1TPGA

F1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKSCEIDTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-PLASMINOGEN ACTIVATOR F1-G
publication title The solution structure and backbone dynamics of the fibronectin type I and epidermal growth factor-like pair of modules of tissue-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Plasminogen activation
total genus 9
structure length 91
sequence length 91
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1995-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1tpgA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1tpgA01
1TPNA 1ZAQA 1Z6CA 2CG6A 2JRAA 1G2MB 1AUTL 1IQNL 2RLPA 1FFMA 1WHEA 3ZYGA 4MMZB 3KL6B 3LIWB 1UZKA 2QY0A 2XC0L 2NPRA 1UOTP 3N8XA 3M37L 2Y7ZB 2BOXA 1RFNB 3N8YB 2XRDA 4YT7L 2OYUP 2UWLB 3OLTA 2MHPA 1YUKB 3ASIA 4Z6AL 3BPSE 3IJEB 1K36A 1XFEA 1IGXA 1HX2A 1NQLB 2I9BA 2WG4B 4JZDL 5FDQA 1IQFL 5EGMB 1MD7A 2P16L 2VWNL 5JB8E 2ADXA 1FJSL 2XRBA 1N7DA 2W81A 3EJHA 4Z0LA 3GCWE 1JBUL 1XDTR 2J95B 3N8ZA 2XBYL 1IQIL 4MMYB 1ATBA 1Z92B 3HPTA 2D1JB 3LTFB 5COXA 3HO5A 2W2PE 1H04P 4FM5A 2WPME 2GD4A 4XBMA 5I0QB 3ERBA 2YRAA 1IP0A 3KCGL 4BTTA 5IKVA 4ISIL 5IKRA 4JYUL 1A3PA 3BT2A 1EPJA 5CKNA 3L89M 2YGOA 3N8WB 5CKQA 2BZ6L 1ADXA 3KQEL 5K0HB 2WPLE 1J9CL 4BTUA 3K9XA 3TZIA 3MQEA 2RL0A 1C1ZA 1FAXL 4D0FA 3HS6A 1SRZA 3ENSA 1GHQB 4Z0KB 3HS5A 4LOTA 3CENL 2EI7B 1IVOC 4IGDA 4MUCA 2J38B 4ZXXL 1GK5A 4X8SL 1G2LB 4K12A 1ATDA 4C16A 4ZXYL 1CKLA 1G1QA 2P94L 3R62A 1KSNB 2K2SB 4AYEA 1COUA 2XWBF 3R05A 3LAQA 4Y79B 1IQEL 3Q7DA 1EBVA 1IJQA 3M36L 1HRFA 3ZD1A 1LPGA 3PGHA 1XKBA 3HO3A 4YZUB 3IU3I 2MCYA 1EPHA 2VH6B 4LOSA 4MMXB 4Y76B 3FBYA 3TVJA 4RUTA 2J34B 3Q3KB 3GXEA 4RS0A 2PHBB 1E5GA 1M1XB 2VJ3A 2OYEP 1KLIL 2MGPA 1NWVA 3SW0X 4XLWA 4ZHAB 3C9AC 2RHPA 3OEDC 3T5OA 2WFXB 1WU1B 4E1GA 2RLQA 3LN1A 2P3FN 1E8BA 4CSYA 2FLGA 1G4FA 2DDUA 2F9BL 1QO6A 1YUFA 1LY2A 2B5ID 1DDXA 3TGFA 4AYIA 1ZJKA 4TGFA 4YT6L 2Q1JB 3O8EB 3FCSB 4RRZA 2UWPB 1HAEA 3KQCL 1DIYA 4Y7BB 1HFHA 1F0RB 2WPKE 3MQLA 2Y5FL 2J2UB 1ATAA 2B7DL 1L3YA 2ERJA 2EHFA 4OTJA 4DJZA 4ONTD 1GKNA 3OLUA 1APOA 4X8UL 1SS2A 3N8YA 4YNXA 3ZRZA 5E8DA 2YGPA 4A7IA 4M11A 1UZPA 1Z6EL 2RA0L 1CCFA 2KL7A 2XWJI 2Y82B 5JBCE 2VVVL 3F1SB 1TLEA 2P3TA 4M10A 1LPKA 4Y71B 2P3UA 2W80A 2Y7XB 2WG3C 1ATEA 1HCGB 5HYPA 4X8VL 1EPGA 3HO4A 4LORA 2VWLL 2EI6B 2Y5GL 3TK5B 1IOXA 1HAFA 1Q3XA 2P3FL 1PPQA 4BDXA 4NG9L 1NZIA 1G1TA 1P0SL 5JVYA 3GISX 1TPMA 3SW2A 1HT8A 3KK6A 1PRHA 1EGFA 2WPJE 3LTGD 1V3XB 2M74A 4X8TL 3F6UL 2YBYA 1Q4GA 1MQ5L 1NFUB 4WJG2 4F4OC 1W7XL 1XKAL 3MDLA 1F7MA 5I46L 3H5CB 4O02B 1CX2A 1O5DL 2FLRL 1HFIA 5IKTA 2BOHA 3N8WA 3SOBB 2XBVL 1H2PP 3CS7L 3FFGL 2BQ6A 2VWMK 1FBRA 2CKUA 4FXGG 1SZBA 2W2NE 1NFWB 2Y5HL 4CUFA 2WPIE 1KLOA 1EPIA 1CVWL 5F19A 1CQEA 4O1ZA 4BXSA 2MCZA 1C5MF 3M7PA 1I0UA 3CA7A 5KIRA 2A55A 1HREA 4A5WB 4ISHL 2Y81B 3V65B 4RRWA 3NT1A 2P93L 3GCXE 2BZMA 3KQDL 1CVUA 3ZD2A 4CUDA 1BF9A 1L5GB 2W86A 4BXWA 4D0EA 4JYVL 1JL9A 2BOUA 4JZEL 1EAIC 3KRKA 3LN0A 2XC5L 3LC5B 2KRIA 2FLBL 2CJIB 2J94B 3IX0A 1PFXL 1U67A 1MQ6L 2W3IB 3TH3L 1OK1A 3P5BL 4B2SA 2W2QE 1VVCA 1GPZA 4CUEA 2O39C 5JBAE 1VVDA 2G00L 1OB1C 2PUQL 1TPGA 3EGFA 1PGEA 2J4IB 3HS7A 3LC3B 3KQBL 1OK9A 2KV4A 4Y6DB 2KMSA 1EMOA 1FE2A 2AYLA 1HT5A 2XC4L 2FZZL 1IQLL 4ZH8B 6COXA 2TGFA 1QFKL 4OTYA 3GOVA 2IZ3A 3DEMA 1LMJA 1DQBA 1N1IA 2RKZA 1NPEB 2IZ4A 1X7AL 1CEJA 1EZQB 1E88A 5CISA 3IITB 1U8CB 3NJPC 2H9EL 4XL1A 1OK2A 1IQKL 2KB9A 1H03P 3ZYJB 2XQWC 1EMNA 5IKQA 1IGZA 5JB9E 3KZJA 3V64C 5CKMA 2P95L 2W2OE 4AYMA 1NT0A 2G7IA 2XBXL 5L30L 1LPZA 4NGAL 4D90A 1YGCL 2V8EA 3QCWA 1TOZA 2CG7A 2BQWA 3ZYIB 2PR3B 2VWOL 1HJ7A 1HCCA 1KIGL 3OP8A 3NFPI 1EQHA 4JZFL 1LQDA 2JKHL 4RRXA 4BTIA 4PH9A 2P26A 1HZ8A 2WFTA 2EI8B 3POYA 4Y7AB 4NA9L 1K37A 3NTBA 1DX5I 1YUGA 3ELAL 3U73A 5FO8C 1KLJL 4J38B 4AYDA 1EQGA 1GKGA 2MGRA 2EC3A 2Y38A 1YO8A 1G4GA 1UZQA 1FSBA 2WYGB 