1TOKA

Maleic acid-bound structure of srhept mutant of e. coli aspartate aminotransferase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
396
structure length
395
Chain Sequence
MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSNFALYNERVGACTLVAADSETVDRAFGQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Narrowing substrate specificity in a directly evolved enzyme: the A293D mutant of aspartate aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 139
structure length 395
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1tokA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1tokA01
5G4JA 1AKCA 1WKGA 2X8UA 4CBRA 1I41A 5DJ9A 4ZAHA 2HUIA 2QB3A 1E5EA 3DR4A 2YOBA 1UU1A 3AEJA 2TPLA 2W7KA 4OBUA 2O0RA 4IX8A 2C44A 2ZYJA 4ADCA 4ZM4A 1YJYA 2ZY2A 2X3LA 4GSAA 4GE9A 2VGWA 1AHFA 2V0YA 4Y0DA 3RQ1A 3NDNA 3GZDC 3G8MA 2Z9UA 4ITXA 2DGKA 2JJEA 3RUYA 3TFUA 1H1CA 3E9KA 1YAAA 3LY1A 2GMUA 4XJMA 2BWPA 1GC2A 1DKAA 1CL2A 4GE4A 4MGRA 1JF9A 4ATQA 4A6UA 4PFNA 2BIEA 3VP6A 4EB5A 3AEMC 4IXOA 3AATA 3PD6B 5K8BA 3EZSA 2Q7WA 2W8UA 2C81A 3QPGA 2AY3A 1G7WA 4Q31A 2YRIA 3WGBA 2NMPA 4ADBA 2YKYA 3GJUA 4XJPA 5LH9A 4LC3A 1TATA 4ZDOA 3NYTA 2W7MA 3MAFA 2ORDA 4WYFA 3HQTA 1ELQA 4Y0IA 1ASNA 1MDOA 4HVKA 2YKXA 4AZKA 5G09A 1GDEA 4JF1A 9AATA 2W7FA 1KKJA 1IX8A 5FT6A 4R8DA 1BKGA 3DRDA 2OATA 5G4IA 3UAKA 3CQ6A 1WYUA 3HDOA 5EQCA 3DXWA 4M2KA 2BIGA 3BN1A 2E7JA 3KGXA 4MQRA 3PD6A 4MSOA 1C0NA 3L44A 1OHYA 2D65A 1PMMA 1W7MA 3JZLA 5EUDA 4BMKA 4F5IA 2OGEA 3OKSA 3LV2A 1VJOA 1UKJA 3H7FA 3F9TA 4ADDA 2EGYA 4XJLA 2W7LA 1WYVB 4W1XA 4WD2A 1ASDA 5LHAA 3NU7A 2AY5A 1B5OA 3A9XA 3D6KA 1WSTA 3PA9A 1VP4A 3T32A 3ECDA 5M46A 3WY7A 3TFTA 2VI8A 4GE7A 1OHVA 1ASEA 1C9CA 3FQ7A 1M0NA 2VMWA 5E3KA 3GSBA 2C7TA 3OP7A 1IAYA 3RBFA 1I43A 1C7GA 3QN6A 1ASFA 1DJEA 3CQ4A 2CANA 3ZRQA 4WLJA 1EJIA 4DQ6A 2BYJA 1IX6A 2X5FA 3WX9A 3WCOA 4FFCA 5IWQA 1KL2A 3LG0A 4MQPA 4A00A 4ITGA 4GDYA 4Q75A 3PDXA 1WYVA 2BI1A 3G0TA 2AEVA 3R9AA 4L0OA 3AEPA 4RKCA 3B46A 2JJHA 3BCXA 4WXBA 1BT4A 1WYTB 4IYOB 4M2JA 2CJHA 2YRRA 3FKDA 3EI7A 1YJZA 2CB1A 2FN6A 4GEBA 5G2QA 3MBBA 1GD9A 1BJWA 2C0RA 2CJDA 2DKBA 2PB0A 3PDBB 4K2BA 3VOMA 3WKSA 2R2NA 4ZLVA 4JEYA 5EUEA 1ARGA 1M7YA 2ZSMA 5BJ4A 3B1CA 2DOUA 2CTZA 3PIUA 1C7NA 1PFFA 3ZZKA 1AHYA 3EIBA 3QHXA 1S06A 4CXRA 1W7NA 2EZ2A 4U1TA 1J32A 3K7YA 3EI6A 4ADEA 3M5UA 3NYSA 1WYTA 2CH1A 1YNUA 3I4JA 1GC3A 3DYDA 3NTJA 1AHXA 4CXQA 2AY2A 2VMXA 2X5DA 1N31A 2BWOA 3E2ZA 4OMAA 5C6UA 1EG5A 1SZSA 3FD0A 1IUGA 2AEUA 2QB2A 3CBFA 3PDBA 3CQ5A 1GEWA 2CJGA 5AX8A 2PO3A 1W23A 5I92A 4W8IA 1AAWA 3BWNC 1DGEA 1D2FA 5EUNA 3FZ8A 2HOXA 1BJ4A 1O62A 2E7UA 2AATA 2ZY3A 1TOKA 3FFRA 2GQNA 1UU2A 2CSTA 4RKDA 3EUCA 3EI5A 1RV3A 1RVYA 3MAFB 1S08A 4B9BA 5EFSA 2W8JA 3FTBA 4IXZA 4R5FA 4WP0A 1Z3ZA 1MLYA 1SVVA 3W1HA 3HVYA 1YIZA 5HXXA 1KMJA 3DODA 3HMUA 2VGSA 2DGLA 3FRKA 4H51A 4JEVA 1JG8A 2F8JA 4WYDA 4CBSA 5HDMA 1WYUB 4Q76A 2ZC0A 3QM2A 4OCAA 1CL1A 2OKKA 5F9SA 1MGVA 2VMVA 3MADA 3GWPA 3ZRPA 3B8XA 4LW4A 3NX3A 3A2BA 3BC8A 1GEYA 2QLRA 4ZDLA 5F8VA 1BS0A 2HZPA 4UOYA 2VMSA 1S09A 3VK4A 3WCNA 3EZ1A 4MQQA 1AMQA 3AEMA 4J8LA 3E2YA 3WGCA 1C7OA 4A72A 3HLMA 1ASBA 1X0MA 3I5TA 1LS3A 4A6TA 3DR7A 1AAMA 4KXKA 5D5SA 1W7LA 4PVFA 4F5FA 4NOGA 2D7ZA 4TN4A 2DR1A 4IXSA 1IBJA 4P3MA 3II0A 4W5KA 2Z1YA 1G7XA 1JS3A 1SF2A 4Q6RA 2HP1A 4UQVA 1B8GA 2DKJA 2ZJGA 2PB2A 5E4ZA 2VGTA 5EAAA 4UHOA 1ASAA 4AOAA 2BI3A 3ASAA 3JU7A 4WXGA 5EAVA 4ZASA 2YHKA 4A0GA 3G7QA 2Z20A 2VMQA 4ATPA 2O7CA 2EO5A 1AMSA 1M32A 8AATA 4XAUA 2CFBA 1QZ9A 3PAAA 4AO4A 2AY7A 1UU0A 2AY1A 1D7RA 1AJSB 1VEFA 2XBNA 2YCTA 3AEOA 2ZY5A 2VMYA 4OYTA 1ASLA 1FG7A 1AIBA 4XK1A 4E1OA 1Z7DA 1D7SA 2ZY4A 3AV7A 1BQDA 1N2TA 2OGAA 1MDXA 2XH1A 2W8VA 3FVSA 3HL2A 1M0PA 2VGUA 2HP2A 3AELA 3FVXA 4N0WA 4RIZA 4HF8A 4RLGA 4J5UA 3TCMA 1TOJA 1QGNA 1AMRA 4A0HA 4BA4A 1CQ7A 1ASCA 1C4KA 2E54A 1AX4A 2W8WA 2CH2A 2R5EA 2VMNA 4O6ZA 1OHWA 1M0QA 1B4XA 4ZSYA 3BCBA 2VLFA 4F5LA 3P6KA 3EIAA 2D66A 1RVUA 4RM1A 1KKPA 1QJ5A 3NNKA 2G6WA 1AJSA 2JG2A 3BWOA 1KL1A 3Q8NA 1XEYA 3W1IA 1KMKA 2CY8A 4RAEA 3AOVA 3LVKA 4UHMA 4WB0B 2D5YA 3E2ZB 4ZWVA 4ZWMA 1SZKA 2HUFA 4RITA 2BI9A 2VMOA 4PFFA 2VIAA 2AY8A 2YCNA 2JGTA 3AENB 3MKJA 3ZRRA 1M0OA 2VMTA 1LC8A 3A8UX 4BHDA 3DZZA 1ORDA 4JF0A 1DFOA 3COGA 5DJ1A 4K2MA 2AY9A 3TATA 1DJUA 1H0CA 1V2DA 2EPJA 4F5JA 1OXPA 2VGVA 3FDBA 5DB5A 3ACZA 1ECXA 2VMPA 3ASBA 3E77A 1TPLA 3LWSA 3K40A 4MY5A 3RCHB 3DXVA 4LNJA 4WB0A 3RI6A 2Z61A 1X28A 5J8QA 1LKCA 2W7DA 1YJSA 1PMOA 1CZCA 3IF2A 3FQ8A 4JEZA 3JTXA 1O61A 1LW4A 2YKUA 3GBXA 2BWNA 1QJ3A 3MC6C 5M4BA 1YIYA 3AENA 4E3QA 1B5PA 1TOGA 4EFFA 5M4DA 1ASMA 1OATA 3ELEA 3E2FA 2WK9A 3ATHA 1D7UA 1AKAA 3A9ZA 3ZZJA 1Y4IA 4KAMA 1E5FA 3RBLA 1SPAA 3HBXA 1LC5A 2O1BA 3QGUA 2Z1ZA 4WYGA 2GB3A 4I8AA 1BQAA 3AEJC 3A9YA 3VK3A 4LW2A 3RCHA 4F4EA 3BWNA 5DX5A 1JS6A 4F5GA 3PGYA 1O4SA 2OQXA 1GC4A 4WYEA 1ARTA 3WZFA 1WKHA 2HOYA 4EMYA 1PG8A 2VIBA 1DGDA 1QISA 4OC9A 1BJOB 5BJ3A 2FM1A 2HORA 2HOZA 2JJGA 3NU8A 2ZP7A 3WLXA 2Z9XA 2W7IA 4JEXA 3GZDA 2R5CA 1QITA 3KE3A 1ARSA 1V72A 1CJ0A 1M4NA 5G0AA 4N0BA 1ZOBA 1IVRA 3F6TA 3FZ7A 4W91A 1AIAA 2YKVA 4OTLA 4ZDPA 4A0FA 3FSLA 1X29A 4DGTA 2WK8A 1CQ8A 4WXFA 4F5KA 1GCKA 1FC4A 4E77A 4M2MA 3KGWA 1ZC9A 4FL0A 1BW0A 1OXOA 5E5IA 4Y0HA 1AY8A 3B1EA 3W1JA 4EB7A 2FNUA 3CAIA 4PIWA 1B9HA 1ARHA 5TF5A 1ASGA 3DU4A 2VGZA 3NUIA 1M6SA 1T3IA 3R4TA 1BJOA 4RJ0A 2GSAA 4XEWA 2VMRA 2W7JA 3ISLA 1EQBA 2QMAA 4BQ0A 2W8TA 2BKWA 4F5HA 3H14A 2YCPA 1AHEA 1MLZA 2JISA 3KKIA 3NRAA 4R5ZA 3USFA 3GZCA 3DC1A 1I48A 1S0AA 2R0TA 1X2AA 1MDZA 2BHXA 2DGMA 3WKRA 1IJIA 2FYFA 4UHNA 1BJNA 1DJ9A 1AJRA 4R2NA 1XI9A 2D63A 2Z9WA 2EH6A 1RV4A 5EIGB 5JAYA 4JE5A 4XJOA 3FZ6A 3LVMA 5G2PA 4LNLA 2Z9VA 3HT4A 4W1VA 3TQXA 3JWBA 2ZSLA 1LC7A 1AMAA 2HUUA 3F0HA 3LVLB 4IW7A 3FQAA 3UWCA 3N75A 1ZODA 1J04A 1G4XA 2OKJA 2VLHA 1FG3A 3FVUA 4JE5D 2W7GA 3BB8A 2QA3A 3GR9A 1AY4A 4QGRA 1TOIA 4LNMA 1GEXA 1GBNA 2QBTA 4W1WA 2Z67A 3VK2A 1U08A 4U2HA 4CVQA 5FT5A 3B1DA 2RFVA 1ELUA 1IX7A 1N8PA 3I16A 3JWAA 4K2IA 1B9IA 1TASA 2BI5A 2ZUKA 5EIGA 4EU1A 4JEWA 1V2FA 3FDDA 2BI2A 2CINA 3NUBA 2BYLA 2E7IA 4WYCA 2W7HA 4RJYA 3MAUA 4TMRA 5M49A 3GETA 3IHJA 1TARA 1S07A 3LVJA 3EI9A 4F5MA 2GMSA 1AHGA 1MAQA 1AY5A 1SZUA 2EZ1A 1CS1A 1YOOA 5FT8A 3MEBA 4P7YA 3PJ0A 2JJFA 1MAPA 3BV0A 3E6GA 5FT4A 2VMUA 4A0RA 3JW9A 3NYUA 4WYAA 4BA5A 1TOEA 4ZM3A 4TV7A 4AH3A 3N5MA 2AY4A 3FFHA 1G4VA 4IY7A 1P3WA 1O69A 2WK7A 2W7EA 5D95A 4A6RA 2BIAA 4AZJA 1IAXA 2D64A 4MKKA 4ISYA 3L8AA 4OT8A 1ARIA 3ELPA 4DBCA 3AOWA 1DTYA 1SFFA 3PPLA 2V1PA 3BCAA 4WBTA 4E3RA 1AICA 3QBOA 2R5CB 1AKBA 3QI6A 2WKAA 3FCRA 1I29A 3N0LA 4KYOA 4OBVA 3UE8A 2VMZA 1QIRA 2D7YA 4WLHA 1CZEA 2FQ6A 4XQ2A 2D61A 4IYOA 4AO9A 4MKJA 1LW5A 1GC0A 2VI9A 2AY6A 4B98A 7AATA 1W3UA 3BS8A 5HHYA 3MC6A 1V2EA 3P1TA 4GRXA 2FNIA 1LK9A 3VAXA 1CQ6A 2VYCA 4ZSWA 3EI8A 3K28A 1D7VA
