1TPOA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase (serine proteinase)
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tpoA02
5C5NA 3RXLA 1PYTC 5C5OA 1O3AA 1ZSJA 2UWLA 2A7CA 1ZYOA 4KTSA 3SU5A 5TCCA 3I78A 5FAHA 2VWMA 3RXAA 3GY4A 2FLBH 1TX7A 1O0DH 1NM6A 5EW1H 1K1PA 3C1KA 1F7ZA 2AYWA 1GI4A 2BD2A 1T4UH 2XBYA 4GCHG 1ZMLA 1OYQA 1G30B 1WV7H 2ZU5A 2BY7X 2G00A 4Y6DA 3RM2H 4CR5A 2F9NA 1TAWA 4LOYH 3CS0A 2FTMA 2B0FA 4E06H 2TGAA 2QGRA 2Y81A 1ZSKA 4Y7AA 1C5TA 1MUEB 3DD2H 4OGYA 3LONA 1EQ9A 3IWMA 1ZHMA 4CR9A 4WMDA 2R3UA 1EAIA 1PQAA 4X2VA 4XE4A 2Z94A 1OWJA 1TNJA 4DOQA 6GCHG 1TGTA 3EA7A 1TA6A 1C2IA 1C1UH 3UREA 1ESTA 1A46H 2OBOA 2ZFPH 5C1YA 5K0HA 3KQCA 3V3MA 1GI3A 2Y5HA 2VVUA 3GDSA 1O3BA 1P2IA 5FPSA 1DXWA 3S7KB 4R8TB 3RMMH 1OSSA 1GG6C 2TRMA 4NA9H 1CT0E 1GWAA 2G55A 3V7TA 1QQ4A 2R0LA 5T6GA 2P93A 1UVOA 1SGEE 3SJIA 3F68H 1VCPA 1B0FA 7GCHF 2G52A 1FY5A 1GI0A 1HIAA 2RA3A 2ZCHP 5GCHG 1GI5A 1QURH 3RXOA 3SZNA 3PYHA 2PSXA 1L4ZA 2BQWB 2QV1A 3BN9A 2D1JA 2OBQA 1YPKH 2C8WB 1AZ8A 2VIDA 3NCLA 3T25A 5A8XA 3ODFA 3S7HB 3EAJA 1C4V2 4MPUA 1FDPA 4BTUB 1NFUA 1GJ6A 3UR9A 3LIWA 1O5EH 1NFYA 2F91A 1GVLA 2OP9A 1LPGB 3U8TH 2FI4E 5HM9A 2OQ5A 3RLWH 1EAXA 1MKWK 4SGAE 8LPRA 1TRYA 3PWCA 2RCEA 3PM3A 1C5RA 1TOMH 2H5DA 3GCNA 1Z1IA 4IS5A 2FEQH 1QRZA 1SOTA 1AO5A 3A7XA 3ZZAA 5C2ZA 1BMNH 1FAKH 2SGEE 3RXHA 1EZSC 4CRFA 4UFDH 2AFQB 1O2ZA 5FX6A 2WPLS 3E90B 3JZ2B 1C1QA 3SN8A 3UQVA 3SUEA 4PROA 1ANEA 3RDZA 3ZZDA 1G36A 4I31A 2PW8H 5L30H 4ZXXH 2OUAA 2P3TB 5A2MH 4OS6A 2VU8E 4ABJA 1ESAA 3L33A 4IC5A 1J9CH 2H9EH 4UONA 1ELAA 4IMQA 1ID5H 2J9NA 1TPSA 2GV6A 4YM9A 2GCHF 2A2QH 1O37A 1IOEA 1PPGE 3ODDA 1EJNA 1OOKB 5DPAA 4FUFA 4D9QA 1J14A 4I33A 1YYY1 1XUGA 4JZ1A 2AH4X 3KQEA 5DP5A 1GG6B 1ANCA 4AOQA 4ZHMU 3E91A 3MFJA 2FIRH 4K1EA 2A45B 2BY5X 1UJ1A 1WQVH 4HFPB 2VVVA 1C2FA 4BAOB 1XVMA 3GCHC 1THSH 3MO3A 3D23A 1YPHC 1KLJH 1VR1H 2XW9A 5DK1A 1TNGA 3LH3A 4WVPE 1HAVA 1LKBA 2BM2A 3KHVA 1QRXA 2TIOA 3GY7A 3M36A 4E05H 4Q7XA 2AGIX 2OLGA 4AG2A 2G81E 2WPJS 4ESTE 4DT7B 3BTDE 1O5FH 1OKXA 1B5GH 1HJ9A 1BTXA 2F9VA 3SJKA 3LOXA 3TK5A 3RXUA 3ZZ7A 1ZHRA 5F03A 1PJPA 4I8JA 1LVYA 4YOIA 3GY3A 4B71A 3U1JB 1P9SA 2K1QA 2TGDA 1TX6A 1C5VA 1ZR0A 5HXFA 1BBRE 2PKAB 1O2VA 3PO1C 4Y11E 1WSSH 5HGGA 3P17H 1A0LA 1TONA 2NU1E 1LHEH 4JZDH 1CT2E 4TY7A 3ZYEA 5F8XA 3MU1A 3MNBA 1V6DA 2WPMS 2AEIH 2ZA5A 5ESTE 1C1TA 4X8SH 1XUIA 5DG6A 3MNCA 5L2ZH 3OTJE 2I6QA 1AY6H 