2W26B 3INBC 1FAKL 1CCVA 4ZH1D 3QH0A 4AQTA 3RJ3D 1URKA 1OJYA 5KN5C 5JW1A 3TK6B 1PTHA 1U5MA 2RNLA 3N8VA 1IQGL 1MD8A 2BMGA 1OJVA 2UWNA 4RRYA 3TBDA 2BOKL 2VVCK 2VH0B 1IQJL 1F0SB 3OXUD 3BT1A 1NFXB 1W8BL 1APQA 4BDWA 1O9AA 1OK3A 2JGXA 1IQML 3QMOA 1QUBA 5JPMG 4LMFA 4KKDA 2WPHE 1IOEL 3NTGA 5HYTB 1QGBA 1JV2B 1UZJA 2XBWL 2LOJA 1G1SA 5L2YL 1MOXC 2P28B 2BO2A 5HYUB 4G1MB 2VVUL 2I9AA 2W3KB 4JHSA 1PXXA 2WYJB 5HZPB 1B9WA 5F1AA 5L2ZL 3U7UG 1H2QP 5JBBE 3KXVA 1ELVA 2RKYA 2BQ7A 1OJWA 1DVAL 3CALA 4PZ5A 2W2ME 2JGWA 1P9JA 1G1RA 4ZAEB 3SOVA 1F7EA 2WIIC 4B2RA 3SOQA 1IQHL 2FD6A 3CFWA 3RR3A 1WHFA 2K2TA 2UWOB 1NFYB 4COXA 5JVZA 2Y80B 1FF7A
chains in the Genus database with same CATH superfamily
1TPNA 1ZAQA 1Z6CA 2CG6A 2JRAA 1G2MB 1AUTL 1IQNL 2RLPA 1FFMA 1WHEA 3ZYGA 4MMZB 3KL6B 3LIWB 1UZKA 2QY0A 2XC0L 2YGQA 2NPRA 1UOTP 3N8XA 3M37L 2Y7ZB 2BOXA 1RFNB 1LK9A 3N8YB 2XRDA 4YT7L 2OYUP 2UWLB 3OLTA 2MHPA 1YUKB 3ASIA 4Z6AL 3BPSE 3IJEB 1K36A 1XFEA 1IGXA 1HX2A 1NQLB 2I9BA 2WG4B 4JZDL 5FDQA 1IQFL 5EGMB 1MD7A 2P16L 2VWNL 5JB8E 2ADXA 1FJSL 2XRBA 1N7DA 2W81A 3EJHA 4Z0LA 3GCWE 1JBUL 1XDTR 1QIUA 2J95B 3VWOA 3N8ZA 2XBYL 1IQIL 4MMYB 1ATBA 1Z92B 3HPTA 2D1JB 3LTFB 3FGRA 5COXA 3HO5A 3NJAA 2W2PE 1H04P 4FM5A 2WPME 2GD4A 4XBMA 5I0QB 3ERBA 2YRAA 1IP0A 3KCGL 4BTTA 5IKVA 4ISIL 5IKRA 4JYUL 1A3PA 3BT2A 1EPJA 5CKNA 3L89M 2YGOA 3N8WB 5CKQA 2BZ6L 1ADXA 3KQEL 5K0HB 2WPLE 1J9CL 4BTUA 3K9XA 3TZIA 3MQEA 2RL0A 1C1ZA 1FAXL 4D0FA 3HS6A 1SRZA 3ENSA 1GHQB 4Z0KB 3HS5A 4LOTA 3CENL 2EI7B 1IVOC 4IGDA 4MUCA 2J38B 4ZXXL 1GK5A 4X8SL 1G2LB 4K12A 1ATDA 4C16A 4ZXYL 1CKLA 1G1QA 2P94L 3R62A 1KSNB 2K2SB 4AYEA 1COUA 2XWBF 3R05A 3LAQA 4Y79B 1IQEL 3Q7DA 1EBVA 1IJQA 3M36L 2Y8TA 1HRFA 3ZD1A 1LPGA 3PGHA 1XKBA 3HO3A 4YZUB 3IU3I 2MCYA 2HORA 1EPHA 2VH6B 4LOSA 4MMXB 4Y76B 3FBYA 3TVJA 4RUTA 2Y8RA 2J34B 3Q3KB 3GXEA 4RS0A 2PHBB 1E5GA 1M1XB 2VJ3A 2OYEP 1KLIL 2MGPA 1NWVA 2X2ZA 3SW0X 4XLWA 4ZHAB 3C9AC 2RHPA 3OEDC 1V1IA 3T5OA 2WFXB 1WU1B 4E1GA 2RLQA 3LN1A 2P3FN 1E8BA 4CSYA 2FLGA 1G4FA 2DDUA 2F9BL 1QO6A 1YUFA 1LY2A 2JJLA 2B5ID 1DDXA 2H9EC 3TGFA 4AYIA 1ZJKA 4TGFA 4YT6L 2Q1JB 3O8EB 3FCSB 3K3TA 4RRZA 2UWPB 1HAEA 3KQCL 1DIYA 4Y7BB 1HFHA 1F0RB 2WPKE 3MQLA 2Y5FL 2J2UB 2ZYCA 1ATAA 2B7DL 1L3YA 2ERJA 2EHFA 4OTJA 4DJZA 4ONTD 1GKNA 3OLUA 1APOA 4X8UL 1SS2A 3N8YA 4YNXA 5DN4A 3ZRZA 5E8DA 2YGPA 4A7IA 4M11A 3WSYA 1UZPA 1Z6EL 2RA0L 1CCFA 2KL7A 2XWJI 2BSFA 2Y82B 4GU4A 5JBCE 2VVVL 3F1SB 1TLEA 2P3TA 4M10A 1LPKA 4Y71B 2P3UA 2WZPP 2W80A 2Y7XB 2WG3C 1ATEA 1HCGB 5HYPA 4X8VL 1EPGA 3HO4A 4LORA 2VWLL 2EI6B 2Y5GL 3TK5B 1IOXA 3ZLDA 1HAFA 1Q3XA 2P3FL 1PPQA 4BDXA 4NG9L 1NZIA 1G1TA 1P0SL 5JVYA 3GISX 1TPMA 2KNIA 3SW2A 1HT8A 3KK6A 1PRHA 1EGFA 2WPJE 3LTGD 1V3XB 2M74A 4X8TL 3F6UL 2YBYA 1Q4GA 1MQ5L 1NFUB 4WJG2 4PO7A 4F4OC 1W7XL 4MSLA 1XKAL 3MDLA 1F7MA 5I46L 3H5CB 4O02B 1CX2A 1O5DL 2FLRL 1HFIA 5IKTA 2BOHA 3N8WA 3SOBB 2XBVL 1H2PP 3CS7L 3FFGL 2BQ6A 2VWMK 1FBRA 2CKUA 4FXGG 1SZBA 2W2NE 1NFWB 2Y5HL 4CUFA 2WPIE 1KLOA 1EPIA 1CVWL 3S6XA 5F19A 1CQEA 4O1ZA 4BXSA 2MCZA 1C5MF 3M7PA 1I0UA 3CA7A 5KIRA 2A55A 1HREA 4A5WB 4ISHL 4YIZA 2Y81B 3V65B 4RRWA 3NT1A 2P93L 3GCXE 2BZMA 3KQDL 1CVUA 3ZD2A 4CUDA 1BF9A 1L5GB 2W86A 4BXWA 4D0EA 4JYVL 1JL9A 2BOUA 4JZEL 1EAIC 1LMMA 3KRKA 3LN0A 2XC5L 3LC5B 2KRIA 2FLBL 2CJIB 2J94B 3IX0A 3ZLEA 1PFXL 1U67A 1MQ6L 2W3IB 3TH3L 1OK1A 3P5BL 4B2SA 2W2QE 1VVCA 1GPZA 4CUEA 2O39C 5JBAE 1VVDA 2G00L 1OB1C 2PUQL 1TPGA 3EGFA 1PGEA 2J4IB 3HS7A 3LC3B 3KQBL 1OK9A 2KV4A 4Y6DB 2KMSA 1EMOA 1FE2A 2AYLA 1HT5A 2XC4L 2FZZL 3FGTA 1IQLL 4ZH8B 6COXA 2I2LA 2TGFA 1QFKL 4OTYA 3GOVA 2IZ3A 3DEMA 4N7EA 1LMJA 1DQBA 2HOXA 1N1IA 2RKZA 1NPEB 2IZ4A 1X7AL 1CEJA 1EZQB 1E88A 5CISA 3IITB 1U8CB 3NJPC 2H9EL 4XL1A 1OK2A 1IQKL 2KB9A 1H03P 3ZYJB 2XQWC 1EMNA 5IKQA 1IGZA 5JB9E 3KZJA 3V64C 5CKMA 4APLA 2P95L 2W2OE 4AYMA 1NT0A 2G7IA 2XBXL 5L30L 1LPZA 4NGAL 4D90A 1KKEA 3F6KA 1YGCL 