chains in the Genus database with same CATH superfamily
5G4JA 1AKCA 1WKGA 2X8UA 4CBRA 1I41A 5DJ9A 4ZAHA 2HUIA 2QB3A 1E5EA 3DR4A 2YOBA 1UU1A 3AEJA 2TPLA 2W7KA 4OBUA 2O0RA 4IX8A 2C44A 2ZYJA 4K05A 4ADCA 4ZM4A 1YJYA 2ZY2A 2X3LA 4GSAA 4GE9A 2VGWA 1AHFA 2V0YA 4Y0DA 3RQ1A 3NDNA 3GZDC 3G8MA 2Z9UA 4ITXA 2DGKA 2JJEA 3RUYA 3TFUA 1H1CA 3E9KA 1YAAA 3LY1A 2GMUA 4XJMA 2BWPA 1GC2A 1DKAA 1CL2A 4GE4A 4MGRA 1JF9A 4ATQA 4A6UA 4PFNA 2BIEA 3VP6A 4EB5A 2FKIA 3AEMC 4IXOA 3AATA 3PD6B 5K8BA 3EZSA 2Q7WA 2W8UA 2C81A 3QPGA 2AY3A 1G7WA 4Q31A 2YRIA 3WGBA 2NMPA 4ADBA 2YKYA 3GJUA 4XJPA 5LH9A 4LC3A 1TATA 4ZDOA 3NYTA 2W7MA 3MAFA 2ORDA 4WYFA 3HQTA 1ELQA 4Y0IA 1ASNA 1MDOA 4HVKA 2YKXA 4AZKA 5G09A 1GDEA 4JF1A 9AATA 2W7FA 1KKJA 1IX8A 5FT6A 4R8DA 1BKGA 3DRDA 2OATA 5G4IA 3UAKA 3CQ6A 1WYUA 3HDOA 5EQCA 3DXWA 4M2KA 2BIGA 3BN1A 2E7JA 3KGXA 4MQRA 3PD6A 4MSOA 1C0NA 3L44A 1OHYA 2D65A 1PMMA 1W7MA 3JZLA 5EUDA 4BMKA 4F5IA 2OGEA 3OKSA 3LV2A 1VJOA 1UKJA 3H7FA 3F9TA 4ADDA 2EGYA 4XJLA 2W7LA 1WYVB 4W1XA 4WD2A 1ASDA 5LHAA 3NU7A 2AY5A 1B5OA 3A9XA 3D6KA 1WSTA 3PA9A 1VP4A 3T32A 3ECDA 5M46A 3WY7A 3TFTA 2VI8A 4GE7A 1OHVA 1ASEA 1C9CA 3FQ7A 1M0NA 2VMWA 5E3KA 3GSBA 2C7TA 3OP7A 1IAYA 3RBFA 1I43A 1C7GA 3QN6A 1ASFA 1DJEA 3CQ4A 2CANA 3ZRQA 4WLJA 1EJIA 4DQ6A 2BYJA 1IX6A 2X5FA 3WX9A 3WCOA 4FFCA 5IWQA 1KL2A 3LG0A 4MQPA 4A00A 4ITGA 4GDYA 4Q75A 3PDXA 1WYVA 2BI1A 3G0TA 2AEVA 3R9AA 4L0OA 3AEPA 4RKCA 3B46A 2JJHA 3BCXA 4WXBA 1BT4A 1WYTB 4IYOB 4M2JA 2CJHA 2YRRA 3FKDA 3EI7A 1YJZA 2CB1A 2FN6A 4GEBA 5G2QA 3MBBA 1GD9A 1BJWA 2C0RA 2CJDA 2DKBA 2PB0A 3PDBB 4K2BA 3VOMA 3WKSA 2R2NA 4ZLVA 4JEYA 5EUEA 1ARGA 1M7YA 2ZSMA 5BJ4A 3B1CA 2DOUA 2CTZA 3PIUA 1C7NA 1PFFA 3ZZKA 1AHYA 3EIBA 3QHXA 1S06A 4CXRA 1W7NA 2EZ2A 4U1TA 1J32A 3K7YA 3EI6A 4ADEA 3M5UA 3NYSA 1WYTA 2CH1A 1YNUA 3I4JA 1GC3A 3DYDA 3NTJA 1AHXA 4CXQA 2AY2A 2VMXA 2X5DA 1N31A 2BWOA 3E2ZA 4OMAA 5C6UA 1EG5A 1SZSA 3FD0A 1IUGA 2AEUA 2QB2A 3CBFA 3PDBA 3CQ5A 1GEWA 2CJGA 5AX8A 2PO3A 2EYQA 1W23A 5I92A 4W8IA 1AAWA 3BWNC 1DGEA 1D2FA 5EUNA 3FZ8A 2HOXA 1BJ4A 1O62A 2E7UA 2AATA 2ZY3A 1TOKA 3FFRA 2GQNA 1UU2A 2CSTA 4RKDA 3EUCA 3EI5A 1RV3A 1RVYA 3MAFB 1S08A 4B9BA 5EFSA 2W8JA 3FTBA 4IXZA 4R5FA 4WP0A 1Z3ZA 1MLYA 1SVVA 3W1HA 3HVYA 1YIZA 5HXXA 1KMJA 3DODA 3HMUA 2VGSA 2DGLA 3FRKA 4H51A 4JEVA 1JG8A 2F8JA 4WYDA 4CBSA 5HDMA 1WYUB 4Q76A 2ZC0A 3QM2A 4OCAA 2A1VA 1CL1A 2OKKA 5F9SA 1MGVA 2VMVA 3MADA 3GWPA 3ZRPA 3B8XA 4LW4A 3NX3A 3A2BA 3BC8A 1GEYA 2QLRA 4ZDLA 5F8VA 1BS0A 2HZPA 4UOYA 2VMSA 1S09A 3VK4A 3WCNA 3EZ1A 4MQQA 1AMQA 3AEMA 4J8LA 3E2YA 3WGCA 1C7OA 4A72A 3HLMA 1ASBA 1X0MA 3I5TA 1LS3A 4A6TA 3DR7A 1AAMA 4KXKA 5D5SA 1W7LA 4PVFA 4F5FA 4NOGA 2D7ZA 4TN4A 2DR1A 4IXSA 1IBJA 4P3MA 3II0A 4W5KA 2Z1YA 1G7XA 1JS3A 1SF2A 4Q6RA 2HP1A 4UQVA 1B8GA 2DKJA 2ZJGA 2PB2A 5E4ZA 2VGTA 5EAAA 4UHOA 1ASAA 4AOAA 2BI3A 3ASAA 3JU7A 4WXGA 5EAVA 4ZASA 2YHKA 4A0GA 3G7QA 2Z20A 2VMQA 4ATPA 2O7CA 2EO5A 1AMSA 1M32A 8AATA 4XAUA 2CFBA 1QZ9A 3PAAA 4AO4A 2AY7A 1UU0A 2AY1A 1D7RA 1AJSB 1VEFA 2XBNA 2YCTA 3AEOA 2ZY5A 2VMYA 4OYTA 1ASLA 1FG7A 1AIBA 4XK1A 4E1OA 1Z7DA 1D7SA 2ZY4A 3AV7A 1BQDA 1N2TA 2OGAA 1MDXA 2XH1A 2W8VA 3FVSA 3HL2A 1M0PA 2VGUA 2HP2A 3AELA 3FVXA 4N0WA 4RIZA 4HF8A 4RLGA 4J5UA 3TCMA 1TOJA 1QGNA 1AMRA 4A0HA 4BA4A 1CQ7A 1ASCA 1C4KA 2E54A 2WB6A 1AX4A 2W8WA 2CH2A 2R5EA 2VMNA 4O6ZA 1OHWA 1M0QA 1B4XA 4ZSYA 3BCBA 2VLFA 4F5LA 3P6KA 3EIAA 2D66A 1RVUA 4RM1A 1KKPA 1QJ5A 3NNKA 2G6WA 1AJSA 2JG2A 3BWOA 1KL1A 3Q8NA 1XEYA 3W1IA 1KMKA 2CY8A 4RAEA 3AOVA 3LVKA 4UHMA 4WB0B 2D5YA 3E2ZB 4ZWVA 4ZWMA 2QSRA 1SZKA 2HUFA 4RITA 2BI9A 2VMOA 4PFFA 2VIAA 2AY8A 2YCNA 2JGTA 3AENB 3MKJA 3ZRRA 1M0OA 2VMTA 1LC8A 3A8UX 4BHDA 3DZZA 1ORDA 4JF0A 1DFOA 3COGA 5DJ1A 4K2MA 2AY9A 3TATA 1DJUA 1H0CA 1V2DA 2EPJA 4F5JA 1OXPA 2VGVA 3FDBA 5DB5A 3ACZA 1ECXA 2VMPA 3ASBA 3E77A 1TPLA 3LWSA 3K40A 4MY5A 3RCHB 3DXVA 4LNJA 4WB0A 3RI6A 2Z61A 1X28A 5J8QA 1LKCA 2W7DA 1YJSA 1PMOA 1CZCA 3IF2A 3N4XA 3FQ8A 4JEZA 2KFPA 3JTXA 1O61A 1LW4A 2YKUA 3GBXA 2BWNA 1QJ3A 3MC6C 5M4BA 1YIYA 3AENA 4E3QA 1B5PA 1TOGA 4EFFA 5M4DA 1ASMA 1OATA 3ELEA 3E2FA 2WK9A 3ATHA 1D7UA 1AKAA 3A9ZA 3ZZJA 1Y4IA 4KAMA 1E5FA 3RBLA 1SPAA 3HBXA 1LC5A 2O1BA 3QGUA 5KTBA 2Z1ZA 4WYGA 2GB3A 4I8AA 1BQAA 3AEJC 3A9YA 3VK3A 4LW2A 3RCHA 4F4EA 3BWNA 5DX5A 1JS6A 4F5GA 3PGYA 1O4SA 2OQXA 1GC4A 4WYEA 1ARTA 3WZFA 1WKHA 2HOYA 4EMYA 1PG8A 2VIBA 1DGDA 1QISA 4OC9A 1BJOB 5BJ3A 2FM1A 2HORA 2HOZA 2JJGA 3NU8A 2ZP7A 3WLXA 2Z9XA 2W7IA 4JEXA 3GZDA 2R5CA 1QITA 3KE3A 1ARSA 1V72A 4H63Q 1CJ0A 1M4NA 5G0AA 4N0BA 1ZOBA 1IVRA 3F6TA 3FZ7A 4W91A 1AIAA 2YKVA 4OTLA 4ZDPA 4A0FA 3FSLA 1X29A 4DGTA 2WK8A 1CQ8A 4WXFA 4F5KA 1GCKA 1FC4A 4E77A 4M2MA 1KAFA 3KGWA 1ZC9A 4FL0A 1BW0A 1OXOA 5E5IA 4Y0HA 1AY8A 3B1EA 3W1JA 4EB7A 2FNUA 3CAIA 4PIWA 1B9HA 1ARHA 5TF5A 1ASGA 3DU4A 3N4RA 2VGZA 3NUIA 1M6SA 1T3IA 3R4TA 1BJOA 4RJ0A 2GSAA 4XEWA 2VMRA 2W7JA 3ISLA 1EQBA 2QMAA 4BQ0A 2W8TA 2BKWA 4F5HA 3H14A 2YCPA 1AHEA 1MLZA 2JISA 3KKIA 3NRAA 4R5ZA 3USFA 3GZCA 3DC1A 1I48A 1S0AA 2R0TA 1X2AA 1MDZA 2BHXA 2DGMA 3WKRA 1IJIA 2FYFA 4UHNA 1BJNA 1DJ9A 1AJRA 4R2NA 1XI9A 2D63A 2Z9WA 2EH6A 1RV4A 