1TPGA

F1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKSCEIDTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-PLASMINOGEN ACTIVATOR F1-G
publication title The solution structure and backbone dynamics of the fibronectin type I and epidermal growth factor-like pair of modules of tissue-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Plasminogen activation
total genus 9
structure length 91
sequence length 91
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1995-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1tpgA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1tpgA01
3M7PA 1QUBA 1EZQB 3OP8A 1EMNA 1A3PA 1HAFA 2OYUP 1LMJA 2PUQL 2MGPA 4YT7L 3HO5A 1N7DA 2VWOL 3EGFA 2FLBL 1EQHA 4Y76B 2WIIC 1E8BA 5FO8C 1PFXL 1K37A 1UZJA 2XRDA 3ELAL 3F6UL 2WPKE 1LPZA 2NPRA 4CSYA 1APOA 3TGFA 1CVWL 4A5WB 1QGBA 2JGXA 3ZYJB 3CENL 1EQGA 1YGCL 1EMOA 2RLQA 1V3XB 4J38B 2P3UA 5L30L 2BQ7A 2W2QE 1J9CL 5KIRA 4ZH1D 2Q1JB 1UZPA 1IQJL 3V64C 4O02B 1MOXC 2W81A 3L89M 3N8WA 2RLPA 3ENSA 2P93L 1LPKA 5I46L 1XFEA 5E8DA 4NG9L 2I9AA 1JBUL 5HZPB 1UZQA 5I0QB 3N8YB 1LPGA 3LAQA 3FBYA 3HO3A 1G2MB 3OXUD 2RA0L 5JW1A 1X7AL 5CKQA 2WG4B 3LTGD 3KZJA 1LY2A 2H9EL 3LC3B 1CCVA 2W26B 2K2SB 2JGWA 2V8EA 3GCWE 2J34B 5L2ZL 5IKRA 1E88A 1VVDA 1HCCA 2BQWA 1OK3A 3KL6B 1BF9A 2K2TA 4YZUB 4G1MB 1P0SL 2P94L 1G1TA 2KL7A 4ZXYL 1DQBA 3QCWA 2RNLA 1YUFA 2XBVL 2P3TA 5K0HB 4X8VL 3PGHA 3SOVA 1IQHL 4E1GA 1IP0A 4BDWA 4RRXA 1U5MA 2BO2A 2UWOB 1HZ8A 2P3FN 4WJG2 4AYMA 2XC5L 3DEMA 1SZBA 1EPIA 3R62A 4D0EA 2I9BA 1HX2A 1DX5I 3RJ3D 2WPHE 3IU3I 5IKTA 4YT6L 2WFXB 2P28B 1KLOA 1FE2A 2W2PE 2W86A 4JZFL 4PH9A 2XBYL 2RKZA 4AYEA 1HREA 2G00L 2XBXL 3KQDL 2WFTA 4JYUL 5HYPA 1PTHA 4Y71B 1OJWA 4OTYA 3IITB 5JBBE 3TBDA 1NQLB 1G4GA 3OLTA 1CCFA 1F0SB 2PHBB 4XBMA 6COXA 2D1JB 3RR3A 1M1XB 1ELVA 3TK6B 1EAIC 1G1RA 1MQ6L 2WPJE 3FFGL 3CALA 3M36L 3GCXE 3SW2A 4M11A 2BOUA 3Q7DA 4JHSA 1MD7A 2KMSA 3CS7L 2J2UB 4LMFA 3ERBA 3P5BL 2Y5GL 5COXA 4Y7BB 2GD4A 2MHPA 2CJIB 3U73A 4PZ5A 2J95B 1TPMA 2IZ4A 1H04P 2EI6B 1TOZA 5HYTB 2OYEP 1FAKL 2ADXA 2BMGA 4JYVL 2RKYA 1DDXA 4XLWA 2A55A 4B2SA 1OK1A 4BXWA 3O8EB 1DIYA 3LN0A 4X8SL 3INBC 2VWMK 4ZHAB 4ISIL 5CKNA 1IOXA 3KRKA 1VVCA 4AYIA 1JL9A 4CUEA 5JPMG 2RL0A 3TK5B 3MDLA 3OEDC 1TPGA 1G4FA 4TGFA 3NFPI 1IQLL 1IQEL 3R05A 1COUA 1FFMA 2YRAA 3CA7A 4LOTA 1W8BL 3NTGA 1NFYB 2XC0L 2Y5HL 2VWLL 4RRWA 4MMZB 1ATAA 2KRIA 1OK9A 2UWNA 2PR3B 2CKUA 1G1QA 5CKMA 1U8CB 1F7EA 3HS5A 1Q4GA 3QMOA 4XL1A 4COXA 1FSBA 2EI8B 2CG6A 3SW0X 2UWPB 3ZYIB 1YO8A 2EC3A 1IQNL 2W2ME 2FLGA 1CX2A 3HPTA 3IJEB 4BTUA 3C9AC 4C16A 2J38B 1GPZA 1KSNB 4MMXB 1O5DL 2Y80B 1NZIA 2WG3C 1C1ZA 2BOXA 5HYUB 2YGPA 2FD6A 4AYDA 1EBVA 1NFXB 5F19A 3ZD2A 1OJYA 4Z6AL 4Y7AB 1OJVA 1IOEL 2G7IA 1GKNA 3KQBL 1FBRA 3SOQA 3EJHA 2KV4A 4FM5A 5F1AA 1P9JA 1WU1B 3KQEL 4MMYB 1KIGL 5JVYA 2BOHA 2TGFA 1PRHA 4ISHL 1HRFA 3TVJA 4CUFA 3LN1A 1PXXA 2WPLE 1ZJKA 2KB9A 2BQ6A 1UZKA 1HT5A 1N1IA 1HFHA 3GXEA 4YNXA 2M74A 1H2QP 2F9BL 4ZH8B 4A7IA 1H03P 3NJPC 3LC5B 3BT2A 1WHFA 1Z92B 2YGOA 1PGEA 1KLJL 1KLIL 1NFWB 2JKHL 2XBWL 2P3FL 3BT1A 1JV2B 1IQGL 3ASIA 4BXSA 4NGAL 2W2NE 3KQCL 1EPHA 2Y7ZB 1G1SA 1Q3XA 3N8ZA 2O39C 3GOVA 5JVZA 1YUGA 1TPNA 1NT0A 2P16L 5JB9E 4BTTA 4ONTD 2RHPA 4M10A 1HCGB 4JZEL 2VWNL 4BDXA 5EGMB 2UWLB 4RRZA 1CVUA 3BPSE 1U67A 1ZAQA 1CKLA 2J94B 3IX0A 3K9XA 3QH0A 1IGXA 2Y38A 2W2OE 1IQML 1HT8A 2P26A 1Z6CA 3F1SB 4RRYA 2Y5FL 3MQEA 1ATEA 1ADXA 4ZAEB 3N8XA 1FF7A 1CQEA 4NA9L 1OK2A 2WYJB 3LIWB 2LOJA 1NPEB 1L3YA 2FLRL 1I0UA 1DVAL 4F4OC 4X8TL 2CG7A 4Y6DB 1PPQA 3NTBA 2JRAA 1FAXL 1GHQB 1NWVA 5FDQA 3OLUA 2AYLA 4D90A 3N8YA 4RUTA 1IGZA 1EGFA 2WYGB 3KXVA 2ERJA 2XC4L 2EHFA 2XWJI 1XDTR 2Y7XB 2MCZA 4LORA 4DJZA 2BOKL 4AQTA 1LQDA 3KCGL 3TZIA 1HJ7A 2XRBA 1Z6EL 1IVOC 2VJ3A 4CUDA 1H2PP 4ZXXL 1SS2A 3ZYGA 1OB1C 3POYA 3N8WB 1GK5A 3Q3KB 3SOBB 2YBYA 5L2YL 2VH0B 2J4IB 2VVUL 2MGRA 3ZRZA 1O9AA 