2V8EA 3QCWA 1TOZA 1RLHA 2CG7A 2BQWA 3ZYIB 2PR3B 2VWOL 1HJ7A 1HCCA 1KIGL 3OP8A 3NFPI 1EQHA 4JZFL 1LQDA 2JKHL 4RRXA 4BTIA 4PH9A 2P26A 1HZ8A 2WFTA 2EI8B 3POYA 4Y7AB 4NA9L 1K37A 3NTBA 1DX5I 1YUGA 3ELAL 3U73A 5FO8C 1KLJL 4J38B 4AYDA 1EQGA 1GKGA 2MGRA 2EC3A 2Y38A 1YO8A 1G4GA 1UZQA 1FSBA 2VRSA 2WYGB 2W26B 3INBC 1FAKL 1CCVA 4ZH1D 3QH0A 4AQTA 3RJ3D 1URKA 1OJYA 5KN5C 5JW1A 3TK6B 1PTHA 4GU3A 1U5MA 2BT7A 2RNLA 3N8VA 3CI0J 1IQGL 1MD8A 2BMGA 1OJVA 2UWNA 4RRYA 3TBDA 2BOKL 2VVCK 2VH0B 1IQJL 1F0SB 2Y8SA 1V1HA 3OXUD 3BT1A 1NFXB 1W8BL 1APQA 4BDWA 1O9AA 1OK3A 2JGXA 1IQML 3QMOA 1QUBA 5JPMG 4LMFA 4BWCA 4KKDA 2WPHE 1IOEL 3NTGA 5HYTB 1QGBA 1JV2B 1UZJA 2XBWL 2LOJA 1G1SA 5L2YL 1MOXC 2P28B 2BO2A 5HYUB 4G1MB 2VVUL 2I9AA 2W3KB 4JHSA 1PXXA 2WYJB 5HZPB 1B9WA 5F1AA 5L2ZL 3U7UG 1H2QP 5JBBE 3KXVA 1ELVA 5DN5A 2RKYA 2BQ7A 1OJWA 1DVAL 3CALA 4PZ5A 2W2ME 2JGWA 1P9JA 1G1RA 4A94C 4ZAEB 3SOVA 1F7EA 2WIIC 4B2RA 3SOQA 1IQHL 2FD6A 3CFWA 3RR3A 1WHFA 2K2TA 2UWOB 1NFYB 2BT8A 4COXA 3WSXA 5JVZA 2Y80B 1FF7A
chains in the Genus database with same CATH topology
1TPNA 1ZAQA 1Z6CA 2CG6A 2JRAA 1G2MB 1AUTL 1IQNL 2RLPA 1FFMA 1WHEA 3ZYGA 4MMZB 3KL6B 3LIWB 1UZKA 2QY0A 2XC0L 2YGQA 2NPRA 1UOTP 3N8XA 3M37L 2Y7ZB 2BOXA 1RFNB 3N8YB 2XRDA 4YT7L 2OYUP 2UWLB 3OLTA 2MHPA 1YUKB 3ASIA 4Z6AL 3BPSE 3IJEB 1K36A 1XFEA 1IGXA 1HX2A 1NQLB 2I9BA 2WG4B 4JZDL 5FDQA 1IQFL 5EGMB 1MD7A 2P16L 2VWNL 5JB8E 2ADXA 1FJSL 2XRBA 1N7DA 2W81A 3EJHA 4Z0LA 3GCWE 1JBUL 1XDTR 2J95B 3N8ZA 2XBYL 1IQIL 4MMYB 1ATBA 1Z92B 3HPTA 2D1JB 3LTFB 5COXA 3HO5A 2W2PE 1H04P 4FM5A 2WPME 2GD4A 4XBMA 5I0QB 3ERBA 2YRAA 1IP0A 3KCGL 4BTTA 5IKVA 4ISIL 5IKRA 4JYUL 1A3PA 3BT2A 1EPJA 5CKNA 3L89M 2YGOA 3N8WB 5CKQA 2BZ6L 1ADXA 3KQEL 5K0HB 2WPLE 1J9CL 4BTUA 3K9XA 3TZIA 3MQEA 2RL0A 1C1ZA 1FAXL 4D0FA 3HS6A 1SRZA 3ENSA 1GHQB 4Z0KB 3HS5A 4LOTA 3CENL 2EI7B 1IVOC 4IGDA 4MUCA 2J38B 4ZXXL 1GK5A 4X8SL 1G2LB 4K12A 1ATDA 4C16A 4ZXYL 1CKLA 1G1QA 2P94L 3R62A 1KSNB 2K2SB 4AYEA 1COUA 2XWBF 3R05A 3LAQA 4Y79B 1IQEL 3Q7DA 1EBVA 1IJQA 3M36L 1HRFA 3ZD1A 1LPGA 3PGHA 1XKBA 3HO3A 4YZUB 3IU3I 2MCYA 1EPHA 2VH6B 4LOSA 4MMXB 4Y76B 3FBYA 3TVJA 4RUTA 2J34B 3Q3KB 3GXEA 4RS0A 2PHBB 1E5GA 1M1XB 2VJ3A 2OYEP 1KLIL 2MGPA 1NWVA 3SW0X 4XLWA 4ZHAB 3C9AC 2RHPA 3OEDC 3T5OA 2WFXB 1WU1B 4E1GA 2RLQA 3LN1A 2P3FN 1E8BA 4CSYA 2FLGA 1G4FA 2DDUA 2F9BL 1QO6A 1YUFA 1LY2A 2B5ID 1DDXA 2H9EC 3TGFA 4AYIA 1ZJKA 4TGFA 4YT6L 2Q1JB 3O8EB 3FCSB 4RRZA 2UWPB 1HAEA 3KQCL 1DIYA 4Y7BB 1HFHA 1F0RB 2WPKE 3MQLA 2Y5FL 2J2UB 1ATAA 2B7DL 1L3YA 2ERJA 2EHFA 4OTJA 4DJZA 4ONTD 1GKNA 3OLUA 1APOA 4X8UL 1SS2A 3N8YA 4YNXA 3ZRZA 5E8DA 2YGPA 4A7IA 4M11A 1UZPA 1Z6EL 2RA0L 1CCFA 2KL7A 2XWJI 2Y82B 5JBCE 2VVVL 3F1SB 1TLEA 2P3TA 4M10A 1LPKA 4Y71B 2P3UA 2WZPP 2W80A 2Y7XB 2WG3C 1ATEA 1HCGB 5HYPA 4X8VL 1EPGA 3HO4A 4LORA 2VWLL 2EI6B 2Y5GL 3TK5B 1IOXA 1HAFA 1Q3XA 2P3FL 1PPQA 4BDXA 4NG9L 1NZIA 1G1TA 1P0SL 5JVYA 3GISX 1TPMA 2KNIA 3SW2A 1HT8A 3KK6A 1PRHA 1EGFA 2WPJE 3LTGD 1V3XB 2M74A 4X8TL 3F6UL 2YBYA 1Q4GA 1MQ5L 1NFUB 4WJG2 4F4OC 1W7XL 1XKAL 3MDLA 1F7MA 5I46L 3H5CB 4O02B 1CX2A 1O5DL 2FLRL 1HFIA 5IKTA 2BOHA 3N8WA 3SOBB 2XBVL 1H2PP 3CS7L 3FFGL 2BQ6A 2VWMK 1FBRA 2CKUA 4FXGG 1SZBA 2W2NE 1NFWB 2Y5HL 4CUFA 2WPIE 1KLOA 1EPIA 1CVWL 3S6XA 5F19A 1CQEA 4O1ZA 4BXSA 2MCZA 1C5MF 3M7PA 1I0UA 3CA7A 5KIRA 2A55A 1HREA 4A5WB 4ISHL 2Y81B 3V65B 4RRWA 3NT1A 2P93L 3GCXE 2BZMA 3KQDL 1CVUA 3ZD2A 4CUDA 1BF9A 1L5GB 2W86A 4BXWA 4D0EA 4JYVL 1JL9A 2BOUA 4JZEL 1EAIC 1LMMA 3KRKA 3LN0A 2XC5L 3LC5B 2KRIA 2FLBL 2CJIB 2J94B 3IX0A 1PFXL 1U67A 1MQ6L 2W3IB 3TH3L 1OK1A 3P5BL 4B2SA 2W2QE 1VVCA 1GPZA 4CUEA 2O39C 5JBAE 1VVDA 2G00L 1OB1C 2PUQL 1TPGA 3EGFA 1PGEA 2J4IB 3HS7A 3LC3B 3KQBL 1OK9A 2KV4A 4Y6DB 2KMSA 1EMOA 1FE2A 2AYLA 1HT5A 2XC4L 2FZZL 1IQLL 4ZH8B 6COXA 2TGFA 1QFKL 4OTYA 3GOVA 2IZ3A 3DEMA 1LMJA 1DQBA 1N1IA 2RKZA 1NPEB 2IZ4A 1X7AL 1CEJA 1EZQB 1E88A 5CISA 