5EIGB 5JAYA 4JE5A 4XJOA 3FZ6A 3LVMA 5G2PA 4LNLA 2Z9VA 3HT4A 4W1VA 3TQXA 3JWBA 2ZSLA 1LC7A 1AMAA 2HUUA 3F0HA 3LVLB 4IW7A 3FQAA 3UWCA 3N75A 1ZODA 1J04A 1G4XA 2OKJA 2VLHA 1FG3A 3FVUA 4JE5D 2W7GA 3BB8A 2QA3A 3GR9A 1AY4A 4QGRA 1TOIA 4LNMA 1GEXA 1GBNA 2QBTA 4W1WA 2Z67A 3VK2A 1U08A 4U2HA 4CVQA 5FT5A 3B1DA 2RFVA 1ELUA 1IX7A 1N8PA 3I16A 3JWAA 4K2IA 1B9IA 1TASA 2BI5A 2ZUKA 5EIGA 4EU1A 4JEWA 1V2FA 3FDDA 2BI2A 2CINA 3NUBA 2BYLA 2E7IA 4WYCA 2W7HA 3N7NA 4RJYA 3MAUA 4TMRA 5M49A 3H9XA 3GETA 3IHJA 1TARA 1S07A 3LVJA 3EI9A 4F5MA 2GMSA 1AHGA 1MAQA 1AY5A 1SZUA 2EZ1A 1CS1A 1YOOA 5FT8A 3MEBA 4P7YA 3PJ0A 2JJFA 1MAPA 3BV0A 3E6GA 5FT4A 2VMUA 4A0RA 3JW9A 3NYUA 4WYAA 4BA5A 1TOEA 4ZM3A 4TV7A 4AH3A 3N5MA 2AY4A 3FFHA 1G4VA 4IY7A 1P3WA 1O69A 2WK7A 2W7EA 5D95A 2G7JA 4A6RA 2BIAA 4AZJA 1IAXA 2D64A 4MKKA 4ISYA 3L8AA 4OT8A 1ARIA 3ELPA 4DBCA 3AOWA 1DTYA 1SFFA 3PPLA 2V1PA 3BCAA 4WBTA 4E3RA 1AICA 3QBOA 2R5CB 1AKBA 3QI6A 2WKAA 3FCRA 1I29A 3N0LA 4KYOA 4OBVA 3UE8A 2VMZA 1QIRA 2D7YA 4WLHA 1CZEA 2FQ6A 4XQ2A 2D61A 4IYOA 4AO9A 3N4SA 4MKJA 1LW5A 1GC0A 2VI9A 2AY6A 4B98A 7AATA 1W3UA 3BS8A 5HHYA 3MC6A 1V2EA 3P1TA 4GRXA 2FNIA 1LK9A 3VAXA 1CQ6A 2VYCA 4ZSWA 3EI8A 3K28A 1D7VA
chains in the Genus database with same CATH topology
5G4JA 1AKCA 1WKGA 2X8UA 4CBRA 1I41A 5DJ9A 4ZAHA 2HUIA 2QB3A 1E5EA 3DR4A 2YOBA 1UU1A 3AEJA 2TPLA 2W7KA 4OBUA 2O0RA 4IX8A 2C44A 2ZYJA 4K05A 4ADCA 4ZM4A 1YJYA 2ZY2A 2X3LA 4GSAA 4GE9A 2VGWA 1AHFA 2V0YA 4Y0DA 3RQ1A 3NDNA 3GZDC 3G8MA 2Z9UA 4ITXA 2DGKA 2JJEA 3RUYA 3TFUA 1H1CA 3E9KA 1YAAA 3LY1A 2GMUA 4XJMA 2BWPA 1GC2A 1DKAA 1CL2A 4GE4A 4MGRA 1JF9A 4ATQA 4A6UA 4PFNA 2BIEA 3VP6A 4EB5A 2FKIA 3AEMC 4IXOA 3AATA 3PD6B 5K8BA 3EZSA 2Q7WA 2W8UA 2C81A 3QPGA 2AY3A 1G7WA 4Q31A 2YRIA 3WGBA 2NMPA 4ADBA 2YKYA 3GJUA 4XJPA 5LH9A 4LC3A 1TATA 4ZDOA 3NYTA 2W7MA 3MAFA 2ORDA 4WYFA 3HQTA 1ELQA 4Y0IA 1ASNA 1MDOA 4HVKA 2YKXA 4AZKA 5G09A 1GDEA 4JF1A 9AATA 2W7FA 1KKJA 1IX8A 5FT6A 4R8DA 1BKGA 3DRDA 2OATA 5G4IA 3UAKA 3CQ6A 1WYUA 3HDOA 5EQCA 3DXWA 4M2KA 2BIGA 3BN1A 2E7JA 3KGXA 4MQRA 3PD6A 4MSOA 1C0NA 3L44A 1OHYA 2D65A 1PMMA 1W7MA 3JZLA 5EUDA 4BMKA 4F5IA 2OGEA 3OKSA 3LV2A 1VJOA 1UKJA 3H7FA 3F9TA 4ADDA 2EGYA 4XJLA 2W7LA 1WYVB 4W1XA 4WD2A 1ASDA 5LHAA 3NU7A 2AY5A 1B5OA 3A9XA 3D6KA 1WSTA 3PA9A 1VP4A 3T32A 3ECDA 5M46A 3WY7A 3TFTA 2VI8A 4GE7A 1OHVA 1ASEA 1C9CA 3FQ7A 1M0NA 2VMWA 5E3KA 3GSBA 2C7TA 3OP7A 1IAYA 3RBFA 1I43A 1C7GA 3QN6A 1ASFA 1DJEA 3CQ4A 2CANA 3ZRQA 4WLJA 1EJIA 4DQ6A 2BYJA 1IX6A 2X5FA 3WX9A 3WCOA 4FFCA 5IWQA 1KL2A 3LG0A 4MQPA 4A00A 4ITGA 4GDYA 4Q75A 3PDXA 1WYVA 2BI1A 3G0TA 2AEVA 3R9AA 4L0OA 3AEPA 4RKCA 3B46A 2JJHA 3BCXA 4WXBA 1BT4A 1WYTB 4IYOB 4M2JA 2CJHA 2YRRA 3FKDA 3EI7A 1YJZA 2CB1A 2FN6A 4GEBA 5G2QA 3MBBA 1GD9A 1BJWA 2C0RA 2CJDA 2DKBA 2PB0A 3PDBB 4K2BA 3VOMA 3WKSA 2R2NA 4ZLVA 4JEYA 5EUEA 1ARGA 1M7YA 2ZSMA 5BJ4A 3B1CA 2DOUA 2CTZA 3PIUA 1C7NA 1PFFA 3ZZKA 1AHYA 3EIBA 3QHXA 1S06A 4CXRA 1W7NA 2EZ2A 4U1TA 1J32A 3K7YA 3EI6A 4ADEA 3M5UA 3NYSA 1WYTA 2CH1A 1YNUA 3I4JA 1GC3A 3DYDA 3NTJA 1AHXA 4CXQA 2AY2A 2VMXA 2X5DA 1N31A 2BWOA 3E2ZA 4OMAA 5C6UA 1EG5A 1SZSA 3FD0A 1IUGA 2AEUA 2QB2A 3CBFA 3PDBA 3CQ5A 1GEWA 2CJGA 5AX8A 2PO3A 2EYQA 1W23A 5I92A 4W8IA 1AAWA 3BWNC 1DGEA 1D2FA 5EUNA 3FZ8A 2HOXA 1BJ4A 1O62A 2E7UA 2AATA 2ZY3A 1TOKA 3FFRA 2GQNA 1UU2A 2CSTA 4RKDA 3EUCA 3EI5A 1RV3A 1RVYA 3MAFB 1S08A 4B9BA 5EFSA 2W8JA 3FTBA 4IXZA 4R5FA 4WP0A 1Z3ZA 1MLYA 1SVVA 3W1HA 3HVYA 1YIZA 5HXXA 1KMJA 3DODA 3HMUA 2VGSA 2DGLA 3FRKA 4H51A 4JEVA 1JG8A 2F8JA 4WYDA 4CBSA 5HDMA 1WYUB 4Q76A 2ZC0A 3QM2A 4OCAA 2A1VA 1CL1A 2OKKA 5F9SA 1MGVA 2VMVA 3MADA 3GWPA 3ZRPA 3B8XA 4LW4A 3NX3A 3A2BA 3BC8A 1GEYA 2QLRA 4ZDLA 5F8VA 1BS0A 2HZPA 4UOYA 2VMSA 1S09A 3VK4A 3WCNA 3EZ1A 4MQQA 1AMQA 3AEMA 4J8LA 3E2YA 3WGCA 1C7OA 4A72A 3HLMA 1ASBA 1X0MA 3I5TA 1LS3A 4A6TA 3DR7A 1AAMA 4KXKA 5D5SA 1W7LA 4PVFA 4F5FA 4NOGA 2D7ZA 4TN4A 2DR1A 4IXSA 1IBJA 4P3MA 3II0A 4W5KA 2Z1YA 1G7XA 1JS3A 1SF2A 4Q6RA 2HP1A 4UQVA 1B8GA 2DKJA 2ZJGA 2PB2A 5E4ZA 2VGTA 5EAAA 4UHOA 1ASAA 4AOAA 2BI3A 3ASAA 3JU7A 4WXGA 5EAVA 4ZASA 2YHKA 4A0GA 3G7QA 2Z20A 2VMQA 4ATPA 2O7CA 2EO5A 1AMSA 1M32A 8AATA 4XAUA 2CFBA 1QZ9A 3PAAA 4AO4A 2AY7A 1UU0A 2AY1A 1D7RA 1AJSB 1VEFA 2XBNA 2YCTA 3AEOA 2ZY5A 2VMYA 4OYTA 1ASLA 1FG7A 1AIBA 4XK1A 4E1OA 1Z7DA 1D7SA 2ZY4A 3AV7A 1BQDA 1N2TA 2OGAA 1MDXA 2XH1A 2W8VA 3FVSA 3HL2A 1M0PA 2VGUA 2HP2A 3AELA 3FVXA 4N0WA 4RIZA 4HF8A 4RLGA 4J5UA 3TCMA 1TOJA 1QGNA 1AMRA 4A0HA 4BA4A 1CQ7A 1ASCA 1C4KA 2E54A 2WB6A 1AX4A 2W8WA 2CH2A 2R5EA 2VMNA 4O6ZA 1OHWA 1M0QA 1B4XA 4ZSYA 3BCBA 2VLFA 4F5LA 3P6KA 3EIAA 2D66A 1RVUA 4RM1A 1KKPA 1QJ5A 3NNKA 2G6WA 1AJSA 2JG2A 3BWOA 1KL1A 3Q8NA 1XEYA 3W1IA 1KMKA 2CY8A 4RAEA 3AOVA 3LVKA 4UHMA 4WB0B 2D5YA 3E2ZB 4ZWVA 4ZWMA 2QSRA 1SZKA 2HUFA 4RITA 2BI9A 2VMOA 4PFFA 2VIAA 2AY8A 2YCNA 2JGTA 3AENB 3MKJA 3ZRRA 1M0OA 2VMTA 1LC8A 3A8UX 4BHDA 3DZZA 1ORDA 4JF0A 1DFOA 3COGA 5DJ1A 4K2MA 2AY9A 3TATA 1DJUA 1H0CA 1V2DA 2EPJA 4F5JA 1OXPA 2VGVA 3FDBA 5DB5A 3ACZA 1ECXA 2VMPA 3ASBA 3E77A 1TPLA 3LWSA 3K40A 4MY5A 3RCHB 3DXVA 4LNJA 4WB0A 3RI6A 2Z61A 1X28A 5J8QA 1LKCA 2W7DA 1YJSA 1PMOA 1CZCA 3IF2A 3N4XA 3FQ8A 4JEZA 2KFPA 3JTXA 1O61A 1LW4A 2YKUA 3GBXA 2BWNA 1QJ3A 3MC6C 5M4BA 1YIYA 3AENA 4E3QA 1B5PA 1TOGA 4EFFA 5M4DA 1ASMA 1OATA 3ELEA 3E2FA 2WK9A 3ATHA 1D7UA 1AKAA 3A9ZA 3ZZJA 1Y4IA 4KAMA 1E5FA 3RBLA 1SPAA 3HBXA 1LC5A 2O1BA 3QGUA 5KTBA 2Z1ZA 4WYGA 2GB3A 4I8AA 1BQAA 3AEJC 3A9YA 3VK3A 4LW2A 3RCHA 4F4EA 3BWNA 5DX5A 1JS6A 4F5GA 3PGYA 1O4SA 2OQXA 1GC4A 4WYEA 1ARTA 3WZFA 1WKHA 2HOYA 4EMYA 1PG8A 2VIBA 1DGDA 1QISA 4OC9A 1BJOB 5BJ3A 2FM1A 2HORA 2HOZA 2JJGA 3NU8A 2ZP7A 3WLXA 2Z9XA 2W7IA 4JEXA 3GZDA 2R5CA 1QITA 3KE3A 1ARSA 1V72A 4H63Q 1CJ0A 1M4NA 5G0AA 4N0BA 1ZOBA 1IVRA 3F6TA 3FZ7A 4W91A 1AIAA 2YKVA 4OTLA 4ZDPA 4A0FA 3FSLA 1X29A 4DGTA 2WK8A 1CQ8A 4WXFA 4F5KA 1GCKA 1FC4A 4E77A 4M2MA 3KGWA 1ZC9A 4FL0A 1BW0A 1OXOA 5E5IA 4Y0HA 1AY8A 3B1EA 3W1JA 4EB7A 2FNUA 3CAIA 4PIWA 