2W3KB 2WPIE 3FCSB 1C5MF 5JBAE 2B7DL 5IKVA 1F7MA 1W7XL 1YUKB 4IGDA 3NT1A 2IZ3A 2BZ6L 3M37L 1FJSL 1G2LB 1IQIL 3HS6A 5JB8E 2DDUA 1L5GB 1XKAL 2MCYA 3TH3L 1WHEA 1EPGA 4Z0LA 1GKGA 2XWBF 4OTJA 2W3IB 3CFWA 3HO4A 1K36A 1IQFL 1SRZA 2P95L 1CEJA 2QY0A 1ATBA 2BZMA 3N8VA 3HS7A 1TLEA 1RFNB 1HAEA 1XKBA 1QFKL 1IJQA 3GISX 2EI7B 4FXGG 1UOTP 3T5OA 5JBCE 2W80A 4LOSA 1URKA 1HFIA 1APQA 2WPME 3V65B 5KN5C 1NFUB 5IKQA 1AUTL 2FZZL 2Y81B 2VH6B 3LTFB 1MD8A 3U7UG 3MQLA 3ZD1A 3KK6A 4BTIA 2VVCK 4JZDL 4Z0KB 4D0FA 2XQWC 3H5CB 1IQKL 4O1ZA 2VVVL 1MQ5L 4RS0A 4K12A 2Y82B 4X8UL 4KKDA 1B9WA 4Y79B 4MUCA 1E5GA 1F0RB 1EPJA 2B5ID 4B2RA 1QO6A 5CISA 1ATDA
chains in the Genus database with same CATH superfamily
3M7PA 1QUBA 1EZQB 3OP8A 1EMNA 2KNIA 1A3PA 1HAFA 2OYUP 1LMJA 2PUQL 2MGPA 2HORA 3ZLDA 4YT7L 3HO5A 1N7DA 2VWOL 3EGFA 2FLBL 1EQHA 4Y76B 2WIIC 1E8BA 5FO8C 1PFXL 1K37A 1UZJA 2XRDA 3ELAL 4APLA 3F6UL 2WPKE 1LPZA 2NPRA 4CSYA 1APOA 3TGFA 1CVWL 4A5WB 1QGBA 2JGXA 3ZYJB 3CENL 1EQGA 1YGCL 1EMOA 3FGTA 2RLQA 1V3XB 4J38B 2P3UA 5L30L 2BQ7A 2W2QE 1J9CL 5KIRA 4ZH1D 2Q1JB 1UZPA 1IQJL 3V64C 4O02B 1MOXC 2W81A 3L89M 3N8WA 2RLPA 3ENSA 2P93L 1LPKA 5I46L 1XFEA 5E8DA 4NG9L 4MSLA 2I9AA 4BWCA 1JBUL 5HZPB 1UZQA 5I0QB 3N8YB 1LPGA 3LAQA 3FBYA 3HO3A 1G2MB 3OXUD 2RA0L 5JW1A 1X7AL 5CKQA 2WG4B 3LTGD 3KZJA 1LY2A 2H9EL 3LC3B 1CCVA 2W26B 2K2SB 2JGWA 2V8EA 3GCWE 2J34B 5L2ZL 5DN5A 5IKRA 1E88A 1VVDA 1HCCA 2BQWA 1OK3A 3KL6B 1BF9A 2K2TA 4YZUB 4G1MB 1LK9A 1P0SL 2P94L 1G1TA 2KL7A 4ZXYL 1DQBA 3QCWA 2RNLA 1YUFA 2XBVL 2P3TA 3WSXA 5K0HB 4X8VL 3PGHA 3SOVA 1IQHL 4E1GA 1IP0A 4BDWA 4RRXA 1U5MA 2BO2A 2UWOB 1HZ8A 2P3FN 4WJG2 4AYMA 2XC5L 3DEMA 1SZBA 1EPIA 3R62A 4D0EA 2I9BA 1HX2A 1DX5I 3RJ3D 2WPHE 3IU3I 5IKTA 4YT6L 2WFXB 2P28B 1KLOA 1FE2A 2W2PE 2W86A 4JZFL 4PH9A 2XBYL 2RKZA 4AYEA 1HREA 2G00L 2XBXL 3KQDL 2WFTA 4JYUL 3VWOA 5HYPA 1PTHA 4Y71B 1OJWA 4OTYA 3IITB 5JBBE 3TBDA 1NQLB 1G4GA 3OLTA 1CCFA 1F0SB 2PHBB 4XBMA 6COXA 2D1JB 3RR3A 1M1XB 1ELVA 3TK6B 1EAIC 1G1RA 1MQ6L 2WPJE 3FFGL 3CALA 3M36L 3GCXE 3SW2A 4M11A 2BOUA 2WZPP 2BT8A 3Q7DA 4JHSA 1MD7A 2KMSA 3CS7L 2J2UB 4LMFA 3ERBA 3P5BL 2Y5GL 5COXA 4Y7BB 2GD4A 2MHPA 2CJIB 3U73A 4PZ5A 2J95B 1TPMA 2IZ4A 1H04P 2EI6B 1TOZA 5HYTB 2OYEP 1FAKL 2ADXA 2BMGA 4JYVL 2RKYA 1DDXA 4XLWA 2A55A 4B2SA 1OK1A 4BXWA 3O8EB 1DIYA 3LN0A 4GU3A 4X8SL 3INBC 4N7EA 2VWMK 4ZHAB 4ISIL 5CKNA 1IOXA 3KRKA 1VVCA 4AYIA 1JL9A 4CUEA 5JPMG 1V1HA 2RL0A 3TK5B 3MDLA 3OEDC 4YIZA 1TPGA 1G4FA 4TGFA 3NFPI 1IQLL 1IQEL 3R05A 1V1IA 2BSFA 1COUA 1FFMA 2YRAA 2BT7A 3CA7A 4LOTA 1W8BL 3NTGA 3S6XA 1NFYB 2XC0L 2Y5HL 2VWLL 4RRWA 4MMZB 1ATAA 2KRIA 1OK9A 2UWNA 2PR3B 2CKUA 1G1QA 5CKMA 2ZYCA 1U8CB 2HOXA 1F7EA 3HS5A 1Q4GA 3QMOA 4XL1A 4COXA 1FSBA 2EI8B 2CG6A 3SW0X 2UWPB 3ZYIB 1YO8A 2EC3A 1IQNL 2W2ME 2FLGA 1CX2A 3HPTA 3IJEB 4BTUA 3C9AC 4C16A 2J38B 1GPZA 5DN4A 1KSNB 4MMXB 1O5DL 2Y80B 1NZIA 2WG3C 1C1ZA 2BOXA 5HYUB 2YGPA 2FD6A 4AYDA 1EBVA 1NFXB 5F19A 3ZD2A 1OJYA 4Z6AL 4Y7AB 1OJVA 1IOEL 2G7IA 1GKNA 2JJLA 3KQBL 1FBRA 3SOQA 3EJHA 2KV4A 4FM5A 5F1AA 1P9JA 1WU1B 3KQEL 4MMYB 1KIGL 5JVYA 2BOHA 2TGFA 1PRHA 4ISHL 1HRFA 3TVJA 4CUFA 3LN1A 1PXXA 2WPLE 1ZJKA 2KB9A 2BQ6A 1UZKA 1HT5A 1N1IA 1HFHA 3GXEA 1KKEA 3NJAA 2M74A 4YNXA 1H2QP 2X2ZA 2F9BL 4ZH8B 4A7IA 1H03P 3NJPC 3LC5B 3BT2A 1WHFA 1Z92B 2YGOA 1PGEA 1KLJL 3F6KA 1KLIL 1NFWB 2JKHL 2Y8SA 2XBWL 2YGQA 2P3FL 3BT1A 1JV2B 1IQGL 3ASIA 4BXSA 4NGAL 2W2NE 3KQCL 1EPHA 2Y7ZB 1G1SA 1Q3XA 3N8ZA 2O39C 3GOVA 5JVZA 1YUGA 3FGRA 1TPNA 1NT0A 2P16L 5JB9E 4BTTA 4ONTD 2RHPA 4M10A 1HCGB 4JZEL 2VWNL 4BDXA 5EGMB 2UWLB 4GU4A 4RRZA 1CVUA 3BPSE 1U67A 1ZAQA 1CKLA 2J94B 3IX0A 3K9XA 3QH0A 1IGXA 2Y38A 2W2OE 1IQML 1HT8A 2P26A 3CI0J 1Z6CA 3F1SB 4RRYA 2Y5FL 1QIUA 3MQEA 1ATEA 1ADXA 4ZAEB 3N8XA 1FF7A 1CQEA 4NA9L 1OK2A 2Y8TA 2WYJB 3LIWB 2LOJA 1NPEB 1L3YA 2FLRL 1I0UA 1DVAL 4F4OC 2VRSA 4X8TL 2CG7A 4PO7A 4Y6DB 1PPQA 3NTBA 2JRAA 1FAXL 