3S0NA 1P2KA 4K8BA 1B7XB 5LPEA 1J8AA 1HAGE 5EGMA 2GMTC 2SGDE 2STBE 1Z6EA 1W7GH 1W0YH 6LPRA 1DOJA 1FLEE 4ZAEA 2OCVB 3U98H 1AVGH 1UK4A 2BVRH 2C90B 2LPRA 1JIRA 1O2MA 4HTCH 1O3PB 4B2CA 4FUHA 1MTVA 4JK5A 2VWNA 3LGWA 4MPWA 1O3KA 3A86A 1GHBG 1BA8B 3UPEA 6ESTA 1QB1A 1X7AC 4NG9H 3URCA 1XMNB 4NIWA 1DPOA 3RC5A 2VIPA 1AVXA 1FJSA 1YPHE 3GCHB 3UWJH 4MPVA 1K1JA 4AGKA 1BJUA 4X6MA 2FOBA 2AGGX 2HGTH 1GHAG 4ISOA 5EQQA 1HJAC 1MCVA 1EATA 1SGIB 2GGVB 3JZ1B 2BLOA 4E7RG 2VWLA 4ABHA 5LGOA 2XCFA 4YLQH 4MNXA 4B76A 1VCWA 3LC3A 1V2TT 1TMUH 5FX5A 2A7HA 1H1BA 2FOMB 2HWLB 4O3UA 1P3EA 2BD9A 2PSYA 4WMEA 2ZDAH 3TH4H 2ZHEH 2AMQA 4XFQA 4NWLA 5J4SA 1JOUB 1ZPZA 2BTCE 2R9PA 1DFPA 4CBOA 1BRBE 3ZVDA 2ZHQH 1HUTH 3PO1B 4UFGH 1DY8A 2F9BH 3O8CA 1YBWA 2BDCA 2GTBA 2C8ZB 1DWEH 3PMHB 3RXCA 1BZXE 1ETRH 1HDTH 3ZZBA 2FZZA 5C67A 4H42U 1K28D 1AVWA 4Y71A 3LJJA 2A7JA 1GL0E 3RMLH 2Z9LA 1FUJA 1BTYA 1HV7A 1MTUA 2PUQH 3LGTA 5LPRA 1TRNA 3F1SB 4X8TH 2H9HA 2RG3A 3GYMA 2OC8A 3Q3XA 2GMTB 1CBWC 3PMAB 1TRMA 3KL6A 2PKSB 1MBQA 4BXWA 5DP7A 4WH6A 2Q6FA 4ABBA 1JRTA 2BQ7B 3CP7A 3GOVB 3A82A 1P2MA 4D9RA 2CHAB 2VIWA 1A0HB 2XWAA 3SU0A 5F8ZA 1YP9A 5GIBA 2VNTA 3BTWE 1C2JA 4A1VA 1SGRE 1D3TB 2B7DH 1NFXA 4X2WA 4UE7H 1EJAA 3HGNA 2H9TH 1EUFA 2EI6A 4TWYA 1K1NA 1O3MA 3ZVEA 1ELTA 2P3FH 1SVPA 1C5QA 2JH6D 1ANDA 5TCAA 1GMCG 1XX9A 1KXDA 4JYTA 4TYDA 1DWDH 2GP9B 4B2BA 3HGPA 4FXGH 3D62A 2HALA 2HPQH 3DFJA 1RIWC 2Z7FE 3BV9B 1F0UA 1HJAB 2SGQE 1SGYE 1Y3VA 2ZTXA 2F3CE 3BTHE 1AN1E 3BTQE 5FHTA 1S0QA 1GBHA 1O3LA 1P3CA 3T5FH 3RXBA 3T28A 1UTPA 3E6PH 4WJG2 2Z9KA 1HIAB 2HNTC 2XBXA 4ZROA 3M5OA 1V2RT 2VIVA 2Q1JA 2QIQA 1P2OA 2XBVA 1UVTH 4MDSA 5CHAB 1O2TA 2G8TA 1ZSLA 2Y5FA 2ZWLH 1QHRB 1MKXH 5EPNA 2FI3E 4X6NA 1SLWB 1CHOG 1F0TA 1RD3B 1OS8A 4NFEA 4OGXA 4NSVA 2BZ6H 4OS2A 4X0WU 2NU4E 2QY0B 3CS7A 3OX7U 4GVUA 1W14U 5EODA 4E7NA 1O3NA 1UO6A 1UMAH 3A7TA 1VZQH 2W5EA 8ESTE 3KIDU 1HAYB 4CH8B 1FMGA 4FUJA 3LDXH 1SB1H 1GJ4H 1GPZA 1KYNA 1OX1A 1YC0A 4Z0KA 1GGDB 2P59A 1P04A 4H4FA 2F9UA 2PUXB 1CBWB 3VGCC 5DKMA 3SW2B 2PV9B 2ZIQH 1GBEA 3P8GA 1T8MA 4HI3A 3BTGE 2AS9A 1W12U 4Y8XA 1CHOF 3QWCH 1YLDA 1O3HA 2JETC 9LPRA 3K2UA 1Q3XA 2ZTZA 4I8HA 5FBEA 2EC9H 3KQBA 4IN2A 3ATKA 1AIXH 3MMGA 1HAIH 3RXTA 1AHTH 1Y3YA 1LVBA 1GI9B 1CGHA 2ANKH 2M5TA 1L0ZA 1GBDA 1EOLA 1O39A 1O5GH 1O5AB 3A7VA 2SGFE 2A0QB 1GBIA 3U8OH 4GPGA 2ZFTA 3NXPA 4Y0YE 4X8VH 1GMDF 1Z8RA 1CA0C 2ZHDA 1LKAA 1EZXC 2RA0A 4M7GA 