1B9HA 1ARHA 5TF5A 1ASGA 3DU4A 3N4RA 2VGZA 3NUIA 1M6SA 1T3IA 3R4TA 1BJOA 4RJ0A 2GSAA 4XEWA 2VMRA 2W7JA 3ISLA 1EQBA 2QMAA 4BQ0A 2W8TA 2BKWA 4F5HA 3H14A 2YCPA 1AHEA 1MLZA 2JISA 3KKIA 3NRAA 4R5ZA 3USFA 3GZCA 3DC1A 1I48A 1S0AA 2R0TA 1X2AA 1MDZA 2BHXA 2DGMA 3WKRA 1IJIA 2FYFA 4UHNA 1BJNA 1DJ9A 1AJRA 4R2NA 1XI9A 2D63A 2Z9WA 2EH6A 1RV4A 5EIGB 5JAYA 4JE5A 4XJOA 3FZ6A 3LVMA 5G2PA 4LNLA 2Z9VA 3HT4A 4W1VA 3TQXA 3JWBA 2ZSLA 1LC7A 1AMAA 2HUUA 3F0HA 3LVLB 4IW7A 3FQAA 3UWCA 3N75A 1ZODA 1J04A 1G4XA 2OKJA 2VLHA 1FG3A 3FVUA 4JE5D 2W7GA 3BB8A 2QA3A 3GR9A 1AY4A 4QGRA 1TOIA 4LNMA 1GEXA 1GBNA 2QBTA 4W1WA 2Z67A 3VK2A 1U08A 4U2HA 4CVQA 5FT5A 3B1DA 2RFVA 1ELUA 1IX7A 1N8PA 3I16A 3JWAA 4K2IA 1B9IA 1TASA 2BI5A 2ZUKA 5EIGA 4EU1A 4JEWA 1V2FA 3FDDA 2BI2A 2CINA 3NUBA 2BYLA 2E7IA 4WYCA 2W7HA 3N7NA 4RJYA 3MAUA 4TMRA 5M49A 3H9XA 3GETA 3IHJA 1TARA 1S07A 3LVJA 3EI9A 4F5MA 2GMSA 1AHGA 1MAQA 1AY5A 1SZUA 2EZ1A 1CS1A 1YOOA 5FT8A 3MEBA 4P7YA 3PJ0A 2JJFA 1MAPA 3BV0A 3E6GA 5FT4A 2VMUA 4A0RA 3JW9A 3NYUA 4WYAA 4BA5A 1TOEA 4ZM3A 4TV7A 4AH3A 3N5MA 2AY4A 3FFHA 1G4VA 4IY7A 1P3WA 1O69A 2WK7A 2W7EA 5D95A 2G7JA 4A6RA 2BIAA 4AZJA 1IAXA 2D64A 4MKKA 4ISYA 3L8AA 4OT8A 1ARIA 3ELPA 4DBCA 3AOWA 1DTYA 1SFFA 3PPLA 2V1PA 3BCAA 4WBTA 4E3RA 1AICA 3QBOA 2R5CB 1AKBA 3QI6A 2WKAA 3FCRA 1I29A 3N0LA 4KYOA 4OBVA 3UE8A 2VMZA 1QIRA 2D7YA 4WLHA 1CZEA 2FQ6A 4XQ2A 2D61A 4IYOA 4AO9A 3N4SA 4MKJA 1LW5A 1GC0A 2VI9A 2AY6A 4B98A 7AATA 1W3UA 3BS8A 5HHYA 3MC6A 1V2EA 3P1TA 4GRXA 2FNIA 1LK9A 3VAXA 1CQ6A 2VYCA 4ZSWA 3EI8A 3K28A 1D7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4J A;  1AKC A;  1WKG A;  2X8U A;  4CBR A;  1I41 A;  5DJ9 A;  4ZAH A;  2HUI A;  2QB3 A;  1E5E A;  3DR4 A;  2YOB A;  1UU1 A;  3AEJ A;  2TPL A;  2W7K A;  4OBU A;  2O0R A;  4IX8 A;  2C44 A;  2ZYJ A;  4ADC A;  4ZM4 A;  1YJY A;  2ZY2 A;  2X3L A;  4GSA A;  4GE9 A;  2VGW A;  1AHF A;  2V0Y A;  4Y0D A;  3RQ1 A;  3NDN A;  3GZD C;  3G8M A;  2Z9U A;  4ITX A;  2DGK A;  2JJE A;  3RUY A;  3TFU A;  1H1C A;  3E9K A;  1YAA A;  3LY1 A;  2GMU A;  4XJM A;  2BWP A;  1GC2 A;  1DKA A;  1CL2 A;  4GE4 A;  4MGR A;  1JF9 A;  4ATQ A;  4A6U A;  4PFN A;  2BIE A;  3VP6 A;  4EB5 A;  3AEM C;  4IXO A;  3AAT A;  3PD6 B;  5K8B A;  3EZS A;  2Q7W A;  2W8U A;  2C81 A;  3QPG A;  2AY3 A;  1G7W A;  4Q31 A;  2YRI A;  3WGB A;  2NMP A;  4ADB A;  2YKY A;  3GJU A;  4XJP A;  5LH9 A;  4LC3 A;  1TAT A;  4ZDO A;  3NYT A;  2W7M A;  3MAF A;  2ORD A;  4WYF A;  3HQT A;  1ELQ A;  4Y0I A;  1ASN A;  1MDO A;  4HVK A;  2YKX A;  4AZK A;  5G09 A;  1GDE A;  4JF1 A;  9AAT A;  2W7F A;  1KKJ A;  1IX8 A;  5FT6 A;  4R8D A;  1BKG A;  3DRD A;  2OAT A;  5G4I A;  3UAK A;  3CQ6 A;  1WYU A;  3HDO A;  5EQC A;  3DXW A;  4M2K A;  2BIG A;  3BN1 A;  2E7J A;  3KGX A;  4MQR A;  3PD6 A;  4MSO A;  1C0N A;  3L44 A;  1OHY A;  2D65 A;  1PMM A;  1W7M A;  3JZL A;  5EUD A;  4BMK A;  4F5I A;  2OGE A;  3OKS A;  3LV2 A;  1VJO A;  1UKJ A;  3H7F A;  3F9T A;  4ADD A;  2EGY A;  4XJL A;  2W7L A;  1WYV B;  4W1X A;  4WD2 A;  1ASD A;  5LHA A;  3NU7 A;  2AY5 A;  1B5O A;  3A9X A;  3D6K A;  1WST A;  3PA9 A;  1VP4 A;  3T32 A;  3ECD A;  5M46 A;  3WY7 A;  3TFT A;  2VI8 A;  4GE7 A;  1OHV A;  1ASE A;  1C9C A;  3FQ7 A;  1M0N A;  2VMW A;  5E3K A;  3GSB A;  2C7T A;  3OP7 A;  1IAY A;  3RBF A;  1I43 A;  1C7G A;  3QN6 A;  1ASF A;  1DJE A;  3CQ4 A;  2CAN A;  3ZRQ A;  4WLJ A;  1EJI A;  4DQ6 A;  2BYJ A;  1IX6 A;  2X5F A;  3WX9 A;  3WCO A;  4FFC A;  5IWQ A;  1KL2 A;  3LG0 A;  4MQP A;  4A00 A;  4ITG A;  4GDY A;  4Q75 A;  3PDX A;  1WYV A;  2BI1 A;  3G0T A;  2AEV A;  3R9A A;  4L0O A;  3AEP A;  4RKC A;  3B46 A;  2JJH A;  3BCX A;  4WXB A;  1BT4 A;  1WYT B;  4IYO B;  4M2J A;  2CJH A;  2YRR A;  3FKD A;  3EI7 A;  1YJZ A;  2CB1 A;  2FN6 A;  4GEB A;  5G2Q A;  3MBB A;  1GD9 A;  1BJW A;  2C0R A;  2CJD A;  2DKB A;  2PB0 A;  3PDB B;  4K2B A;  3VOM A;  3WKS A;  2R2N A;  4ZLV A;  4JEY A;  5EUE A;  1ARG A;  1M7Y A;  2ZSM A;  5BJ4 A;  3B1C A;  2DOU A;  2CTZ A;  3PIU A;  1C7N A;  1PFF A;  3ZZK A;  1AHY A;  3EIB A;  3QHX A;  1S06 A;  4CXR A;  1W7N A;  2EZ2 A;  4U1T A;  1J32 A;  3K7Y A;  3EI6 A;  4ADE A;  3M5U A;  3NYS A;  1WYT A;  2CH1 A;  1YNU A;  3I4J A;  1GC3 A;  3DYD A;  3NTJ A;  1AHX A;  4CXQ A;  2AY2 A;  2VMX A;  2X5D A;  1N31 A;  2BWO A;  3E2Z A;  4OMA A;  5C6U A;  1EG5 A;  1SZS A;  3FD0 A;  1IUG A;  2AEU A;  2QB2 A;  3CBF A;  3PDB A;  3CQ5 A;  1GEW A;  2CJG A;  5AX8 A;  2PO3 A;  1W23 A;  5I92 A;  4W8I A;  1AAW A;  3BWN C;  1DGE A;  1D2F A;  5EUN A;  3FZ8 A;  2HOX A;  1BJ4 A;  1O62 A;  2E7U A;  2AAT A;  2ZY3 A;  1TOK A;  3FFR A;  2GQN A;  1UU2 A;  2CST A;  4RKD A;  3EUC A;  3EI5 A;  1RV3 A;  1RVY A;  3MAF B;  1S08 A;  4B9B A;  5EFS A;  2W8J A;  3FTB A;  4IXZ A;  4R5F A;  4WP0 A;  1Z3Z A;  1MLY A;  1SVV A;  3W1H A;  3HVY A;  1YIZ A;  5HXX A;  1KMJ A;  3DOD A;  3HMU A;  2VGS A;  2DGL A;  3FRK A;  4H51 A;  4JEV A;  1JG8 A;  2F8J A;  4WYD A;  4CBS A;  5HDM A;  1WYU B;  4Q76 A;  2ZC0 A;  3QM2 A;  4OCA A;  1CL1 A;  2OKK A;  5F9S A;  1MGV A;  2VMV A;  3MAD A;  3GWP A;  3ZRP A;  3B8X A;  4LW4 A;  3NX3 A;  3A2B A;  3BC8 A;  1GEY A;  2QLR A;  4ZDL A;  5F8V A;  1BS0 A;  2HZP A;  4UOY A;  2VMS A;  1S09 A;  3VK4 A;  3WCN A;  3EZ1 A;  4MQQ A;  1AMQ A;  3AEM A;  4J8L A;  3E2Y A;  3WGC A;  1C7O A;  4A72 A;  3HLM A;  1ASB A;  1X0M A;  3I5T A;  1LS3 A;  4A6T A;  3DR7 A;  1AAM A;  4KXK A;  5D5S A;  1W7L A;  4PVF A;  4F5F A;  4NOG A;  2D7Z A;  4TN4 A;  2DR1 A;  4IXS A;  1IBJ A;  4P3M A;  3II0 A;  4W5K A;  2Z1Y A;  1G7X A;  1JS3 A;  1SF2 A;  4Q6R A;  2HP1 A;  4UQV A;  1B8G A;  2DKJ A;  2ZJG A;  2PB2 A;  5E4Z A;  2VGT A;  5EAA A;  4UHO A;  1ASA A;  4AOA A;  2BI3 A;  3ASA A;  3JU7 A;  4WXG A;  5EAV A;  4ZAS A;  2YHK A;  4A0G A;  3G7Q A;  2Z20 A;  2VMQ A;  4ATP A;  2O7C A;  2EO5 A;  1AMS A;  1M32 A;  8AAT A;  4XAU A;  2CFB A;  1QZ9 A;  3PAA A;  4AO4 A;  2AY7 A;  