1GHQB 1NWVA 5FDQA 3OLUA 2AYLA 4D90A 3N8YA 4RUTA 1IGZA 1EGFA 2WYGB 3KXVA 2ERJA 2XC4L 2EHFA 2XWJI 1XDTR 2Y7XB 2MCZA 4LORA 4DJZA 2BOKL 4AQTA 1LQDA 3KCGL 3TZIA 1HJ7A 2XRBA 1Z6EL 1IVOC 2VJ3A 4CUDA 1H2PP 4ZXXL 1SS2A 3ZYGA 1OB1C 3POYA 3N8WB 1GK5A 3Q3KB 3SOBB 2YBYA 5L2YL 2VH0B 2J4IB 2VVUL 2MGRA 2I2LA 3ZRZA 1O9AA 2W3KB 2WPIE 3FCSB 1C5MF 5JBAE 2B7DL 5IKVA 1F7MA 1W7XL 1YUKB 4IGDA 3NT1A 2IZ3A 2BZ6L 3M37L 1FJSL 1G2LB 1IQIL 3HS6A 5JB8E 2DDUA 3K3TA 1L5GB 1XKAL 1RLHA 2MCYA 3TH3L 1WHEA 1EPGA 4Z0LA 1GKGA 2XWBF 4OTJA 2W3IB 3CFWA 3HO4A 1K36A 1IQFL 1SRZA 1LMMA 2P95L 1CEJA 2Y8RA 2QY0A 1ATBA 3ZLEA 2BZMA 3N8VA 3HS7A 1TLEA 1RFNB 1HAEA 1XKBA 1QFKL 1IJQA 3GISX 2EI7B 4FXGG 1UOTP 3T5OA 5JBCE 2W80A 4A94C 4LOSA 1URKA 1HFIA 1APQA 2WPME 3V65B 5KN5C 1NFUB 5IKQA 1AUTL 2FZZL 2Y81B 3WSYA 2VH6B 3LTFB 1MD8A 3U7UG 3MQLA 3ZD1A 3KK6A 4BTIA 2VVCK 4JZDL 4Z0KB 4D0FA 2XQWC 3H5CB 1IQKL 4O1ZA 2VVVL 1MQ5L 4RS0A 4K12A 2Y82B 4X8UL 4KKDA 1B9WA 4Y79B 4MUCA 1E5GA 1F0RB 1EPJA 2H9EC 2B5ID 4B2RA 1QO6A 5CISA 1ATDA
chains in the Genus database with same CATH topology
3M7PA 1QUBA 1EZQB 3OP8A 1EMNA 2KNIA 1A3PA 1HAFA 2OYUP 1LMJA 2PUQL 2MGPA 4YT7L 3HO5A 1N7DA 2VWOL 3EGFA 2FLBL 1EQHA 4Y76B 2WIIC 1E8BA 5FO8C 1PFXL 1K37A 1UZJA 2XRDA 3ELAL 3F6UL 2WPKE 1LPZA 2NPRA 4CSYA 1APOA 3TGFA 1CVWL 4A5WB 1QGBA 2JGXA 3ZYJB 3CENL 1EQGA 1YGCL 1EMOA 2RLQA 1V3XB 4J38B 2P3UA 5L30L 2BQ7A 2W2QE 1J9CL 5KIRA 4ZH1D 2Q1JB 1UZPA 1IQJL 3V64C 4O02B 1MOXC 2W81A 3L89M 3N8WA 2RLPA 3ENSA 2P93L 1LPKA 5I46L 1XFEA 5E8DA 4NG9L 2I9AA 1JBUL 5HZPB 1UZQA 5I0QB 3N8YB 1LPGA 3LAQA 3FBYA 3HO3A 1G2MB 3OXUD 2RA0L 5JW1A 1X7AL 5CKQA 2WG4B 3LTGD 3KZJA 1LY2A 2H9EL 3LC3B 1CCVA 2W26B 2K2SB 2JGWA 2V8EA 3GCWE 2J34B 5L2ZL 5IKRA 1E88A 1VVDA 1HCCA 2BQWA 1OK3A 3KL6B 1BF9A 2K2TA 4YZUB 4G1MB 1P0SL 2P94L 1G1TA 2KL7A 4ZXYL 1DQBA 3QCWA 2RNLA 1YUFA 2XBVL 2P3TA 5K0HB 4X8VL 3PGHA 3SOVA 1IQHL 4E1GA 1IP0A 4BDWA 4RRXA 1U5MA 2BO2A 2UWOB 1HZ8A 2P3FN 4WJG2 4AYMA 2XC5L 3DEMA 1SZBA 1EPIA 3R62A 4D0EA 2I9BA 1HX2A 1DX5I 3RJ3D 2WPHE 3IU3I 5IKTA 4YT6L 2WFXB 2P28B 1KLOA 1FE2A 2W2PE 2W86A 4JZFL 4PH9A 2XBYL 2RKZA 4AYEA 1HREA 2G00L 2XBXL 3KQDL 2WFTA 4JYUL 5HYPA 1PTHA 4Y71B 1OJWA 4OTYA 3IITB 5JBBE 3TBDA 1NQLB 1G4GA 3OLTA 1CCFA 1F0SB 2PHBB 4XBMA 6COXA 2D1JB 3RR3A 1M1XB 1ELVA 3TK6B 1EAIC 1G1RA 1MQ6L 2WPJE 3FFGL 3CALA 3M36L 3GCXE 3SW2A 4M11A 2BOUA 2WZPP 3Q7DA 4JHSA 1MD7A 2KMSA 3CS7L 2J2UB 4LMFA 3ERBA 3P5BL 2Y5GL 5COXA 4Y7BB 2GD4A 2MHPA 2CJIB 3U73A 4PZ5A 2J95B 1TPMA 2IZ4A 1H04P 2EI6B 1TOZA 5HYTB 2OYEP 1FAKL 2ADXA 2BMGA 4JYVL 2RKYA 1DDXA 4XLWA 2A55A 4B2SA 1OK1A 4BXWA 3O8EB 1DIYA 3LN0A 4X8SL 3INBC 2VWMK 4ZHAB 4ISIL 5CKNA 1IOXA 3KRKA 1VVCA 4AYIA 1JL9A 4CUEA 5JPMG 2RL0A 3TK5B 3MDLA 3OEDC 1TPGA 1G4FA 4TGFA 3NFPI 1IQLL 1IQEL 3R05A 1COUA 1FFMA 2YRAA 3CA7A 4LOTA 1W8BL 3NTGA 3S6XA 1NFYB 2XC0L 2Y5HL 2VWLL 4RRWA 4MMZB 1ATAA 2KRIA 1OK9A 2UWNA 2PR3B 2CKUA 1G1QA 5CKMA 1U8CB 1F7EA 3HS5A 1Q4GA 3QMOA 4XL1A 4COXA 1FSBA 2EI8B 2CG6A 3SW0X 2UWPB 3ZYIB 1YO8A 2EC3A 1IQNL 2W2ME 2FLGA 1CX2A 3HPTA 3IJEB 4BTUA 3C9AC 4C16A 2J38B 1GPZA 1KSNB 4MMXB 1O5DL 2Y80B 1NZIA 2WG3C 1C1ZA 2BOXA 5HYUB 2YGPA 2FD6A 4AYDA 1EBVA 1NFXB 5F19A 3ZD2A 1OJYA 4Z6AL 4Y7AB 1OJVA 1IOEL 2G7IA 1GKNA 3KQBL 1FBRA 3SOQA 3EJHA 2KV4A 4FM5A 5F1AA 1P9JA 1WU1B 3KQEL 4MMYB 1KIGL 5JVYA 2BOHA 2TGFA 1PRHA 4ISHL 1HRFA 3TVJA 4CUFA 3LN1A 1PXXA 2WPLE 1ZJKA 2KB9A 2BQ6A 1UZKA 1HT5A 1N1IA 1HFHA 3GXEA 4YNXA 2M74A 1H2QP 2F9BL 4ZH8B 4A7IA 1H03P 3NJPC 3LC5B 3BT2A 1WHFA 1Z92B 2YGOA 1PGEA 1KLJL 1KLIL 1NFWB 2JKHL 2XBWL 2YGQA 2P3FL 3BT1A 1JV2B 1IQGL 3ASIA 4BXSA 4NGAL 2W2NE 3KQCL 1EPHA 2Y7ZB 1G1SA 1Q3XA 3N8ZA 2O39C 3GOVA 5JVZA 1YUGA 1TPNA 1NT0A 2P16L 5JB9E 4BTTA 4ONTD 2RHPA 4M10A 1HCGB 4JZEL 2VWNL 4BDXA 5EGMB 2UWLB 4RRZA 1CVUA 3BPSE 1U67A 1ZAQA 1CKLA 2J94B 3IX0A 3K9XA 3QH0A 1IGXA 2Y38A 2W2OE 1IQML 1HT8A 2P26A 1Z6CA 3F1SB 4RRYA 2Y5FL 3MQEA 