3IITB 1U8CB 3NJPC 2H9EL 4XL1A 1OK2A 1IQKL 2KB9A 1H03P 3ZYJB 2XQWC 1EMNA 5IKQA 1IGZA 5JB9E 3KZJA 3V64C 5CKMA 2P95L 2W2OE 4AYMA 1NT0A 2G7IA 2XBXL 5L30L 1LPZA 4NGAL 4D90A 1YGCL 2V8EA 3QCWA 1TOZA 2CG7A 2BQWA 3ZYIB 2PR3B 2VWOL 1HJ7A 1HCCA 1KIGL 3OP8A 3NFPI 1EQHA 4JZFL 1LQDA 2JKHL 4RRXA 4BTIA 4PH9A 2P26A 1HZ8A 2WFTA 2EI8B 3POYA 4Y7AB 4NA9L 1K37A 3NTBA 1DX5I 1YUGA 3ELAL 3U73A 5FO8C 1KLJL 4J38B 4AYDA 1EQGA 1GKGA 2MGRA 2EC3A 2Y38A 1YO8A 1G4GA 1UZQA 1FSBA 2WYGB 2W26B 3INBC 1FAKL 1CCVA 4ZH1D 3QH0A 4AQTA 3RJ3D 1URKA 1OJYA 5KN5C 5JW1A 3TK6B 1PTHA 1U5MA 2RNLA 3N8VA 1IQGL 1MD8A 2BMGA 1OJVA 2UWNA 4RRYA 3TBDA 2BOKL 2VVCK 2VH0B 1IQJL 1F0SB 3OXUD 3BT1A 1NFXB 1W8BL 1APQA 4BDWA 1O9AA 1OK3A 2JGXA 1IQML 3QMOA 1QUBA 5JPMG 4LMFA 4KKDA 2WPHE 1IOEL 3NTGA 5HYTB 1QGBA 1JV2B 1UZJA 2XBWL 2LOJA 1G1SA 5L2YL 1MOXC 2P28B 2BO2A 5HYUB 4G1MB 2VVUL 2I9AA 2W3KB 4JHSA 1PXXA 2WYJB 5HZPB 1B9WA 5F1AA 5L2ZL 3U7UG 1H2QP 5JBBE 3KXVA 1ELVA 2RKYA 2BQ7A 1OJWA 1DVAL 3CALA 4PZ5A 2W2ME 2JGWA 1P9JA 1G1RA 4A94C 4ZAEB 3SOVA 1F7EA 2WIIC 4B2RA 3SOQA 1IQHL 2FD6A 3CFWA 3RR3A 1WHFA 2K2TA 2UWOB 1NFYB 4COXA 5JVZA 2Y80B 1FF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TPN A;  1ZAQ A;  1Z6C A;  2CG6 A;  2JRA A;  1G2M B;  1AUT L;  1IQN L;  2RLP A;  1FFM A;  1WHE A;  3ZYG A;  4MMZ B;  3KL6 B;  3LIW B;  1UZK A;  2QY0 A;  2XC0 L;  2NPR A;  1UOT P;  3N8X A;  3M37 L;  2Y7Z B;  2BOX A;  1RFN B;  3N8Y B;  2XRD A;  4YT7 L;  2OYU P;  2UWL B;  3OLT A;  2MHP A;  1YUK B;  3ASI A;  4Z6A L;  3BPS E;  3IJE B;  1K36 A;  1XFE A;  1IGX A;  1HX2 A;  1NQL B;  2I9B A;  2WG4 B;  4JZD L;  5FDQ A;  1IQF L;  5EGM B;  1MD7 A;  2P16 L;  2VWN L;  5JB8 E;  2ADX A;  1FJS L;  2XRB A;  1N7D A;  2W81 A;  3EJH A;  4Z0L A;  3GCW E;  1JBU L;  1XDT R;  2J95 B;  3N8Z A;  2XBY L;  1IQI L;  4MMY B;  1ATB A;  1Z92 B;  3HPT A;  2D1J B;  3LTF B;  5COX A;  3HO5 A;  2W2P E;  1H04 P;  4FM5 A;  2WPM E;  2GD4 A;  4XBM A;  5I0Q B;  3ERB A;  2YRA A;  1IP0 A;  3KCG L;  4BTT A;  5IKV A;  4ISI L;  5IKR A;  4JYU L;  1A3P A;  3BT2 A;  1EPJ A;  5CKN A;  3L89 M;  2YGO A;  3N8W B;  5CKQ A;  2BZ6 L;  1ADX A;  3KQE L;  5K0H B;  2WPL E;  1J9C L;  4BTU A;  3K9X A;  3TZI A;  3MQE A;  2RL0 A;  1C1Z A;  1FAX L;  4D0F A;  3HS6 A;  1SRZ A;  3ENS A;  1GHQ B;  4Z0K B;  3HS5 A;  4LOT A;  3CEN L;  2EI7 B;  1IVO C;  4IGD A;  4MUC A;  2J38 B;  4ZXX L;  1GK5 A;  4X8S L;  1G2L B;  4K12 A;  1ATD A;  4C16 A;  4ZXY L;  1CKL A;  1G1Q A;  2P94 L;  3R62 A;  1KSN B;  2K2S B;  4AYE A;  1COU A;  2XWB F;  3R05 A;  3LAQ A;  4Y79 B;  1IQE L;  3Q7D A;  1EBV A;  1IJQ A;  3M36 L;  1HRF A;  3ZD1 A;  1LPG A;  3PGH A;  1XKB A;  3HO3 A;  4YZU B;  3IU3 I;  2MCY A;  1EPH A;  2VH6 B;  4LOS A;  4MMX B;  4Y76 B;  3FBY A;  3TVJ A;  4RUT A;  2J34 B;  3Q3K B;  3GXE A;  4RS0 A;  2PHB B;  1E5G A;  1M1X B;  2VJ3 A;  2OYE P;  1KLI L;  2MGP A;  1NWV A;  3SW0 X;  4XLW A;  4ZHA B;  3C9A C;  2RHP A;  3OED C;  3T5O A;  2WFX B;  1WU1 B;  4E1G A;  2RLQ A;  3LN1 A;  2P3F N;  1E8B A;  4CSY A;  2FLG A;  1G4F A;  2DDU A;  2F9B L;  1QO6 A;  1YUF A;  1LY2 A;  2B5I D;  1DDX A;  3TGF A;  4AYI A;  1ZJK A;  4TGF A;  4YT6 L;  2Q1J B;  3O8E B;  3FCS B;  4RRZ A;  2UWP B;  1HAE A;  3KQC L;  1DIY A;  4Y7B B;  1HFH A;  1F0R B;  2WPK E;  3MQL A;  2Y5F L;  2J2U B;  1ATA A;  2B7D L;  1L3Y A;  2ERJ A;  2EHF A;  4OTJ A;  4DJZ A;  4ONT D;  1GKN A;  3OLU A;  1APO A;  4X8U L;  1SS2 A;  3N8Y A;  4YNX A;  3ZRZ A;  5E8D A;  2YGP A;  4A7I A;  4M11 A;  1UZP A;  1Z6E L;  2RA0 L;  1CCF A;  2KL7 A;  2XWJ I;  2Y82 B;  5JBC E;  2VVV L;  3F1S B;  1TLE A;  2P3T A;  4M10 A;  1LPK A;  4Y71 B;  2P3U A;  2W80 A;  2Y7X B;  2WG3 C;  1ATE A;  1HCG B;  5HYP A;  4X8V L;  1EPG A;  3HO4 A;  4LOR A;  2VWL L;  2EI6 B;  2Y5G L;  3TK5 B;  1IOX A;  1HAF A;  1Q3X A;  2P3F L;  1PPQ A;  4BDX A;  4NG9 L;  1NZI A;  1G1T A;  1P0S