP A;  4AH3 A;  1AIC A;  3EIA A;  3FTB A;  2QBT A;  5EQC A;  2ZY4 A;  2PB2 A;  3AEL A;  1C4K A;  1ELQ A;  2YHK A;  2ZYJ A;  4ADB A;  4HF8 A;  3NYU A;  2ZC0 A;  2VGZ A;  2VGV A;  3GZC A;  3PAA A;  1ASA A;  2DGK A;  3ATH A;  4J5U A;  4U2H A;  4ZAS A;  2BI3 A;  1YNU A;  3LY1 A;  3GZD C;  3R4T A;  2W7L A;  1VJO A;  4WYE A;  3EI6 A;  1LKC A;  2HP2 A;  1FG3 A;  3DR7 A;  1G4X A;  3AOV A;  4JF0 A;  2DGL A;  5BJ3 A;  3VAX A;  5D5S A;  5DB5 A;  3EI8 A;  4ITG A;  3N7N A;  3G8M A;  1OHY A;  1SF2 A;  4ZM3 A;  3HT4 A;  1MGV A;  1AKA A;  2BWO A;  2YOB A;  5D95 A;  1G7W A;  1CL1 A;  1WKH A;  3DU4 A;  3G0T A;  3PDX A;  4W8I A;  4OT8 A;  3K28 A;  2HUI A;  4A0H A;  3UE8 A;  2CAN A;  3JW9 A;  1LC7 A;  1DTY A;  1TAR A;  1QJ5 A;  2CTZ A;  1KKJ A;  1LW4 A;  2KFP A;  2E7I A;  4W5K A;  3KGX A;  2BIA A;  3OP7 A;  2XBN A;  2ZJG A;  4GEB A;  1LK9 A;  2OQX A;  4ADC A;  4H63 Q;  3LG0 A;  1ARS A;  2VMX A;  3ASA A;  1M32 A;  1EJI A;  3F6T A;  3BWO A;  4K2B A;  4AO9 A;  2FKI A;  5E4Z A;  1C0N A;  2GB3 A;  3K40 A;  3EIB A;  3NRA A;  4JF1 A;  8AAT A;  2HUF A;  1N2T A;  3FZ8 A;  4Q75 A;  2CH2 A;  3DC1 A;  2NMP A;  1GC0 A;  2EPJ A;  2BYL A;  4LC3 A;  4B9B A;  4OYT A;  1J04 A;  3N5M A;  2DKB A;  1ZC9 A;  4WXF A;  3DOD A;  1BJ4 A;  1YJZ A;  3AEP A;  3N0L A;  3FVU A;  1MAP A;  1CQ8 A;  4BQ0 A;  5BJ4 A;  2BIG A;  3PJ0 A;  1I29 A;  1WKG A;  2YKV A;  3AEJ C;  1OHV A;  2AY8 A;  1AHX A;  1AJS B;  2JJH A;  2QMA A;  3Q8N A;  2YCT A;  3BB8 A;  3E6G A;  4JE5 A;  1I43 A;  1CQ6 A;  4P7Y A;  3WCN A;  4ZM4 A;  1CZE A;  3B1C A;  1IUG A;  1JG8 A;  4ZSW A;  3JU7 A;  2BHX A;  1AJS A;  3NU7 A;  1W7M A;  4UHO A;  5HHY A;  1X28 A;  1IAX A;  4Q76 A;  4F4E A;  1LS3 A;  1IJI A;  1RV3 A;  4A0F A;  2AAT A;  3EI5 A;  4EMY A;  5EUN A;  5G4I A;  4UQV A;  1D7V A;  3RBF A;  3VP6 A;  4ADE A;  2GSA A;  1AY8 A;  5G09 A;  2ZSL A;  1XI9 A;  1DFO A;  3B1D A;  4M2M A;  4CBS A;  2D64 A;  2FYF A;  2ORD A;  1B5P A;  2AEU A;  1PMO A;  1TOE A;  1ELU A;  1BQD A;  1J32 A;  1IBJ A;  1W3U A;  3EI7 A;  3HL2 A;  2WB6 A;  2AY3 A;  4R5Z A;  3DR4 A;  1N31 A;  4LW4 A;  3BN1 A;  2C0R A;  1LC5 A;  3AEM A;  2OGE A;  2WK9 A;  1QZ9 A;  1FC4 A;  2ZY3 A;  2O0R A;  4Y0I A;  4IX8 A;  3DRD