1ATEA 1ADXA 4ZAEB 3N8XA 1FF7A 1CQEA 4NA9L 1OK2A 2WYJB 3LIWB 2LOJA 1NPEB 1L3YA 2FLRL 1I0UA 1DVAL 4F4OC 4X8TL 2CG7A 4Y6DB 1PPQA 3NTBA 2JRAA 1FAXL 1GHQB 1NWVA 5FDQA 3OLUA 2AYLA 4D90A 3N8YA 4RUTA 1IGZA 1EGFA 2WYGB 3KXVA 2ERJA 2XC4L 2EHFA 2XWJI 1XDTR 2Y7XB 2MCZA 4LORA 4DJZA 2BOKL 4AQTA 1LQDA 3KCGL 3TZIA 1HJ7A 2XRBA 1Z6EL 1IVOC 2VJ3A 4CUDA 1H2PP 4ZXXL 1SS2A 3ZYGA 1OB1C 3POYA 3N8WB 1GK5A 3Q3KB 3SOBB 2YBYA 5L2YL 2VH0B 2J4IB 2VVUL 2MGRA 3ZRZA 1O9AA 2W3KB 2WPIE 3FCSB 1C5MF 5JBAE 2B7DL 5IKVA 1F7MA 1W7XL 1YUKB 4IGDA 3NT1A 2IZ3A 2BZ6L 3M37L 1FJSL 1G2LB 1IQIL 3HS6A 5JB8E 2DDUA 1L5GB 1XKAL 2MCYA 3TH3L 1WHEA 1EPGA 4Z0LA 1GKGA 2XWBF 4OTJA 2W3IB 3CFWA 3HO4A 1K36A 1IQFL 1SRZA 1LMMA 2P95L 1CEJA 2QY0A 1ATBA 2BZMA 3N8VA 3HS7A 1TLEA 1RFNB 1HAEA 1XKBA 1QFKL 1IJQA 3GISX 2EI7B 4FXGG 1UOTP 3T5OA 5JBCE 2W80A 4A94C 4LOSA 1URKA 1HFIA 1APQA 2WPME 3V65B 5KN5C 1NFUB 5IKQA 1AUTL 2FZZL 2Y81B 2VH6B 3LTFB 1MD8A 3U7UG 3MQLA 3ZD1A 3KK6A 4BTIA 2VVCK 4JZDL 4Z0KB 4D0FA 2XQWC 3H5CB 1IQKL 4O1ZA 2VVVL 1MQ5L 4RS0A 4K12A 2Y82B 4X8UL 4KKDA 1B9WA 4Y79B 4MUCA 1E5GA 1F0RB 1EPJA 2H9EC 2B5ID 4B2RA 1QO6A 5CISA 1ATDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7P A;  1QUB A;  1EZQ B;  3OP8 A;  1EMN A;  1A3P A;  1HAF A;  2OYU P;  1LMJ A;  2PUQ L;  2MGP A;  4YT7 L;  3HO5 A;  1N7D A;  2VWO L;  3EGF A;  2FLB L;  1EQH A;  4Y76 B;  2WII C;  1E8B A;  5FO8 C;  1PFX L;  1K37 A;  1UZJ A;  2XRD A;  3ELA L;  3F6U L;  2WPK E;  1LPZ A;  2NPR A;  4CSY A;  1APO A;  3TGF A;  1CVW L;  4A5W B;  1QGB A;  2JGX A;  3ZYJ B;  3CEN L;  1EQG A;  1YGC L;  1EMO A;  2RLQ A;  1V3X B;  4J38 B;  2P3U A;  5L30 L;  2BQ7 A;  2W2Q E;  1J9C L;  5KIR A;  4ZH1 D;  2Q1J B;  1UZP A;  1IQJ L;  3V64 C;  4O02 B;  1MOX C;  2W81 A;  3L89 M;  3N8W A;  2RLP A;  3ENS A;  2P93 L;  1LPK A;  5I46 L;  1XFE A;  5E8D A;  4NG9 L;  2I9A A;  1JBU L;  5HZP B;  1UZQ A;  5I0Q B;  3N8Y B;  1LPG A;  3LAQ A;  3FBY A;  3HO3 A;  1G2M B;  3OXU D;  2RA0 L;  5JW1 A;  1X7A L;  5CKQ A;  2WG4 B;  3LTG D;  3KZJ A;  1LY2 A;  2H9E L;  3LC3 B;  1CCV A;  2W26 B;  2K2S B;  2JGW A;  2V8E A;  3GCW E;  2J34 B;  5L2Z L;  5IKR A;  1E88 A;  1VVD A;  1HCC A;  2BQW A;  1OK3 A;  3KL6 B;  1BF9 A;  2K2T A;  4YZU B;  4G1M B;  1P0S L;  2P94 L;  1G1T A;  2KL7 A;  4ZXY L;  1DQB A;  3QCW A;  2RNL A;  1YUF A;  2XBV L;  2P3T A;  5K0H B;  4X8V L;  3PGH A;  3SOV A;  1IQH L;  4E1G A;  1IP0 A;  4BDW A;  4RRX A;  1U5M A;  2BO2 A;  2UWO B;  1HZ8 A;  2P3F N;  4WJG 2;  4AYM A;  2XC5 L;  3DEM A;  1SZB A;  1EPI A;  3R62 A;  4D0E A;  2I9B A;  1HX2 A;  1DX5 I;  3RJ3 D;  2WPH E;  3IU3 I;  5IKT A;  4YT6 L;  2WFX B;  2P28 B;  1KLO A;  1FE2 A;  2W2P E;  2W86 A;  4JZF L;  4PH9 A;  2XBY L;  2RKZ A;  4AYE A;  1HRE A;  2G00 L;  2XBX L;  3KQD L;  2WFT A;  4JYU L;  5HYP A;  1PTH A;  4Y71 B;  1OJW A;  4OTY A;  3IIT B;  5JBB E;  3TBD A;  1NQL B;  1G4G A;  3OLT A;  1CCF A;  1F0S B;  2PHB B;  4XBM A;  6COX A;  2D1J B;  3RR3 A;  1M1X B;  1ELV A;  3TK6 B;  1EAI C;  1G1R A;  1MQ6 L;  2WPJ E;  3FFG L;  3CAL A;  3M36 L;  3GCX E;  3SW2 A;  4M11 A;  2BOU A;  3Q7D A;  4JHS A;  1MD7 A;  2KMS A;  3CS7 L;  2J2U B;  4LMF A;  3ERB A;  3P5B L;  2Y5G L;  5COX A;  4Y7B B;  2GD4 A;  2MHP A;  2CJI B;  3U73 A;  4PZ5 A;  2J95 B;  1TPM A;  2IZ4 A;  1H04 P;  2EI6 B;  1TOZ A;  5HYT B;  2OYE P;  1FAK L;  2ADX A;  2BMG A;  4JYV L;  2RKY A;  1DDX A;  4XLW A;  2A55 A;  4B2S A;  1OK1 A;  4BXW A;  3O8E B;  1DIY A;  3LN0 A;  4X8S L;  3INB C;  2VWM K;  4ZHA B;  4ISI L;  5CKN A;  1IOX A;  3KRK A;  1VVC A;  4AYI A;  1JL9 A;  4CUE A;  5JPM G;  2RL0 A;  3TK5 B;  3MDL A;  3OED C;  1TPG A;  1G4F A;  4TGF A;  3NFP I;  1IQL L;  1IQE L;  3R05 A;  1COU A;  1FFM A;  2YRA A;  3CA7 A;  4LOT A;  1W8B L;  3NTG A;  1NFY B;  2XC0 L;  2Y5H L;  2VWL L;  4RRW A;  4MMZ B;  1ATA A;  2KRI A;  1OK9 A;  2UWN A;  2PR3 B;  2CKU