L;  5JVY A;  3GIS X;  1TPM A;  3SW2 A;  1HT8 A;  3KK6 A;  1PRH A;  1EGF A;  2WPJ E;  3LTG D;  1V3X B;  2M74 A;  4X8T L;  3F6U L;  2YBY A;  1Q4G A;  1MQ5 L;  1NFU B;  4WJG 2;  4F4O C;  1W7X L;  1XKA L;  3MDL A;  1F7M A;  5I46 L;  3H5C B;  4O02 B;  1CX2 A;  1O5D L;  2FLR L;  1HFI A;  5IKT A;  2BOH A;  3N8W A;  3SOB B;  2XBV L;  1H2P P;  3CS7 L;  3FFG L;  2BQ6 A;  2VWM K;  1FBR A;  2CKU A;  4FXG G;  1SZB A;  2W2N E;  1NFW B;  2Y5H L;  4CUF A;  2WPI E;  1KLO A;  1EPI A;  1CVW L;  5F19 A;  1CQE A;  4O1Z A;  4BXS A;  2MCZ A;  1C5M F;  3M7P A;  1I0U A;  3CA7 A;  5KIR A;  2A55 A;  1HRE A;  4A5W B;  4ISH L;  2Y81 B;  3V65 B;  4RRW A;  3NT1 A;  2P93 L;  3GCX E;  2BZM A;  3KQD L;  1CVU A;  3ZD2 A;  4CUD A;  1BF9 A;  1L5G B;  2W86 A;  4BXW A;  4D0E A;  4JYV L;  1JL9 A;  2BOU A;  4JZE L;  1EAI C;  3KRK A;  3LN0 A;  2XC5 L;  3LC5 B;  2KRI A;  2FLB L;  2CJI B;  2J94 B;  3IX0 A;  1PFX L;  1U67 A;  1MQ6 L;  2W3I B;  3TH3 L;  1OK1 A;  3P5B L;  4B2S A;  2W2Q E;  1VVC A;  1GPZ A;  4CUE A;  2O39 C;  5JBA E;  1VVD A;  2G00 L;  1OB1 C;  2PUQ L;  1TPG A;  3EGF A;  1PGE A;  2J4I B;  3HS7 A;  3LC3 B;  3KQB L;  1OK9 A;  2KV4 A;  4Y6D B;  2KMS A;  1EMO A;  1FE2 A;  2AYL A;  1HT5 A;  2XC4 L;  2FZZ L;  1IQL L;  4ZH8 B;  6COX A;  2TGF A;  1QFK L;  4OTY A;  3GOV A;  2IZ3 A;  3DEM A;  1LMJ A;  1DQB A;  1N1I A;  2RKZ A;  1NPE B;  2IZ4 A;  1X7A L;  1CEJ A;  1EZQ B;  1E88 A;  5CIS A;  3IIT B;  1U8C B;  3NJP C;  2H9E L;  4XL1 A;  1OK2 A;  1IQK L;  2KB9 A;  1H03 P;  3ZYJ B;  2XQW C;  1EMN A;  5IKQ A;  1IGZ A;  5JB9 E;  3KZJ A;  3V64 C;  5CKM A;  2P95 L;  2W2O E;  4AYM A;  1NT0 A;  2G7I A;  2XBX L;  5L30 L;  1LPZ A;  4NGA L;  4D90 A;  1YGC L;  2V8E A;  3QCW A;  1TOZ A;  2CG7 A;  2BQW A;  3ZYI B;  2PR3 B;  2VWO L;  1HJ7 A;  1HCC A;  1KIG L;  3OP8 A;  3NFP I;  1EQH A;  4JZF L;  1LQD A;  2JKH L;  4RRX A;  4BTI A;  4PH9 A;  2P26 A;  1HZ8 A;  2WFT A;  2EI8 B;  3POY A;  4Y7A B;  4NA9 L;  1K37 A;  3NTB A;  1DX5 I;  1YUG A;  3ELA L;  3U73 A;  5FO8 C;  1KLJ L;  4J38 B;  4AYD A;  1EQG A;  1GKG A;  2MGR A;  2EC3 A;  2Y38 A;  1YO8 A;  1G4G A;  1UZQ A;  1FSB A;  2WYG B;  2W26 B;  3INB C;  1FAK L;  1CCV A;  4ZH1 D;  3QH0 A;  4AQT A;  3RJ3 D;  1URK A;  1OJY A;  5KN5 C;  5JW1 A;  3TK6 B;  1PTH A;  1U5M A;  2RNL A;  3N8V A;  1IQG L;  1MD8 A;  2BMG A;  1OJV A;  2UWN A;  4RRY A;  3TBD A;  2BOK L;  2VVC K;  2VH0 B;  1IQJ L;  1F0S B;  3OXU D;  3BT1 A;  1NFX B;  1W8B L;  1APQ A;  4BDW A;  1O9A A;  1OK3 A;  2JGX A;  1IQM L;  3QMO A;  1QUB A;  5JPM G;  4LMF A;  4KKD A;  2WPH E;  1IOE L;  3NTG A;  5HYT B;  1QGB A;  1JV2 B;  1UZJ A;  2XBW L;  2LOJ A;  1G1S A;  5L2Y L;  1MOX C;  2P28 B;  2BO2 A;  5HYU B;  4G1M B;  2VVU L;  2I9A A;  2W3K B;  4JHS A;  1PXX A;  2WYJ B;  5HZP B;  1B9W A;  5F1A A;  5L2Z L;  3U7U G;  1H2Q P;  5JBB E;  3KXV A;  1ELV A;  2RKY A;  2BQ7 A;  1OJW A;  1DVA L;  3CAL A;  4PZ5 A;  2W2M E;  2JGW A;  1P9J A;  1G1R A;  4ZAE B;  3SOV A;  1F7E A;  2WII C;  4B2R A;  3SOQ A;  1IQH L;  2FD6 A;  3CFW A;  3RR3 A;  1WHF A;  2K2T A;  2UWO B;  1NFY B;  4COX A;  5JVZ A;  2Y80 B;  1FF7 A; 
#chains in the Genus database with same CATH topology
 1TPN A;  1ZAQ A;  1Z6C A;  2CG6 A;  2JRA A;  1G2M B;  1AUT L;  1IQN L;  2RLP A;  1FFM A;  1WHE A;  3ZYG A;  4MMZ B;  3KL6 B;  3LIW B;  1UZK A;  2QY0 A;  2XC0 L;  2YGQ A;  2NPR A;  1UOT P;  3N8X A;  3M37 L;  2Y7Z B;  2BOX A;  1RFN B;  1LK9 A;  3N8Y B;  2XRD A;  4YT7 L;  2OYU P;  2UWL B;  3OLT A;  2MHP A;  1YUK B;  3ASI A;  4Z6A L;  3BPS E;  3IJE B;  1K36 A;  1XFE A;  1IGX A;  1HX2 A;  1NQL B;  2I9B A;  2WG4 B;  4JZD L;  5FDQ A;  1IQF L;  5EGM B;  1MD7 A;  2P16 L;  2VWN L;  5JB8 E;  2ADX A;  1FJS L;  2XRB A;  1N7D A;  2W81 A;  3EJH A;  4Z0L A;  3GCW E;  1JBU L;  1XDT R;  1QIU A;  2J95 B;  3VWO A;  3N8Z A;  2XBY L;  1IQI L;  