A;  3FVX A;  1ASN A;  3I5T A;  1B4X A;  1MDX A;  1YIZ A;  2W8T A;  3CBF A;  4F5G A;  2G7J A;  3DZZ A;  1BS0 A;  4ATQ A;  1ZOD A;  5FT8 A;  3WLX A;  2EYQ A;  1N8P A;  1IX8 A;  2VMU A;  4H51 A;  4NOG A;  4F5H A;  3MBB A;  3NUB A;  1W23 A;  3R9A A;  3MAD A;  1H0C A;  1RVU A;  2AY5 A;  4U1T A;  3FFH A;  5G4J A;  1M0O A;  2Z9X A;  2AY1 A;  4TMR A;  3IHJ A;  1CS1 A;  1ZOB A;  2W7J A;  1AMR A;  1WYV B;  4RM1 A;  3K7Y A;  3G7Q A;  4EB7 A;  1ECX A;  1V2E A;  1X29 A;  2JGT A;  4MKK A;  4RKD A;  2VGT A;  3TQX A;  4A6T A;  4EB5 A;  2VMW A;  1WYV A;  1Z3Z A;  1V72 A;  2BYJ A;  1ART A;  1UU1 A;  3FD0 A;  1ARH A;  4BHD A;  3ACZ A;  4IYO B;  2WK8 A;  2PB0 A;  3PA9 A;  4W1V A;  3KKI A;  5AX8 A;  4WP0 A;  3KGW A;  4IYO A;  4MKJ A;  5I92 A;  2D66 A;  4XJM A;  2JJF A;  2AY6 A;  2DGM A;  1UU2 A;  2FNI A;  4WYD A;  2VGU A;  1PG8 A;  1OXO A;  4R5F A;  4XAU A;  2OGA A;  1AMS A;  2EZ1 A;  2EO5 A;  1TAS A;  3FFR A;  4R8D A;  4B98 A;  1EQB A;  5EAA A;  2VMR A;  3FVS A;  1W7L A;  3AEO A;  2EZ2 A;  2HP1 A;  4RLG A;  5EFS A;  4ATP A;  2VMZ A;  2D65 A;  3KE3 A;  2F8J A;  4JEV A;  3GJU A;  2RFV A;  1ASB A;  2V0Y A;  1LW5 A;  2VMO A;  1MAQ A;  2WKA A;  4IXZ A;  2VMS A;  4UHM A;  3H7F A;  2G6W A;  3E9K A;  1S08 A;  2W7G A;  4BMK A;  3FZ7 A;  3HLM A;  3PPL A;  1M7Y A;  2VLH A;  2FQ6 A;  2HOR A;  2EH6 A;  4I8A A;  2EGY A;  3FDB A;  5F8V A;  4W1W A;  1MLZ A;  3AOW A;  2ZP7 A;  2JJG A;  2ZY5 A;  1T3I A;  4RJ0 A;  2R5E A;  3DXW A;  4WLH A;  3RUY A;  4ZWV A;  1SPA A;  3L44 A;  2YRR A;  3RCH B;  2VGS A;  3VOM A;  4A6R A;  1MDZ A;  3LVL B;  4CXR A;  4E1O A;  2CJD A;  1D7R A;  2W7F A;  3AEM C;  4Q6R A;  4HVK A;  1BJN A;  2BI9 A;  3LVK A;  2AY4 A;  3NUI A;  2D5Y A;  2R0T A;  3QPG A;  3E77 A;  3RCH A;  2O1B A;  5FT4 A;  4ZLV A;  4A00 A;  2Z61 A;  5G2Q A;  1AHE A;  5TF5 A;  3EI9 A;  3MAU A;  5J8Q A;  1QIT A;  3E2Y A;  4RAE A;  3NYS A;  3WCO A;  1JS6 A;  4ITX A;  1AIB A;  3LVM A;  4W91 A;  4DQ6 A;  5IWQ A;  1G7X A;  1Y4I A;  4FFC A;  1MLY A;  9AAT A;  2W7D A;  4MQR A;  2Z9V A;  5FT5 A;  2CST A;  1DGD A;  2WK7 A;  1CJ0 A;  4JE5 D;  1O4S A;  1ORD A;  4PVF A;  2C44 A;  7AAT A;  1B9H A;  1C7N A;  2VMT A;  3QBO A;  5HXX A;  3FRK A;  3FKD