1TPNA

Solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
50
structure length
50
Chain Sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TISSUE-TYPE PLASMINOGEN ACTIVATOR
publication title Solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1H nuclear magnetic resonance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Plasminogen activator
total genus 5
structure length 50
sequence length 50
ec nomenclature ec 3.4.21.68: T-plasminogen activator.
pdb deposition date 1993-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1tpnA00
2ERJA 1FBRA 4KKDA 2IZ3A 1G4FA 1UOTP 1HFHA 3OEDC 4LOTA 3OXUD 3TVJA 1E8BA 2UWNA 1GPZA 1TPNA 2RLQA 4ZH1D 1OK1A 2RKZA 1OK3A 1C1ZA 2CKUA 2XWBF 4AYDA 1LY2A 4K12A 4LOSA 1TPMA 3IU3I 2RL0A 2IZ4A 2V8EA 2XQWC 4JHSA 2BZMA 4AYMA 4ONTD 4A5WB 1QGBA 1G4GA 2W80A 1H2PP 1HCCA 4CSYA 1E5GA 2G7IA 4B2RA 2KMSA 4WJG2 4FXGG 3GXEA 2B5ID 1GKGA 4PZ5A 3OP8A 2RLPA 2QY0A 1H03P 3KXVA 5HZPB 2EC3A 1VVDA 1ELVA 3INBC 3NFPI 3ZD1A 2EHFA 2MCZA 3GOVA 1SRZA 4B2SA 2CG6A 1MD7A 2A55A 3RJ3D 1MD8A 1OK2A 5JPMG 1VVCA 2YRAA 1U5MA 5I0QB 1H2QP 2YBYA 2CG7A 3SW0X 4MUCA 2XRBA 1E88A 2LOJA 2W81A 4AYIA 5HYUB 3T5OA 4YNXA 4J38B 3M7PA 3ERBA 5HYPA 3MQLA 1CKLA 2RKYA 1Q3XA 3EJHA 2KRIA 3O8EB 1OJVA 1PPQA 1H04P 5HYTB 4AYEA 4IGDA 1SS2A 3CALA 2JRAA 2XRDA 4C16A 5FO8C 4F4OC 2JGXA 4DJZA 3KZJA 1O9AA 2WIIC 2MCYA 1GHQB 2JGWA 2O39C 1HFIA 1OK9A 1QUBA 1Z92B 1OJYA 3L89M 3ZD2A 3IX0A 3R62A 1GKNA 1ZJKA 1OJWA 3ZRZA 1QO6A 2XWJI 1TPGA 1NWVA
chains in the Genus database with same CATH superfamily
2ERJA 1FBRA 4KKDA 2IZ3A 1G4FA 1UOTP 1HFHA 3WSXA 3ZLEA 3OEDC 3VWOA 4LOTA 3OXUD 3TVJA 1E8BA 2UWNA 1GPZA 1TPNA 2RLQA 2ZYCA 4ZH1D 1OK1A 2Y8SA 2RKZA 1OK3A 1C1ZA 2CKUA 2XWBF 3WSYA 4AYDA 1LY2A 4K12A 4LOSA 1TPMA 3IU3I 2RL0A 2IZ4A 2V8EA 2XQWC 4JHSA 2BZMA 4AYMA 4ONTD 4A5WB 1QGBA 1G4GA 2W80A 1H2PP 4YIZA 1HCCA 4APLA 1RLHA 3FGTA 3K3TA 4CSYA 2G7IA 1E5GA 4B2RA 2KMSA 4WJG2 4FXGG 3GXEA 2X2ZA 3ZLDA 5DN5A 2B5ID 1GKGA 4PZ5A 3OP8A 2RLPA 2QY0A 1H03P 3KXVA 5HZPB 2EC3A 1VVDA 1ELVA 3INBC 