3UUZA 1LHFH 1F0RA 1RIWB 1AI8H 4NZLA 1KXBA 1Z8IB 5TJXA 1ZLRA 1C1PA 2WPHS 2FOFA 2I6SA 3M5MA 1IHTH 1W3CA 3RM0H 2VB0A 1SGFG 2O8TA 3TJUA 1HXEH 2HNTE 4HZHA 3GY6A 5DP3A 4FVBA 1SFIA 4DY7B 1O3OA 1XKAC 2R2WU 1M9UA 3L3TA 1FY4A 2ZZUH 2A4GA 2QA9E 4Y7BA 1G3DA 1EP5A 1GBKA 1HAVB 1PQ5A 2BYAX 1MQ6A 2ANMH 1O2UA 1ELCA 1O31A 3ZV9A 2A4OA 1DX5M 3A7YA 4AZ2B 5FXLA 3VB7A 3TU7H 1T31A 1ELVA 1PPFE 1WUNH 3QTOH 3ZV8A 3M7TA 1ETSH 4FUDA 2JKHA 1BOQA 3VFEA 3A81A 3AVZA 3GCTF 8GCHF 4UDWH 3HKIB 1BTHH 3LGUA 3T27A 1BHXB 2ZGJA 1TX8A 2W3KA 2ZGBH 2FMJA 4O03A 1EB2A 1ACBE 2FLRH 2P94A 5I46H 1LMWB 1ZGVA 1S83A 3TJVA 1GBAA 3SV7A 1RTFB 3VGCB 1O2SA 3M35A 3R3GB 1QGFA 3LKWA 1C4Y2 3SUGA 2CJIA 3O8BA 2DE9A 3IITA 7GCHG 1E38B 1O2OA 3NUMA 4CH2B 3O8RA 4MNWA 2JETB 3HATH 4YESB 1ZHPA 4MVNA 5JDUB 1UCYH 1AKSB 1MTWA 1SGDE 1W0ZU 2SNWA 2ZKSA 1UHBB 4YOGA 4YT6H 1QL9A 2J95A 1TMBH 2BD3A 1RS0A 3I77A 2F9OA 2BOKA 1TNLA 3UOPA 3TK6A 3PV4A 2H5CA 1VITF 2ZCLP 3FVFB 1TBQH 4CRBA 3QUMP 1BT7A 4ZH8A 3GY8A 2FOCA 4CRAA 3ENSB 2ZHWH 1K1LA 1VCQA 1CA0B 2HPPH 3OY5U 1BHXF 4OS5A 1V2UT 1Y8TA 3P6ZB 3BTME 1DWCH 1AFQB 2O8UA 1TABE 4H6TA 1D3QB 1D4PB 1T32A 2FX4A 3RXEA 3SORA 2AGEX 2QAAA 4FVDA 3FP8E 3ITIA 1D9IA 2LNCA 2PLXA 3VB5A 2HLCA 4B75A 5HMAA 3Q3YA 5CMXH 1VGCC 3A8CA 2EA3A 4Q2KA 1V2OT 1NN6A 1HGTH 2FWWA 1BRAA 5DO4H 1N6YA 1QNJA 1KTSB 1A0JA 2FP7B 1H8IH 1PPHE 1GL1A 3QZQA 3NK8A 1PPEE 3ATMA 1C5OH 2BZAA 1AE8H 1UK3A 4KP0A 2GCHG 1J17T 2ILNA 1NFWA 1T8NA 5AHGH 5E2OA 5ABWA 5IDKA 3TGKE 1E37B 4BTIB 2FI5E 3K6YA 1QQUA 1T8OA 2Y6TA 4YOJA 3TNTA 1O36A 2QYIA 1KXFA 4J2YB 3S9BA 5GJ4B 1KXCA 1A2CH 4DIHH 1NT1A 1C5XB 3LGVA 4OS1A 5GWZA 3A7WA 1GJCB 3MH7A 3Q76A 1PQ8A 2H1UA 5EQSA 1A61H 2WPIS 3PWBA 3M37A 1EPTC 1TPAE 2C4FH 2Y7ZA 1GHXH 4NA7A 3K9XB 4JZEH 3MI4A 2ZEBA 2ZFFH 1GI2A 3EYDA 4YTAA 5AVDA 1SHYA 1ELDE 3SNBA 2PTCE 2J4IA 4I7YH 1F5LA 3KEEA 1HXFH 2ZGHA 4OS7A 1DY9A 1Y3XA 1AB9C 5AF9H 4A1TA 1AQ7A 2WUBA 3BSQA 4RKJB 1FN8A 1QTFA 2KAIB 3SUFA 4AORA 1TGSZ 2PR3A 1HFDA 3OU0A 1ZMJA 5LH8A 1BRCE 5EXLA 3SU3A 1GHZA 3BTEE 1SGFA 1L1JA 1MD8A 4K1SA 1NTPA 1RTKA 1KLTA 4Q80A 1O2NA 4UFEH 1C5NH 4A7IB 3AAVA 1ORFA 3AW0A 4F4OC 3GICB 1G3EA 3OSYA 2UWOA 4B2AA 1W10U 1SHHB 1SGCA 1ELGA 3NWUA 4JYUH 2BD5A 1KDQB 3BG8A 1KY9A 3PMJA 1GJDB 1OWKA 1VGCB 9ESTA 1N1LA 4I32A 1S5SA 3B9FH 3ZVFA 2BQ6B 1IQKA 1MTSA 3LGIA 1GJBB 2FX6A 1GVZA 2QXIA 3TLOA 2FODA 1ZPBA 2ZG0H 3SNEA 4CHAC 3SV9A 2A31A 2VIOA 2IPHA 1DICA 4U01A 1C4U2 1P12E 