4MMY B;  1ATB A;  1Z92 B;  3HPT A;  2D1J B;  3LTF B;  3FGR A;  5COX A;  3HO5 A;  3NJA A;  2W2P E;  1H04 P;  4FM5 A;  2WPM E;  2GD4 A;  4XBM A;  5I0Q B;  3ERB A;  2YRA A;  1IP0 A;  3KCG L;  4BTT A;  5IKV A;  4ISI L;  5IKR A;  4JYU L;  1A3P A;  3BT2 A;  1EPJ A;  5CKN A;  3L89 M;  2YGO A;  3N8W B;  5CKQ A;  2BZ6 L;  1ADX A;  3KQE L;  5K0H B;  2WPL E;  1J9C L;  4BTU A;  3K9X A;  3TZI A;  3MQE A;  2RL0 A;  1C1Z A;  1FAX L;  4D0F A;  3HS6 A;  1SRZ A;  3ENS A;  1GHQ B;  4Z0K B;  3HS5 A;  4LOT A;  3CEN L;  2EI7 B;  1IVO C;  4IGD A;  4MUC A;  2J38 B;  4ZXX L;  1GK5 A;  4X8S L;  1G2L B;  4K12 A;  1ATD A;  4C16 A;  4ZXY L;  1CKL A;  1G1Q A;  2P94 L;  3R62 A;  1KSN B;  2K2S B;  4AYE A;  1COU A;  2XWB F;  3R05 A;  3LAQ A;  4Y79 B;  1IQE L;  3Q7D A;  1EBV A;  1IJQ A;  3M36 L;  2Y8T A;  1HRF A;  3ZD1 A;  1LPG A;  3PGH A;  1XKB A;  3HO3 A;  4YZU B;  3IU3 I;  2MCY A;  2HOR A;  1EPH A;  2VH6 B;  4LOS A;  4MMX B;  4Y76 B;  3FBY A;  3TVJ A;  4RUT A;  2Y8R A;  2J34 B;  3Q3K B;  3GXE A;  4RS0 A;  2PHB B;  1E5G A;  1M1X B;  2VJ3 A;  2OYE P;  1KLI L;  2MGP A;  1NWV A;  2X2Z A;  3SW0 X;  4XLW A;  4ZHA B;  3C9A C;  2RHP A;  3OED C;  1V1I A;  3T5O A;  2WFX B;  1WU1 B;  4E1G A;  2RLQ A;  3LN1 A;  2P3F N;  1E8B A;  4CSY A;  2FLG A;  1G4F A;  2DDU A;  2F9B L;  1QO6 A;  1YUF A;  1LY2 A;  2JJL A;  2B5I D;  1DDX A;  2H9E C;  3TGF A;  4AYI A;  1ZJK A;  4TGF A;  4YT6 L;  2Q1J B;  3O8E B;  3FCS B;  3K3T A;  4RRZ A;  2UWP B;  1HAE A;  3KQC L;  1DIY A;  4Y7B B;  1HFH A;  1F0R B;  2WPK E;  3MQL A;  2Y5F L;  2J2U B;  2ZYC A;  1ATA A;  2B7D L;  1L3Y A;  2ERJ A;  2EHF A;  4OTJ A;  4DJZ A;  4ONT D;  1GKN A;  3OLU A;  1APO A;  4X8U L;  1SS2 A;  3N8Y A;  4YNX A;  5DN4 A;  3ZRZ A;  5E8D A;  2YGP A;  4A7I A;  4M11 A;  3WSY A;  1UZP A;  1Z6E L;  2RA0 L;  1CCF A;  2KL7 A;  2XWJ I;  2BSF A;  2Y82 B;  4GU4 A;  5JBC E;  2VVV L;  3F1S B;  1TLE A;  2P3T A;  4M10 A;  1LPK A;  4Y71 B;  2P3U A;  2WZP P;  2W80 A;  2Y7X B;  2WG3 C;  1ATE A;  1HCG B;  5HYP A;  4X8V L;  1EPG A;  3HO4 A;  4LOR A;  2VWL L;  2EI6 B;  2Y5G L;  3TK5 B;  1IOX A;  3ZLD A;  1HAF A;  1Q3X A;  2P3F L;  1PPQ A;  4BDX A;  4NG9 L;  1NZI A;  1G1T A;  1P0S L;  5JVY A;  3GIS X;  1TPM A;  2KNI A;  3SW2 A;  1HT8 A;  3KK6 A;  1PRH A;  1EGF A;  2WPJ E;  3LTG D;  1V3X B;  2M74 A;  4X8T L;  3F6U L;  2YBY A;  1Q4G A;  1MQ5 L;  1NFU B;  4WJG 2;  4PO7 A;  4F4O C;  1W7X L;  4MSL A;  1XKA L;  3MDL A;  1F7M A;  5I46 L;  3H5C B;  4O02 B;  1CX2 A;  1O5D L;  2FLR L;  1HFI A;  5IKT A;  2BOH A;  3N8W A;  3SOB B;  2XBV L;  1H2P P;  3CS7 L;  3FFG L;  2BQ6 A;  2VWM K;  1FBR A;  2CKU A;  4FXG G;  1SZB A;  2W2N E;  1NFW B;  2Y5H L;  4CUF A;  2WPI E;  1KLO A;  1EPI A;  1CVW L;  3S6X A;  5F19 A;  1CQE A;  4O1Z A;  4BXS A;  2MCZ A;  1C5M F;  3M7P A;  1I0U A;  3CA7 A;  5KIR A;  2A55 A;  1HRE A;  4A5W B;  4ISH L;  4YIZ A;  2Y81 B;  3V65 B;  4RRW A;  3NT1 A;  2P93 L;  3GCX E;  2BZM A;  3KQD L;  1CVU A;  3ZD2 A;  4CUD A;  1BF9 A;  1L5G B;  2W86 A;  4BXW A;  4D0E A;  4JYV L;  1JL9 A;  2BOU A;  4JZE L;  1EAI C;  1LMM A;  3KRK A;  3LN0 A;  2XC5 L;  3LC5 B;  2KRI A;  2FLB L;  2CJI B;  2J94 B;  3IX0 A;  3ZLE A;  1PFX L;  1U67 A;  1MQ6 L;  2W3I B;  3TH3 L;  1OK1 A;  3P5B L;  4B2S A;  2W2Q E;  1VVC A;  1GPZ A;  4CUE A;  2O39 C;  5JBA E;  1VVD A;  2G00 L;  1OB1 C;  2PUQ L;  1TPG A;  3EGF A;  1PGE A;  2J4I B;  3HS7 A;  3LC3 B;  3KQB L;  1OK9 A;  2KV4 A;  4Y6D B;  2KMS A;  1EMO A;  1FE2 A;  2AYL A;  1HT5 A;  2XC4 L;  2FZZ L;  3FGT A;  1IQL L;  4ZH8 B;  6COX A;  2I2L A;  2TGF A;  1QFK L;  4OTY A;  3GOV A;  2IZ3 A;  3DEM A;  4N7E A;  1LMJ A;  1DQB A;  2HOX A;  1N1I A;  2RKZ A;  1NPE B;  2IZ4 A;  1X7A L;  1CEJ A;  1EZQ B;  1E88 A;  5CIS A;  3IIT B;  1U8C B;  3NJP C;  2H9E L;  4XL1 A;  1OK2 A;  1IQK L;  2KB9 A;  1H03 P;  3ZYJ B;  2XQW C;  