A;  1G1Q A;  5CKM A;  1U8C B;  1F7E A;  3HS5 A;  1Q4G A;  3QMO A;  4XL1 A;  4COX A;  1FSB A;  2EI8 B;  2CG6 A;  3SW0 X;  2UWP B;  3ZYI B;  1YO8 A;  2EC3 A;  1IQN L;  2W2M E;  2FLG A;  1CX2 A;  3HPT A;  3IJE B;  4BTU A;  3C9A C;  4C16 A;  2J38 B;  1GPZ A;  1KSN B;  4MMX B;  1O5D L;  2Y80 B;  1NZI A;  2WG3 C;  1C1Z A;  2BOX A;  5HYU B;  2YGP A;  2FD6 A;  4AYD A;  1EBV A;  1NFX B;  5F19 A;  3ZD2 A;  1OJY A;  4Z6A L;  4Y7A B;  1OJV A;  1IOE L;  2G7I A;  1GKN A;  3KQB L;  1FBR A;  3SOQ A;  3EJH A;  2KV4 A;  4FM5 A;  5F1A A;  1P9J A;  1WU1 B;  3KQE L;  4MMY B;  1KIG L;  5JVY A;  2BOH A;  2TGF A;  1PRH A;  4ISH L;  1HRF A;  3TVJ A;  4CUF A;  3LN1 A;  1PXX A;  2WPL E;  1ZJK A;  2KB9 A;  2BQ6 A;  1UZK A;  1HT5 A;  1N1I A;  1HFH A;  3GXE A;  4YNX A;  2M74 A;  1H2Q P;  2F9B L;  4ZH8 B;  4A7I A;  1H03 P;  3NJP C;  3LC5 B;  3BT2 A;  1WHF A;  1Z92 B;  2YGO A;  1PGE A;  1KLJ L;  1KLI L;  1NFW B;  2JKH L;  2XBW L;  2P3F L;  3BT1 A;  1JV2 B;  1IQG L;  3ASI A;  4BXS A;  4NGA L;  2W2N E;  3KQC L;  1EPH A;  2Y7Z B;  1G1S A;  1Q3X A;  3N8Z A;  2O39 C;  3GOV A;  5JVZ A;  1YUG A;  1TPN A;  1NT0 A;  2P16 L;  5JB9 E;  4BTT A;  4ONT D;  2RHP A;  4M10 A;  1HCG B;  4JZE L;  2VWN L;  4BDX A;  5EGM B;  2UWL B;  4RRZ A;  1CVU A;  3BPS E;  1U67 A;  1ZAQ A;  1CKL A;  2J94 B;  3IX0 A;  3K9X A;  3QH0 A;  1IGX A;  2Y38 A;  2W2O E;  1IQM L;  1HT8 A;  2P26 A;  1Z6C A;  3F1S B;  4RRY A;  2Y5F L;  3MQE A;  1ATE A;  1ADX A;  4ZAE B;  3N8X A;  1FF7 A;  1CQE A;  4NA9 L;  1OK2 A;  2WYJ B;  3LIW B;  2LOJ A;  1NPE B;  1L3Y A;  2FLR L;  1I0U A;  1DVA L;  4F4O C;  4X8T L;  2CG7 A;  4Y6D B;  1PPQ A;  3NTB A;  2JRA A;  1FAX L;  1GHQ B;  1NWV A;  5FDQ A;  3OLU A;  2AYL A;  4D90 A;  3N8Y A;  4RUT A;  1IGZ A;  1EGF A;  2WYG B;  3KXV A;  2ERJ A;  2XC4 L;  2EHF A;  2XWJ I;  1XDT R;  2Y7X B;  2MCZ A;  4LOR A;  4DJZ A;  2BOK L;  4AQT A;  1LQD A;  3KCG L;  3TZI A;  1HJ7 A;  2XRB A;  1Z6E L;  1IVO C;  2VJ3 A;  4CUD A;  1H2P P;  4ZXX L;  1SS2 A;  3ZYG A;  1OB1 C;  3POY A;  3N8W B;  1GK5 A;  3Q3K B;  3SOB B;  2YBY A;  5L2Y L;  2VH0 B;  2J4I B;  2VVU L;  2MGR A;  3ZRZ A;  1O9A A;  2W3K B;  2WPI E;  3FCS B;  1C5M F;  5JBA E;  2B7D L;  5IKV A;  1F7M A;  1W7X L;  1YUK B;  4IGD A;  3NT1 A;  2IZ3 A;  2BZ6 L;  3M37 L;  1FJS L;  1G2L B;  1IQI L;  3HS6 A;  5JB8 E;  2DDU A;  1L5G B;  1XKA L;  2MCY A;  3TH3 L;  1WHE A;  1EPG A;  4Z0L A;  1GKG A;  2XWB F;  4OTJ A;  2W3I B;  3CFW A;  3HO4 A;  1K36 A;  1IQF L;  1SRZ A;  2P95 L;  1CEJ A;  2QY0 A;  1ATB A;  2BZM A;  3N8V A;  3HS7 A;  1TLE A;  1RFN B;  1HAE A;  1XKB A;  1QFK L;  1IJQ A;  3GIS X;  2EI7 B;  4FXG G;  1UOT P;  3T5O A;  5JBC E;  2W80 A;  4LOS A;  1URK A;  1HFI A;  1APQ A;  2WPM E;  3V65 B;  5KN5 C;  1NFU B;  5IKQ A;  1AUT L;  2FZZ L;  2Y81 B;  2VH6 B;  3LTF B;  1MD8 A;  3U7U G;  3MQL A;  3ZD1 A;  3KK6 A;  4BTI A;  2VVC K;  4JZD L;  4Z0K B;  4D0F A;  2XQW C;  3H5C B;  1IQK L;  4O1Z A;  2VVV L;  1MQ5 L;  4RS0 A;  4K12 A;  2Y82 B;  4X8U L;  4KKD A;  1B9W A;  4Y79 B;  4MUC A;  1E5G A;  1F0R B;  1EPJ A;  2B5I D;  4B2R A;  1QO6 A;  5CIS A;  1ATD A; 
#chains in the Genus database with same CATH topology
 3M7P A;  1QUB A;  1EZQ B;  3OP8 A;  1EMN A;  2KNI A;  1A3P A;  1HAF A;  2OYU P;  1LMJ A;  2PUQ L;  2MGP A;  2HOR A;  3ZLD A;  4YT7 L;  3HO5 A;  1N7D A;  2VWO L;  3EGF A;  2FLB L;  1EQH A;  4Y76 B;  2WII C;  1E8B A;  5FO8 C;  1PFX L;  1K37 A;  1UZJ A;  2XRD A;  3ELA L;  4APL A;  3F6U L;  2WPK E;  1LPZ A;  2NPR A;  4CSY A;  1APO A;  3TGF A;  1CVW L;  4A5W B;  1QGB A;  2JGX A;  3ZYJ B;  3CEN L;  1EQG A;  1YGC L;  1EMO A;  3FGT A;  2RLQ A;  1V3X B;  4J38 B;  2P3U A;  5L30 L;  2BQ7 A;  2W2Q E;  1J9C L;  5KIR A;  4ZH1 D;  2Q1J B;  1UZP A;  1IQJ L;  3V64 C;  4O02 B;  1MOX C;  2W81 A;  3L89 M;  3N8W A;  2RLP A;  3ENS A;  2P93 L;  1LPK