1UU0 A;  2AY1 A;  1D7R A;  1AJS B;  1VEF A;  2XBN A;  2YCT A;  3AEO A;  2ZY5 A;  2VMY A;  4OYT A;  1ASL A;  1FG7 A;  1AIB A;  4XK1 A;  4E1O A;  1Z7D A;  1D7S A;  2ZY4 A;  3AV7 A;  1BQD A;  1N2T A;  2OGA A;  1MDX A;  2XH1 A;  2W8V A;  3FVS A;  3HL2 A;  1M0P A;  2VGU A;  2HP2 A;  3AEL A;  3FVX A;  4N0W A;  4RIZ A;  4HF8 A;  4RLG A;  4J5U A;  3TCM A;  1TOJ A;  1QGN A;  1AMR A;  4A0H A;  4BA4 A;  1CQ7 A;  1ASC A;  1C4K A;  2E54 A;  1AX4 A;  2W8W A;  2CH2 A;  2R5E A;  2VMN A;  4O6Z A;  1OHW A;  1M0Q A;  1B4X A;  4ZSY A;  3BCB A;  2VLF A;  4F5L A;  3P6K A;  3EIA A;  2D66 A;  1RVU A;  4RM1 A;  1KKP A;  1QJ5 A;  3NNK A;  2G6W A;  1AJS A;  2JG2 A;  3BWO A;  1KL1 A;  3Q8N A;  1XEY A;  3W1I A;  1KMK A;  2CY8 A;  4RAE A;  3AOV A;  3LVK A;  4UHM A;  4WB0 B;  2D5Y A;  3E2Z B;  4ZWV A;  4ZWM A;  1SZK A;  2HUF A;  4RIT A;  2BI9 A;  2VMO A;  4PFF A;  2VIA A;  2AY8 A;  2YCN A;  2JGT A;  3AEN B;  3MKJ A;  3ZRR A;  1M0O A;  2VMT A;  1LC8 A;  3A8U X;  4BHD A;  3DZZ A;  1ORD A;  4JF0 A;  1DFO A;  3COG A;  5DJ1 A;  4K2M A;  2AY9 A;  3TAT A;  1DJU A;  1H0C A;  1V2D A;  2EPJ A;  4F5J A;  1OXP A;  2VGV A;  3FDB A;  5DB5 A;  3ACZ A;  1ECX A;  2VMP A;  3ASB A;  3E77 A;  1TPL A;  3LWS A;  3K40 A;  4MY5 A;  3RCH B;  3DXV A;  4LNJ A;  4WB0 A;  3RI6 A;  2Z61 A;  1X28 A;  5J8Q A;  1LKC A;  2W7D A;  1YJS A;  1PMO A;  1CZC A;  3IF2 A;  3FQ8 A;  4JEZ A;  3JTX A;  1O61 A;  1LW4 A;  2YKU A;  3GBX A;  2BWN A;  1QJ3 A;  3MC6 C;  5M4B A;  1YIY A;  3AEN A;  4E3Q A;  1B5P A;  1TOG A;  4EFF A;  5M4D A;  1ASM A;  1OAT A;  3ELE A;  3E2F A;  2WK9 A;  3ATH A;  1D7U A;  1AKA A;  3A9Z A;  3ZZJ A;  1Y4I A;  4KAM A;  1E5F A;  3RBL A;  1SPA A;  3HBX A;  1LC5 A;  2O1B A;  3QGU A;  2Z1Z A;  4WYG A;  2GB3 A;  4I8A A;  1BQA A;  3AEJ C;  3A9Y A;  3VK3 A;  4LW2 A;  3RCH A;  4F4E A;  3BWN A;  5DX5 A;  1JS6 A;  4F5G A;  3PGY A;  1O4S A;  2OQX A;  1GC4 A;  4WYE A;  1ART A;  3WZF A;  1WKH A;  2HOY A;  4EMY A;  1PG8 A;  2VIB A;  1DGD A;  1QIS A;  4OC9 A;  1BJO B;  5BJ3 A;  2FM1 A;  2HOR A;  2HOZ A;  2JJG A;  3NU8 A;  2ZP7 A;  3WLX A;  2Z9X A;  2W7I A;  4JEX A;  3GZD A;  2R5C A;  1QIT A;  3KE3 A;  1ARS A;  1V72 A;  1CJ0 A;  1M4N A;  5G0A A;  4N0B A;  1ZOB A;  1IVR A;  3F6T A;  3FZ7 A;  4W91 A;  1AIA A;  2YKV A;  4OTL A;  4ZDP A;  4A0F A;  3FSL A;  1X29 A;  4DGT A;  2WK8 A;  1CQ8 A;  4WXF A;  4F5K A;  1GCK A;  1FC4 A;  4E77 A;  4M2M A;  3KGW A;  1ZC9 A;  4FL0 A;  1BW0 A;  1OXO A;  5E5I A;  4Y0H A;  1AY8 A;  3B1E A;  3W1J A;  4EB7 A;  2FNU A;  3CAI A;  4PIW A;  1B9H A;  1ARH A;  5TF5 A;  1ASG A;  3DU4 A;  2VGZ A;  3NUI A;  1M6S A;  1T3I A;  3R4T A;  1BJO A;  4RJ0 A;  2GSA A;  4XEW A;  2VMR A;  2W7J A;  3ISL A;  1EQB A;  2QMA A;  4BQ0 A;  2W8T A;  2BKW A;  4F5H A;  3H14 A;  2YCP A;  1AHE A;  1MLZ A;  2JIS A;  3KKI A;  3NRA A;  4R5Z A;  3USF A;  3GZC A;  3DC1 A;  1I48 A;  1S0A A;  2R0T A;  1X2A A;  1MDZ A;  2BHX A;  2DGM A;  3WKR A;  1IJI A;  2FYF A;  4UHN A;  1BJN A;  1DJ9 A;  1AJR A;  4R2N A;  1XI9 A;  2D63 A;  2Z9W A;  2EH6 A;  1RV4 A;  5EIG B;  5JAY A;  4JE5 A;  4XJO A;  3FZ6 A;  3LVM A;  5G2P A;  4LNL A;  2Z9V A;  3HT4 A;  4W1V A;  3TQX A;  3JWB A;  2ZSL A;  1LC7 A;  1AMA A;  2HUU A;  3F0H A;  3LVL B;  4IW7 A;  3FQA A;  3UWC A;  3N75 A;  1ZOD A;  1J04 A;  1G4X A;  2OKJ A;  2VLH A;  1FG3 A;  3FVU A;  4JE5 D;  2W7G A;  3BB8 A;  2QA3 A;  3GR9 A;  1AY4 A;  4QGR A;  1TOI A;  4LNM A;  1GEX A;  1GBN A;  2QBT A;  4W1W A;  2Z67 A;  3VK2 A;  1U08 A;  4U2H A;  4CVQ A;  5FT5 A;  3B1D A;  2RFV A;  1ELU A;  1IX7 A;  1N8P A;  3I16 A;  3JWA A;  4K2I A;  1B9I A;  1TAS A;  2BI5 A;  2ZUK A;  5EIG A;  4EU1 A;  4JEW A;  1V2F A;  3FDD A;  2BI2 A;  2CIN A;  3NUB A;  2BYL A;  2E7I A;  4WYC A;  2W7H A;  4RJY A;  3MAU A;  4TMR A;  5M49 A;  3GET A;  3IHJ A;  1TAR A;  1S07 A;  3LVJ A;  3EI9 A;  4F5M A;  2GMS A;  1AHG A;  1MAQ A;  1AY5 A;  1SZU A;  2EZ1 A;  1CS1 A;  1YOO A;  5FT8 A;  3MEB A;  4P7Y A;  3PJ0 A;  2JJF A;  1MAP A;  3BV0 A;  3E6G A;  5FT4 A;  2VMU A;  4A0R A;  3JW9 A;  3NYU A;  4WYA A;  4BA5 A;  1TOE A;  4ZM3 A;  4TV7 A;  4AH3 A;  3N5M A;  2AY4 A;  3FFH A;  1G4V A;  4IY7 A;  1P3W A;  1O69 A;  2WK7 A;  2W7E A;  5D95 A;  4A6R A;  2BIA A;  4AZJ A;  1IAX A;  2D64 A;  4MKK A;  4ISY A;  3L8A A;  4OT8 A;  1ARI A;  3ELP A;  4DBC A;  3AOW A;  1DTY A;  1SFF A;  3PPL A;  2V1P A;  3BCA A;  4WBT A;  4E3R A;  1AIC A;  3QBO A;  2R5C B;  1AKB A;  3QI6 A;  2WKA A;  3FCR A;  1I29 A;  3N0L A;  4KYO A;  4OBV A;  3UE8 A;  2VMZ A;  1QIR A;  2D7Y A;  4WLH A;  1CZE A;  2FQ6 A;  4XQ2 A;  2D61 A;  4IYO A;  4AO9 A;  4MKJ A;  1LW5 A;  1GC0 A;  2VI9 A;  2AY6 A;  4B98 A;  7AAT A;  1W3U A;  3BS8 A;  5HHY A;  3MC6 A;  1V2E A;  3P1T A;  4GRX A;  2FNI A;  1LK9 A;  3VAX A;  1CQ6 A;  2VYC A;  4ZSW A;  3EI8 A;  3K28 A;  1D7V A; 
#chains in the Genus database with same CATH topology
 5G4J A;  1AKC A;  1WKG A;  2X8U A;  4CBR A;  1I41 A;  5DJ9 A;  4ZAH A;  2HUI A;  2QB3 A;  1E5E A;  3DR4 A;  2YOB A;  1UU1 A;  3AEJ A;  2TPL A;  2W7K A;  4OBU A;  2O0R A;  4IX8 A;  2C44 A;  2ZYJ A;  4K05 A;  4ADC A;  4ZM4 A;  1YJY A;  2ZY2 A;  2X3L A;  4GSA A;  4GE9 A;  2VGW A;  1AHF A;  2V0Y A;  4Y0D A;  3RQ1 A;  3NDN A;  3GZD C;  3G8M A;  2Z9U A;  4ITX A;  2DGK A;  2JJE A;  3RUY A;  3TFU A;  1H1C A;  3E9K A;  1YAA A;  3LY1 A;  2GMU A;  4XJM A;  2BWP A;  1GC2 A;  1DKA A;  1CL2 A;  4GE4 A;  4MGR A;  1JF9 A;  4ATQ A;  4A6U A;  4PFN A;  2BIE A;  3VP6 A;  4EB5 A;  2FKI A;  3AEM C;  4IXO A;  3AAT A;  3PD6 B;  5K8B A;  3EZS A;  2Q7W A;  2W8U A;  2C81 A;  3QPG A;  2AY3 A;  1G7W A;  4Q31 A;  2YRI A;  3WGB A;  2NMP A;  4ADB A;  2YKY A;  3GJU A;  4XJP A;  5LH9 A;  4LC3 A;  1TAT A;  4ZDO A;  3NYT A;  2W7M A;  3MAF A;  2ORD A;  4WYF A;  3HQT A;  1ELQ A;  4Y0I A;  1ASN A;  1MDO A;  4HVK A;  2YKX A;  4AZK A;  5G09 A;  1GDE A;  4JF1 A;  9AAT A;  2W7F