1EMN A;  5IKQ A;  1IGZ A;  5JB9 E;  3KZJ A;  3V64 C;  5CKM A;  4APL A;  2P95 L;  2W2O E;  4AYM A;  1NT0 A;  2G7I A;  2XBX L;  5L30 L;  1LPZ A;  4NGA L;  4D90 A;  1KKE A;  3F6K A;  1YGC L;  2V8E A;  3QCW A;  1TOZ A;  1RLH A;  2CG7 A;  2BQW A;  3ZYI B;  2PR3 B;  2VWO L;  1HJ7 A;  1HCC A;  1KIG L;  3OP8 A;  3NFP I;  1EQH A;  4JZF L;  1LQD A;  2JKH L;  4RRX A;  4BTI A;  4PH9 A;  2P26 A;  1HZ8 A;  2WFT A;  2EI8 B;  3POY A;  4Y7A B;  4NA9 L;  1K37 A;  3NTB A;  1DX5 I;  1YUG A;  3ELA L;  3U73 A;  5FO8 C;  1KLJ L;  4J38 B;  4AYD A;  1EQG A;  1GKG A;  2MGR A;  2EC3 A;  2Y38 A;  1YO8 A;  1G4G A;  1UZQ A;  1FSB A;  2VRS A;  2WYG B;  2W26 B;  3INB C;  1FAK L;  1CCV A;  4ZH1 D;  3QH0 A;  4AQT A;  3RJ3 D;  1URK A;  1OJY A;  5KN5 C;  5JW1 A;  3TK6 B;  1PTH A;  4GU3 A;  1U5M A;  2BT7 A;  2RNL A;  3N8V A;  3CI0 J;  1IQG L;  1MD8 A;  2BMG A;  1OJV A;  2UWN A;  4RRY A;  3TBD A;  2BOK L;  2VVC K;  2VH0 B;  1IQJ L;  1F0S B;  2Y8S A;  1V1H A;  3OXU D;  3BT1 A;  1NFX B;  1W8B L;  1APQ A;  4BDW A;  1O9A A;  1OK3 A;  2JGX A;  1IQM L;  3QMO A;  1QUB A;  5JPM G;  4LMF A;  4BWC A;  4KKD A;  2WPH E;  1IOE L;  3NTG A;  5HYT B;  1QGB A;  1JV2 B;  1UZJ A;  2XBW L;  2LOJ A;  1G1S A;  5L2Y L;  1MOX C;  2P28 B;  2BO2 A;  5HYU B;  4G1M B;  2VVU L;  2I9A A;  2W3K B;  4JHS A;  1PXX A;  2WYJ B;  5HZP B;  1B9W A;  5F1A A;  5L2Z L;  3U7U G;  1H2Q P;  5JBB E;  3KXV A;  1ELV A;  5DN5 A;  2RKY A;  2BQ7 A;  1OJW A;  1DVA L;  3CAL A;  4PZ5 A;  2W2M E;  2JGW A;  1P9J A;  1G1R A;  4A94 C;  4ZAE B;  3SOV A;  1F7E A;  2WII C;  4B2R A;  3SOQ A;  1IQH L;  2FD6 A;  3CFW A;  3RR3 A;  1WHF A;  2K2T A;  2UWO B;  1NFY B;  2BT8 A;  4COX A;  3WSX A;  5JVZ A;  2Y80 B;  1FF7 A; 
#chains in the Genus database with same CATH homology
 1TPN A;  1ZAQ A;  1Z6C A;  2CG6 A;  2JRA A;  1G2M B;  1AUT L;  1IQN L;  2RLP A;  1FFM A;  1WHE A;  3ZYG A;  4MMZ B;  3KL6 B;  3LIW B;  1UZK A;  2QY0 A;  2XC0 L;  2YGQ A;  2NPR A;  1UOT P;  3N8X A;  3M37 L;  2Y7Z B;  2BOX A;  1RFN B;  3N8Y B;  2XRD A;  4YT7 L;  2OYU P;  2UWL B;  3OLT A;  2MHP A;  1YUK B;  3ASI A;  4Z6A L;  3BPS E;  3IJE B;  1K36 A;  1XFE A;  1IGX A;  1HX2 A;  1NQL B;  2I9B A;  2WG4 B;  4JZD L;  5FDQ A;  1IQF L;  5EGM B;  1MD7 A;  2P16 L;  2VWN L;  5JB8 E;  2ADX A;  1FJS L;  2XRB A;  1N7D A;  2W81 A;  3EJH A;  4Z0L A;  3GCW E;  1JBU L;  1XDT R;  2J95 B;  3N8Z A;  2XBY L;  1IQI L;  4MMY B;  1ATB A;  1Z92 B;  3HPT A;  2D1J B;  3LTF B;  5COX A;  3HO5 A;  2W2P E;  1H04 P;  4FM5 A;  2WPM E;  2GD4 A;  4XBM A;  5I0Q B;  3ERB A;  2YRA A;  1IP0 A;  3KCG L;  4BTT A;  5IKV A;  4ISI L;  5IKR A;  4JYU L;  1A3P A;  3BT2 A;  1EPJ A;  5CKN A;  3L89 M;  2YGO A;  3N8W B;  5CKQ A;  2BZ6 L;  1ADX A;  3KQE L;  5K0H B;  2WPL E;  1J9C L;  4BTU A;  3K9X A;  3TZI A;  3MQE A;  2RL0 A;  1C1Z A;  1FAX L;  4D0F A;  3HS6 A;  1SRZ A;  3ENS A;  1GHQ B;  4Z0K B;  3HS5 A;  4LOT A;  3CEN L;  2EI7 B;  1IVO C;  4IGD A;  4MUC A;  2J38 B;  4ZXX L;  1GK5 A;  4X8S L;  1G2L B;  4K12 A;  1ATD A;  4C16 A;  4ZXY L;  1CKL A;  1G1Q A;  2P94 L;  3R62 A;  1KSN B;  2K2S B;  4AYE A;  1COU A;  2XWB F;  3R05 A;  3LAQ A;  4Y79 B;  1IQE L;  3Q7D A;  1EBV A;  1IJQ A;  3M36 L;  1HRF A;  3ZD1 A;  1LPG A;  3PGH A;  1XKB A;  3HO3 A;  4YZU B;  3IU3 I;  2MCY A;  1EPH A;  2VH6 B;  4LOS A;  4MMX B;  4Y76 B;  3FBY A;  3TVJ A;  4RUT A;  2J34 B;  3Q3K B;  3GXE A;  4RS0 A;  2PHB B;  1E5G A;  1M1X B;  2VJ3 A;  2OYE P;  1KLI L;  2MGP A;  1NWV A;  3SW0 X;  4XLW A;  4ZHA B;  3C9A C;  2RHP A;  3OED C;  3T5O A;  2WFX B;  1WU1 B;  4E1G A;  2RLQ A;  3LN1 A;  2P3F N;  1E8B A;  4CSY A;  2FLG A;  1G4F A;  2DDU A;  2F9B L;  1QO6 A;  1YUF A;  1LY2 A;  2B5I D;  1DDX A;  2H9E C;  3TGF A;  4AYI A;  1ZJK A;  4TGF A;  4YT6 L;  2Q1J B;  3O8E B;  3FCS B;  4RRZ A;  2UWP B;  1HAE A;  3KQC L;  1DIY A;  4Y7B