1TP7A

Crystal structure of the rna-dependent rna polymerase from human rhinovirus 16
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
460
structure length
460
Chain Sequence
b'GQIQISKHVKDVGLPSIHTPTKTKLQPSVFYDIFPGSKEPAVLTEKDPRLKVDFDSALFSKYKGNTECSLNEHIQVAVAHYSAQLATLDIDPQPIAMEDSVFGMDGLEALDLNTSAGYPYVTLGIKKKDLINNKTKDISKLKLALDKYDVDLPMITFLKDELRKKDKIAAGKTRVIEASSINDTILFRTVYGNLFSKFHLNPGVVTGCAVGCDPETFWSKIPLMLDGDCIMAFDYTNYDGSIHPIWFKALGMVLDNLSFNPTLINRLCNSKHIFKSTYYEVEGGVPSGCSGTSIFNSMINNIIIRTLVLDAYKHIDLDKLKIIAYGDDVIFSYKYKLDMEAIAKEGQKYGLTITPADKSSEFKELDYGNVTFLKRGFRQDDKYKFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLCHLMWHNGPEIYKDFETKIRSVSAGRALYIPPYELLRHEWYEKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Genome polyprotein
molecule tags Transferase
source organism Human rhinovirus 16
publication title Crystal structure of complete rhinovirus RNA polymerase suggests front loading of protein primer.
pubmed doi rcsb
total genus 125
structure length 460
sequence length 460
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1tp7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tp7A02
2UVWA 1JLEA 1S49A 4ZPCA 1I6JA 3QIPA 5KFKA 3M8QB 4MFBA 3GIKA 3Q8QB 4O4GB 4Y2AA 4LQ3A 1KLMB 5F8MA 1LWFA 2BQUA 1Z4UA 2ALZA 3DYAB 1KHWA 3OHAA 4ECUA 3BQ0A 3KOAA 5L9XA 3PZPA 5KG7A 4PUOB 4DL4A 4XPEA 3PJXA 1N56A 2O5DA 5EWGA 4NLPA 4XPCA 5KG4A 3SFGA 4WFXA 1C0UB 5CYMA 1IKWB 4Q45A 2WK4A 3BR9A 4EO8A 3CIZA 3IN5A 4IRKA 4NLDA 5EWFA 4EBEA 1RTHB 3KLHB 5KFAA 5DG9A 3PW5A 2FJWA 4R5PA 3H5XA 3H59A 4J9SA 3E01A 4TQSA 5EUHA 4EYHB 5J1EB 4ECTA 2EC0A 2B6AA 4PUOA 3DLEA 1ZETA 4JV2A 3G6YA 3LAKA 4DL6A 4ZPDA 3KK1B 4RNNA 2OPQA 4DG1A 3CJ3A 1UWBB 2IAJB 3DLGA 1JLQA 5L1LA 5HP1A 4K4TA 3NBPA 1REVB 3QZ7A 4R5PB 3IG1A 1RT6A 3DI6A 4NLOA 1W25A 3IS9A 5HLFA 5J1EA 2HMIA 5F9NA 3DLEB 1LW0B 4URGA 4RW6A 1FK9B 5C25B 5J2NA 1LWCB 1SV5A 3QZ8A 4R8UA 4ID5A 4QWEA 1QAIA 3KLVA 3DLKB 2DPJA 2VG5B 3QYYA 4J9QA 3MEDA 5K14A 4NYZA 4IRDA 2OPQB 2HWIA 4DG1B 4WXWA 2W7PA 4NRTA 4GC7A 4I2QB 5F8IA 1SH2A 2WOMB 3KJVB 3NBPB 2IC3A 4Q8EA 5J2MB 1DTQB 4RNOA 2XGPA 2R8GA 5KFPA 4YP3A 2HMIB 5C42B 3KHLA 3DMJB 5JXSA 2RF2B 3PW0A 4R8UB 1RA6A 4R0EA 4B3OB 1RTIA 3SFUA 3FFIA 1RYRA 5I3UB 4RNMA 4KSEB 2XWYA 1ZTTA 4IQXA 5F8NA 1JKHA 1HPZA 1VRUA 1T05B 5DQIA 3FDSA 3G6XA 3RBEA 2IC3B 3MECB 4K50A 4I7FB 1XR7A 2HNYA 4ZP7A 1WNEA 4KHRA 4TY8B 3V6KA 2WCXA 3KMSA 3BQ2A 1RTDA 2J6TA 3I5AA 4IG3A 1NHUA 2BR0A 2W8LA 1IKYA 4O3SA 3V4IA 2DPIA 4K4WA 2FLLA 2YNIA 3JSMA 3EPGA 2VA3A 1U09A 1RT3A 1T94A 3DM2A 1K1SA 2FVQA 2QE5A 1GX5A 3M9OB 4M95A 4O3NA 5KFXA 3H98A 4Q44A 1RAJA 1JLCB 2JEFA 3KK3B 4MK9A 2C2DA 3V6HA 2UVUA 4TLRA 3IS9B 3CJ0A 5KFGA 3BSNA 3KLIA 2W9BA 4KAIA 2JLEA 3V4IB 5I42B 5FDLB 3H5YA 5KFIA 5KG5A 4ID5B 1TL1B 3JYTB 3T5KA 2ZD1B 3MTKA 2W8KA 2AGQA 1N4LA 4ECRA 1JLGA 3I0RA 4RZRA 3CDWA 3DRRB 1MU2B 2OPPB 1DTTB 3DRSB 2I5JB 4TYAA 3EZUA 3MEGA 5L1JA 4ECXA 5J2QA 5J2MA 1DTQA 1KHVA 5KFBA 3KK3A 3ISNC 2IJNA 4MIAA 2BE2A 2XC9A 2RKIB 3BGRA 5HBMA 3LAMA 4J9RA 4LSNA 5I42A 3H40A 2BRKA 5L1IA 4H4MA 2RF2A 3MF5A 2IM2A 3GYNA 4O3OA 2V4QA 1DLOA 4KV8A 3V81A 4IR9A 3KLFA 5KFRA 1S9FA 3QIDA 1J5OA 4NRUA 1JKHB 1MU2A 2OPPA 5C5JA 3FSIA 2FJXA 1QE1A 1JLFA 3TAMB 4RW7B 1TVRA 1D0EA 3CDUA 4Q43A 2RKIA 3HVTB 2BQRA 4TY8A 1D1UA 3ITHA 2YNGA 4Y2CA 3GV7B 5KFUA 3Q8SB 1RT5B 2AU0A 4PWDA 4Y34A 5KFVA 1C1BA 4J9OA 3V81B 3OLBA 1JLBA 1S9GB 3LP1B 4KO0B 2D41A 3MR2A 1SUQB 3KLFB 5C24B 4HYKA 1S6PB 1J5OB 1S0MA 3DM2B 1QE1B 4WFYA 5KFJA 1S1TA 1FKPB 3TQ1A 5D3GB 1S1XB 3RB6A 4KE5A 4YMEA 2C2RA 1C1BB 4IG0B 4ICLA 4TY9A 2ASDA 1RT4A 4G3IA 4ZVGA 4ZVEA 3OLAA 5C24A 4EBDA 4O3QA 2ASLA 2ZKUA 2WHOA 2R2RA 3QO9B 1IKVB 2YKNA 4IH5A 4Y3CA 5DG8A 1FKOB 1BQNA 3OL7A 2BANB 4QWDA 1XR6A 3M9NB 2YNFA 3I0RB 3ICLA 4K4ZA 4ZHRB 1T03B 4RW9A 4ECWA 3OL6A 2R2SA 2GIQA 4WYWA 1S6QB 4ICLB 2AX0A 4NLRA 3PR4A 3MFHA 2C22A 1HQEA 2HAIA 4KKOB 1HMVB 1C0TB 2YNHA 4FS1A 1TL3A 3DOKB 1IKVA 2YKNB 2FJVA 1SH0A 3NAIA 1RA7A 1DLOB 1FKOA 2D7SA 1LWEA 3LP2B 3QIPB 2XCPA 4IFYA 4GC6A 3RAQA 4J9LA 5F9LA 4WE1B 4DL2A 3N6MA 3N6NA 4O44A 3UDLA 1TKTA 4NLXA 2AX1A 3TAMA 4IKAA 3LP0A 1RTJA 3QGIA 5DGBA 4KKOA 2UUWA 3T5LA 3MR5A 3PW7A 2XI2A 5KFLA 3PVXA 1S0OA 3KNAA 3IRXB 4YR3A 4Q8FA 5J2PA 1SUQA 2V0NA 1S6PA 3CDEA 5DQHA 5T14A 4ECSA 1EP4B 1N6QA 3EPIA 3E01B 2IM0A 1IM4A 1S9EB 4X2BA 1TKXB 3RBDA 1S1TB 5KFWA 1HYSB 3LP0B 3KLEB 2GC8A 4OL8A 4KHMA 2E9TA 2WONA 4K4UA 2GIRA 3I5CA 2HNZB 2F8EX 2FVSA 3CJ5A 4H4OA 4ZVFA 1HNIA 3GIJA 3IRXA 4ECQA 2UVRA 3M8QA 2OPSB 4QWAA 2R8KA 1ZTWA 3DRPA 3UR0A 3MFIA 5DLGA 1RT6B 1JLEB 3DYAA 3M9MB 1BQNB 1RT2A 2VG7A 5KFMA 1LW0A 3PR5B 1QUVA 1LWCA 1SV5B 1VRTB 4WFZA 3DLKA 3HHKA 3OSPA 3CO9A 1C0UA 5CYMB 4ZVHA 4TN2A 3DDKA 4I2PA 5CYQA 5KFHA 1HARA 5KT5A 4H4OB 4F50A 3DOLA 2ASJA 3I5BA 4I2QA 2IA6A 2C28A 1HMVA 1C0TA 2YNHB 3PW2A 3T5HA 3RB3A 3NMAA 1YVFA 4HKQA 4RW4A 1HNVB 2OPRA 1LWEB 3QGGA 4EO6A 1NHVA 5DQGA 1RTHA 3KLHA 5L1KA 2IMWP 3CWJA 1TKZB 3NAHA 3KLGB 4WE1A 1VRTA 4QPXA 1TQLA 3BSCA 2E9RX 5HROB 4I2PB 5CYQB 5KFNA 3DOLB 1UWBA 2RDIA 3KHRA 4ECZA 5HP1B 2VA2A 4J9PA 3C6UA 1R0AB 2YKMA 4ZP9A 3NL0A 3V6JA 3MR3A 3GV5B 5DLFA 1HNVA 2OPRB 5DGAA 2CKWA 4MFBB 1JLQB 4RW6B 5KT6A 4ED8A 1N5YB 1S97A 3BSOA 1QAJA 2B5JA 1CSJA 