3NFPI 3ZD1A 2EHFA 2MCZA 3GOVA 1SRZA 4B2SA 2CG6A 1MD7A 2A55A 3RJ3D 1MD8A 4PO7A 1OK2A 2Y8TA 5JPMG 1VVCA 2YRAA 1U5MA 5I0QB 4MSLA 1H2QP 2YBYA 2CG7A 3SW0X 4MUCA 2Y8RA 3CI0J 2XRBA 1E88A 2LOJA 2W81A 4AYIA 5HYUB 3T5OA 4YNXA 4J38B 3M7PA 3ERBA 5HYPA 3MQLA 1CKLA 2RKYA 1Q3XA 3EJHA 2KRIA 3O8EB 1OJVA 1PPQA 1H04P 5HYTB 4AYEA 4IGDA 1SS2A 3CALA 2JRAA 2XRDA 4C16A 5FO8C 4F4OC 3FGRA 3NJAA 2JGXA 4DJZA 3KZJA 1O9AA 2WIIC 3F6KA 2I2LA 1GHQB 2MCYA 2JGWA 2O39C 4BWCA 1HFIA 1OK9A 1QUBA 1Z92B 1OJYA 3L89M 3ZD2A 3IX0A 3R62A 1GKNA 1ZJKA 1OJWA 5DN4A 4N7EA 3ZRZA 1QO6A 2XWJI 1TPGA 1NWVA
chains in the Genus database with same CATH topology
2ERJA 1FBRA 4KKDA 2IZ3A 1G4FA 1UOTP 1HFHA 3OEDC 4LOTA 3OXUD 3TVJA 1E8BA 2UWNA 1GPZA 1TPNA 2RLQA 4ZH1D 1OK1A 2RKZA 1OK3A 1C1ZA 2CKUA 2XWBF 4AYDA 1LY2A 4K12A 4LOSA 1TPMA 3IU3I 2RL0A 2IZ4A 2V8EA 2XQWC 4JHSA 2BZMA 4AYMA 4ONTD 4A5WB 1QGBA 1G4GA 2W80A 1H2PP 1HCCA 4CSYA 1E5GA 2G7IA 4B2RA 2KMSA 4WJG2 4FXGG 3GXEA 2B5ID 1GKGA 4PZ5A 3OP8A 2RLPA 2QY0A 1H03P 3KXVA 5HZPB 2EC3A 1VVDA 1ELVA 3INBC 3NFPI 3ZD1A 2EHFA 2MCZA 3GOVA 1SRZA 4B2SA 2CG6A 1MD7A 2A55A 3RJ3D 1MD8A 1OK2A 5JPMG 1VVCA 2YRAA 1U5MA 5I0QB 1H2QP 2YBYA 2CG7A 3SW0X 4MUCA 2XRBA 1E88A 2LOJA 2W81A 4AYIA 5HYUB 3T5OA 4YNXA 4J38B 3M7PA 3ERBA 5HYPA 3MQLA 1CKLA 2RKYA 1Q3XA 3EJHA 2KRIA 3O8EB 1OJVA 1PPQA 1H04P 5HYTB 4AYEA 4IGDA 1SS2A 3CALA 2JRAA 2XRDA 4C16A 5FO8C 4F4OC 2JGXA 4DJZA 3KZJA 1O9AA 2WIIC 2MCYA 1GHQB 2JGWA 2O39C 1HFIA 1OK9A 1QUBA 1Z92B 1OJYA 3L89M 3ZD2A 3IX0A 3R62A 1GKNA 1ZJKA 1OJWA 3ZRZA 1QO6A 2XWJI 1TPGA 1NWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERJ A;  1FBR A;  4KKD A;  2IZ3 A;  1G4F A;  1UOT P;  1HFH A;  3OED C;  4LOT A;  3OXU D;  3TVJ A;  1E8B A;  2UWN A;  1GPZ A;  1TPN A;  2RLQ A;  4ZH1 D;  1OK1 A;  2RKZ A;  1OK3 A;  1C1Z A;  2CKU A;  2XWB F;  4AYD A;  1LY2 A;  4K12 A;  4LOS A;  1TPM A;  3IU3 I;  2RL0 A;  2IZ4 A;  2V8E A;  2XQW C;  4JHS A;  2BZM A;  4AYM A;  4ONT D;  4A5W B;  1QGB A;  1G4G A;  2W80 A;  1H2P P;  1HCC A;  4CSY A;  1E5G A;  2G7I A;  