4ISIH 1QL8A 4ABFA 1NRNH 4JYVH 2R0KA 3BG4C 3MYWA 5A8YA 4CRCA 4ABAA 1DANH 3ATLA 3EGKH 1SR5C 1MCTA 3TH3H 3M5NA 1CO7E 3SO3A 1ZMNA 4NGAH 2NU2E 2VINA 4IW4E 2C8YB 3SV8A 3QZRA 3UR6A 1EB1H 2V3OH 1BTUA 1W13U 2PGQB 2FDAA 3SJ9A 3F9HA 3SJ8A 2QC2A 1L1NA 3OY6U 1O2GH 2ZGXH 1HB0B 1AUTC 4TPIZ 2IN2A 1EPTB 2XC0A 5EPYA 1EAWA 4Y8YA 1VITH 2XC5A 1EJMA 4JZIA 3SNDA 5J4QA 1TBRH 1GJ9B 1TB6H 3TGIE 1WAYB 3UTUH 2Y7XA 2BVSH 3RUOA 3A84A 1MAXA 1AB9B 4LXBH 1Q2WA 5L6NH 1SFQB 2BDBA 2Q6DA 1FV9A 1G3BA 3EA9A 5A0AE 3MU0A 1C1VH 3SV2H 1G2LA 2B5TB 5C3NA 5FPYA 3HKJB 1ELBA 4U2WA 1JMOH 3T26A 1HAHH 3UNSA 2STAE 1QBVH 4AFZA 1EX3A 3ZZ8A 1O30A 3UIRA 1O2LA 1TA2A 2C93B 2ZDMA 3QGNB 3MOCA 4TWWA 3RXPA 3TH2H 1G37A 1UVSH 2VIQA 1OPHB 3UNRA 1SG8B 3MNXA 2ZDVH 3QX5H 3VEQB 4FU7A 3L6PA 2FM2A 2FS8A 1NO9H 7ESTE 3ZVBA 4X6PA 2EI7A 1GBBA 4DW2U 1IQIA 4RSPA 4NIVA 3SI3H 3P92A 1DE7H 1SLUB 2ZPQA 1W2KH 3MNSA 3MH6A 3TJNA 1O3EA 3Q00A 1TBZH 2FS9A 2VGCC 3AW1A 1YPJH 1DXPA 4XBDA 1O2HA 3P8NA 1ZTKA 3IG6B 3QDZB 1TGBA 2J34A 2EEKA 2WYGA 1C5ZB 1FONA 1P11E 2Y5GA 3TK9A 3BG4B 1MKXK 1HAZB 2B9LA 1GDNA 3KN2A 2R3YA 3MU8A 4YZUA 1XM1A 1AE5A 4ZUHA 1LVMA 4U30A 1QIXB 2PFEA 1CVWH 1KXEA 1NU7B 2ZU4A 4NFFA 5CE1A 1SGQE 1C2GA 2BDGA 3A8DA 1PFXC 1OWHA 5GDSH 2O8WA 3BTFE 3T62A 1OWIA 1D6WA 1IAUA 3S69A 3MU4A 3RC6A 3LC5A 3E3TA 1PPZA 3E16B 1DITH 1FY1A 1NRQH 1SI5H 4MQAA 4RN6A 5E0GA 4LZ1H 3KQDA 4AYYB 4KELA 4NA8A 2J38A 1FI8A 2ZQ2A 5E2PA 1GI6A 4INLA 1H9HE 1HPGA 2BMGB 4HGCA 4ZKNU 2BDYA 2WUCA 4X1PU 1TYNA 5AFZH 1TMTH 2ANWA 1TFXA 1C2EA 1XXFA 1LO6A 2Z9IA 5LPFA 2A1DB 4TPYA 3SJOA 1ZGIA 1BMMH 5EU8A 1EOJA 1CU1A 1TQ7B 4XDEA 1K9OE 1W11U 4ZKOU 2B8OH 1LPZB 1GBMA 1O2RA 2A2XH 2CMYA 3RXIA 3KNXA 2SNVA 2BX3A 1QBNA 2XBWA 3MU5A 1IQNA 1S6HA 1BCUH 1E34B 3M7QA 2WINI 4INKA 1FPCH 4ISLA 2HOBA 1ZOMA 3ZVAA 3FZDA 5F8TA 3UY9A 4AFSA 1F0SA 4MTBA 2VJ1A 2YOLA 3URDA 1PQ7A 2HRVA 4BAQB 4SGBE 1QJ7B 3N7OA 2VGCB 2BDAA 1GI7B 2XWBI 1N8OC 7KMEH 5JB9S 4BAHB 1MQ5A 2A5IA 4XOJA 2W26A 4X1NU 1C5UA 4DCDA 1QA0A 1S82A 1SBWA 3RXVA 1O35A 1ZJDA 3NZIA 3O8DA 2QXGA 1MU8B 2ALPA 1AMHA 2QF0A 1O3CA 3SQEE 1GJAB 1OXGA 1C5PA 3ZZCA 1ESBA 1THPB 1QB9A 2BD7A 3ATWA 3GY2A 1TOCB 5AFYH 3PMBB 1LTOA 1FXYA 4AB8A 2P95A 5A8ZA 1GJ5H 1V2QT 4I8LA 2ZI2H 1TGCA 1CQQA 2ZU3A 3E1XB 1QY6A 2P8OC 1IQHA 1O3FA 4I8GA 1INCA 1O38A 3WY8A 3P70B 1F5RA 1Y5AT 1GMDG 3ZVCA 1A5GH 1GHWH 2ULLA 3SGBE 4BANB 2OXSA 1P06A 3RMNH 1HAXB 4FUGA 1S6FA 1DSTA 3GDVA 1BBRH 