4IG3B 3DI6B 5KFOA 3FQLA 1RDRA 4K4VA 2UVVA 1TKXA 5HLFB 3MEDB 5K14B 3HKWA 4K4XA 4MIBA 4MKBA 4URQU 4ED0A 5HROA 2FVPA 1FK9A 1HYSA 3KK2B 5F8LA 3Q8PB 3PW4A 4DEZA 2WONB 4NLYA 4F4YA 2JC0A 4PQUB 3RAXA 3M8PA 1IKWA 3MR6A 2ILZA 1S0NA 4IH6A 1HNIB 1C2PA 2D3UA 2WOMA 3TVKA 4NLTA 5KFCA 2FVCA 4TYBA 3DRPB 2HNDA 1IKXA 4ZPAA 3UPFA 4B3OA 1RTIB 4ED7A 1RT2B 2VG7B 5I3UA 5KFTA 4MK8A 3LANA 3NKYA 4O3RA 5KFZA 4ZP6A 1OS5A 1VRUB 3GIMA 2QV6A 4J9NA 4ED2A 4IR1A 3RB0A 4PQUA 3MECA 3ISND 1NNDA 2R8HA 3KK1A 2XGQA 1EETB 2RDJA 4QWCA 4QWBA 5F8GA 1HPZB 1TV6A 3DRRA 1T05A 4RNFA 2I5JA 5J2QB 1RTDB 3IGNA 3E51A 2WRMA 3IG1B 4I7FA 3BQ1A 2FLNA 5KFSA 5KT4A 3BGRB 5EDWA 2CJQA 5KG0A 3FRZA 5J2NB 3CVKA 5C25A 4J9KA 4H4MB 4U7CA 3GIIA 1T3NA 4IDKB 3NGDA 2AGPA 2VG5A 4RU9A 3LALA 4ECVA 1S1WB 2OH2A 1EETA 3H4BA 4KFBB 4IFVA 5F8JA 4WZQA 1K1QA 1RT3B 4MKAA 1JLFB 4ED1A 5KFYA 3C6UB 1S1UB 1R0AA 2YKMB 4TQRA 3D28A 4RW7A 4FS2A 1SH3A 2JC1A 2E9ZA 3GV8B 4IH7A 4YR2A 5C42A 1JLCA 5FDLA 4TXSA 4ZMMA 3DMJA 5KG6A 1N5YA 4FBUA 2B5JB 1GX6A 4ZP8A 3QLHA 2JEIA 1TL1A 5KFQA 3JYTA 3FFIB 2W9BB 2ZD1A 3T1AA 5KG1A 3BJYA 2JEJA 4KFBA 3KK2A 4RW8B 3G86A 4ED6A 3D5MA 1S48A 1LW2B 3M8PB 1JLAA 3I0SB 1FKPA 2HNYB 1JLGB 1S1XA 3CJ4A 3MEEA 3KHGA 4Q0BA 1DTTA 2BQ3A 2AQ4A 3MEGB 2V9WA 2IM1A 5JUMA 2HNDB 2IM3A 1IKXB 1C1CA 3PHEA 3QLHB 1IKYB 4IG0A 2BE2B 4KBIA 1RT4B 5HBMB 4DL3A 1S10A 3H2LA 4QW8A 3BSAA 4NZ0A 2YNIB 3JSMB 4ZPBA 3Q8RB 1LW2A 1JLAB 3I0SA 3T5JA 1TVRB 2BANA 2W9CB 2JEGA 4NLUA 4JUZA 5KT7A 3KHHA 1TV6B 4MH8A 3ITHB 4H54A 4MK7A 4PWDB 1RT7A 4IOBA 3H5SA 4EEYA 4NLWA 1S6QA 2R2TA 5KFDA 2FVRA 1S9GA 1JLBB 4KO0A 4JV1A 3KLIB 4RUAA 2BRLA 4EBCA 3T19A 2AWZA 1RT5A 4IDKA 2W7OA 3IGVA 4RNHA 2ZE2B 1S1WA 2W9CA 4IFVB 5KFEA 1S4FA 3DRSA 4U6PA 3SI8A 4URSA 1RT1A 1S1UA 1RT7B 2C2EA 3H5UA 4DL7A 5D3GA 1RTJB 3OL8A 3FQKA 3OSNA 2R8JA 4NCGB 4M94A 2IJFA 1HQUB 4LSNB 2IBKA 2I1RA 1BQMA 3PJWA 5KFFA 4O4RA 3N6LA 2ZE2A 2B43A 4KV8B 4O3PA 5J2PB 4F4WA 2WTFA 4O4GA 2FLPA 4RW8A 1KLMA 2AGOA 3QO9A 1N6QB 4NLQA 5KT3A 1RT1B 1JX4A 5F8HA 4LSLB 3KLEA 3GQCA 1XR5A 3HVTA 3MEEB 3HVWA 4Q0BB 4NCGA 4ZHRA 1TP7A 4IRCA 1HQUA 2YNGB 4RW9B 3OL9A 5KG3A 4LQ9A 4YR0A 4WYLA 4NLGA 1TL3B 1BQMB 1C1CB 4K4YA 2VG6A 3LP2A 5KT2A 3LP1A 1HQEB 2R8IA 2J6UA 2OPSA 4YQWA 1MMLA 3V6DA 4KB7A 3G6VA 4NLVA 5KG2A 3DOKA 4O44B 4G1QB 2B6AB 4LSLA 2ILYA 4IFYB 4F4ZA 2V4RA 1S1VB 2UUTA 3H4DA 5DG7A 1TKTB 3CJ2A 2XCAA 3HVAA 2VG6B 4FBTA 3QGHA 2WB4A 2IAJA 3DLGB 5EWEA 3C6TB 4JV0A 4QW9A 4RUCA 1REVA 2D3ZA 4DL5A 3V6DB 3RB4A 1EP4A 1RYSA 4ED3A 4WZMA 4G1QA 4RW4B 2HWHA 3BREA 3OHBA 1TKZA 3KLGA 2YNFB 4NLSA 3KMQA 4WXOA 1S1VA 4EYIB 1LWFB 1JIHA 4ECYA 2ATLA 2J6SA 1T03A 1S9EA 2XI3A 3GILA 4XO0A 2W9AA 3KJVA 3C6TA 1N48A 1JXLA 2HNZA 4F4XA 2R2UA 3UQSA 4K4SA 3VQSA 4J9MA
chains in the Genus database with same CATH superfamily
4USKA 1S49A 1UFKA 3U7JA 1SC3B 3EX7B 1I6JA 3J7Z5 3WC2A 2UXCF 4DX8H 4O4GB 4Y2AA 2CWKA 2LCWA 4LQ3A 5CZVA 1KLMB 2CPEA 2Z2LA 3AJDA 5F8MA 1LWFA 1VHIA 4G1IA 1NM2A 3OVAA 1SI9A 2BYCA 3DYAB 2CQCA 2KXHA 3KOAA 4LF1A 4CLUA 4A8OA 4XPEA 3C14B 2FZKB 2O5DA 3UFCX 4XPCA 1CJUA 2HVHA 1T02A 1FT8A 2L9DA 4WFXA 4OV1A 4DJBA 4A8KA 1IBLJ 4EI2A 5D0HA 4LF7J 3DOMB 3IN5A 4QIEA 3W61A 3CMQA 4NLDA 2MY7A 2D3OR 1VC5A 1HNXJ 4IRKA 1RTHB 4NXMF 3QAUA 4F67A 5KAKA 5IM0A 3CCSS 1Y5NB 8AT1B 2K06A 2CPFA 2IVYA 1C4CA 3A3NB 3E01A 4D3HA 2VONA 4ECTA 5J1EB 3PG9A 5HAOA 3ZZPA 1L3SA 1SQEA 3R5AA 4JV2A 2HHVA 2VIHA 3LAKA 1Y3JA 2H4YB 1S59A 1WKLA 4BC7A 4GRSA 3KK1B 2WVDA 4KPYA 2LFVA 1IR2A 4P9SA 1HBNB 1X4EA 5L1LA 1NK9A 4K4TA 3NBPA 3PYDA 4LRBA 2IYGA 3MM9B 3DI6A 2QLWA 5HLFA 5J1EA 4CLKA 4FF3A 3VGUA 4PKDB 2ZVSA 2BJ7A 5AT1B 2QL5B 3US5A 2V8PA 4URGA 4ES1A 2GVZA 3BGFA 4OX6A 2V8GA 3TJ8A 4ID5A 3JSYA 1QAIA 1JB0C 1LEOA 2CQIA 2RHSB 1AYEA 1WC0A 3SBMA 5K14A 2ZBIA 4NYZA 2EFVA 4NRTA 4QIFA 4DV4F 4I2QB 1E6VA 5F8IA 4FYVB 4PZVA 1NUEA 3TZZA 4OYIA 4KY3A 4JI5F 2ZOFA 3MTJA 2A2DA 2VBWA 3ZC4A 4YP3A 2Y8WA 5ETRA 4DSFA 1WORA 3W9IA 2MKKA 2ERRA 4B3RJ 4USTA 2RF2B 3PW0A 4R8UB 4RWXA 2XTCA 5EGYA 2UV8G 1N34F 1Q53A 2VKZG 5HMYA 4B3OB 2GJFA 2V6AA 4FYXB 5D4LA 3X3UA 1S7HA 3I96A 2V4JB 4KSEB 1F5BA 2JSXA 5DDQC 4M5NA 1ZTTA 1NKBA 1Q5VA 5DQIA 3FDSA 2E5JA 2IRYA 2FC9A 2AJ1A 3TUZC 4I7FB 1XR7A 4W4MA 1KC8T 3NWRA 4ZP7A 1WNEA 3ILJA 4C0OC 1FERA 3OVBA 2R7SA 1X4DA 5D0GA 1B64A 3S01A 4DR4F 3I5AA 4CH7A 2AT1B 3HM9A 4MAKA 5FLXU 1IKYA 1WKKA 4LF9J 2RUGA 1CJVA 4OHVA 2BW7A 4C48A 4K4WA 3H7HB 2FLLA 2CRLA 2XHWA 2YNIA 3I55S 2UZAA 2FVQA 2QE5A 1D9DA 1GX5A 3M9OB 3R2DJ 2MKYA 2D68A 3D0GE 3MD3A 4DF8A 1KBRA 5KFXA 4N5SA 4FPIA 1IXKA 1JJ4A 4KHPF 1RAJA 1AUSL 1JLCB 4M5GA 4P72A 4W90B 3UN3A 2ZVIA 3QFHA 3V6HA 2UVUA 3QJJA 3W9HA 3IS9B 4CM2A 2AEMA 3BSNA 4KAIA 1CJVB 3CJQA 4X66J 3QJPA 1MWZA 4DBQA 1RU1A 3IFEA 4NI2B 4P52A 4CIOA 1NDKA 4ZKAA 2XY6A 3J81Y 5GAGI 1TL1B 2YXLA 3T5KA 4CLPA 2HHHJ 1ROFA 3BN4A 3IMQJ 1YKWA 3C3LA 2C3OA 3I0RA 3HT3A 4C9DA 1DTTB 5L1JA 1GTEA 1KQSR 1P6TA 2XLIA 1DTQA 5J2MA 3RB3A 1ZAWA 3V2UC 4MIAA 1LV5A 1L3TA 1HD1A 2RKIB 3BGRA 2AMCB 2CPIA 4DPYA 3SCIE 3EGZA 4DF4A 1LXNA 3TP2A 5I42A 2BRKA 2EK1A 5LSRA 2VFVA 4WIQA 3SEOA 5LOQA 2KL8A 1GAOA 1FFSB 2OSQA 1R27B 3V81A 1WC3A 3KLFA 1MROA 3ET6A 4GVLA 5E3CA 3QIDA 1AZSB 4NRUA 1KONA 2RILA 3EXYA 3AODA 5C5JA 2FJXA 1QE1A 1ZM4A 1EKRA 4N7TA 