A;  2VMN A;  4M2J A;  3AV7 A;  5C6U A;  2W7H A;  3JWA A;  4PFF A;  1YIY A;  1AY4 A;  1SVV A;  1S09 A;  4KYO A;  3WGB A;  2DOU A;  3A8U X;  3ECD A;  1C7O A;  3NU8 A;  2AY9 A;  2AY7 A;  3GSB A;  3QGU A;  2TPL A;  1B8G A;  1PMM A;  1S06 A;  1W7N A;  3B1E A;  2FN6 A;  1BW0 A;  5EUD A;  2HOX A;  4LW2 A;  3N75 A;  5K8B A;  2YKU A;  4LNM A;  4CVQ A;  2E7J A;  4OBU A;  1H1C A;  3WZF A;  4KAM A;  5FT6 A;  4XQ2 A;  3BS8 A;  3PIU A;  1DGE A;  4MY5 A;  3A9Z A;  2C81 A;  3JZL A;  3TCM A;  4OCA A;  2X5F A;  5LHA A;  2BWP A;  2GQN A;  2O7C A;  3OKS A;  4ZDP A;  4RIT A;  1IAY A;  2QB2 A;  4GRX A;  5DJ1 A;  1SZK A;  1KMJ A;  2CY8 A;  4BA5 A;  4F5L A;  3GBX A;  3P1T A;  4WLJ A;  2AY2 A;  2C7T A;  1ASE A;  2W7K A;  4WYG A;  1CZC A;  1DJ9 A;  2VI8 A;  5JAY A;  2VIA A;  1S07 A;  1GD9 A;  2D63 A;  2R5C B;  3W1H A;  1BJW A;  1DJE A;  1M0P A;  2E54 A;  1BQA A;  3ELE A;  3WKR A;  1FG7 A;  2AEV A;  4Q31 A;  3MEB A;  1XEY A;  1ARI A;  1M0N A;  2R5C A;  4F5K A;  2BI2 A;  1EG5 A;  3JTX A;  4OTL A;  4WYC A;  1TOG A;  1DJU A;  4K2M A;  2OKK A;  1M6S A;  2W8U A;  2DKJ A;  2OKJ A;  1AAW A;  5M46 A;  1E5E A;  1GC4 A;  2QA3 A;  1OHW A;  1TPL A;  1ASC A;  2W7I A;  2BI1 A;  4A0R A;  4MGR A;  3B8X A;  3BV0 A;  3FZ6 A;  4JEY A;  4BA4 A;  3EZ1 A;  1GC2 A;  1KL1 A;  5G2P A;  1SFF A;  2JJE A;  3NTJ A;  4F5M A;  4W1X A;  3BWN A;  3PDB B;  3W1J A;  1AAM A;  2X3L A;  2YKY A;  3BCB A;  1KKP A;  3CQ6 A;  3PGY A;  4R2N A;  2D7Y A;  4IXO A;  3PDB A;  1AIA A;  1VP4 A;  2W8J A;  5M49 A;  3NX3 A;  3ISL A;  2QB3 A;  3EUC A;  3T32 A;  1Z7D A;  1I48 A;  2D61 A;  4O6Z A;  2A1V A;  4ZSY A;  3VK2 A;  3GR9 A;  2FM1 A;  2JG2 A;  2R2N A;  2FNU A;  2JIS A;  1GEY A;  4WD2 A;  3WKS A;  3HBX A;  2VI9 A;  1GBN A;  1TOI A;  3RBL A;  2VIB A;  1OXP A;  1AHF A;  4Y0H A;  3ZZK A;  3I4J A;  3USF A;  1CL2 A;  4RJY A;  3HVY A;  1V2D A;  3ZZJ A;  3TAT A;  1YJS A;  1JS3 A;  4A0G A;  4IW7 A;  4PFN A;  2BWN A;  4WBT A;  4RIZ A;  5KTB A;  3N4R A;  3TFU A;  3RI6 A;  3MKJ A;  5F9S A;  4ZWM A;  3UAK A;  2XH1 A;  3NNK A;  3UWC A;  5LH9 A;  4KXK A;  1TOJ A;  1D2F A;  1YJY A;  3HMU A;  3ELP A;  3IF2 A;  4N0B A;  4JEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...