2GDEH 4AFUA 5FBIA 1MZAA 3SBKA 1A3EH 1CHGA 3A89A 2G5NA 1UCYK 3M3SA 5L2YH 1FY8E 4BXSA 3M3VA 4IN1A 4BNRA 1K1OA 2BB4A 3G01A 3SGQE 3BF6H 4Q7YA 3ZZ9A 5E0HA 1J15A 2JH5D 2ZFSA 1ZZZA 2CF9H 1BDAA 4X1SU 3AASA 3PB1E 2AMDA 1MAYA 2GCTC 1GMHG 1BITA 1HNEE 2PWXA 1BUIA 8GCHG 3DT0H 1V2ST 3GCTG 1P02A 1P0SH 3KGPA 1HRTH 1AGJA 1ARBA 4Q7ZA 2ZU2A 2F9PA 1C2MA 4NZQA 1WTHD 1EZUC 1JBUH 1IQGA 2ZQ1A 2ZU1A 5ETXA 5E8EH 2AMPA 1S85A 1GBCA 1GBFA 5BPEA 1TIOA 1H9IE 1NRRH 1T4VH 3A8BA 5EOKA 3ZZ5A 2R2MB 1XKBC 1GBTA 5EQRA 3PLBA 2XYAA 1V2JT 1N8OB 3PROA 1GCTC 3BEUA 1PPCE 1LHDH 3A8AA 1V2KT 1P03A 1GHVH 2ZHFH 2GD4B 2GZ7A 3R0FA 2ZDLA 4WXVA 3QLPH 1QJ6B 3TPIZ 1JXPA 1MBMA 4X6OA 4BOHA 1GMHF 2AERH 3M3TA 4FUCA 1F92A 1ZPCA 3M61U 4WWYA 1MZDA 5BRRE 4H6SB 3V13A 2WYJA 1MMJN 1P2QA 2GZ8A 1C1OA 1EZQA 3H7TA 3QK1A 3LT3A 4GHQA 2TGPZ 1SQOA 3BEIB 1A5HA 6CHAC 1L1GA 1O3GA 5C1UA 2OC1A 1O2QA 1O3JA 2BLWA 2G51A 1LDTT 1V2WT 1GBJA 1VITG 5JBBS 5ESBA 1C5WB 4ABGA 3VB6A 5FCRA 2P8OB 3FFGA 1FNIA 4MNYA 2H2ZA 3D65E 1DUAA 2FPZA 1FIZA 1SC8U 1C2KA 3QTVH 1H9LB 2HNTF 2W7UA 4XBCA 4NSYA 4GUXA 2A4RA 3E0PB 3BIUH 2Z3DA 3LJOA 1B0EA 4DJZB 2XTTB 1IQJA 3MWIU 2TBSA 1EKBB 1C2DA 3RXRA 1ZTLA 2BD8A 2JH0D 2THFB 4AFQA 4AN7A 3TNSA 1P2JA 2ZNKH 1O2XA 3W95A 4A6LA 1DS2E 5B6OA 5E0JA 1XUJA 3NKKA 4ABDA 1SMFE 1YGCH 1V3XA 5JBAS 1MD7A 2XNIA 4GCHF 1DSUA 2Z9GA 1P10A 4BAMB 3UNQA 4A1XA 4THNH 4K2YA 5A09A 5JBCS 2GCTB 4NIYA 4QT8C 4ABEA 2ESTE 2SFAA 1SPJA 3FAOA 3TITA 1ELEE 3RXSA 1TWXB 1YKTA 4VGCC 2FESH 2H6MA 4IGDA 1CGJE 3PLKA 1WBGB 1FZZA 4ASHA 3DHKH 3LPRA 4K1TA 3VB3A 3Q3KA 1HLTH 2G4UA 3LH1A 4OS4A 6GCHF 1GCTB 3A88A 2UUYA 2DUCA 4B73A 1O3IA 1G2MA 2O8LA 1TPPA 5DP9A 1P9UA 1SGNE 3E8LA 3LGYA 1FQ3A 2GX4A 3RXMA 4UFFH 2PGBB 2NWNA 2A4QA 1UTQA 2F83A 2BXUH 5DP6A 5T6FA 4D8NA 1RXPA 3RP2A 3K6ZA 3A7ZA 1O34A 1YCPH 1Z7KA 3SU1A 3STIA 4CRGA 6CHAB 1UTKA 2ZPRA 1W7XH 1XXDA 1EAUA 2EI8A 1BRUP 2D2DA 2W3IA 5GCHF 3EE0B 4MPXA 2ZFQH 1JWTA 1TNHA 1V2LT 4X1RU 4ZMAH 1TLDA 3UWIA 2FXRA 3MTYA 1JIMA 1FY3A 1AD8H 5HYOA 5DJ7A 3SV6A 5DP4A 1WOFA 1C5LH 3RC4A 2AIPA 1UTLM 1YCPM 3Q77A 4JMYA 1ZTJA 1SQTA 4FUBA 4WY3A 2ODPA 4YO9A 3T2NA 1DVAH 1ZRBA 1KTTB 1XVOA 2FOAA 3V12A 1NRSH 3P95A 5FPTA 4AYVB 4Z6AH 2RDLA 2XCNA 4GLYA 3SNCA 2CN0H 1DWBH 2ZECA 4ZHAA 2CV3A 2Q6GA 2BD4A 3P8OA 2O8MA 2UUJB 3BIVH 4K5ZA 1A5IA 1YPMH 2BLQA 5DP8A 3RXGA 1TPOA 3OYPA 4B1TA 4B74A 1T7CA 4GHTA 1RRKA 1SL3A 1Q31A 1BJVA 4KTUA 1ELFA 2ZDNA 4KKDA 3A80A 