A;  1KKJ A;  1IX8 A;  5FT6 A;  4R8D A;  1BKG A;  3DRD A;  2OAT A;  5G4I A;  3UAK A;  3CQ6 A;  1WYU A;  3HDO A;  5EQC A;  3DXW A;  4M2K A;  2BIG A;  3BN1 A;  2E7J A;  3KGX A;  4MQR A;  3PD6 A;  4MSO A;  1C0N A;  3L44 A;  1OHY A;  2D65 A;  1PMM A;  1W7M A;  3JZL A;  5EUD A;  4BMK A;  4F5I A;  2OGE A;  3OKS A;  3LV2 A;  1VJO A;  1UKJ A;  3H7F A;  3F9T A;  4ADD A;  2EGY A;  4XJL A;  2W7L A;  1WYV B;  4W1X A;  4WD2 A;  1ASD A;  5LHA A;  3NU7 A;  2AY5 A;  1B5O A;  3A9X A;  3D6K A;  1WST A;  3PA9 A;  1VP4 A;  3T32 A;  3ECD A;  5M46 A;  3WY7 A;  3TFT A;  2VI8 A;  4GE7 A;  1OHV A;  1ASE A;  1C9C A;  3FQ7 A;  1M0N A;  2VMW A;  5E3K A;  3GSB A;  2C7T A;  3OP7 A;  1IAY A;  3RBF A;  1I43 A;  1C7G A;  3QN6 A;  1ASF A;  1DJE A;  3CQ4 A;  2CAN A;  3ZRQ A;  4WLJ A;  1EJI A;  4DQ6 A;  2BYJ A;  1IX6 A;  2X5F A;  3WX9 A;  3WCO A;  4FFC A;  5IWQ A;  1KL2 A;  3LG0 A;  4MQP A;  4A00 A;  4ITG A;  4GDY A;  4Q75 A;  3PDX A;  1WYV A;  2BI1 A;  3G0T A;  2AEV A;  3R9A A;  4L0O A;  3AEP A;  4RKC A;  3B46 A;  2JJH A;  3BCX A;  4WXB A;  1BT4 A;  1WYT B;  4IYO B;  4M2J A;  2CJH A;  2YRR A;  3FKD A;  3EI7 A;  1YJZ A;  2CB1 A;  2FN6 A;  4GEB A;  5G2Q A;  3MBB A;  1GD9 A;  1BJW A;  2C0R A;  2CJD A;  2DKB A;  2PB0 A;  3PDB B;  4K2B A;  3VOM A;  3WKS A;  2R2N A;  4ZLV A;  4JEY A;  5EUE A;  1ARG A;  1M7Y A;  2ZSM A;  5BJ4 A;  3B1C A;  2DOU A;  2CTZ A;  3PIU A;  1C7N A;  1PFF A;  3ZZK A;  1AHY A;  3EIB A;  3QHX A;  1S06 A;  4CXR A;  1W7N A;  2EZ2 A;  4U1T A;  1J32 A;  3K7Y A;  3EI6 A;  4ADE A;  3M5U A;  3NYS A;  1WYT A;  2CH1 A;  1YNU A;  3I4J A;  1GC3 A;  3DYD A;  3NTJ A;  1AHX A;  4CXQ A;  2AY2 A;  2VMX A;  2X5D A;  1N31 A;  2BWO A;  3E2Z A;  4OMA A;  5C6U A;  1EG5 A;  1SZS A;  3FD0 A;  1IUG A;  2AEU A;  2QB2 A;  3CBF A;  3PDB A;  3CQ5 A;  1GEW A;  2CJG A;  5AX8 A;  2PO3 A;  2EYQ A;  1W23 A;  5I92 A;  4W8I A;  1AAW A;  3BWN C;  1DGE A;  1D2F A;  5EUN A;  3FZ8 A;  2HOX A;  1BJ4 A;  1O62 A;  2E7U A;  2AAT A;  2ZY3 A;  1TOK A;  3FFR A;  2GQN A;  1UU2 A;  2CST A;  4RKD A;  3EUC A;  3EI5 A;  1RV3 A;  1RVY A;  3MAF B;  1S08 A;  4B9B A;  5EFS A;  2W8J A;  3FTB A;  4IXZ A;  4R5F A;  4WP0 A;  1Z3Z A;  1MLY A;  1SVV A;  3W1H A;  3HVY A;  1YIZ A;  5HXX A;  1KMJ A;  3DOD A;  3HMU A;  2VGS A;  2DGL A;  3FRK A;  4H51 A;  4JEV A;  1JG8 A;  2F8J A;  4WYD A;  4CBS A;  5HDM A;  1WYU B;  4Q76 A;  2ZC0 A;  3QM2 A;  4OCA A;  2A1V A;  1CL1 A;  2OKK A;  5F9S A;  1MGV A;  2VMV A;  3MAD A;  3GWP A;  3ZRP A;  3B8X A;  4LW4 A;  3NX3 A;  3A2B A;  3BC8 A;  1GEY A;  2QLR A;  4ZDL A;  5F8V A;  1BS0 A;  2HZP A;  4UOY A;  2VMS A;  1S09 A;  3VK4 A;  3WCN A;  3EZ1 A;  4MQQ A;  1AMQ A;  3AEM A;  4J8L A;  3E2Y A;  3WGC A;  1C7O A;  4A72 A;  3HLM A;  1ASB A;  1X0M A;  3I5T A;  1LS3 A;  4A6T A;  3DR7 A;  1AAM A;  4KXK A;  5D5S A;  1W7L A;  4PVF A;  4F5F A;  4NOG A;  2D7Z A;  4TN4 A;  2DR1 A;  4IXS A;  1IBJ A;  4P3M A;  3II0 A;  4W5K A;  2Z1Y A;  1G7X A;  1JS3 A;  1SF2 A;  4Q6R A;  2HP1 A;  4UQV A;  1B8G A;  2DKJ A;  2ZJG A;  2PB2 A;  5E4Z A;  2VGT A;  5EAA A;  4UHO A;  1ASA A;  4AOA A;  2BI3 A;  3ASA A;  3JU7 A;  4WXG A;  5EAV A;  4ZAS A;  2YHK A;  4A0G A;  3G7Q A;  2Z20 A;  2VMQ A;  4ATP A;  2O7C A;  2EO5 A;  1AMS A;  1M32 A;  8AAT A;  4XAU A;  2CFB A;  1QZ9 A;  3PAA A;  4AO4 A;  2AY7 A;  1UU0 A;  2AY1 A;  1D7R A;  1AJS B;  1VEF A;  2XBN A;  2YCT A;  3AEO A;  2ZY5 A;  2VMY A;  4OYT A;  1ASL A;  1FG7 A;  1AIB A;  4XK1 A;  4E1O A;  1Z7D A;  1D7S A;  2ZY4 A;  3AV7 A;  1BQD A;  1N2T A;  2OGA A;  1MDX A;  2XH1 A;  2W8V A;  3FVS A;  3HL2 A;  1M0P A;  2VGU A;  2HP2 A;  3AEL A;  3FVX A;  4N0W A;  4RIZ A;  4HF8 A;  4RLG A;  4J5U A;  3TCM A;  1TOJ A;  1QGN A;  1AMR A;  4A0H A;  4BA4 A;  1CQ7 A;  1ASC A;  1C4K A;  2E54 A;  2WB6 A;  1AX4 A;  2W8W A;  2CH2 A;  2R5E A;  2VMN A;  4O6Z A;  1OHW A;  1M0Q A;  1B4X A;  4ZSY A;  3BCB A;  2VLF A;  4F5L A;  3P6K A;  3EIA A;  2D66 A;  1RVU A;  4RM1 A;  1KKP A;  1QJ5 A;  3NNK A;  2G6W A;  1AJS A;  2JG2 A;  3BWO A;  1KL1 A;  3Q8N A;  1XEY A;  3W1I A;  1KMK A;  2CY8 A;  4RAE A;  3AOV A;  3LVK A;  4UHM A;  4WB0 B;  2D5Y A;  3E2Z B;  4ZWV A;  4ZWM A;  2QSR A;  1SZK A;  2HUF A;  4RIT A;  2BI9 A;  2VMO A;  4PFF A;  2VIA A;  2AY8 A;  2YCN A;  2JGT A;  3AEN B;  3MKJ A;  3ZRR A;  1M0O A;  2VMT A;  1LC8 A;  3A8U X;  4BHD A;  3DZZ A;  1ORD A;  4JF0 A;  1DFO A;  3COG A;  5DJ1 A;  4K2M A;  2AY9 A;  3TAT A;  1DJU A;  1H0C A;  1V2D A;  2EPJ A;  4F5J A;  1OXP A;  2VGV A;  3FDB A;  5DB5 A;  3ACZ A;  1ECX A;  2VMP A;  3ASB A;  3E77 A;  1TPL A;  3LWS A;  3K40 A;  4MY5 A;  3RCH B;  3DXV A;  4LNJ A;  4WB0 A;  3RI6 A;  2Z61 A;  1X28 A;  5J8Q A;  1LKC A;  2W7D A;  1YJS A;  1PMO A;  1CZC A;  3IF2 A;  3N4X A;  3FQ8 A;  4JEZ A;  2KFP A;  3JTX A;  1O61 A;  1LW4 A;  2YKU A;  3GBX A;  2BWN A;  1QJ3 A;  3MC6 C;  5M4B A;  1YIY A;  3AEN A;  4E3Q A;  1B5P A;  1TOG A;  4EFF A;  5M4D A;  1ASM A;  1OAT A;  3ELE A;  3E2F A;  2WK9 A;  3ATH A;  1D7U A;  1AKA A;  3A9Z A;  3ZZJ A;  1Y4I A;  4KAM A;  1E5F A;  3RBL A;  1SPA A;  3HBX A;  1LC5 A;  2O1B A;  3QGU A;  5KTB A;  2Z1Z A;  4WYG A;  2GB3 A;  4I8A A;  1BQA A;  3AEJ C;  3A9Y A;  3VK3 A;  4LW2 A;  3RCH A;  4F4E A;  3BWN A;  5DX5 A;  1JS6 A;  4F5G A;  3PGY A;  1O4S A;  2OQX A;  1GC4 A;  4WYE A;  1ART A;  3WZF A;  1WKH A;  2HOY A;  4EMY A;  1PG8 A;  2VIB A;  1DGD A;  1QIS A;  4OC9 A;  1BJO B;  5BJ3 A;  2FM1 A;  2HOR A;  2HOZ A;  2JJG A;  3NU8 A;  2ZP7 A;  3WLX A;  2Z9X A;  2W7I A;  4JEX A;  3GZD A;  2R5C A;  1QIT A;  3KE3 A;  1ARS A;  1V72 A;  4H63 Q;  1CJ0 A;  1M4N A;  5G0A A;  4N0B A;  1ZOB A;  1IVR A;  3F6T A;  3FZ7 A;  4W91 A;  1AIA A;  2YKV A;  4OTL A;  4ZDP A;  4A0F A;  3FSL A;  1X29 A;  4DGT A;  2WK8 A;  1CQ8 A;  4WXF A;  4F5K A;  1GCK A;  1FC4 A;  4E77 A;  4M2M A;  1KAF A;  3KGW A;  1ZC9 A;  4FL0 A;  1BW0 A;  1OXO A;  5E5I