A;  5I46 L;  1XFE A;  5E8D A;  4NG9 L;  4MSL A;  2I9A A;  4BWC A;  1JBU L;  5HZP B;  1UZQ A;  5I0Q B;  3N8Y B;  1LPG A;  3LAQ A;  3FBY A;  3HO3 A;  1G2M B;  3OXU D;  2RA0 L;  5JW1 A;  1X7A L;  5CKQ A;  2WG4 B;  3LTG D;  3KZJ A;  1LY2 A;  2H9E L;  3LC3 B;  1CCV A;  2W26 B;  2K2S B;  2JGW A;  2V8E A;  3GCW E;  2J34 B;  5L2Z L;  5DN5 A;  5IKR A;  1E88 A;  1VVD A;  1HCC A;  2BQW A;  1OK3 A;  3KL6 B;  1BF9 A;  2K2T A;  4YZU B;  4G1M B;  1LK9 A;  1P0S L;  2P94 L;  1G1T A;  2KL7 A;  4ZXY L;  1DQB A;  3QCW A;  2RNL A;  1YUF A;  2XBV L;  2P3T A;  3WSX A;  5K0H B;  4X8V L;  3PGH A;  3SOV A;  1IQH L;  4E1G A;  1IP0 A;  4BDW A;  4RRX A;  1U5M A;  2BO2 A;  2UWO B;  1HZ8 A;  2P3F N;  4WJG 2;  4AYM A;  2XC5 L;  3DEM A;  1SZB A;  1EPI A;  3R62 A;  4D0E A;  2I9B A;  1HX2 A;  1DX5 I;  3RJ3 D;  2WPH E;  3IU3 I;  5IKT A;  4YT6 L;  2WFX B;  2P28 B;  1KLO A;  1FE2 A;  2W2P E;  2W86 A;  4JZF L;  4PH9 A;  2XBY L;  2RKZ A;  4AYE A;  1HRE A;  2G00 L;  2XBX L;  3KQD L;  2WFT A;  4JYU L;  3VWO A;  5HYP A;  1PTH A;  4Y71 B;  1OJW A;  4OTY A;  3IIT B;  5JBB E;  3TBD A;  1NQL B;  1G4G A;  3OLT A;  1CCF A;  1F0S B;  2PHB B;  4XBM A;  6COX A;  2D1J B;  3RR3 A;  1M1X B;  1ELV A;  3TK6 B;  1EAI C;  1G1R A;  1MQ6 L;  2WPJ E;  3FFG L;  3CAL A;  3M36 L;  3GCX E;  3SW2 A;  4M11 A;  2BOU A;  2WZP P;  2BT8 A;  3Q7D A;  4JHS A;  1MD7 A;  2KMS A;  3CS7 L;  2J2U B;  4LMF A;  3ERB A;  3P5B L;  2Y5G L;  5COX A;  4Y7B B;  2GD4 A;  2MHP A;  2CJI B;  3U73 A;  4PZ5 A;  2J95 B;  1TPM A;  2IZ4 A;  1H04 P;  2EI6 B;  1TOZ A;  5HYT B;  2OYE P;  1FAK L;  2ADX A;  2BMG A;  4JYV L;  2RKY A;  1DDX A;  4XLW A;  2A55 A;  4B2S A;  1OK1 A;  4BXW A;  3O8E B;  1DIY A;  3LN0 A;  4GU3 A;  4X8S L;  3INB C;  4N7E A;  2VWM K;  4ZHA B;  4ISI L;  5CKN A;  1IOX A;  3KRK A;  1VVC A;  4AYI A;  1JL9 A;  4CUE A;  5JPM G;  1V1H A;  2RL0 A;  3TK5 B;  3MDL A;  3OED C;  4YIZ A;  1TPG A;  1G4F A;  4TGF A;  3NFP I;  1IQL L;  1IQE L;  3R05 A;  1V1I A;  2BSF A;  1COU A;  1FFM A;  2YRA A;  2BT7 A;  3CA7 A;  4LOT A;  1W8B L;  3NTG A;  3S6X A;  1NFY B;  2XC0 L;  2Y5H L;  2VWL L;  4RRW A;  4MMZ B;  1ATA A;  2KRI A;  1OK9 A;  2UWN A;  2PR3 B;  2CKU A;  1G1Q A;  5CKM A;  2ZYC A;  1U8C B;  2HOX A;  1F7E A;  3HS5 A;  1Q4G A;  3QMO A;  4XL1 A;  4COX A;  1FSB A;  2EI8 B;  2CG6 A;  3SW0 X;  2UWP B;  3ZYI B;  1YO8 A;  2EC3 A;  1IQN L;  2W2M E;  2FLG A;  1CX2 A;  3HPT A;  3IJE B;  4BTU A;  3C9A C;  4C16 A;  2J38 B;  1GPZ A;  5DN4 A;  1KSN B;  4MMX B;  1O5D L;  2Y80 B;  1NZI A;  2WG3 C;  1C1Z A;  2BOX A;  5HYU B;  2YGP A;  2FD6 A;  4AYD A;  1EBV A;  1NFX B;  5F19 A;  3ZD2 A;  1OJY A;  4Z6A L;  4Y7A B;  1OJV A;  1IOE L;  2G7I A;  1GKN A;  2JJL A;  3KQB L;  1FBR A;  3SOQ A;  3EJH A;  2KV4 A;  4FM5 A;  5F1A A;  1P9J A;  1WU1 B;  3KQE L;  4MMY B;  1KIG L;  5JVY A;  2BOH A;  2TGF A;  1PRH A;  4ISH L;  1HRF A;  3TVJ A;  4CUF A;  3LN1 A;  1PXX A;  2WPL E;  1ZJK A;  2KB9 A;  2BQ6 A;  1UZK A;  1HT5 A;  1N1I A;  1HFH A;  3GXE A;  1KKE A;  3NJA A;  2M74 A;  4YNX A;  1H2Q P;  2X2Z A;  2F9B L;  4ZH8 B;  4A7I A;  1H03 P;  3NJP C;  3LC5 B;  3BT2 A;  1WHF A;  1Z92 B;  2YGO A;  1PGE A;  1KLJ L;  3F6K A;  1KLI L;  1NFW B;  2JKH L;  2Y8S A;  2XBW L;  2YGQ A;  2P3F L;  3BT1 A;  1JV2 B;  1IQG L;  3ASI A;  4BXS A;  4NGA L;  2W2N E;  3KQC L;  1EPH A;  2Y7Z B;  1G1S A;  1Q3X A;  3N8Z A;  2O39 C;  3GOV A;  5JVZ A;  1YUG A;  3FGR A;  1TPN A;  1NT0 A;  2P16 L;  5JB9 E;  4BTT A;  4ONT D;  2RHP A;  4M10 A;  1HCG B;  4JZE L;  2VWN L;  4BDX A;  5EGM B;  2UWL B;  4GU4 A;  4RRZ A;  1CVU A;  3BPS E;  1U67 A;  1ZAQ A;  1CKL A;  2J94 B;  3IX0 A;  3K9X A;  3QH0 A;  1IGX A;  2Y38 A;  2W2O E;  1IQM L;  1HT8 A;  2P26 A;  3CI0 J;  1Z6C A;  3F1S B;  4RRY A;  2Y5F L;  1QIU A;  3MQE A;  1ATE A;  1ADX A;  4ZAE B;  3N8X A;  1FF7 A;  1CQE A;  