4B2R A;  2KMS A;  4WJG 2;  4FXG G;  3GXE A;  2B5I D;  1GKG A;  4PZ5 A;  3OP8 A;  2RLP A;  2QY0 A;  1H03 P;  3KXV A;  5HZP B;  2EC3 A;  1VVD A;  1ELV A;  3INB C;  3NFP I;  3ZD1 A;  2EHF A;  2MCZ A;  3GOV A;  1SRZ A;  4B2S A;  2CG6 A;  1MD7 A;  2A55 A;  3RJ3 D;  1MD8 A;  1OK2 A;  5JPM G;  1VVC A;  2YRA A;  1U5M A;  5I0Q B;  1H2Q P;  2YBY A;  2CG7 A;  3SW0 X;  4MUC A;  2XRB A;  1E88 A;  2LOJ A;  2W81 A;  4AYI A;  5HYU B;  3T5O A;  4YNX A;  4J38 B;  3M7P A;  3ERB A;  5HYP A;  3MQL A;  1CKL A;  2RKY A;  1Q3X A;  3EJH A;  2KRI A;  3O8E B;  1OJV A;  1PPQ A;  1H04 P;  5HYT B;  4AYE A;  4IGD A;  1SS2 A;  3CAL A;  2JRA A;  2XRD A;  4C16 A;  5FO8 C;  4F4O C;  2JGX A;  4DJZ A;  3KZJ A;  1O9A A;  2WII C;  2MCY A;  1GHQ B;  2JGW A;  2O39 C;  1HFI A;  1OK9 A;  1QUB A;  1Z92 B;  1OJY A;  3L89 M;  3ZD2 A;  3IX0 A;  3R62 A;  1GKN A;  1ZJK A;  1OJW A;  3ZRZ A;  1QO6 A;  2XWJ I;  1TPG A;  1NWV A; 
#chains in the Genus database with same CATH topology
 2ERJ A;  1FBR A;  4KKD A;  2IZ3 A;  1G4F A;  1UOT P;  1HFH A;  3WSX A;  3ZLE A;  3OED C;  3VWO A;  4LOT A;  3OXU D;  3TVJ A;  1E8B A;  2UWN A;  1GPZ A;  1TPN A;  2RLQ A;  2ZYC A;  4ZH1 D;  1OK1 A;  2Y8S A;  2RKZ A;  1OK3 A;  1C1Z A;  2CKU A;  2XWB F;  3WSY A;  4AYD A;  1LY2 A;  4K12 A;  4LOS A;  1TPM A;  3IU3 I;  2RL0 A;  2IZ4 A;  2V8E A;  2XQW C;  4JHS A;  2BZM A;  4AYM A;  4ONT D;  4A5W B;  1QGB A;  1G4G A;  2W80 A;  1H2P P;  4YIZ A;  1HCC A;  4APL A;  1RLH A;  3FGT A;  3K3T A;  4CSY A;  2G7I A;  1E5G A;  4B2R A;  2KMS A;  4WJG 2;  4FXG G;  3GXE A;  2X2Z A;  3ZLD A;  5DN5 A;  2B5I D;  1GKG A;  4PZ5 A;  3OP8 A;  2RLP A;  2QY0 A;  1H03 P;  3KXV A;  5HZP B;  2EC3 A;  1VVD A;  1ELV A;  3INB C;  3NFP I;  3ZD1 A;  2EHF A;  2MCZ A;  3GOV A;  1SRZ A;  4B2S A;  2CG6 A;  1MD7 A;  2A55 A;  3RJ3 D;  1MD8 A;  4PO7 A;  1OK2 A;  2Y8T A;  5JPM G;  1VVC A;  2YRA A;  1U5M A;  5I0Q B;  4MSL A;  1H2Q P;  2YBY A;  2CG7 A;  3SW0 X;  4MUC A;  2Y8R A;  3CI0 J;  2XRB A;  1E88 A;  2LOJ A;  2W81 A;  4AYI A;  5HYU