1YTYA 4BS2A 1YSJA 3TAMB 3SCLE 3MEKA 4L73A 5D4PA 3E2EA 2QJ3A 2Z2ZA 4Q43A 1M1GA 2J9DE 2RKIA 3HVTB 3N79A 1D1UA 1WHVA 2HHQA 4P6QA 4AUKA 2VPZB 2BJDA 4DR3J 5ETOA 1RT5B 2W2MP 4USHA 4DR5J 2PE8A 4MYTA 3OW2R 3V81B 5A8KB 1Y0HA 3V5RA 4HYKA 2JVRA 1AZSA 3M8YA 3A13A 2HBRB 1QE1B 2GHWA 3MAHA 2J76E 3BV8A 4LF8J 4DQRA 2G4BA 4MYUA 3NOCA 1U6ZA 3RB6A 2AP6A 2DNLA 2N4CA 2FYXA 3K8WA 4JI2F 3PV8A 4GKJJ 3PKMA 1U2CA 1RT4A 3LW5C 1SJ1A 2PO4A 4PPZA 1U2FA 2MKHA 2VICA 4PR6A 3OLAA 1O8BA 4WU3A 4O3QA 2BE9B 2VASA 4EBDA 2PEBA 3PNIA 2FZGB 1TK8A 2NQPA 2AV5A 1BQNA 4QPTA 2YWEA 1S0VA 2BANB 4QWDA 4NWBA 4DR3F 5J1NA 2YNFA 4AXIA 3GYXB 3M8ZA 4DUTA 4K4ZA 5FJ4A 2E5IA 2XMWA 1U02A 1X5TA 2BM1A 4JI3F 1VK3A 1NK6A 4NLRA 4C97A 5ETKA 3PR4A 3NWGA 1OO0B 1QTNB 1MWQA 2YNHA 4FS1A 3VVUA 1PJ5A 4DFKA 4PRFA 4M63A 3DOKB 2ZITA 1SH0A 3LP2B 1DLOB 2BX6A 3QIPB 1RHKB 4L76A 4GC6A 3MM5A 1GXTA 2EW9A 1TZ0A 3KNGA 3HI9A 5CAAA 3N6NA 2YH0A 4RL1A 2MTLA 1M0SA 1TKTA 2LDYA 3LP0A 8RUCA 4DV2F 1DQ9A 1SVDA 2F5GA 3T1YJ 3CUNA 2CPHA 3O5TB 3B54A 2HK2A 4J90A 2BKPA 3EGWB 3SSQA 3PW7A 2CZ4A 2DR9A 2UUCF 3H20A 1S0OA 3VZIA 2AF6A 1N34J 3ZFVA 2LQJA 3C8YA 3OTEA 4YR3A 4K0KJ 2RNEA 2V0NA 2ZH8A 5DQHA 4ECSA 3ZNJ1 1EP4B 1TFYA 1FEEA 1MW7A 1D3WA 3HP6A 3RBDA 1Q78A 1IBLF 2GC8A 1VI7A 1XNQJ 2XMTA 2KFZA 5DDRC 4ZA1A 2GIRA 3I5CA 2MQ8A 4B3SJ 2GCFA 3UN5A 3OXGA 3IRWP 5CHCB 4ZVOB 1O51A 2HVEA 3E3XA 4QWAA 1AT1B 5ETLA 3CDAA 2ZJRQ 2PSZA 3THTA 3DRPA 3UR0A 3SIPB 1WEZA 4PG6A 3MFIA 1VQOS 1ZTWA 5IT9Y 2K2PA 1FXLA 3FCWA 3FBEA 3VAGA 2RVJA 3LF0A 3J81U 4DSLA 5M2PA 4WFZA 3CO9A 3HX9A 3OFGA 4N8OA 5CXTA 1S4EA 2AJ0A 4I2PA 1HARA 1PKUA 2CQGA 5JMNA 3DOLA 3MPYA 2MQOA 4UOFA 4I2QA 2CYYA 4PG4A 1RAOA 2IA6A 1E6YB 1F6TA 2MQMA 2AZ1A 2YY3A 3ZZ0A 2C28A 4OZ5A 2QMUB 3CNQP 1YVFA 3TOQA 1RCXB 1PYTA 3R7NB 2RRBA 2YWHA 5F0UA 4EO6A 1LWEB 2B7BB 3OXLA 1UUJA 2HHHF 4E8UA 4ELUA 1PAUB 4EU0A 3CCLS 5K8MA 1VBXA 2YKPA 1NB7A 5LM7E 3CMAS 1K0TA 4QPXA 3F41A 5DO2A 4F26A 4I2PB 2KXNB 3ETOA 3DOLB 1QVGR 1UTAA 3VR1A 3OTOJ 2M2BA 4HVZA 3L9ZA 3TZWA 3KHRA 3K5MA 1NSQA 1CS4B 2AIRB 2IBOA 1NKCA 2YKMA 1FA0A 2YTCA 1HNZJ 1XNRJ 2F4VJ 3V6JA 1GT8A 3QWPA 4EWTA 4WFBQ 2OPRB 5DLFA 3LUYA 1JLQB 1D9FA 1N5YB 2GVZB 3BSOA 4LFBF 3MR2A 3DDIA 1R0BG 2GO9A 1UZDA 3IAM9 1TKXA 1N52B 3MEDB 3HKWA 4MIBA 5CA5A 1TK5A 1Y9OA 1SPBP 1WG5A 4JV5J 2WONB 1R0CB 3K7RA 2KHCA 3UD5A 2Y1RI 5LMNJ 1IKWA 1VQ6S 3MR6A 4XDDA 2ILZA 3HLUA 4IH6A 3ZZRA 4X62J 5A2QU 4DR5F 1CULA 1X4AA 2WOMA 1EQ0A 2OHDA 4LRCA 4HR2A 4PXEA 4BC9A 1WEYA 2GS8A 4TYBA 1VQSA 1YI2S 5H1SV 3BO2A 4PAAA 2CQHA 2W2PP 1SBRA 1RTIB 2XNQA 3KFWX 1FWLA 4ED7A 1K9MT 1FJGF 2DISA 2QSFA 4MK8A 2KKHA 3DXSX 5KFTA 4O3RA 5LMUF 3LWLA 4OYAA 4ED2A 2G1HA 2LEAA 3RB0A 4PQUA 3MECA 2R8HA 2W2NP 1EETB 1HPZB 1U0HB 1UFWA 4FNHA 3HMJG 4J7CA 2VB6A 5AE1A 3CCZA 3CC2S 4YHHF 2WRMA 3IG1B 2NREA 2HAFA 3MPDA 5B09A 2FLNA 1N5QA 1CBKA 4BBYA 2DR5A 1RTZA 3BGRB 5GAEU 2E5HA 2CJQA 4B3TJ 2NYHA 2KJWA 2OMLA 3ETMA 2YWKA 3VAFA 4WP9A 3JSRA 1T3NA 4IDKB 1XMBA 2HG4A 2LXUA 4QIGA 3NGDA 3W60A 1UA0A 1UVKA 2XZTB 2EFGA 3R5DA 3LALA 2G2YA 1VC6A 3THVA 3H4BA 1S72S 5BYRA 1SKRA 4ZVSB 3BYRA 2R7QA 2OMOA 1K1QA 1RT3B 2DHGA 5L38A 4WK1A 3NS6A 2ZH4A 3RTVA 4RW7A 1VQ5S 4DLGA 4IH7A 1GFWB 4HHJA 3K5PA 1RLDA 1FCAA 3DMJA 5KG6A 1FTRA 2DEJA 4CNYA 2P5VA 2DGQA 2B5JB 1Z2ZA 4C3KA 4YB1P 4FBUA 2PFDA 1TL5A 1TL1A 3D1OA 3QLHA 1IQTA 1Y11A 2ZD1A 4TU7A 3MMAA 1H98A 2YKQA 2MKIA 4B9TA 4J9MA 2QL7B 4CWBA 3PJ9A 4WKYA 5LXRA 1LW2B 4J5OA 1JLAA 3BYPA 2C2MB 3CJ4A 2W2QP 3KJQB 4DQQA 2I2YA 3AJ1A 4DU7A 2BQ3A 4ZIWA 2DGUA 2AQ4A 5E7OB 4ZIVA 2HRTA 2IM3A 4I0WA 1C1CA 2M5YA 3QLHB 3TZXA 3I9V9 3Q23A 2V2ZA 5IC4B 2UXDF 4N47A 1A9NB 2J8AA 4PYDA 3IAS9 3HFKA 4NZ0A 2D74B 3NCRA 3ENWA 2F8MA 4ANCA 5FLXY 4ZPBA 1JNRB 2KT3A 2Z8QA 2BDPA 3Q8RB 3FEZA 3OR2A 1KDNA 3I0SA 4B08A 1NK8A 2BANA 4NLUA 1ZAVA 4JUZA 3MAAA 3ZTOA 5LSLA 3KHHA 2A6OA 3PCOB 3QNWB 4WF9Q 1NZ8A 3WZ0A 3SSRA 4TU9A 5ETTA 3AB2B 2APOA 2OP5A 2R2TA 2KH9A 4KO0A 1NSPA 3KLIB 4RUAA 2F8HA 2GMHA 3D4JA 2P9GA 3R5JB 3DKDA 3GG1A 3T19A 2HZCA 1KFSA 5D6GA 3NGSA 4KGVB 3D2WA 2DY9A 2W01A 4RNHA 1ZM9A 2ZE2B 5A0YA 3WIUA 1IBKJ 1QSLA 1FXRA 4IFVB 4XIUA 2ATCB 1S4FA 3DRSA 3BB5A 1YQHA 3PDNA 4MMOA 1K8AT 2NUHA 2R7WA 4F0HA 3A8IA 2UUAF 4NZ7A 1SKWA 3W5XA 3OL8A 4OZ0A 1VQ9S 2R8JA 1T8EA 4JI0F 3S1TA 3UE2A 4LSNB 1D8ZA 4DX6A 4M94A 4MTPA 4NXMJ 3BKFA 1FDAA 2WVFA 3PJWA 5KFFA 2BJ8A 4U9RA 2A18A 2ZE2A 3N6LA 1U24A 3H2UB 3BF4A 5IT4A 5J2PB 1GNKA 3PKYA 3MWBA 4F4WA 2FLPA 3X1LB 1HQ2A 1KLMA 2CZ9A 2AGOA 1MNEA 1OMSA 1AUDA 4FVMA 3PW2A 3FC9A 4V19J 3SV3A 5F8HA 1QAYA 2DNOA 2KO1A 3CJKA 3GR0A 1XMQF 2ZNYA 3H42A 2Q1LA 5K5MA 2RRNA 2KJVA 4UOCA 3MEEB 1CJUB 4IRCA 1TP7A 1OM2A 4PCQA 4RW9B 2XMVA 4C8MA 4CLYA 2VG6A 3CF5Q 3LP2A 2GMJA 2R4FA 3LP1A 3T1HF 1HQEB 1L3UA 2MZSA 2OPSA 4YQWA 2ZOGA 1R31A 1MMLA 1RXOB 2R42A 2DGWA 4HH1A 4KB7A 5T7LA 3G6VA 4HDGA 1T3OA 1URRA 3NOGA 3K2YA 2UP1A 4DR7F 3DGVA 4IFYB 2J7KA 2N3OA 4F4ZA 3QRRA 4DN9A 4IQMA 1I1GA 3HDSA 3I56S 4B3SF 2KZMA 5IOLA 3QRPA 5HMZA 2KB2A 2KG0A 1VRQC 2DNRA 1WG4A 1X4FA 2OD6A 2VG6B 1Q1KA 3FUYA 1YRTA 4J9UE 5CZXA 4IO1A 3MUTP 3RB4A 3BDPA 1V6HA 1EB0A 4G3IA 4JI6F 2YX7A 4ED3A 2J0QD 3C46A 2N82B 4CP5A 1M5OC 4B3RF 2CA9A 5IV4A 5HJYA 4AQYJ 3OHBA 3D0HE 1U47A 3KLGA 1EAYC 1FWKA 4USIA 1LK7A 1V3SA 4HDHA 3C19A 