4NA9 L;  1OK2 A;  2Y8T A;  2WYJ B;  3LIW B;  2LOJ A;  1NPE B;  1L3Y A;  2FLR L;  1I0U A;  1DVA L;  4F4O C;  2VRS A;  4X8T L;  2CG7 A;  4PO7 A;  4Y6D B;  1PPQ A;  3NTB A;  2JRA A;  1FAX L;  1GHQ B;  1NWV A;  5FDQ A;  3OLU A;  2AYL A;  4D90 A;  3N8Y A;  4RUT A;  1IGZ A;  1EGF A;  2WYG B;  3KXV A;  2ERJ A;  2XC4 L;  2EHF A;  2XWJ I;  1XDT R;  2Y7X B;  2MCZ A;  4LOR A;  4DJZ A;  2BOK L;  4AQT A;  1LQD A;  3KCG L;  3TZI A;  1HJ7 A;  2XRB A;  1Z6E L;  1IVO C;  2VJ3 A;  4CUD A;  1H2P P;  4ZXX L;  1SS2 A;  3ZYG A;  1OB1 C;  3POY A;  3N8W B;  1GK5 A;  3Q3K B;  3SOB B;  2YBY A;  5L2Y L;  2VH0 B;  2J4I B;  2VVU L;  2MGR A;  2I2L A;  3ZRZ A;  1O9A A;  2W3K B;  2WPI E;  3FCS B;  1C5M F;  5JBA E;  2B7D L;  5IKV A;  1F7M A;  1W7X L;  1YUK B;  4IGD A;  3NT1 A;  2IZ3 A;  2BZ6 L;  3M37 L;  1FJS L;  1G2L B;  1IQI L;  3HS6 A;  5JB8 E;  2DDU A;  3K3T A;  1L5G B;  1XKA L;  1RLH A;  2MCY A;  3TH3 L;  1WHE A;  1EPG A;  4Z0L A;  1GKG A;  2XWB F;  4OTJ A;  2W3I B;  3CFW A;  3HO4 A;  1K36 A;  1IQF L;  1SRZ A;  1LMM A;  2P95 L;  1CEJ A;  2Y8R A;  2QY0 A;  1ATB A;  3ZLE A;  2BZM A;  3N8V A;  3HS7 A;  1TLE A;  1RFN B;  1HAE A;  1XKB A;  1QFK L;  1IJQ A;  3GIS X;  2EI7 B;  4FXG G;  1UOT P;  3T5O A;  5JBC E;  2W80 A;  4A94 C;  4LOS A;  1URK A;  1HFI A;  1APQ A;  2WPM E;  3V65 B;  5KN5 C;  1NFU B;  5IKQ A;  1AUT L;  2FZZ L;  2Y81 B;  3WSY A;  2VH6 B;  3LTF B;  1MD8 A;  3U7U G;  3MQL A;  3ZD1 A;  3KK6 A;  4BTI A;  2VVC K;  4JZD L;  4Z0K B;  4D0F A;  2XQW C;  3H5C B;  1IQK L;  4O1Z A;  2VVV L;  1MQ5 L;  4RS0 A;  4K12 A;  2Y82 B;  4X8U L;  4KKD A;  1B9W A;  4Y79 B;  4MUC A;  1E5G A;  1F0R B;  1EPJ A;  2H9E C;  2B5I D;  4B2R A;  1QO6 A;  5CIS A;  1ATD A; 
#chains in the Genus database with same CATH homology
 3M7P A;  1QUB A;  1EZQ B;  3OP8 A;  1EMN A;  2KNI A;  1A3P A;  1HAF A;  2OYU P;  1LMJ A;  2PUQ L;  2MGP A;  4YT7 L;  3HO5 A;  1N7D A;  2VWO L;  3EGF A;  2FLB L;  1EQH A;  4Y76 B;  2WII C;  1E8B A;  5FO8 C;  1PFX L;  1K37 A;  1UZJ A;  2XRD A;  3ELA L;  3F6U L;  2WPK E;  1LPZ A;  2NPR A;  4CSY A;  1APO A;  3TGF A;  1CVW L;  4A5W B;  1QGB A;  2JGX A;  3ZYJ B;  3CEN L;  1EQG A;  1YGC L;  1EMO A;  2RLQ A;  1V3X B;  4J38 B;  2P3U A;  5L30 L;  2BQ7 A;  2W2Q E;  1J9C L;  5KIR A;  4ZH1 D;  2Q1J B;  1UZP A;  1IQJ L;  3V64 C;  4O02 B;  1MOX C;  2W81 A;  3L89 M;  3N8W A;  2RLP A;  3ENS A;  2P93 L;  1LPK A;  5I46 L;  1XFE A;  5E8D A;  4NG9 L;  2I9A A;  1JBU L;  5HZP B;  1UZQ A;  5I0Q B;  3N8Y B;  1LPG A;  3LAQ A;  3FBY A;  3HO3 A;  1G2M B;  3OXU D;  2RA0 L;  5JW1 A;  1X7A L;  5CKQ A;  2WG4 B;  3LTG D;  3KZJ A;  1LY2 A;  2H9E L;  3LC3 B;  1CCV A;  2W26 B;  2K2S B;  2JGW A;  2V8E A;  3GCW E;  2J34 B;  5L2Z L;  5IKR A;  1E88 A;  1VVD A;  1HCC A;  2BQW A;  1OK3 A;  3KL6 B;  1BF9 A;  2K2T A;  4YZU B;  4G1M B;  1P0S L;  2P94 L;  1G1T A;  2KL7 A;  4ZXY L;  1DQB A;  3QCW A;  2RNL A;  1YUF A;  2XBV L;  2P3T A;  5K0H B;  4X8V L;  3PGH A;  3SOV A;  1IQH L;  4E1G A;  1IP0 A;  4BDW A;  4RRX A;  1U5M A;  2BO2 A;  2UWO B;  1HZ8 A;  2P3F N;  4WJG 2;  4AYM A;  2XC5 L;  3DEM A;  1SZB A;  1EPI A;  3R62 A;  4D0E A;  2I9B A;  1HX2 A;  1DX5 I;  3RJ3 D;  2WPH E;  3IU3 I;  5IKT A;  4YT6 L;  2WFX B;  2P28 B;  1KLO A;  1FE2 A;  2W2P E;  2W86 A;  4JZF L;  4PH9 A;  2XBY L;  2RKZ A;  4AYE A;  1HRE A;  2G00 L;  2XBX L;  3KQD L;  2WFT A;  4JYU L;  5HYP A;  1PTH A;  4Y71 B;  1OJW A;  4OTY A;  3IIT B;  5JBB E;  3TBD A;  1NQL B;  1G4G A;  3OLT A;  1CCF A;  1F0S B;  2PHB B;  4XBM A;  6COX A;  2D1J B;  3RR3 A;  1M1X B;  1ELV A;  3TK6 B;  1EAI C;  1G1R A;  1MQ6 L;  2WPJ E;  3FFG L;  3CAL A;  3M36 L;  3GCX E;  3SW2 A;  4M11 A;  2BOU A;  2WZP P;  3Q7D A;  4JHS A;  1MD7 A;  2KMS A;  3CS7 L;  2J2U B;  4LMF A;  3ERB A;  3P5B L;  2Y5G L;  5COX A;  4Y7B B;  2GD4 A;  2MHP A;  2CJI B;  3U73 A;  