1GDQA 3SGAE 1WQSA 1O2YA 4F49A 1AFEH 1P05A 1O2WA 2SGAA 2FO9A 3STJA 3FP7E 4X8UH 5JBTA 2ZGCA 1HAPH 3E0NB 1ANBA 4ISNA 2YNAA 3BEFB 4VGCB 2IJOB 4U32A 1TE0A 4A5TS 2BY6X 3RXKA 2OQUA 1NS3A 3NPSA 3EDXB 2O9QA 3VXFH 2J92A 1KXAA 3KCGH 2ALVA 2OINA 1GJ7B 1RGQA 2ASUB 3V0XA 2BX4A 2GKVE 4FU8A 2BY8X 3PTNA 1OP2A 4JK6A 3DFLA 1ABJH 2J94A 1CE5A 4IMZA 3GYLB 3A85A 3C27B 1CT4E 1FN6A 1MKWH 1P01A 3GISB 1K1MA 2BXTH 3CENA 4UD9H 1KIGH 4FU9A 2BDHA 5C1XA 3U69H 3HK3B 2V35A 3SQHE 1BMLA 2C8XB 1QR3E 3PLPA 3RU4D 1IQMA 1GBLA 3F9GA 2ZDKA 1ZRKA 1OWEA 1LQDB 1LHGH 1AKSA 1ARCA 1ABIH 2WV5A 1UHBA 1O33A 4K60A 5I25A 2WPKS 4INHA 1AU8A 2Y80A 1D3PB 1U6QA 1TNKA 3B8JA 2FOHA 1Z71A 3SU4A 1Y5UT 1DLKB 2PKSC 1HBTH 1GVKB 1UTMA 1F2SE 1QCPA 4IBLH 1MU6B 2FYRA 1DLEA 1Z6JH 3ESTA 2G4TA 2CHAC 2PHBA 2QN5T 1A4WH 1FIWA 2GVFA 1V2VT 2BLVA 4X2XA 3DUXH 1BTPA 2VVCA 2P3UB 4KTCA 3ATIA 5EXMA 1RJXB 3I29A 2UUKB 1V2PT 1JRSA 3KF2A 1SLVB 4GSOA 4O97A 4RKOB 1Z8JB 1S84A 1C1WH 1Y3UA 1SQAA 4Y76A 1Z1JA 1SSXA 1J16A 1LPKB 1QJ1B 1XUHA 3UOUA 3PTBA 1AZZA 3LU9B 2ODYB 4WMFA 3SU2A 4NCYA 5EG4A 1LCYA 4JCNA 2D26C 3F9FA 3QO6A 1P2NA 2ZTYA 1YPGH 4X1QU 7LPRA 3RXDA 1T8LA 4CHAB 1GHYH 4O9VA 2FYQA 1PPBH 1CA8B 1BIOA 3VPKA 3ZZ4A 2VH0A 2Y82A 4WXIA 3VB4A 1UTNA 4D7GA 1WCZA 3D49H 1WU1A 1FPHH 1GHBF 3U9AH 5H4IB 1NROH 1SGTA 3GDUA 1BMAA 5IYTA 2OTVA 1QL7A 1GI8B 1V2MT 2ANYA 2A5KA 1H8DH 4Y10E 1EP6A 1YPEH 4DVAU 3M7UA 1XUKA 3FP6E 2Z3EA 2TGTA 4DURA 1UCYE 1GHAF 3FANA 5CHAC 1O5CB 1O5DH 2UWPA 2AIQA 5GXPA 3SNAA 1E0FD 1L2EA 1AWFH 1QFKH 2HVXA 2BVXH 2GT7A 4XBBA 1N6XA 1NC6A 1Y5BT 3HPTB 2OD3B 1MTNC 1V2NT 3ZZ6A 3RU4E 1VJ9U 3ELAH 1E36B 4FUEA 1O2PA 2ZO3H 4MLFB 1A3BH 1GGDC 1SGPE 3TGJE 1WTGH 4J1YA 1BBRK 1C2HA 4ISHH 2KAIA 1UK2A 1AUJA 3RMOH 2SGPE 4NIXA 4K69A 5GPIB 1XUFA 4K8YA 1UTJA 1Z8GA 1O3DA 2ODQA 1EASA 1SLXB 4CRDA 2ZP0H 3SU6A 2D8WA 1D6RA 2QXHA 4YLUA 3RXFA 1S81A 1KLIH 2FTLE 5A0BA 1IQEA 1O2JA 4DG4A 1OWDA 2ZPSA 3MH5A 4IC6A 3RXJA 3DA9B 3B23B 5A0CA 3TJOA 3UFAA 2XRCA 3RXQA 2WV4A 4XSKU 5JYIA 3RLYH 4JZFH 2Z9JA 1KDQA 1C5YB 1OYTH 2ZCKP 3P8FA 4NWKA 2NU0E 3EQ0H 4ZKRU 4BAKB 2ZF0H 5EXNA 4DGJA 1W8BH 1SOZA 1G3CA 1OP0A 1UTOA 4FUIA 2P16A 4K3JA 3S9CA 1O32A 4AG1A 3AAUA 4MNVA 2OC7A 3QGJA 3TIUA 1C1SA 4I8KA 1TGNA 3H7OA 1HYLA 1S0RA 1VJAU 2CF8H 4A92A 1C5SA 1UVUH 4ZKSU 3ZYDA 1GI1A 1NY22 3A83A 3RU4T 1H4WA 1TNIA 1K22H 1G32B 2PKAA 1FAXA 3SI4H 2A32A 3MHWU 4D7FA 1ZJKA 3H5CB 2G5VA 2FOEA 1QBOA 1C9TA 4O3TA 3UQOA 