B;  3T5O A;  4YNX A;  4J38 B;  3M7P A;  3ERB A;  5HYP A;  3MQL A;  1CKL A;  2RKY A;  1Q3X A;  3EJH A;  2KRI A;  3O8E B;  1OJV A;  1PPQ A;  1H04 P;  5HYT B;  4AYE A;  4IGD A;  1SS2 A;  3CAL A;  2JRA A;  2XRD A;  4C16 A;  5FO8 C;  4F4O C;  3FGR A;  3NJA A;  2JGX A;  4DJZ A;  3KZJ A;  1O9A A;  2WII C;  3F6K A;  2I2L A;  1GHQ B;  2MCY A;  2JGW A;  2O39 C;  4BWC A;  1HFI A;  1OK9 A;  1QUB A;  1Z92 B;  1OJY A;  3L89 M;  3ZD2 A;  3IX0 A;  3R62 A;  1GKN A;  1ZJK A;  1OJW A;  5DN4 A;  4N7E A;  3ZRZ A;  1QO6 A;  2XWJ I;  1TPG A;  1NWV A; 
#chains in the Genus database with same CATH homology
 2ERJ A;  1FBR A;  4KKD A;  2IZ3 A;  1G4F A;  1UOT P;  1HFH A;  3OED C;  4LOT A;  3OXU D;  3TVJ A;  1E8B A;  2UWN A;  1GPZ A;  1TPN A;  2RLQ A;  4ZH1 D;  1OK1 A;  2RKZ A;  1OK3 A;  1C1Z A;  2CKU A;  2XWB F;  4AYD A;  1LY2 A;  4K12 A;  4LOS A;  1TPM A;  3IU3 I;  2RL0 A;  2IZ4 A;  2V8E A;  2XQW C;  4JHS A;  2BZM A;  4AYM A;  4ONT D;  4A5W B;  1QGB A;  1G4G A;  2W80 A;  1H2P P;  1HCC A;  4CSY A;  1E5G A;  2G7I A;  4B2R A;  2KMS A;  4WJG 2;  4FXG G;  3GXE A;  2B5I D;  1GKG A;  4PZ5 A;  3OP8 A;  2RLP A;  2QY0 A;  1H03 P;  3KXV A;  5HZP B;  2EC3 A;  1VVD A;  1ELV A;  3INB C;  3NFP I;  3ZD1 A;  2EHF A;  2MCZ A;  3GOV A;  1SRZ A;  4B2S A;  2CG6 A;  1MD7 A;  2A55 A;  3RJ3 D;  1MD8 A;  1OK2 A;  5JPM G;  1VVC A;  2YRA A;  1U5M A;  5I0Q B;  1H2Q P;  2YBY A;  2CG7 A;  3SW0 X;  4MUC A;  2XRB A;  1E88 A;  2LOJ A;  2W81 A;  4AYI A;  5HYU B;  3T5O A;  4YNX A;  4J38 B;  3M7P A;  3ERB A;  5HYP A;  3MQL A;  1CKL A;  2RKY A;  1Q3X A;  3EJH A;  2KRI A;  3O8E B;  1OJV A;  1PPQ A;  1H04 P;  5HYT B;  4AYE A;  4IGD A;  1SS2 A;  3CAL A;  2JRA A;  2XRD A;  4C16 A;  5FO8 C;  4F4O C;  2JGX A;  4DJZ A;  3KZJ A;  1O9A A;  2WII C;  2MCY A;  1GHQ B;  2JGW A;  2O39 C;  1HFI A;  1OK9 A;  1QUB A;  1Z92 B;  1OJY A;  3L89 M;  3ZD2 A;  3IX0 A;  3R62 A;  1GKN A;  1ZJK A;  1OJW A;  3ZRZ A;  1QO6 A;  2XWJ I;  1TPG A;  1NWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...