2CQBA 2EBEA 2XSFA 1BMQB 4YDDB 4OHYA 2Q6CA 2VPWB 3S6EA 2CPJA 3IWXA 3P5TL 4USJC 1BWEA 1M5PC 3C6TA 2DJWA 2OD4A 2HNZA 4PXBA 3QT8A 3UQSA 5B0EA 2R2UA 2VFTA 1NJWA 1EIYB 4LRFA 2MHEA 3QQCD 4FYYB 4I67A 1K44A 2DTJA 5KFKA 2XULA 2J8SA 2BQUA 4USUA 1RWNB 4U67Q 4HACA 2ACYA 2MMYA 5KG7A 3UN2A 2FHJD 3E8OA 3PJXA 2QA2A 2VQFJ 4DL4A 4NLPA 1Q8IA 3B82A 4UTGA 3MOZA 4NMLA 5KG4A 1PG5B 2B51A 4QIVA 2ROGA 1KOOA 2Z4PA 4BWMA 2M7SA 4CLZA 1IKWB 4Q45A 2WK4A 4ZPVR 3G8TA 2YPYA 3MCOA 4EO8A 2BOAA 3R8YA 3CIZA 1B0VA 3ZXWA 5IWAF 1S77D 1LFWA 2HURA 4RLEA 1BLUA 5EWFA 4EBEA 3PW5A 1FD2A 3J7A1 4DFMA 3H5XA 1FTCA 1NH8A 3H59A 3U1LA 1R8BA 1X0PA 3M6UA 5EX0A 5EUHA 2OSRA 3B4DA 1IN0A 3RRHA 4PUOA 1RKIA 4E98A 3CCUS 5JVGQ 4DL6A 1SL0A 2MLZA 2K8GA 3EXCX 1X7VA 4UOGA 1PBUA 5GADU 4C98A 5KOXA 4DG1A 1GMWD 2K3IA 3NG8A 2V2VA 5E3AA 3ELHA 4OFZA 4ZJQA 2E1MC 3U02A 5HQLA 2AHOB 3DLGA 5HVHA 5HP1A 4MIWA 4P71A 3QZ7A 3QRQA 1REVB 1U1QA 4R5PB 3GFXA 1RT6A 4QU7A 1W25A 3IS9A 2RQMA 4Q2MA 2HMIA 2XS2A 4DZDA 5F9NA 3DLEB 2UXBF 1V3RA 1LWCB 2V50A 2AEJA 2JHEA 4OHXA 3UCUP 3TRGA 3BO3A 5GAHU 4OZJA 4OLOA 3DLKB 2DPJA 2EFNA 3QYYA 4J9QA 2UXDJ 4PWUA 1P9YA 4DG1B 2HWIA 2A6MA 1VQ7S 3TVYA 2CQ2A 2XYHB 3KJVB 4JI1J 4AL6A 2IC3A 4Q8EA 3MM7B 5J2MB 1DTQB 2XGPA 2C2KB 5GMDA 2H54B 4W92B 5KFPA 3M32B 4ED4A 1YJTA 2AYGA 3D6TB 3W65A 3W8GA 2IRUA 3MMCB 1H72C 2H3EB 1RA6A 4Y2MA 3UWTA 5A6PA 2ADCA 2E1CA 3SFUA 3FFIA 5I3UB 5HMWA 2KHDA 2UUAJ 1MROB 1DBDA 3ET6B 3L09A 3A3PB 1JKHA 1J27A 2HQCA 3CPWR 2DNPA 6FDRA 3KUGA 3M6XA 2OI2A 4R0JA 1Q0NA 3NGTA 4K50A 2PIIA 3VWSA 4X4NA 1JK9B 2R3VA 1ZYQA 5DZ6A 5CCMA 2MSTA 3CCVS 4GKJF 3KMSA 2O67A 1UP1A 3MI7X 1X4HA 3GFYA 1WOPA 1MLAA 1XK8A 2RU3A 1RTDA 2OTLS 4Z37A 1NHUA 2ZUGA 3I9ZA 1UMJA 4CI0B 2W8LA 4O3SA 3V4IA 2DPIA 3CB4A 3LTOA 2OAUA 3N0VA 2KTQA 4IO9Q 2GQ2A 1N0UA 3EPGA 2G0IA 4A8QA 1RT3A 2EC2A 4X4OA 3TAQA 2PI4A 5IV3A 2QEXS 2VBXA 4RBTA 4QCLA 1IR1A 5E0OA 1RB0A 4M95A 4CTAA 2CPDA 4I69A 4H4KC 4Y2IA 1WWHA 3POTA 5K8NA 3K5LA 4KYZA 3RYLA 4TLRA 2KYZA 2QG9B 3M30A 2B0GA 3V4IB 3KLIA 3RJMB 1HHTP 5FDLB 3DHWC 1RWMB 3VTIA 1T95A 3KTQA 4DR6J 3M7VA 4F0KA 3JYTB 4B3MJ 1FDBA 2JFDA 2AGQA 1I94F 4F2SA 3N28A 4JI4J 2FJBB 4QR2A 4TYAA 5J2QA 4HL9A 4ECXA 3IM8A 4PQAA 4KIAA 3KK3A 1XN9A 1KVJA 2G1DA 1U1OA 1YITS 3ISNC 2IJNA 3AXMA 2UUCJ 4M5DB 3BDEA 5H9FK 5HVGA 2H9ZA 3LAMA 3HPOA 3DXBA 3TAPA 4LSNA 2HHWA 5CH7B 1RABB 4OX8A 5L1IA 2CZVC 4ZLNA 1SJ4P 1G3OA 2C3UA 3G2XA 2RT3A 4B17A 4OI2A 1A6LA 1DLOA 4C7QA 1NJIT 1PBAA 1QY7A 1NH7A 2V4JA 1S9FA 3KUHA 5DJBA 4X65J 1MU2A 3W1YC 1U48A 1U6BA 1JLFA 1WSRA 3AXKA 3QSYB 4Q5VA 2MYFA 4PG7A 1TVRA 3IM9A 3JQJA 4UQTA 5D77A 4DI6A 5I4MA 2XO6A 3BO4A 3EWGA 3HZGA 4TY8A 2BQRA 2EKNA 2J9EA 4DCOB 2JH3A 5E3QA 4ITSA 2AU0A 3HFVA 4XTTA 1KLNA 3VALA 1VIXA 4J9OA 1S9GB 4P74A 1HBUB 3MMBB 2D41A 5C24B 2GAGC 3C66A 4YOEA 2FDNA 4AFFA 3W7BA 2P9EA 1R6YA 1VGYA 3F44A 2F3JA 4LF5J 4CZCA 3JB9k 3PTWA 1HR0F 1PC5A 4AT1B 2HKEA 3ILLA 3DNCA 1N32F 1B99A 1FX4A 2F4FA 3OVSA 1VLOA 2DYAA 2PA3A 1OPIA 1ICEB 1WSVA 1C1BB 1KP6A 2IPOB 4ICLA 2RHQB 1RAEB 5A8WB 2FHJA 4EZ9A 1VQLS 4WPAA 1O5JA 1HI1A 4OYZA 2MZ1A 5CD4H 2R2RA 2VQEF 1RBLA 5AXMA 1IKVB 5GAEI 2R7VA 4Y3CA 1V3ZA 1FKOB 2F9DA 2YQ3A 2MZQA 1VC0A 3W2VA 1T9VA 3HD2A 3WIVA 3M9NB 1Q7LB 3I0RB 2XYPB 4CO3A 1DURA 1T03B 1Y5IB 4FF2A 3PIOQ 2HHSA 1RHRB 2GIQA 3KG4A 3AX3A 1CG2A 1IWGA 1VLYA 3MFHA 3J7AN 4PPDA 4FYDA 1HQEA 3PYEA 1HWIA 4WWSA 2KVQE 4K2XA 2CPZA 4UUWA 3RUBL 1YBAA 5BR8F 1RWUA 2BA9A 2D69A 2H5EA 2XMAA 3A8KA 2VZ9A 2RDDA 4LR9A 6AT1B 1UEKA 2DGXA 1FKOA 3NAIA 1RA7A 1LWEA 4ERDA 2CWXA 4IFYA 2VFUA 1SJFA 2CG8A 3A8EA 3HF5A 4PABA 1BUXA 1TU0B 3CE8A 4DUYF 4NLXA 1TAQA 3MMJA 3TAMA 4IKAA 1BWVA 1RWPB 1RTJA 3L95X 5K9FA 1RAHB 1WTBA 2EXUA 4C8KA 4Z7YA 5DGBA 2XMKA 4DSJA 4GKKF 2CQDA 2HGLA 4G6VB 3T5LA 1WF2A 2VU5A 3MR5A 1APSA 3T41A 5KFLA 2O3DA 1IQZA 1KS2A 3RR7A 4Q8FA 4JB8B 4QQBA 5DM6Q 1B7YB 4CCHA 1TUVA 1YLXA 5E3RA 4AXJA 4QR1A 2LA6A 2PT0A 2G0CA 2DGVA 2DKOB 3EPIA 1KQFB 2E5LF 1TKXB 4ILRA 3M2UA 1S1TB 5KFWA 4FF1A 1HYSB 3KLEB 1SC1B 1LK5A 4OI0A 2C3YA 4K4UA 2B4UA 2HNZB 1O0PA 2DT9A 1U2RA 2K7JA 3M1VA 3VAIA 2WSCC 4H4OA 1WELA 2MQQA 4FKYA 4Y6IA 3IRXA 4CO0A 3M8QA 2DCUB 7AT1B 4LF7F 2DH8A 2FIUA 3O6QA 2R8KA 1Q79A 4NYOA 5DLGA 1RT6B 3HHEA 2Y0SD 3GJQB 4LJMA 4WK3A 1BC6A 1RT2A 2VG7A 3M2UB 3HHLD 1S99A 3PR5B 5B0GA 4ZDNA 1SV5B 1NK4A 1VRTB 1HWLA 3OV7A 4DUZF 2FJEB 4C8ZA 4ZVHA 1C0UA 1RBOB 3P96A 5CYMB 4B9UA 3MDFA 4CT9A 3DDKA 3I87A 3GYGA 4M8LA 2BABA 2V63A 5CYQA 1XTZA 5KT5A 2ASJA 2G13A 3I5BA 2Y3YA 3BBCA 1AB8A 1HMVA 1C0TA 2BACA 2LLZA 4YDXA 3WC0A 3DCAA 4WFAQ 3T5HA 2POKA 2JL9A 4A4JA 2HBYB 4B02A 4DCPB 4RW4A 7FD1A 4DV3J 1FRKA 1RI7A 1HNVB 1R6VA 3C16A 5DQGA 1NHVA 2DBBA 3KLHA 3CWJA 4JI4F 7FDRA 1EJ7L 1H7XA 1VRTA 2MY8A 3J80U 1TQLA 5HROB 2E9RX 4HT7A 2WSFC 4OX9F 1PILA 2WBRA 5I3PA 2BJ1A 1UWBA 2ZBRA 3FJ2A 3HK2A 2RDIA 2E7VA 4F3MA 3JSBA 2HLUA 1YBTA 5HP1B 3R7SB 1XMOF 3FSYA 1I94J 4HEA9 1H7WA 3NL0A 4JI0J 3MR3A 4DS5A 4ZK7M 2OEMA 1HNVA 1Q8BA 2BKOA 2Z58B 3K5OA 4MFBB 3TO8A 2CDQA 2DIUA 4ED8A 2B56A 5ETMA 4OYWA 4CYUB 1UW4A 2B5JA 1MG7A 3ADAC 1DQ8A 2ZC3A 3FQLA 3IBCB 3LGNA 5DS7A 3ULHA 1FD8A 4C0HA 5HLFB 4AL5A 3R6GB 3MMAB 3AD8C 3DLJA 3R9LA 4DFJA 3KK2B 5LMNF 1FFWB 4LBIA 1YG0A 2V8HA 2GVDB 4NLYA 4DEZA 2JC0A 3GLJA 2HEKA 