1GMCF 1BTZA 3F6UH 1D3DB 2GV7A 4LZ4B 4LK4A 1Y59T 4AGJA 2GDDA 4Y8ZA 2W7SA 4UEHH 1DDJA 2Z6BD 1C1MA 2VWOA 4D76A 2V6NA 2QCYA 1K21H 1C5MD 2V0BA 1MH0A 1DM4B 2V3HH 1EPTA 1IQLA 1LVOA 2ZFRH 1ETTH 4KGAA 8KME2 5K7RA 1RFNA 3ZVGA 1GJ8B 1YPLH 2PTNA 1LHCH 1MTNB 2A5AA 4CBNA 4Y0ZE 1YF4A 3S9AA 1C1NA 2QXJA 1K2I1 3F9EA 5JB8S 1BTWA 1CSOE 1AWHB 1YM0A 3A87A 5HM2A 3ZZ3A 2GT8A 1DUEA 2GZ9A 2BHGA 4GAWA 3U1IB 1NESE 1YLCA 2TPIZ 2BOHB 1NRPH 1TQ0B 2FOGA 1Y3WA 3GY5A 1P8VC 4MG3A 1QA7A 1HJ8A 1OP8A 4WH8A 1BB0B 4YT7H 4ZHLU 1QRWA 1NZQH 2CXVA 1F5KU 1C2LA 1O2KA 2OC0A 1TALA 3M5LA 2ZC9H 2XXLA 1CGIE 2CGAA 3U8RH 5DGJA 2Z3CA 5F6MA 1IQFA 3K65B 5PTPA 2YNBA 3TVJB 2XC4A 1GCDA 1NU9A 1NPMA 2BY9X 1A1RA 1G9IE 3GCOA 4DIIH 2DE8A 2QF3A 3QN7A 3VXEH 1BQYA 1GDUA 5G4BA 5SGAE 5EW2H 1L4DA 5T3HA 1K1IA 2VH6A 2UUFB 5T6DA 4ABIA 1P57B 2NU3E 1WYKA 4BTTB 4R0IA 1O2IA 1QB6A 2C3SA 1AFQC 1KSNA 3T29A 1DT2A 3SOSA 4AB9A 5FCKA 4AX9H 1E35B 3SHCH 3HK6B 2IOTA 4X2YA 4CREA 3BTKE 3W94A 3MO9A 1O5BB 3FZZA 4TY6A 1PYTD 4WF8A 3EA8A 3MO6A 1C9PA 4Y79A 1EXFA 2BDIA 1IHSH 1UVPA 3BTTE 4ZXYH 1HAOH 2J2UA 3SHAH 5C20A 1LQEA 1THRH 1HCGA 1A7SA 3MH4A 1RTLA 3SUDA 1YCPK 5JPMH 1C1RA 1P09A
chains in the Genus database with same CATH superfamily
5C5NA 3RXLA 1PYTC 5C5OA 1O3AA 1ZSJA 2UWLA 2A7CA 1ZYOA 4KTSA 3SU5A 5TCCA 3I78A 5FAHA 2VWMA 3RXAA 3GY4A 2FLBH 1TX7A 1O0DH 1NM6A 5EW1H 1K1PA 3C1KA 1F7ZA 2AYWA 1GI4A 2BD2A 1T4UH 2XBYA 4GCHG 1ZMLA 1OYQA 1G30B 1WV7H 2ZU5A 2BY7X 2G00A 4Y6DA 3RM2H 4CR5A 2F9NA 1TAWA 3FN8A 4LOYH 3CS0A 2FTMA 2B0FA 4E06H 2LP6A 2TGAA 2QGRA 2Y81A 1ZSKA 4Y7AA 1C5TA 1MUEB 3DD2H 4OGYA 3LONA 1EQ9A 3IWMA 1ZHMA 4CR9A 4WMDA 2R3UA 1EAIA 1PQAA 4X2VA 4XE4A 2Z94A 1OWJA 1TNJA 4DOQA 6GCHG 1TGTA 2WV9A 3EA7A 1TA6A 1C2IA 1C1UH 5CHBA 3UREA 1ESTA 1A46H 2OBOA 2ZFPH 5C1YA 5K0HA 3KQCA 4Q63A 3V3MA 1GI3A 2Y5HA 2J98B 2VVUA 3GDSA 1O3BA 1P2IA 5FPSA 1DXWA 3S7KB 4R8TB 3RMMH 1OSSA 1GG6C 2TRMA 4HG6A 4NA9H 1CT0E 1GWAA 2G55A 2KM0A 3V7TA 1QQ4A 2R0LA 5T6GA 2P93A 1UVOA 1SGEE 3SJIA 3F68H 3OTPA 1VCPA 1B0FA 7GCHF 2G52A 1FY5A 1GI0A 1HIAA 2RA3A 2ZCHP 5GCHG 2HVYB 1GI5A 1QURH 3RXOA 3SZNA 3PYHA 2PSXA 1L4ZA 2BQWB 2QV1A 3BN9A 2D1JA 2OBQA 1YPKH 2C8WB 1AZ8A 2VIDA 3NCLA 3T25A 5A8XA 3ODFA 3S7HB 3EAJA 1C4V2 4MPUA 1FDPA 4BTUB 1NFUA 1GJ6A 3UR9A 3LIWA 1O5EH 1NFYA 5IK2D 2F91A 1GVLA 2OP9A 1LPGB 3U8TH 2FI4E 5HM9A 2OQ5A 3F0PA 3RLWH 1EAXA 1MKWK 4SGAE 8LPRA 1TRYA 3PWCA 2RCEA 3PM3A 1C5RA 1TOMH 