A;  4Y0H A;  1AY8 A;  3B1E A;  3W1J A;  4EB7 A;  2FNU A;  3CAI A;  4PIW A;  1B9H A;  1ARH A;  5TF5 A;  1ASG A;  3DU4 A;  3N4R A;  2VGZ A;  3NUI A;  1M6S A;  1T3I A;  3R4T A;  1BJO A;  4RJ0 A;  2GSA A;  4XEW A;  2VMR A;  2W7J A;  3ISL A;  1EQB A;  2QMA A;  4BQ0 A;  2W8T A;  2BKW A;  4F5H A;  3H14 A;  2YCP A;  1AHE A;  1MLZ A;  2JIS A;  3KKI A;  3NRA A;  4R5Z A;  3USF A;  3GZC A;  3DC1 A;  1I48 A;  1S0A A;  2R0T A;  1X2A A;  1MDZ A;  2BHX A;  2DGM A;  3WKR A;  1IJI A;  2FYF A;  4UHN A;  1BJN A;  1DJ9 A;  1AJR A;  4R2N A;  1XI9 A;  2D63 A;  2Z9W A;  2EH6 A;  1RV4 A;  5EIG B;  5JAY A;  4JE5 A;  4XJO A;  3FZ6 A;  3LVM A;  5G2P A;  4LNL A;  2Z9V A;  3HT4 A;  4W1V A;  3TQX A;  3JWB A;  2ZSL A;  1LC7 A;  1AMA A;  2HUU A;  3F0H A;  3LVL B;  4IW7 A;  3FQA A;  3UWC A;  3N75 A;  1ZOD A;  1J04 A;  1G4X A;  2OKJ A;  2VLH A;  1FG3 A;  3FVU A;  4JE5 D;  2W7G A;  3BB8 A;  2QA3 A;  3GR9 A;  1AY4 A;  4QGR A;  1TOI A;  4LNM A;  1GEX A;  1GBN A;  2QBT A;  4W1W A;  2Z67 A;  3VK2 A;  1U08 A;  4U2H A;  4CVQ A;  5FT5 A;  3B1D A;  2RFV A;  1ELU A;  1IX7 A;  1N8P A;  3I16 A;  3JWA A;  4K2I A;  1B9I A;  1TAS A;  2BI5 A;  2ZUK A;  5EIG A;  4EU1 A;  4JEW A;  1V2F A;  3FDD A;  2BI2 A;  2CIN A;  3NUB A;  2BYL A;  2E7I A;  4WYC A;  2W7H A;  3N7N A;  4RJY A;  3MAU A;  4TMR A;  5M49 A;  3H9X A;  3GET A;  3IHJ A;  1TAR A;  1S07 A;  3LVJ A;  3EI9 A;  4F5M A;  2GMS A;  1AHG A;  1MAQ A;  1AY5 A;  1SZU A;  2EZ1 A;  1CS1 A;  1YOO A;  5FT8 A;  3MEB A;  4P7Y A;  3PJ0 A;  2JJF A;  1MAP A;  3BV0 A;  3E6G A;  5FT4 A;  2VMU A;  4A0R A;  3JW9 A;  3NYU A;  4WYA A;  4BA5 A;  1TOE A;  4ZM3 A;  4TV7 A;  4AH3 A;  3N5M A;  2AY4 A;  3FFH A;  1G4V A;  4IY7 A;  1P3W A;  1O69 A;  2WK7 A;  2W7E A;  5D95 A;  2G7J A;  4A6R A;  2BIA A;  4AZJ A;  1IAX A;  2D64 A;  4MKK A;  4ISY A;  3L8A A;  4OT8 A;  1ARI A;  3ELP A;  4DBC A;  3AOW A;  1DTY A;  1SFF A;  3PPL A;  2V1P A;  3BCA A;  4WBT A;  4E3R A;  1AIC A;  3QBO A;  2R5C B;  1AKB A;  3QI6 A;  2WKA A;  3FCR A;  1I29 A;  3N0L A;  4KYO A;  4OBV A;  3UE8 A;  2VMZ A;  1QIR A;  2D7Y A;  4WLH A;  1CZE A;  2FQ6 A;  4XQ2 A;  2D61 A;  4IYO A;  4AO9 A;  3N4S A;  4MKJ A;  1LW5 A;  1GC0 A;  2VI9 A;  2AY6 A;  4B98 A;  7AAT A;  1W3U A;  3BS8 A;  5HHY A;  3MC6 A;  1V2E A;  3P1T A;  4GRX A;  2FNI A;  1LK9 A;  3VAX A;  1CQ6 A;  2VYC A;  4ZSW A;  3EI8 A;  3K28 A;  1D7V A; 
#chains in the Genus database with same CATH homology
 5G4J A;  1AKC A;  1WKG A;  2X8U A;  4CBR A;  1I41 A;  5DJ9 A;  4ZAH A;  2HUI A;  2QB3 A;  1E5E A;  3DR4 A;  2YOB A;  1UU1 A;  3AEJ A;  2TPL A;  2W7K A;  4OBU A;  2O0R A;  4IX8 A;  2C44 A;  2ZYJ A;  4K05 A;  4ADC A;  4ZM4 A;  1YJY A;  2ZY2 A;  2X3L A;  4GSA A;  4GE9 A;  2VGW A;  1AHF A;  2V0Y A;  4Y0D A;  3RQ1 A;  3NDN A;  3GZD C;  3G8M A;  2Z9U A;  4ITX A;  2DGK A;  2JJE A;  3RUY A;  3TFU A;  1H1C A;  3E9K A;  1YAA A;  3LY1 A;  2GMU A;  4XJM A;  2BWP A;  1GC2 A;  1DKA A;  1CL2 A;  4GE4 A;  4MGR A;  1JF9 A;  4ATQ A;  4A6U A;  4PFN A;  2BIE A;  3VP6 A;  4EB5 A;  2FKI A;  3AEM C;  4IXO A;  3AAT A;  3PD6 B;  5K8B A;  3EZS A;  2Q7W A;  2W8U A;  2C81 A;  3QPG A;  2AY3 A;  1G7W A;  4Q31 A;  2YRI A;  3WGB A;  2NMP A;  4ADB A;  2YKY A;  3GJU A;  4XJP A;  5LH9 A;  4LC3 A;  1TAT A;  4ZDO A;  3NYT A;  2W7M A;  3MAF A;  2ORD A;  4WYF A;  3HQT A;  1ELQ A;  4Y0I A;  1ASN A;  1MDO A;  4HVK A;  2YKX A;  4AZK A;  5G09 A;  1GDE A;  4JF1 A;  9AAT A;  2W7F A;  1KKJ A;  1IX8 A;  5FT6 A;  4R8D A;  1BKG A;  3DRD A;  2OAT A;  5G4I A;  3UAK A;  3CQ6 A;  1WYU A;  3HDO A;  5EQC A;  3DXW A;  4M2K A;  2BIG A;  3BN1 A;  2E7J A;  3KGX A;  4MQR A;  3PD6 A;  4MSO A;  1C0N A;  3L44 A;  1OHY A;  2D65 A;  1PMM A;  1W7M A;  3JZL A;  5EUD A;  4BMK A;  4F5I A;  2OGE A;  3OKS A;  3LV2 A;  1VJO A;  1UKJ A;  3H7F A;  3F9T A;  4ADD A;  2EGY A;  4XJL A;  2W7L A;  1WYV B;  4W1X A;  4WD2 A;  1ASD A;  5LHA A;  3NU7 A;  2AY5 A;  1B5O A;  3A9X A;  3D6K A;  1WST A;  3PA9 A;  1VP4 A;  3T32 A;  3ECD A;  5M46 A;  3WY7 A;  3TFT A;  2VI8 A;  4GE7 A;  1OHV A;  1ASE A;  1C9C A;  3FQ7 A;  1M0N A;  2VMW A;  5E3K A;  3GSB A;  2C7T A;  3OP7 A;  1IAY A;  3RBF A;  1I43 A;  1C7G A;  3QN6 A;  1ASF A;  1DJE A;  3CQ4 A;  2CAN A;  3ZRQ A;  4WLJ A;  1EJI A;  4DQ6 A;  2BYJ A;  1IX6 A;  2X5F A;  3WX9 A;  3WCO A;  4FFC A;  5IWQ A;  1KL2 A;  3LG0 A;  4MQP A;  4A00 A;  4ITG A;  4GDY A;  4Q75 A;  3PDX A;  1WYV A;  2BI1 A;  3G0T A;  2AEV A;  3R9A A;  4L0O A;  3AEP A;  4RKC A;  3B46 A;  2JJH A;  3BCX A;  4WXB A;  1BT4 A;  1WYT B;  4IYO B;  4M2J A;  2CJH A;  2YRR A;  3FKD A;  3EI7 A;  1YJZ A;  2CB1 A;  2FN6 A;  4GEB A;  5G2Q A;  3MBB A;  1GD9 A;  1BJW A;  2C0R A;  2CJD A;  2DKB A;  2PB0 A;  3PDB B;  4K2B A;  3VOM A;  3WKS A;  2R2N A;  4ZLV A;  4JEY A;  5EUE A;  1ARG A;  1M7Y A;  2ZSM A;  5BJ4 A;  3B1C A;  2DOU A;  2CTZ A;  3PIU A;  1C7N A;  1PFF A;  3ZZK A;  1AHY A;  3EIB A;  3QHX A;  1S06 A;  4CXR A;  1W7N A;  2EZ2 A;  4U1T A;  1J32 A;  3K7Y A;  3EI6 A;  4ADE A;  3M5U A;  3NYS A;  1WYT A;  2CH1 A;  1YNU A;  3I4J A;  1GC3 A;  3DYD A;  3NTJ A;  1AHX A;  4CXQ A;  2AY2 A;  2VMX A;  2X5D A;  1N31 A;  2BWO A;  3E2Z A;  4OMA A;  5C6U A;  1EG5 A;  1SZS A;  3FD0 A;  1IUG A;  2AEU A;  2QB2 A;  3CBF A;  3PDB A;  3CQ5 A;  1GEW A;  2CJG A;  5AX8 A;  2PO3 A;  2EYQ A;  1W23 A;  5I92 A;  4W8I A;  1AAW A;  3BWN C;  1DGE A;  1D2F A;  5EUN A;  3FZ8 A;  2HOX A;  1BJ4 A;  1O62 A;  2E7U A;  2AAT A;  2ZY3 A;  1TOK A;  3FFR A;  2GQN A;  1UU2 A;  2CST A;  4RKD A;  3EUC A;  3EI5 A;  1RV3 A;  1RVY A;  3MAF B;  1S08 A;  4B9B A;  5EFS A;  2W8J A;  3FTB A;  4IXZ A;  4R5F A;  4WP0 A;  1Z3Z A;  1MLY A;  1SVV A;  3W1H A;  3HVY A;  1YIZ A;  5HXX A;  1KMJ A;  3DOD A;  3HMU A;  2VGS A;  2DGL A;  3FRK A;  4H51 A;  4JEV A;  1JG8 A;  2F8J A;  4WYD A;  4CBS A;  5HDM A;  1WYU B;  4Q76 A;  2ZC0 A;  3QM2 A;  4OCA A;  2A1V A;  