1TUGB 1YJWS 1XMQJ 3J7YU 1Q95G 1NK0A 1S0NA 3JXOA 3OJSA 4ZVTB 2UV8A 4C0BA 4NLTA 3DRPB 4OYPA 3I31A 1IKXA 4RO0A 2B8QA 5B0CA 2QYCA 3M30B 2MSSA 2ZH1A 5I3UA 1W2BR 1T9YA 3LANA 1TK0A 3I6PA 3Q8YA 1N5VA 1OS5A 3D68A 1VRUB 4WCEQ 3GIMA 4IR1A 4X4PA 2NXUA 1HBOB 3OPKA 4EK2A 2ZBQA 2VODA 4HTJA 2XGQA 3KK1A 1CQNA 2XHCA 4EZ6A 2K7KA 3AFGA 1GEHA 1Z1ZA 3W9JA 3M6WA 4RX6A 1SC6A 4P7TA 2Z0GA 5J2QB 1CEZA 1RTDB 2GO8A 3AD7C 2MXYA 5IZHA 3DLLQ 4I7FA 1H2VZ 1H0HB 2CVEA 2QN6B 5KFSA 3VAJA 3W3SA 4L6V3 4HLBA 1RHMB 1HW8A 4M1KA 5D4NA 4DPTA 4F2RA 5KG0A 3FRZA 1VQ4S 1U8WA 2BXJA 3CVKA 3HT0A 2DNHA 2RIJA 3GIIA 3LQVA 1X9SA 3L4BC 3NGRA 2XM3A 1YHQS 3OD2A 2XZ2A 2YX1A 4CLTA 4RU9A 4LFBJ 2OH2A 4DFPA 2YKAA 1RJJA 5GADI 4IFVA 1F3FA 4ZCKA 1FWPA 2E1PA 1N0VC 4PWWA 2AZ3A 4WJBA 4MKAA 5MLCV 2UU9J 1RGVA 1JLFB 5BYSA 1R0AA 3C6UB 1S1UB 2HQ3A 2PN6A 1RSCA 5ETPA 2YKMB 4YY3F 3M8SA 4JV5F 1SH3A 1LNQA 2E9ZA 1LWXA 3DGPA 3GV8B 4V1Ak 4AD6A 4YR2A 2M70A 3P49B 1I5OB 5FDLA 4TXSA 2A2CA 1VBKA 3SQOP 3GFZA 5HI7A 1YIJS 3KUEA 4USMA 2BM0A 4LBHA 1N5YA 2EFQA 2JEIA 4E2FB 1RE1B 3L7OA 2X7IA 3BJYA 5E5NA 2JEJA 4KFBA 3D7SB 4C4WA 4RW8B 2NZ4A 3PX4A 4ED6A 2CFXA 3D5MA 1S48A 2O01C 4FNIA 4DPUA 2QMXA 4UZCA 3L3CA 1DRZA 3BH6B 1JLGB 3AA9A 4S0MA 3PYGA 1CULB 1NPRA 2H1YA 2VUGA 2XEXA 3FSXA 3MEGB 2V9WA 2IM1A 4DR6F 2A3JA 2VOPA 3DLHA 1QUPA 4QJVA 2ZOMA 2YWWA 4IG0A 1HHSA 2BE2B 3KXDA 4ES2A 4MKYA 4GKKJ 3ILOA 4CO2A 1IVZA 4DR1F 3H2LA 2Z2MA 2W2OP 2ZWOA 2YNIB 4OZ1A 2HQGA 2NXEA 2W4DA 1WC4A 3UO0A 5CCLA 4B9SA 1DJ0A 4I64A 3K59A 1BD6A 5E41A 2YPZA 2W9CB 4NASA 1TAUA 1P1TA 2RSQA 1NSAA 4MH8A 2DNMA 1PCAA 2KRBA 2H51B 2CNOB 2DY1A 4P7VA 2GMLA 2BKNA 5IC6B 1CJKA 4DV7F 2HVZA 2P9CA 2Z2YB 5KFDA 1H74A 1S9GA 3PIPQ 4JV1A 3KYLA 4EBCA 1HI8A 2GJ2A 1RT5A 2HS4A 3W62A 4JI6J 2ZJPQ 1ZS6A 4N77A 1T0TV 2BOPA 1VHFA 4DV5J 4EUVA 1S57A 2A10A 1NEEA 2VC1A 2J5AA 1FESA 1V5VA 4U7UK 2V1SA 5KFEA 2W9CA 2RS2A 3CMES 4BWJA 3D66A 3UDEA 3NY0A 4U6PA 4URSA 1RT7B 3H5UA 4X4UA 1CJKB 4DL7A 2MHNA 2E7XA 4OZ2A 4OYBA 5A8WA 1FNXH 3FQKA 1UVMA 4FXDA 4V19X 2IRXA 5CYJA 1HQUB 3CSKA 2QA4S 2I1RA 2MEWA 2IBKA 2FZCB 2U1AA 1BQMA 1SC4B 4OJHA 2X1AA 1M5SA 3TI0A 3CO0P 4O4RA 2JJ4D 2MPUA 4KV8B 1PO6A 3PY8A 3HHLB 3RAMA 2WTFA 1SQGA 1VJQA 2Y1JA 2QT7A 3F0NA 2G9OA 2ZFHA 4DX5A 4NLQA 5KT3A 1RT1B 3WBZA 1VISA 1P9QC 4LSLB 1GQEA 2HPUA 3JQMA 4CM0A 3ISZA 3N01A 3KLEA 3GQCA 1K73T 1UVLA 3MOJB 3BH7B 4Q0BB 4ALZA 3AT1B 4F04B 2XMJA 2LU1A 1BQMB 1WKJA 1XERA 4A48A 2DRAA 2DNQA 3EGVA 1Q8LA 5KT2A 5B08A 3Q83A 4WTYA 4ZLPA 1SIWB 2R8IA 2XTDA 2HQFA 2HHTA 4YFUA 5HATA 4Z2XA 4NLVA 5AE2A 4ZPWR 3DOKA 5F0WA 2L9WA 1N54B 2CVIA 2B6AB 2ZNZA 2I9SA 4LSLA 5C2CA 3W66A 2HRYA 2V4RA 1F3VA 2PD1A 3D1QA 1NDLA 5DG7A 1MMDA 1TKTB 2X3GA 3DRYA 4TU8A 3D67A 4DV5F 3ENAA 1H2TZ 1LKZA 2GGPB 1S79A 1UKUA 1ZPWX 2FQQB 3QGHA 4QW9A 1NDCA 3A1YG 3DLGB 2NPFA 5EWEA 2DR8A 4RUCA 4DL5A 1SJRA 2ZM6F 1RYSA 1WACA 4B3MF 1UJ6A 1T11A 3R7BB 1U1PA 2ZDOA 3ZTSA 4WXOA 2DGSA 3BZQA 4OI3A 3NCPA 1LWFB 2XZDB 2KM8C 4EYIB 1U4BA 4PEOA 1ZM2A 2LEPA 3QT5A 4DDFA 1Y5LB 4ES3A 3AA8A 4P2FA 5DDOC 3GILA 1LQ9A 3MM8B 4XO0A 5K20B 4CO4A 5C7PA 3GZ7A 3FCVA 2W9AA 1VQMS 4DSEA 1RHQB 2FTRA 3MM7A 4WIIA 4F4XA 4HHHA 4DS4A 2VOOA 1JLEA 2HFNA 3GWCA 4TVAB 4ZPCA 1KOHA 5AXNA 2D3O1 3QIPA 2B9EA 4MFBA 2B9WA 1REGX 3EDRB 1KRPA 3AAWB 1VQPS 4B9MA 1CQMA 2ALZA 2X51A 4J9VA 1KHWA 5KOWA 3R97A 5L9XA 3ZZYA 2AD9A 2G2OA 1L5UA 1FJ7A 1I51B 3EE3A 1XMOJ 1N56A 4JP8A 5EWGA 3PRVA 2VBZA 2ZUAA 1HBMA 4NA3A 3SFGA 2MLYA 3BR9A 5HANA 4DN0A 2YWFA 2P6TA 1X31C 2DIVA 2C3MA 3KLHB 5KFAA 2FJWA 4LF5F 2ROEA 4UY8T 3KDOA 1YJ7A 2Y1LB 4F8RA 1XBWA 4J9SA 3I32A 3CCRS 4DV0F 1N32J 2IVMA 4OYMA 1R8PA 1ZETA 2AYMA 1HWJA 3IR7B 4CRJA 2AJ4A 1HIYA 3FZBA 1YK9A 1X5PA 3MZIA 3FNNA 4ILMA 5FIIA 3WX4A 1RWVB 1QTMA 3MAQA 3EJMA 4LVOP 5LXYA 1P1LA 3IP0A 2MJUA 4ZJLA 3CGIA 4ZLLA 2LECA 1UZHA 4ETXA 2QFIA 2DH7A 2D1CA 1RHJB 2K3KA 2EFOA 2LP4A 2HLTA 2UXBJ 4WBFA 3LPYA 3ZO7A 1QM9A 1SQFA 2BW2A 4FP9A 2RQKA 4RW6A 1FK9B 3UVJA 3D6HB 3GSDA 3U27A 5C25B 3CCES 5J2NA 4R8UA 3GJRB 4Y28C 2L08A 4FZVA 3MEDA 2DVIA 1HKAA 1S5ZA 1G6BA 1RUSA 1HHQA 3R3TA 4WXWA 2W7PA 2VJUA 3DDNA 4ATNA 2M4MA 1KNZA 1E6YA 4RUHA 1CLFA 4C11B 2HS0A 3NBPB 4DSKA 3IO1A 3M05A 2R7TA 2CJYB 1VS3A 3GU0A 4RNOA 1CC8A 2OUGA 1KQGB 1RU2A 2H5JB 2ZHAA 3M4XA 4NMXA 2NYIA 1X4CA 3GPAA 3OR1A 1AXQA 2LQ9A 4OJ3A 5JXSA 3M8RA 2YVSA 3CC4S 1TMJA 1RTIA 1RYRA 4RNMA 4YHHJ 2XWYA 2DEIA 4CH0S 5F8NA 4ZVRB 4NA1A 3AQOA 4DV6J 3G6XA 3FMWA 3RBEA 1BGXT 1NKEA 3MECB 2QYGA 5D15A 2BEFA 3IA0A 3TYTA 4PXCA 1WUUA 4TY8B 3IWLA 1VQYA 3V6KA 4N76A 3G87A 3BQ2A 2LXFA 4E0DA 2J6TA 3BEGB 1RWWB 4IG3A 5AXKA 2N4DA 2K1RA 3Q8VA 2R7RA 4ZJOA 4X64J 4MT1A 1HNXF 2KT2A 3QT6A 1Q16B 1U09A 3DM2A 4U8VA 2E7WA 2ZH9A 5HVFA 2Y9HA 2KXFA 1S7IA 4O3NA 2XB2D 2V2KA 3GIRA 4C6AA 3H98A 2QRRA 2W25A 2QLXA 3BPSP 4Q44A 2L3MA 1XNQF 2M0GB 1OSCA 1FRMA 3KG1A 4MK9A 4DR1J 2C2DA 3RW7A 1UVJA 2HHXA 3HO1A 5BR8J 1WJ9A 3CJ0A 5KFGA 4CNZA 2NUUG 2B4OA 2EKYA 2CNLB 3O2IA 3H5YA 5I42B 2YBVA 4HI1A 1RADB 5KFIA 5KG5A 1IBMF 1HW9A 4JYAF 2OKQA 2MQLA 3PX6A 2ZD1B 2W8KA 1ZA2B 1UAWA 4ECRA 1FE0A 1JLGA 2NPIA 1WDDA 1D9AA 4LVNP 3UCGA 3CDWA 3DRRB 2OPPB 4CLFA 1KTQA 1N5SA 4X64F 1Q81T 2DR7A 3PRBA 3MEGA 5EN1A 2HZAA 3W2WB 2F1FA 2RQ4A 2ZM6J 2DD8S 4UUXA 3U1NA 2BE2A 2XC9A 1V5IB 