4PZ5 A;  2J95 B;  1TPM A;  2IZ4 A;  1H04 P;  2EI6 B;  1TOZ A;  5HYT B;  2OYE P;  1FAK L;  2ADX A;  2BMG A;  4JYV L;  2RKY A;  1DDX A;  4XLW A;  2A55 A;  4B2S A;  1OK1 A;  4BXW A;  3O8E B;  1DIY A;  3LN0 A;  4X8S L;  3INB C;  2VWM K;  4ZHA B;  4ISI L;  5CKN A;  1IOX A;  3KRK A;  1VVC A;  4AYI A;  1JL9 A;  4CUE A;  5JPM G;  2RL0 A;  3TK5 B;  3MDL A;  3OED C;  1TPG A;  1G4F A;  4TGF A;  3NFP I;  1IQL L;  1IQE L;  3R05 A;  1COU A;  1FFM A;  2YRA A;  3CA7 A;  4LOT A;  1W8B L;  3NTG A;  3S6X A;  1NFY B;  2XC0 L;  2Y5H L;  2VWL L;  4RRW A;  4MMZ B;  1ATA A;  2KRI A;  1OK9 A;  2UWN A;  2PR3 B;  2CKU A;  1G1Q A;  5CKM A;  1U8C B;  1F7E A;  3HS5 A;  1Q4G A;  3QMO A;  4XL1 A;  4COX A;  1FSB A;  2EI8 B;  2CG6 A;  3SW0 X;  2UWP B;  3ZYI B;  1YO8 A;  2EC3 A;  1IQN L;  2W2M E;  2FLG A;  1CX2 A;  3HPT A;  3IJE B;  4BTU A;  3C9A C;  4C16 A;  2J38 B;  1GPZ A;  1KSN B;  4MMX B;  1O5D L;  2Y80 B;  1NZI A;  2WG3 C;  1C1Z A;  2BOX A;  5HYU B;  2YGP A;  2FD6 A;  4AYD A;  1EBV A;  1NFX B;  5F19 A;  3ZD2 A;  1OJY A;  4Z6A L;  4Y7A B;  1OJV A;  1IOE L;  2G7I A;  1GKN A;  3KQB L;  1FBR A;  3SOQ A;  3EJH A;  2KV4 A;  4FM5 A;  5F1A A;  1P9J A;  1WU1 B;  3KQE L;  4MMY B;  1KIG L;  5JVY A;  2BOH A;  2TGF A;  1PRH A;  4ISH L;  1HRF A;  3TVJ A;  4CUF A;  3LN1 A;  1PXX A;  2WPL E;  1ZJK A;  2KB9 A;  2BQ6 A;  1UZK A;  1HT5 A;  1N1I A;  1HFH A;  3GXE A;  4YNX A;  2M74 A;  1H2Q P;  2F9B L;  4ZH8 B;  4A7I A;  1H03 P;  3NJP C;  3LC5 B;  3BT2 A;  1WHF A;  1Z92 B;  2YGO A;  1PGE A;  1KLJ L;  1KLI L;  1NFW B;  2JKH L;  2XBW L;  2YGQ A;  2P3F L;  3BT1 A;  1JV2 B;  1IQG L;  3ASI A;  4BXS A;  4NGA L;  2W2N E;  3KQC L;  1EPH A;  2Y7Z B;  1G1S A;  1Q3X A;  3N8Z A;  2O39 C;  3GOV A;  5JVZ A;  1YUG A;  1TPN A;  1NT0 A;  2P16 L;  5JB9 E;  4BTT A;  4ONT D;  2RHP A;  4M10 A;  1HCG B;  4JZE L;  2VWN L;  4BDX A;  5EGM B;  2UWL B;  4RRZ A;  1CVU A;  3BPS E;  1U67 A;  1ZAQ A;  1CKL A;  2J94 B;  3IX0 A;  3K9X A;  3QH0 A;  1IGX A;  2Y38 A;  2W2O E;  1IQM L;  1HT8 A;  2P26 A;  1Z6C A;  3F1S B;  4RRY A;  2Y5F L;  3MQE A;  1ATE A;  1ADX A;  4ZAE B;  3N8X A;  1FF7 A;  1CQE A;  4NA9 L;  1OK2 A;  2WYJ B;  3LIW B;  2LOJ A;  1NPE B;  1L3Y A;  2FLR L;  1I0U A;  1DVA L;  4F4O C;  4X8T L;  2CG7 A;  4Y6D B;  1PPQ A;  3NTB A;  2JRA A;  1FAX L;  1GHQ B;  1NWV A;  5FDQ A;  3OLU A;  2AYL A;  4D90 A;  3N8Y A;  4RUT A;  1IGZ A;  1EGF A;  2WYG B;  3KXV A;  2ERJ A;  2XC4 L;  2EHF A;  2XWJ I;  1XDT R;  2Y7X B;  2MCZ A;  4LOR A;  4DJZ A;  2BOK L;  4AQT A;  1LQD A;  3KCG L;  3TZI A;  1HJ7 A;  2XRB A;  1Z6E L;  1IVO C;  2VJ3 A;  4CUD A;  1H2P P;  4ZXX L;  1SS2 A;  3ZYG A;  1OB1 C;  3POY A;  3N8W B;  1GK5 A;  3Q3K B;  3SOB B;  2YBY A;  5L2Y L;  2VH0 B;  2J4I B;  2VVU L;  2MGR A;  3ZRZ A;  1O9A A;  2W3K B;  2WPI E;  3FCS B;  1C5M F;  5JBA E;  2B7D L;  5IKV A;  1F7M A;  1W7X L;  1YUK B;  4IGD A;  3NT1 A;  2IZ3 A;  2BZ6 L;  3M37 L;  1FJS L;  1G2L B;  1IQI L;  3HS6 A;  5JB8 E;  2DDU A;  1L5G B;  1XKA L;  2MCY A;  3TH3 L;  1WHE A;  1EPG A;  4Z0L A;  1GKG A;  2XWB F;  4OTJ A;  2W3I B;  3CFW A;  3HO4 A;  1K36 A;  1IQF L;  1SRZ A;  1LMM A;  2P95 L;  1CEJ A;  2QY0 A;  1ATB A;  2BZM A;  3N8V A;  3HS7 A;  1TLE A;  1RFN B;  1HAE A;  1XKB A;  1QFK L;  1IJQ A;  3GIS X;  2EI7 B;  4FXG G;  1UOT P;  3T5O A;  5JBC E;  2W80 A;  4A94 C;  4LOS A;  1URK A;  1HFI A;  1APQ A;  2WPM E;  3V65 B;  5KN5 C;  1NFU B;  5IKQ A;  1AUT L;  2FZZ L;  2Y81 B;  2VH6 B;  3LTF B;  1MD8 A;  3U7U G;  3MQL A;  3ZD1 A;  3KK6 A;  4BTI A;  2VVC K;  4JZD L;  4Z0K B;  4D0F A;  2XQW C;  3H5C B;  1IQK L;  4O1Z A;  2VVV L;  1MQ5 L;  4RS0 A;  4K12 A;  2Y82 B;  4X8U L;  4KKD A;  1B9W A;  4Y79 B;  4MUC A;  1E5G A;  1F0R B;  1EPJ A;  2H9E C;  2B5I D;  4B2R A;  1QO6 A;  5CIS A;  1ATD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...