1CL1 A;  2OKK A;  5F9S A;  1MGV A;  2VMV A;  3MAD A;  3GWP A;  3ZRP A;  3B8X A;  4LW4 A;  3NX3 A;  3A2B A;  3BC8 A;  1GEY A;  2QLR A;  4ZDL A;  5F8V A;  1BS0 A;  2HZP A;  4UOY A;  2VMS A;  1S09 A;  3VK4 A;  3WCN A;  3EZ1 A;  4MQQ A;  1AMQ A;  3AEM A;  4J8L A;  3E2Y A;  3WGC A;  1C7O A;  4A72 A;  3HLM A;  1ASB A;  1X0M A;  3I5T A;  1LS3 A;  4A6T A;  3DR7 A;  1AAM A;  4KXK A;  5D5S A;  1W7L A;  4PVF A;  4F5F A;  4NOG A;  2D7Z A;  4TN4 A;  2DR1 A;  4IXS A;  1IBJ A;  4P3M A;  3II0 A;  4W5K A;  2Z1Y A;  1G7X A;  1JS3 A;  1SF2 A;  4Q6R A;  2HP1 A;  4UQV A;  1B8G A;  2DKJ A;  2ZJG A;  2PB2 A;  5E4Z A;  2VGT A;  5EAA A;  4UHO A;  1ASA A;  4AOA A;  2BI3 A;  3ASA A;  3JU7 A;  4WXG A;  5EAV A;  4ZAS A;  2YHK A;  4A0G A;  3G7Q A;  2Z20 A;  2VMQ A;  4ATP A;  2O7C A;  2EO5 A;  1AMS A;  1M32 A;  8AAT A;  4XAU A;  2CFB A;  1QZ9 A;  3PAA A;  4AO4 A;  2AY7 A;  1UU0 A;  2AY1 A;  1D7R A;  1AJS B;  1VEF A;  2XBN A;  2YCT A;  3AEO A;  2ZY5 A;  2VMY A;  4OYT A;  1ASL A;  1FG7 A;  1AIB A;  4XK1 A;  4E1O A;  1Z7D A;  1D7S A;  2ZY4 A;  3AV7 A;  1BQD A;  1N2T A;  2OGA A;  1MDX A;  2XH1 A;  2W8V A;  3FVS A;  3HL2 A;  1M0P A;  2VGU A;  2HP2 A;  3AEL A;  3FVX A;  4N0W A;  4RIZ A;  4HF8 A;  4RLG A;  4J5U A;  3TCM A;  1TOJ A;  1QGN A;  1AMR A;  4A0H A;  4BA4 A;  1CQ7 A;  1ASC A;  1C4K A;  2E54 A;  2WB6 A;  1AX4 A;  2W8W A;  2CH2 A;  2R5E A;  2VMN A;  4O6Z A;  1OHW A;  1M0Q A;  1B4X A;  4ZSY A;  3BCB A;  2VLF A;  4F5L A;  3P6K A;  3EIA A;  2D66 A;  1RVU A;  4RM1 A;  1KKP A;  1QJ5 A;  3NNK A;  2G6W A;  1AJS A;  2JG2 A;  3BWO A;  1KL1 A;  3Q8N A;  1XEY A;  3W1I A;  1KMK A;  2CY8 A;  4RAE A;  3AOV A;  3LVK A;  4UHM A;  4WB0 B;  2D5Y A;  3E2Z B;  4ZWV A;  4ZWM A;  2QSR A;  1SZK A;  2HUF A;  4RIT A;  2BI9 A;  2VMO A;  4PFF A;  2VIA A;  2AY8 A;  2YCN A;  2JGT A;  3AEN B;  3MKJ A;  3ZRR A;  1M0O A;  2VMT A;  1LC8 A;  3A8U X;  4BHD A;  3DZZ A;  1ORD A;  4JF0 A;  1DFO A;  3COG A;  5DJ1 A;  4K2M A;  2AY9 A;  3TAT A;  1DJU A;  1H0C A;  1V2D A;  2EPJ A;  4F5J A;  1OXP A;  2VGV A;  3FDB A;  5DB5 A;  3ACZ A;  1ECX A;  2VMP A;  3ASB A;  3E77 A;  1TPL A;  3LWS A;  3K40 A;  4MY5 A;  3RCH B;  3DXV A;  4LNJ A;  4WB0 A;  3RI6 A;  2Z61 A;  1X28 A;  5J8Q A;  1LKC A;  2W7D A;  1YJS A;  1PMO A;  1CZC A;  3IF2 A;  3N4X A;  3FQ8 A;  4JEZ A;  2KFP A;  3JTX A;  1O61 A;  1LW4 A;  2YKU A;  3GBX A;  2BWN A;  1QJ3 A;  3MC6 C;  5M4B A;  1YIY A;  3AEN A;  4E3Q A;  1B5P A;  1TOG A;  4EFF A;  5M4D A;  1ASM A;  1OAT A;  3ELE A;  3E2F A;  2WK9 A;  3ATH A;  1D7U A;  1AKA A;  3A9Z A;  3ZZJ A;  1Y4I A;  4KAM A;  1E5F A;  3RBL A;  1SPA A;  3HBX A;  1LC5 A;  2O1B A;  3QGU A;  5KTB A;  2Z1Z A;  4WYG A;  2GB3 A;  4I8A A;  1BQA A;  3AEJ C;  3A9Y A;  3VK3 A;  4LW2 A;  3RCH A;  4F4E A;  3BWN A;  5DX5 A;  1JS6 A;  4F5G A;  3PGY A;  1O4S A;  2OQX A;  1GC4 A;  4WYE A;  1ART A;  3WZF A;  1WKH A;  2HOY A;  4EMY A;  1PG8 A;  2VIB A;  1DGD A;  1QIS A;  4OC9 A;  1BJO B;  5BJ3 A;  2FM1 A;  2HOR A;  2HOZ A;  2JJG A;  3NU8 A;  2ZP7 A;  3WLX A;  2Z9X A;  2W7I A;  4JEX A;  3GZD A;  2R5C A;  1QIT A;  3KE3 A;  1ARS A;  1V72 A;  4H63 Q;  1CJ0 A;  1M4N A;  5G0A A;  4N0B A;  1ZOB A;  1IVR A;  3F6T A;  3FZ7 A;  4W91 A;  1AIA A;  2YKV A;  4OTL A;  4ZDP A;  4A0F A;  3FSL A;  1X29 A;  4DGT A;  2WK8 A;  1CQ8 A;  4WXF A;  4F5K A;  1GCK A;  1FC4 A;  4E77 A;  4M2M A;  3KGW A;  1ZC9 A;  4FL0 A;  1BW0 A;  1OXO A;  5E5I A;  4Y0H A;  1AY8 A;  3B1E A;  3W1J A;  4EB7 A;  2FNU A;  3CAI A;  4PIW A;  1B9H A;  1ARH A;  5TF5 A;  1ASG A;  3DU4 A;  3N4R A;  2VGZ A;  3NUI A;  1M6S A;  1T3I A;  3R4T A;  1BJO A;  4RJ0 A;  2GSA A;  4XEW A;  2VMR A;  2W7J A;  3ISL A;  1EQB A;  2QMA A;  4BQ0 A;  2W8T A;  2BKW A;  4F5H A;  3H14 A;  2YCP A;  1AHE A;  1MLZ A;  2JIS A;  3KKI A;  3NRA A;  4R5Z A;  3USF A;  3GZC A;  3DC1 A;  1I48 A;  1S0A A;  2R0T A;  1X2A A;  1MDZ A;  2BHX A;  2DGM A;  3WKR A;  1IJI A;  2FYF A;  4UHN A;  1BJN A;  1DJ9 A;  1AJR A;  4R2N A;  1XI9 A;  2D63 A;  2Z9W A;  2EH6 A;  1RV4 A;  5EIG B;  5JAY A;  4JE5 A;  4XJO A;  3FZ6 A;  3LVM A;  5G2P A;  4LNL A;  2Z9V A;  3HT4 A;  4W1V A;  3TQX A;  3JWB A;  2ZSL A;  1LC7 A;  1AMA A;  2HUU A;  3F0H A;  3LVL B;  4IW7 A;  3FQA A;  3UWC A;  3N75 A;  1ZOD A;  1J04 A;  1G4X A;  2OKJ A;  2VLH A;  1FG3 A;  3FVU A;  4JE5 D;  2W7G A;  3BB8 A;  2QA3 A;  3GR9 A;  1AY4 A;  4QGR A;  1TOI A;  4LNM A;  1GEX A;  1GBN A;  2QBT A;  4W1W A;  2Z67 A;  3VK2 A;  1U08 A;  4U2H A;  4CVQ A;  5FT5 A;  3B1D A;  2RFV A;  1ELU A;  1IX7 A;  1N8P A;  3I16 A;  3JWA A;  4K2I A;  1B9I A;  1TAS A;  2BI5 A;  2ZUK A;  5EIG A;  4EU1 A;  4JEW A;  1V2F A;  3FDD A;  2BI2 A;  2CIN A;  3NUB A;  2BYL A;  2E7I A;  4WYC A;  2W7H A;  3N7N A;  4RJY A;  3MAU A;  4TMR A;  5M49 A;  3H9X A;  3GET A;  3IHJ A;  1TAR A;  1S07 A;  3LVJ A;  3EI9 A;  4F5M A;  2GMS A;  1AHG A;  1MAQ A;  1AY5 A;  1SZU A;  2EZ1 A;  1CS1 A;  1YOO A;  5FT8 A;  3MEB A;  4P7Y A;  3PJ0 A;  2JJF A;  1MAP A;  3BV0 A;  3E6G A;  5FT4 A;  2VMU A;  4A0R A;  3JW9 A;  3NYU A;  4WYA A;  4BA5 A;  1TOE A;  4ZM3 A;  4TV7 A;  4AH3 A;  3N5M A;  2AY4 A;  3FFH A;  1G4V A;  4IY7 A;  1P3W A;  1O69 A;  2WK7 A;  2W7E A;  5D95 A;  2G7J A;  4A6R A;  2BIA A;  4AZJ A;  1IAX A;  2D64 A;  4MKK A;  4ISY A;  3L8A A;  4OT8 A;  1ARI A;  3ELP A;  4DBC A;  3AOW A;  1DTY A;  1SFF A;  3PPL A;  2V1P A;  3BCA A;  4WBT A;  4E3R A;  1AIC A;  3QBO A;  2R5C B;  1AKB A;  3QI6 A;  2WKA A;  3FCR A;  1I29 A;  3N0L A;  4KYO A;  4OBV A;  3UE8 A;  2VMZ A;  1QIR A;  2D7Y A;  4WLH A;  1CZE A;  2FQ6 A;  4XQ2 A;  2D61 A;  4IYO A;  4AO9 A;  3N4S A;  4MKJ A;  1LW5 A;  1GC0 A;  2VI9 A;  2AY6 A;  4B98 A;  7AAT A;  1W3U A;  3BS8 A;  5HHY A;  3MC6 A;  1V2E A;  3P1T A;  4GRX A;  2FNI A;  1LK9 A;  3VAX A;  1CQ6 A;  2VYC A;  4ZSW A;  3EI8 A;  3K28 A;  1D7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...