B;  1HFH A;  1F0R B;  2WPK E;  3MQL A;  2Y5F L;  2J2U B;  1ATA A;  2B7D L;  1L3Y A;  2ERJ A;  2EHF A;  4OTJ A;  4DJZ A;  4ONT D;  1GKN A;  3OLU A;  1APO A;  4X8U L;  1SS2 A;  3N8Y A;  4YNX A;  3ZRZ A;  5E8D A;  2YGP A;  4A7I A;  4M11 A;  1UZP A;  1Z6E L;  2RA0 L;  1CCF A;  2KL7 A;  2XWJ I;  2Y82 B;  5JBC E;  2VVV L;  3F1S B;  1TLE A;  2P3T A;  4M10 A;  1LPK A;  4Y71 B;  2P3U A;  2WZP P;  2W80 A;  2Y7X B;  2WG3 C;  1ATE A;  1HCG B;  5HYP A;  4X8V L;  1EPG A;  3HO4 A;  4LOR A;  2VWL L;  2EI6 B;  2Y5G L;  3TK5 B;  1IOX A;  1HAF A;  1Q3X A;  2P3F L;  1PPQ A;  4BDX A;  4NG9 L;  1NZI A;  1G1T A;  1P0S L;  5JVY A;  3GIS X;  1TPM A;  2KNI A;  3SW2 A;  1HT8 A;  3KK6 A;  1PRH A;  1EGF A;  2WPJ E;  3LTG D;  1V3X B;  2M74 A;  4X8T L;  3F6U L;  2YBY A;  1Q4G A;  1MQ5 L;  1NFU B;  4WJG 2;  4F4O C;  1W7X L;  1XKA L;  3MDL A;  1F7M A;  5I46 L;  3H5C B;  4O02 B;  1CX2 A;  1O5D L;  2FLR L;  1HFI A;  5IKT A;  2BOH A;  3N8W A;  3SOB B;  2XBV L;  1H2P P;  3CS7 L;  3FFG L;  2BQ6 A;  2VWM K;  1FBR A;  2CKU A;  4FXG G;  1SZB A;  2W2N E;  1NFW B;  2Y5H L;  4CUF A;  2WPI E;  1KLO A;  1EPI A;  1CVW L;  3S6X A;  5F19 A;  1CQE A;  4O1Z A;  4BXS A;  2MCZ A;  1C5M F;  3M7P A;  1I0U A;  3CA7 A;  5KIR A;  2A55 A;  1HRE A;  4A5W B;  4ISH L;  2Y81 B;  3V65 B;  4RRW A;  3NT1 A;  2P93 L;  3GCX E;  2BZM A;  3KQD L;  1CVU A;  3ZD2 A;  4CUD A;  1BF9 A;  1L5G B;  2W86 A;  4BXW A;  4D0E A;  4JYV L;  1JL9 A;  2BOU A;  4JZE L;  1EAI C;  1LMM A;  3KRK A;  3LN0 A;  2XC5 L;  3LC5 B;  2KRI A;  2FLB L;  2CJI B;  2J94 B;  3IX0 A;  1PFX L;  1U67 A;  1MQ6 L;  2W3I B;  3TH3 L;  1OK1 A;  3P5B L;  4B2S A;  2W2Q E;  1VVC A;  1GPZ A;  4CUE A;  2O39 C;  5JBA E;  1VVD A;  2G00 L;  1OB1 C;  2PUQ L;  1TPG A;  3EGF A;  1PGE A;  2J4I B;  3HS7 A;  3LC3 B;  3KQB L;  1OK9 A;  2KV4 A;  4Y6D B;  2KMS A;  1EMO A;  1FE2 A;  2AYL A;  1HT5 A;  2XC4 L;  2FZZ L;  1IQL L;  4ZH8 B;  6COX A;  2TGF A;  1QFK L;  4OTY A;  3GOV A;  2IZ3 A;  3DEM A;  1LMJ A;  1DQB A;  1N1I A;  2RKZ A;  1NPE B;  2IZ4 A;  1X7A L;  1CEJ A;  1EZQ B;  1E88 A;  5CIS A;  3IIT B;  1U8C B;  3NJP C;  2H9E L;  4XL1 A;  1OK2 A;  1IQK L;  2KB9 A;  1H03 P;  3ZYJ B;  2XQW C;  1EMN A;  5IKQ A;  1IGZ A;  5JB9 E;  3KZJ A;  3V64 C;  5CKM A;  2P95 L;  2W2O E;  4AYM A;  1NT0 A;  2G7I A;  2XBX L;  5L30 L;  1LPZ A;  4NGA L;  4D90 A;  1YGC L;  2V8E A;  3QCW A;  1TOZ A;  2CG7 A;  2BQW A;  3ZYI B;  2PR3 B;  2VWO L;  1HJ7 A;  1HCC A;  1KIG L;  3OP8 A;  3NFP I;  1EQH A;  4JZF L;  1LQD A;  2JKH L;  4RRX A;  4BTI A;  4PH9 A;  2P26 A;  1HZ8 A;  2WFT A;  2EI8 B;  3POY A;  4Y7A B;  4NA9 L;  1K37 A;  3NTB A;  1DX5 I;  1YUG A;  3ELA L;  3U73 A;  5FO8 C;  1KLJ L;  4J38 B;  4AYD A;  1EQG A;  1GKG A;  2MGR A;  2EC3 A;  2Y38 A;  1YO8 A;  1G4G A;  1UZQ A;  1FSB A;  2WYG B;  2W26 B;  3INB C;  1FAK L;  1CCV A;  4ZH1 D;  3QH0 A;  4AQT A;  3RJ3 D;  1URK A;  1OJY A;  5KN5 C;  5JW1 A;  3TK6 B;  1PTH A;  1U5M A;  2RNL A;  3N8V A;  1IQG L;  1MD8 A;  2BMG A;  1OJV A;  2UWN A;  4RRY A;  3TBD A;  2BOK L;  2VVC K;  2VH0 B;  1IQJ L;  1F0S B;  3OXU D;  3BT1 A;  1NFX B;  1W8B L;  1APQ A;  4BDW A;  1O9A A;  1OK3 A;  2JGX A;  1IQM L;  3QMO A;  1QUB A;  5JPM G;  4LMF A;  4KKD A;  2WPH E;  1IOE L;  3NTG A;  5HYT B;  1QGB A;  1JV2 B;  1UZJ A;  2XBW L;  2LOJ A;  1G1S A;  5L2Y L;  1MOX C;  2P28 B;  2BO2 A;  5HYU B;  4G1M B;  2VVU L;  2I9A A;  2W3K B;  4JHS A;  1PXX A;  2WYJ B;  5HZP B;  1B9W A;  5F1A A;  5L2Z L;  3U7U G;  1H2Q P;  5JBB E;  3KXV A;  1ELV A;  2RKY A;  2BQ7 A;  1OJW A;  1DVA L;  3CAL A;  4PZ5 A;  2W2M E;  2JGW A;  1P9J A;  1G1R A;  4A94 C;  4ZAE B;  3SOV A;  1F7E A;  2WII C;  4B2R A;  3SOQ A;  1IQH L;  2FD6 A;  3CFW A;  3RR3 A;  1WHF A;  2K2T A;  2UWO B;  1NFY B;  4COX A;  5JVZ A;  2Y80 B;  1FF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...