2AKWB 3M32A 4USVA 4J9RA 4C8LA 4RR5A 4KH0B 4H4MA 3MMCA 1S6UA 3MF5A 4Q2LA 1O6XA 4NL5A 2CPXA 4OQJA 2IM2A 3GYNA 4O3OA 2V4QA 3A8JA 3GJSB 2WW8A 3GSIA 4KV8A 2GZOA 3C15A 1YDLA 4OJ1A 1J5OA 4DV2J 1JKHB 4UZBA 1S12A 2OPPA 5HJXA 2F7VA 4U96A 3FRYA 3W2WA 1EQMA 2DHXA 1WHYA 4RW7B 1Z2LA 4FVCA 4I6WA 5EX3A 3ITHA 3UW1A 3DLBA 4Y2CA 2FJDB 5KFUA 3FZ2A 1NMEB 5KFVA 5B0FA 5AJ3J 4FXWA 2KU7A 1JNZB 4DPXA 3OLBA 4KO0B 1GMWA 1A0OB 1HNZF 3KLFB 2MKCA 1S6PB 2VFRA 1J5OB 3OT9A 4DX7A 1QSSA 3DN9A 4LF9F 1WOSA 1N36F 1WD6A 1H2UX 1NO8A 5KFJA 3NNCA 1S1TA 1FKPB 5D3GB 2PMZD 1S1XB 4ZS6A 4OZLA 4I1TA 3T6JA 5K8PA 2CXEA 3MUVP 1QVFR 4G1PA 5HK4A 1QD1A 2YQ0A 2C2RA 1NDPA 2GIFA 2GGPA 2ASDA 1KSPA 1T7PA 4HT5A 4ELTA 4ENOA 4DV3F 1UJ5A 4WP3A 2WHOA 4NOHA 3L7PA 4CLWA 4DZ6A 3QO9B 5CABA 1XQIA 2YKNA 3TEGA 5A8RA 4DCJB 5DG8A 3NGUA 3OUYA 4JI8J 1M5KC 3OL7A 2XMUA 4NXNJ 3HHDA 1TR0A 3M2VA 4X66F 1XR6A 3HVRA 1ZBTA 3ICLA 3T1HJ 5H9EK 8ATCB 2DR6A 4JI5J 2DNZA 3NS7B 4I56A 2R2SA 3MM8A 4WYWA 2J0WA 2AX0A 4ZCLA 1NK5A 3O44A 4DR7J 2HAIA 4KKOB 4YB7A 1HMVB 1C0TB 3TANA 5IT9U 5ETQA 3VGVA 2XWXA 1VQKS 1NU4A 1TL3A 2B3TB 2YKNB 2RE1A 4YB6A 3CCTA 2P6SA 2MQPA 2UUBJ 2Q3PA 4IR9A 2GX8A 2D7SA 4RU2A 2IDLA 2LQBA 3RAQA 3EGNA 4J9LA 5F9LA 4WE1B 3HHNB 3N6MA 3GONA 5IQQA 5F3TA 2OTJS 5GMEA 2AX1A 1Y7PA 2XG8A 1H73A 1MN9A 2KM8B 3QJLA 1FRXA 3I4PA 2E1AA 3D3BJ 3MPVA 4ZPTR 5BJRA 3QGIA 3ENVA 4RKUC 3TNVA 4KKOA 3THPA 4AQYF 1RAIB 4O23A 2XLJA 4LFAF 2B9YA 3M2RA 2XI2A 1R8HA 2HFZA 1F1BB 4KGMA 3CC7S 4F3OA 4NXNF 3CIMA 3NEKA 3R5CA 4X84A 2FY8A 1FXDA 4L72B 5M2UA 5J2PA 1SUQA 4DPWA 3EDQB 3QFWA 1U1RA 2BMBA 3QWUA 4IUFA 3PM9A 2J9CA 2RQCA 3MM6A 2LA4A 2P8IA 3E01B 3HJFA 1S9EB 4X2BA 2I38A 2CAJA 2QIFA 4OHWA 3UNGC 2I8EA 3LP0B 3TX8A 1TELA 4KHMA 5IXUA 4OL8A 4FXVA 4CO5A 2CJKA 4GVBA 1HFEL 1NPPA 2GVDA 3HFZB 2LYVA 2XSJA 3ENQA 2E44A 2EI5A 4KRWA 4RWWA 1K0VA 1RAGB 3AOAA 4ZVFA 3JAMY 3GIJA 2GFFA 4K8RA 4B9LA 2VDIA 4LMZA 1HBNA 2OPSB 3IBFB 3N4WA 3EVOA 3UI3A 1VBYA 1KQKA 3IR5B 1PYSB 2H48B 2WSEC 3DYAA 2RAQA 4R25A 4ZVPB 5HO4A 3M9MB 3H90A 3R2CJ 3KG0A 5KFMA 3EUNA 3H2VE 2JZ5A 3J81j 5DZ7A 4DUZJ 2AYEA 4L74A 5DDPC 2ZBPA 4M5JA 1AW0A 4EMDA 1R3NA 2P2CB 2Q79A 3UR3C 4HACB 2DXDA 4TN2A 5ETNA 2RU9A 4F50A 1FFGB 4QU6A 1NJZA 3AX5A 2V9KA 5CQGA 2E1RA 3SQGB 3UDVA 3NMAA 5K8OA 1X9MA 4ID8A 4PG8A 3MPWA 5MAOA 2NXJA 2OPRA 1R8AA 3CCQS 4N41A 2IMWP 3SSSA 2CQ4A 1M5VC 3KLGB 3NAHA 1U8SA 1KN6A 1FE4A 3D54A 2DHAA 2YQ1A 3GR1A 3GG0A 1KVKA 1Q5YA 2J7UA 3I82A 1QJHA 3K17A 3MPUB 5B0BA 1U1MA 1UVIA 1N5TA 2OLWA 3CJ8A 5KFNA 1NAQA 1RZMA 2CJAA 4CO1A 4A8MP 2VA2A 3FGVA 2XS7A 4YS2A 3C6UA 2W7AA 1R0AB 2ZKTA 5JJBA 3GCWP 3VGSA 2JNJA 2CKWA 2LKZA 4OX7A 2ZEJA 4RW6B 3PACA 3RG6A 4BHQA 1SJ3P 1Y3KA 4IG3B 2V8VA 1PGZA 3PYFA 4CLSA 1RDRA 2WW4A 5KFOA 3CTRA 5K14B 1NJXA 3EVWA 4URQU 4MKBA 1G1XA 4ZN3A 4A8YA 4DXLA 1HYSA 5F8LA 3AB4B 1E6VB 2GW8A 3VHQA 2FY1A 4PQUB 2DGTA 3RAXA 1X5SA 1BE4A 1XIQA 4F36A 5LT5A 3GB0A 2OELA 3F56A 1HNIB 4ER8A 1D09B 3HSJA 5LJ3Y 2BBEA 6FD1A 2HNDA 3BKTA 2VH7A 2XO7A 4F25A 1UVNA 1WC5A 4ZPAA 1VQNS 1F5AA 4B3OA 1RT2B 2VG7B 2IVFB 4AE5A 4OI4A 1FNOA 1PIEA 3ILIA 3G8SA 5KFZA 3HD1A 3MUMP 4J9NA 2QV6A 4PWDB 4LUBA 3P6YC 4LIRA 1NNDA 5IFMA 2N7CA 2MJNA 1UJ4A 2RDJA 4QWBA 3CEDA 1TV6A 3DRRA 4O0IA 5BXIA 1GMUA 2HGNA 4ZVQB 1T05A 2NR0A 1ULRA 2EFPA 4KH1B 3IGNA 1DY3A 4C3MA 3E51A 1UL3A 5DETA 2XY7A 1VYAA 2AEFA 3CCJS 1GTHA 1IWAA 3M8WA 1ACMB 5GMKa 9RUBA 3SCJE 2CJ9A 2CADA 2FPHX 4H4MB 1X4GA 3N5BA 4J9KA 1HL6A 1T9TA 2QSWA 1HLWA 2FUG9 2VG5A 2B7CB 4RPFA 3T1YF 3R1HA 4X4VA 1EETA 3D6MB 2V34A 3Q8UA 4DR4J 3N5FA 4WZQA 3ONQA 2E5GA 2B4PA 4TKTA 3EYZA 4TQRA 3D28A 2OO4A 3M6VA 4FS2A 1S76D 2JC1A 4K7QA 2VPXB 3OTOF 4WP8A 3SZ2A 2OEJA 3WX8A 3BN7A 5C42A 4DQSA 3ZZOA 1ITPA 4QR0A 4ZP8A 2DGOA 2KVIA 1HA1A 1OSDA 3FFIB 2W9BB 2OJ3A 1U7LA 3T1AA 5KG1A 2B9XA 5A8KA 2X1GA 3TZYA 3KK2A 2IIHA 3S8SA 2JLFA 1KR4A 3OR2B 3M8PB 3IC1A 4OLPA 3HSDA 3I0SB 4OYXA 1FKPA 2HNYB 2E66A 2U2FA 1S1XA 3FEYB 3MAAB 4KGZB 1X0FA 1EZZB 4Q0BA 3JQKA 3T6BA 4D3GA 3PFEA 3JAMU 1IKXB 3PHEA 5L8RC 2AJ2A 2MZRA 4CQ1A 3UD3P 1RT4B 1X5OA 3FBFA 5HBMB 4LFCJ 1X60A 4DL3A 1T9WA 1S10A 1N36J 4PXDA 4QW8A 3BSAA 3TVZA 3JSMB 2LU2A 2BVZA 4PG5A 4OZ3A 2XY5A 1LW2A 2DNKA 2RJZA 1JLAB 2QLFB 3TUIC 4X4RA 3T5JA 4CTAB 5KT7A 3D0IE 1N33F 4K5SA 3K5NA 3ITHB 3EVMA 3POTB 4DV7J 3P3DA 4MK7A 4EEYA 1L3KA 3H5SA 1CVJA 4NLWA 2A0FB 4L3KA 3PHTA 2WZ1A 4B9NA 3SYZA 2AW0A 2BRLA 3RBXA 3EZOA 3W64A 2IHR1 3UD4P 1W2IA 3FKBA 2DHSA 3IGVA 4GO7X 2BV3A 1MN7A 1AFIA 1S1WA 1TL4A 2HGMA 2VBYA 1F5CA 1OQ3A 2G0JA 2R7XA 1ELOA 1IM6A 4IOCQ 3CT9A 3FBCA 1S1UA 4KR0B 5ETSA 3VZHA 1MWYA 4UF4A 1YJRA 5HSPA 2C2EA 3TA1A 3CCWA 1P27B 2DRBA 4CLLA 3PO4A 2NSBA 3DGPB 2KFNA 3OSNA 5HL7Q 2GAHC 2IJFA 3AH6A 4QZVB 4LF8F 3M2RB 1Y00A 3PO5A 1RKJA 3T3FA 1U1NA 4Z7CA 5ITHA 2NSCA 2MDAA 3LOUA 1OYEA 2CJXB 4O4GA 1RAFB 4C8YA 1ZM3A 3BR8A 2KN4A 4RW8A 4A8FA 5T7LB 4X62F 2VF3A 3OFHA 2HVIA 1CPZA 1WHXA 1WC1A 2NXCA 1JX4A 1WI8A 3R6LB 3Q0AA 4L75A 2KRRA 1XR5A 1OY9A 3AHPA 1B4SA 3HVWA 4DMZA 2KDOA 2VC0A 3MGJA 4CDIA 4ZHRA 2KG1A 2PGCA 2YNGB 1WF1A 3OL9A 2LEBA 2HIQA 4NLGA 1TL3B 4HTIA 2MLXA 2X3DA 1D8YA 4K4YA 2XS5A 2WBMA 3MXHP 1Y10A 3MD1A 3Q2SC 1HBUA 3MMBA 4MJKA 4DR2J 2OEKA 2J6UA 2EVZA 2QL9B 5IM0B 2DXEA 3CD7A 1F2HA 4NZ6A 2RB7A 4G1QB 4LBPA 3CJKB 2ILYA 5L39A 1WG1A 2EPIA 1P8GA 2RD5C 3J7YI 2UUTA 4DLEA 1FO1A 3NGKA 3H4DA 3CJTA 1U6FA 2DCLA 2HHPA 4C8NA 2VKRA 1PJ6A 3S7RA 3VGTA 1YJ9S 1HWUA 1SL1A 3R5BA 3UDCA 2XCAA 1DAXA 1BHNA 2CJBA 2UVVA 1W7WA 3C6TB 3CULA 1Q7YT 2D3ZA 2CG4A 4IYQA 1EP4A 2EG1A 1AFJA 1TKDA 4WZMA 3MM6B 4G1QA 1RK8A 2HWHA 1IBMJ 3CJSA 5H9FJ 3BBBA 1NXIA 3HJVA 4ECYA 4OV6A 2ATLA 2J6SA 1JIHA 5E3PA 2QFJA 2QX0A 1T03A 1U0SA 3KJNB 4DR2F 4ILLA 2HFOA 2XI3A 3Q89A 3SMZA 3Q2TC 3OFEA 4K0KF 5RUBA 4UY85 2Y1IA 1URNA 5FD1A 4WU2A 3H8YA 2VL1A 1ZOTA 2BJ3A 2Z56B 4X4TA 4K4SA 1NB2A 1OJ4A 2W4CA 3VQSA 2WB1D 2UVWA 2VPYB 1T9XA 3G82B 3GFHA 1UA1A 2IFXA 3KDNA 3M8QB 3O3LA 2QGFB 3Q8QB 3GIKA 1UWAA 2C2NA 3AQPA 1NJYA 4TNOA 4QBUA 1Z4UA 4ECUA 4ANDA 4WFNQ 3OHAA 3BQ0A 1KTVA 2CQ3A 3PZPA 4PUOB 1TUWA 4ZLJA 1QAXA 4ZN1A 4JI3J 3NXZA 5LL6d 4DV1F 4DPOA 1LXJA 1C0UB 3DU6A 4MKVA 5CYMA 4X65F 2DNYA 1F60B 2ROPA 4BCAA 3LO3A 4A46A 2JFKA 3FMBA 2MGZB 5DG9A 2QA4G 4OX9J 4R5PA 4NCBA 3BPDA 2JWNA 2PI5A 4LF4J 3LGMA 4UQGA 4LREA 4TQSA 4GMKA 4EYHB 4JYAJ 2ZWPA 2EC0A 2B6AA 2M52A 3JTNA 2DITA 3BM7A 3DLEA 3N9UC 1F0XA 3G6YA 2LQ5A 4QIWD 2ZHBA 4ZCIA 4ZPDA 1RQ0A 1RWKB 4LF2A 2HBZB 4AL7A 1R7IA 3M1VB 3RR8A 2OPQA 3CJ3A 1UWBB 2IA0A 2LVWA 4BLGA 5HQ8A 2IAJB 2L41A 1JLQA 2H4WB 3K57A 1UW9A 4WKRA 3IG1A 4KQZA 4U7UD 4DOZA 2DXFA 4NLOA 2CIMA 4U8YA 2F40A 3OXFA 2JOQA 1FEHA 1LW0B 2LDIA 3AJ2A 3CDBA 2EEYA 1SV5A 3K89A 5G0RA 3QZ8A 1TL7B 3BGOP 3TJ9A 4QWEA 3KLVA 1N33J 1FHTA 1U1LA 2VG5B 4EFAC 4DQPA 4LFCF 3FVYA 3TUJC 4YUDA 4IRDA 2OPQB 3QGPA 1KVIA 1ZZNA 2I0XA 2XNRA 2WOMB 1SH2A 1X9WA 3O8WA 4FPRA 2LXIA 3SCKE 1B3TA 3OTCA 2Q6BA 3JS9A 2VJVA 1GXLA 1B0TA 1OPZA 1LFPA 2DHHA 2R8GA 2HMIB 1UEUA 1GMVA 3NRBA 5C42B 3KHLA 4X4SA 2CQPA 2QLBB 3DMJB 1ZPVA 1YRUA 3VAKA 3VQTA 2GJIA 4R0EA 1NBEB 1WHWA 2J9DA 3RU0A 2DH9A 3GTYX 2Y0BB 4ZITA 1MMNA 2C2OB 4DWIA 4LFAJ 4IQXA 1C4AA 1HPZA 1U0HA 2M88A 2VDHA 1VRUA 4O0NA 2ZH3A 4DV0J 5H9EJ 1T05B 1FRJA 2IC3B 2L48A 2L9NA 5GVQA 1BY9A 2HNYA 4XK8C 3DOMA 4LF4F 4DHVA 1F9HA 2BJEA 1W26A 3BS9A 4KHRA 4RJVA 4QYZK 2WCXA 4M5IA 2IY5B 2HS3A 4L3NA 2KYXA 3L7UA 2M8DB 1HNWF 2UU9F 1FJGJ 4YEAA 2BR0A 4LRDA 2NLWA 4ED5A 3DFEA 2DO4A 3P5BP 1KEKA 2FLOA 5IWAJ 1N8RT 1M5HA 4YY3J 1U26A 1X8DA 2QTWA 1UEVA 1TFWA 1VFJA 4F02A 3JSMA 3EM1A 2VA3A 1B7FA 1T94A 3H0PA 4M5LA 2BJ9A 3LH2S 1K1SA 3Q24A 1NSKL 4NYPA 4B3TF 3FBBA 3GMGA 3RZAA 1FX2A 1Y4ZB 4RBVA 1NPKA 3LA0A 1XNRF 2F4VF 1PC4A 5IT0A 4UT4A 3B78A 2JEFA 4F3QA 2GHPA 2PFFB 1JJHA 3LGHA 3CD5A 3W8PA 3KK3B 1ZZFA 1NLKL 3PRDA 1FJEB 4FF4A 2N7YA 3VAHA 2NS1B 4KHPJ 5B0DA 1KFDA 4DQIA 2W9BA 2R7UA 1FRLA 2GA7A 2F65A 2JLEA 3G71S 4WTOB 2ZH2A 4A8WA 2XYGB 3TR5A 4G65A 5LJ5Y 5GAGU 5J1PA 3ZZZA 4ID5B 1FVSA 3IWNC 1X4BA 3LPEA 2XQCA 4F4KA 3CW2C 3MTKA 1QDUB 4DV6F 1U25A 1YX2A 3CD0A 5DRKA 1N4LA 4JI2J 1OY8A 2H65B 4RZRA 3B8HA 2MZJA 1MU2B 3HKZD 3NS5A 3DRSB 1XC9A 2I5JB 3EZUA 3R27A 4TLQA 1KHVA 2DRDA 3HSZA 5KFBA 4P73A 1TTHB 5G4DA 9ATCB 3QBCA 1V9OA 1VDHA 2HFUA 3PFOA 5HBMA 1F2GA 4XDCA 3H40A 3DHXA 4OJGA 1NK7A 2RF2A 5A6WA 3DU5A 2QO3A 4JI7F 1WTFA 2V69A 1WEXA 1R43A 3OTBA 1EKSA 5U47A 4DUYJ 1JJ2R 1FF2A 2KI2A 1G2EA 5KFRA 2WVBA 5HMXA 3FSIA 3TX0A 5B0AA 3ZTRA 4DU8A 2FGOA 1UPPA 1UPMB 2IDEA 3CDUA 4F7VA 1D0EA 2HWTA 4M5DA 4OHZA 3MURP 2AJFE 1WC6A 4P10A 2YNGA 5D4OA 3GV7B 2J0SD 3Q8SB 4PWDA 4Y34A 1C1BA 4OYOA 1VMBA 3IBWA 1RHUB 1JLBA 3HSGA 3LP1B 3VCDA 3ZZUA 5E2QA 1SIZA 1SUQB 4YB5A 5ETVA 5A0YB 1JXEA 4OMFG 1FKAF 4M5KA 1UETA 4KC5A 3QMQA 3DM2B 1S0MA 1OYDA 1RCOB 2IMOA 2ZHOA 3MCMA 4WFYA 1RWXB 4ETZA 2FB0A 1RBAA 4USWA 3TWZA 3TQ1A 2KZZA 2PC6A 4KE5A 4GVBB 1CJTB 1PAEX 4YMEA 2DO0A 1UFLA 4CH1A 1B70B 2XZWA 4F0MA 4IG0B 4TY9A 1RACB 2Q43A 1ZH5A 4J37A 2V5HG 4ZVGA 4ZVEA 2HSEB 2HRUA 5C24A 3FEXB 2VV5A 3QATA 2ZKUA 3RRKA 2ASLA 4K5RA 3TARA 4IH5A 4CT8A 1HD0A 4DL0C 4JI1F 2Y8YA 1H6KX 3BKUA 4KPCA 4J91A 2V94A 4M5MA 2R7OA 2PEHA 2CNKB 4ZHRB 2IJRA 1Q8KA 3AD9C 4RW9A 4ECWA 3OL6A 2XLKA 2X1FA 2BE7D 2ZC4A 3HULA 4ICLB 1S6QB 1SKUB 2OFGX 2C22A 3AWRA 3OTDA 3A3OB 3Q86A 3H25A 1AROP 3W5ZA 2YWGA 4JBCA 1IKVA 3A4TA 3D3CJ 3TW0A 2FJVA 2ZZNA 1AA1B 2XCPA 3MCSA 2Z57B 1RWOB 4QYZJ 2HK3A 3NP5A 3C15B 4RNNA 2AYBA 2J0XA 2XMMA 2JRSA 3IXQA 4O44A 3U1MA 4DL2A 2LQ8A 3UDLA 2ADBA 1VK8A 2HBQB 1YZ6A 5D0RA 1BQXA 3CJRA 2CDRB 2HIYA 2EG2A 4A8XA 1IJFB 1OIAA 4OI6A 4Q7AA 2UUWA 2FD2A 4A8SA 2QA1A 4LIWA 3PVXA 3KNAA 1RP5A 3IRXB 4FYWB 4W98A 2O1PA 1S6PA 3CDEA 5T14A 1IBKF 1FJCA 2PDAA 1M1HA 1NCLA 3KKFA 1N6QA 2D9OA 2NXNA 2IM0A 2ZH5A 1IJEB 1IM4A 2V1TA 4DV1J 1WOOA 2RS8A 2E9TA 2W4PA 2WONA 3BGLA 4FN5A 3G6ES 1GH8A 5I3QA 2F8EX 1VJWA 2ABYA 3EICA 4OIXA 1YJUA 2D9PA 2H5IB 5LSOA 2FVSA 3CJ5A 4ECQA 1HNIA 4ZCMA 4C2MA 1DZ5A 2UVRA 2ALYB 2O66A 5A8RB 1JLEB 2N3LA 3OUYB 3C16B 1BQNB 1XEZA 1FNMA 4KGXB 1EARA 1LW0A 1QUVA 2QMWA 2V68A 5HQMA 1LWCA 1FRHA 2VQEJ 4ELVA 5EHHA 1YJVA 3DLKA 3HHKA 3OSPA 1KWMA 5KFHA 5KTQA 3HHLC 4H4OB 3O1LA 2HFVA 4HI2A 1HBMB 2MGZA 4LT6A 2YNHB 2M9KA 2G2ZA 1FI4A 1H38A 4OZNA 4HKQA 1SL2A 1JMTA 5C2GA 5DM7Q 3SDEA 2ZJQQ 3QGGA 5L1KA 3NNAA 1RTHA 3MCNA 2V2QA 1TKZB 3WHIA 5F3ZA 4WE1A 4N8NA 2CQ1A 2CUYA 1OY6A 3P8BB 2GHVC 3BSCA 3QSIA 2ZH7A 2BUNA 5LMUJ 5CYQB 4GO5X 3UCZP 2WAQD 2E29A 4EGLA 1U49A 4OI1A 2ZDPA 4M5HA 4ECZA 1GK8A 4J9PA 2CNNB 3GJTB 3FK4A 4ZP9A 3WDOA 3GE9A 3GV5B 2I6WA 4I68A 3SDEB 3TEHB 2CQ0A 1XJWB 4ANEA 5DGAA 2EK6A 2CPYA 5KT6A 1S97A 1QAJA 3RW6A 1Q82T 1CSJA 1SCJB 1LOUA 3DI6B 1HR0J 4LF6F 4K4VA 2QC3A 2Z30B 1DHMA 2ZH6A 5HROA 4K4XA 2QLJB 5BYQA 4ED0A 2FVPA 1FK9A 2M3DA 2W1BA 1YZ7A 4P2SA 3HCXA 3TA2A 3Q8PB 4K2JA 3PW4A 4DSIA 1J5EF 4F4YA 2W24A 3UNYA 1G7CB 3TUPA 1KKHA 3M8PA 1QSYA 1F9FA 1EX8A 3DC2A 4I6AA 3ZNUA 4Y00A 2HZVA 3PXGa 1HNWJ 1C2PA 2D3UA 1FVQA 2GQCA 2OGUA 5T41A 3TVKA 4C11A 2MZTA 5KFCA 1RISA 2FVCA 4CYUA 4NA2A 2XBPA 3UPFA 1SJQA 2HQIA 1VR6A 1PJ7A 5A76A 3KJFB 3W5YA 1L3VA 3T9NA 2ZZMA 4IOAQ 3NKYA 4ZP6A 5THWA 3GCXP 2GNKA 4LRAA 3TA0A 3ZZTA 3ZTPA 5HN0A 4K59A 3CCMS 3ISND 3G96A 4N56A 2HQDA 4QWCA 5F8GA 3VAMA 3D6FB 3OFFA 2C42A 4RNFA 2I5JA 2YH1A 3SQGA 2VD3A 3GP9A 4DV4J 2XTJP 3MM9A 1FDNA 4X4QA 3BQ1A 4B9VA 2J7WA 4KT0C 1VCTA 2FJAB 5KT4A 5EDWA 2DNGA 4FKXA 4Y0FA 3J7ZT 1HI0P 5J2NB 1J2VA 3UVJB 5C25A 1JXVA 1S6OA 1YWXA 2LMIA 4A47A 4U7CA 2K1RB 3QAEA 3BGUA 3LWMA 1HBOA 3AOCA 2AGPA 1CC7A 4ECVA 1R89A 1S1WB 4LR7A 2WVCA 4KFBB 5D0EA 5F8JA 2YX4A 1HWKA 3RRGA 2KT5A 2M8HA 3VF0B 1CS4A 2ZZTA 5D78A 2NCKL 5KFYA 5B7WA 2R9LA 4ED1A 2MB0B 2RMLA 2HFSA 4JI7J 3D1HA 3QPIA 1WI6A 3OR1B 3PEJA 1JLCA 1U1KA 2E5LJ 3OQ2A 4ZMMA 1M90T 4QOTA 4ZOSA 3EMTA 1GX6A 2Q66A 4KTQA 2X1BA 5KFQA 3TJAA 5GAHI 3JYTA 1G4CA 4Y65A 3AOBA 1FRIA 3J80Y 3OJUA 4JI8F 1VQ8S 4YN3B 3G86A 4UOHA 3NCQA 3QT7A 3R5GA 4NE9C 3CXCR 2ASYA 3HXMA 4HH0A 1SXLA 2RRAA 3MEEA 2MQNA 3BBFA 3KHGA 1DTTA 3MR7A 4P75A 3B4MA 5JUMA 2HNDB 1NZAA 3K8VA 1IKYB 4KBIA 3DRXA 4RUBA 2DB1A 3PX0A 1DFDA 1A7GE 2FHOB 3NLCA 3G4SS 1YGYA 4I6YA 2V8DA 3RBZA 1IBCB 4XAKA 1JQGA 4I4BA 2COLA 3W63A 1R8CA 3JTOA 3W2VB 2HW3A 3NMRA 1TVRB 5SUHA 2MKSA 2JEGA 5AJ3F 2PMHA 1TV6B 5IS2A 1JWWA 1B0PA 2ACMA 3KWMA 4F4AA 4H54A 1F9EB 3K58A 1RT7A 4IOBA 3RGIA 3F73A 3Q22A 2EBGA 4BDPA 1DQAA 1IUJA 1S6QA 4UW2A 2JLGA 1JLBB 3PEHA 4P2XA 2FVRA 2JDJA 1ZAXA 4NX9A 3IR6B 1EHWA 1XWLA 2AWZA 2BZ2A 2YKOA 3AX2A 2PA8D 4NI2A 4IDKA 1NHKL 3MHYA 2JVOA 2W7OA 4H4KA 2F9JA 5CD4A 3SXLA 5AE3A 2HYIB 1U45A 1CJTA 3SI8A 1RT1A 1PSDA 3I4HX 1Q4RA 1QLNA 3B6BA 1RAAB 5D3GA 1RTJB 3SV4A 3C2PA 4KJIA 1KD1T 4NEZA 4NCGB 4NPOA 2A1BA 1SKSA 2FHKA 2C3PA 2V67A 4KGKA 3VVTA 4Y2KA 1Q86T 1K47A 3D9BA 1GXUA 2JX2A 3G82A 2DNNA 1WF0A 2NZCA 2B43A 4O3PA 1FDDA 3OBIA 2MKJA 2B4VA 5D8HB 5L46A 1N88A 1RLCL 3ZTQA 2C2ZB 3QO9A 2XTEA 4FDFA 4ZVUB 5M2RA 1VBZA 1N6QB 2FHMA 1UCNA 1M1KT 2OIHA 2ZBCA 3AY0A 1YBUA 3G8QA 1WDTA 3JTPA 3HVTA 2UUBF 2RUSA 4NCGA 2IYIA 4P2MA 1HQUA 3V4MA 4AYBD 5KG3A 1PYOB 4LQ9A 1H3DA 4WYLA 4JOUA 4YR0A 5SZTA 1C1CB 1VOMA 1SB6A 2FGCA 3HHLA 1T9UA 2GQQA 3G9CA 3V6DA 2HVDA 5ADZA 5KG2A 4O44B 2VQFF 1J5EJ 3TQEA 3WQPA 4LSZB 3MM5B 4HHUA 4C3LA 1I3OB 2KFYA 1S1VB 2RH3A 4PYAA 2PMWA 1DARA 1YJNS 4LF6J 5IQ6A 2UXCJ 3P45B 1MSWD 1JJCB 1TMMA 2OFHX 5L9NA 1BXNA 2C1EB 3CJ2A 3HVAA 5F41A 4FBTA 5A2QY 2AJQA 2WB4A 2IAJA 4JV0A 1REVA 3V6DB 3HZEA 2GV1A 2EWHA 1NRKA 3T9ZA 4RW4B 2B8PA 2VFSA 3VV2B 1VIOA 3FCHA 3BREA 5E33A 4C8OA 1YRXA 2DK2A 3R1LA 3M2VB 3P4UB 4LR8A 1IR0A 1TKZA 2YNFB 4NLSA 3KMQA 5G0RB 1S1VA 5JVHQ 4NCAA 3K0JA 1TL7A 2HHUA 4RBUA 4U95A 1OWXA 3CD6S 3NNHA 1S9EA 2FC8A 1ZA1B 3A12A 3C14A 4NEYA 3EZ5A 2VHGA 2SXLA 3KJVA 4QYRA 5AXLA 2F63A 2QZ8A 2XSJB 1OQ6A 1N48A 1JXLA 4GC7A 2WVEA
chains in the Genus database with same CATH topology
1S49A 3EX7B 3U7JA 1I6JA 3WC2A 3J7Z5 2UXCF 4DX8H 4O4GB 4Y2AA 4X4RA 2LCWA 4LQ3A 5CZVA 1KLMB 2CPEA 2Z2LA 3OVAA 5F8MA 1LWFA 3BO4A 4G1IA 1SI9A 2BYCA 3DYAB 2CQCA 2KXHA 3KOAA 4A8OA 4XPEA 2O5DA 3UFCX 4XPCA 2HVHA 1T02A 1FT8A 2L9DA 4WFXA 4OV1A 4DJBA 4A8KA 2D3OR 3IN5A 4QIEA 1VC5A 4NLDA 4IRKA 2MY7A 1RTHB 4NXMF 3QAUA 4F67A 5KAKA 5IM0A 3CCSS 1Y5NB 2CPFA 2IVYA 1C4CA 3E01A 4D3HA 2VONA 4ECTA 5J1EB 3ZZPA 1L3SA 1SQEA 3R5AA 4JV2A 2HHVA 3LAKA 1Y3JA 4BC7A 3KK1B 4KPYA 1HBNB 1X4EA 5L1LA 1NK9A 4K4TA 3NBPA 2IYGA 3MM9B 3DI6A 2QLWA 5HLFA 5J1EA 4FF3A 4PKDB 2ZVSA 4URGA 3US5A 4ES1A 3BGFA 4OX6A 2V8GA 4ID5A 3JSYA 1QAIA 1JB0C 2CQIA 5K14A 2ZBIA 4NYZA 2EFVA 4NRTA 4QIFA 4DV4F 4I2QB 1E6VA 5F8IA 4JI5F 2ZOFA 3MTJA 2A2DA 2VBWA 3ZC4A 4YP3A 4DSFA 2ERRA 2MKKA 2RF2B 3PW0A 4R8UB 4RWXA 2XTCA 5EGYA 2UV8G 1N34F 1Q53A 2VKZG 5HMYA 4B3OB 5D4LA 3X3UA 1S7HA 3I96A 2V4JB 4KSEB 1F5BA 2JSXA 5DDQC 1ZTTA 1NKBA 5DQIA 3FDSA 2E5JA 2IRYA 2FC9A 2AJ1A 3TUZC 4I7FB 1XR7A 1KC8T 4ZP7A 1WNEA 4C0OC 1FERA 3OVBA 2R7SA 1X4DA 1B64A 3S01A 4DR4F 3I5AA 4CH7A 3HM9A 4MAKA 1IKYA 2RUGA 4OHVA 4K4WA 2FLLA 2CRLA 2XHWA 2YNIA 3I55S 2UZAA 2FVQA 2QE5A 1D9DA 1GX5A 3M9OB 2D68A 3D0GE 3MD3A 4DF8A 5KFXA 4N5SA 1IXKA 1JJ4A 4KHPF 1RAJA 1JLCB 4W90B 3V6HA 2UVUA 3QJJA 3IS9B 3BSNA 4KAIA 3QJPA 1MWZA 4DBQA 3IFEA 4CIOA 2XY6A 4ZKAA 1S76D 3J81Y 5GAGI 1TL1B 3T5KA 1ROFA 3BN4A 3C3LA 2C3OA 3I0RA 3HT3A 4C9DA 1DTTB 5L1JA 1GTEA 1KQSR 1P6TA 2XLIA 1DTQA 5J2MA 1ZAWA 3V2UC 4MIAA 1LV5A 1L3TA 1HD1A 2RKIB 3BGRA 2CPIA 3SCIE 3EGZA 4DF4A 1LXNA 3TP2A 5I42A 2BRKA 2EK1A 5LSRA 2VFVA 3SEOA 1GAOA 2OSQA 1R27B 3V81A 3KLFA 1MROA 5E3CA 3QIDA 2RILA 4NRUA 1KONA 3EXYA 5C5JA 2FJXA 1QE1A 1ZM4A 1YTYA 4BS2A 1YSJA 3TAMB 3SCLE 3MEKA 5D4PA 3E2EA 4Q43A 2J9DE 2RKIA 3HVTB 3N79A 1D1UA 1WHVA 2HHQA 4P6QA 4AUKA 2VPZB 2BJDA 1RT5B 4USHA 2PE8A 4MYTA 3OW2R 3V81B 5A8KB 1Y0HA 3V5RA 4HYKA 2JVRA 3MAHA 1QE1B 2GHWA 2J76E 4DQRA 2G4BA 4MYUA 1U6ZA 3RB6A 2AP6A