2H5DA 3GCNA 1Z1IA 4IS5A 2FEQH 1QRZA 1SOTA 1AO5A 3A7XA 3ZZAA 5C2ZA 1BMNH 1FAKH 2SGEE 3RXHA 1EZSC 4CRFA 4UFDH 2AFQB 1O2ZA 5FX6A 2WPLS 3E90B 3JZ2B 1YY3A 1C1QA 2QF4A 3SN8A 5KEDA 3UQVA 3SUEA 4PROA 1ANEA 3RDZA 3ZZDA 1G36A 4I31A 2PW8H 5L30H 4ZXXH 2OUAA 2P3TB 5A2MH 2KZ4A 2VU8E 4OS6A 4ABJA 1ESAA 3L33A 4IC5A 1J9CH 2H9EH 4UONA 1ELAA 4IMQA 1ID5H 2J9NA 1TPSA 2GV6A 4YM9A 2GCHF 2A2QH 1O37A 1IOEA 1PPGE 3ODDA 1EJNA 2V3MA 1OOKB 5DPAA 4FUFA 4D9QA 1J14A 2PP6A 4I33A 1YYY1 1XUGA 4JZ1A 2AH4X 3KQEA 5DP5A 1GG6B 1ANCA 4AOQA 4ZHMU 3E91A 3MFJA 2FIRH 4K1EA 2A45B 3F2FA 2BY5X 1UJ1A 1WQVH 4HFPB 2VVVA 1C2FA 4BAOB 1XVMA 1OHHD 3GCHC 1THSH 3MO3A 3D23A 1YPHC 1KLJH 1VR1H 2XW9A 5DK1A 1TNGA 3LH3A 4WVPE 1HAVA 2K8IA 1LKBA 2BM2A 3KHVA 1QRXA 2TIOA 3GY7A 3M36A 4E05H 4Q7XA 2AGIX 2OLGA 4AG2A 2G81E 2WPJS 4ESTE 4DT7B 3BTDE 1O5FH 1OKXA 1B5GH 1HJ9A 5C0TA 1BTXA 2F9VA 2IJD1 3SJKA 3LOXA 3TK5A 3RXUA 3ZZ7A 1SKYE 1ZHRA 5F03A 4F48B 1PJPA 4I8JA 1LVYA 4YOIA 3GY3A 4B71A 3U1JB 1P9SA 2K1QA 2TGDA 1TX6A 1C5VA 1ZR0A 5HXFA 1BBRE 2PKAB 1O2VA 3PO1C 4Y11E 1WSSH 5HGGA 3P17H 1A0LA 1TONA 2NU1E 1LHEH 4JZDH 1CT2E 4TY7A 3ZYEA 5F8XA 3MU1A 3MNBA 1V6DA 2WPMS 2AEIH 2ZA5A 5ESTE 1C1TA 4X8SH 1XUIA 4ACBA 5DG6A 3MNCA 5L2ZH 3OTJE 2I6QA 1AY6H 3S0NA 1P2KA 4K8BA 1B7XB 5LPEA 1J8AA 1HAGE 5EGMA 2GMTC 2SGDE 2STBE 1Z6EA 1W7GH 1W0YH 6LPRA 1DOJA 1FLEE 4ZAEA 2OCVB 3U98H 1AVGH 1UK4A 2BVRH 2C90B 2LPRA 1KMHB 1JIRA 1O2MA 4HTCH 1O3PB 4B2CA 4FUHA 1MTVA 4JK5A 2VWNA 5C0UA 3LGWA 4MPWA 1O3KA 3A86A 1GHBG 1BA8B 3UPEA 6ESTA 1QB1A 1X7AC 4NG9H 3URCA 1XMNB 3PV5A 4NIWA 1DPOA 3RC5A 2VIPA 1AVXA 1FJSA 1YPHE 3GCHB 3U28C 3UWJH 4MPVA 1K1JA 4AGKA 1BJUA 1FX0B 4X6MA 2FOBA 2AGGX 2HGTH 1GHAG 4ISOA 5EQQA 1HJAC 1MCVA 1EATA 1SGIB 2GGVB 3JZ1B 2BLOA 4E7RG 2VWLA 4ABHA 4DT4A 5LGOA 2XCFA 4YLQH 4MNXA 4B76A 1VCWA 3LC3A 1V2TT 1TMUH 5FX5A 2A7HA 1H1BA 2FOMB 4M9FA 2HWLB 4O3UA 1P3EA 2BD9A 2PSYA 4WMEA 2ZDAH 3TH4H 2ZHEH 2AMQA 4XFQA 4NWLA 5J4SA 1JOUB 1ZPZA 2BTCE 2R9PA 1DFPA 4CBOA 1BRBE 2F43B 2ZHQH 3ZVDA 1HUTH 3PO1B 4UFGH 4B6FA 1DY8A 2F9BH 3O8CA 1YBWA 2BDCA 2GTBA 2C8ZB 1DWEH 3PMHB 2KCAA 3RXCA 1BZXE 1ETRH 2JJ1D 1HDTH 3ZZBA 2FZZA 5C67A 4H42U 1K28D 1AVWA 4Y71A 3LJJA 2A7JA 1GL0E 3H09A 3RMLH 2Z9LA 1FUJA 1BTYA 1HV7A 1MTUA 2IPQX 2PUQH 3LGTA 5LPRA 1TRNA 3F1SB 4X8TH 2H9HA 2RG3A 3GYMA 2OC8A 3Q3XA 2GMTB 1CBWC 3PMAB 1TRMA 3KL6A 2PKSB 1MBQA 4BXWA 5DP7A 4WH6A 2Q6FA 4ABBA 1JRTA 2BQ7B 3CP7A 3GOVB 3A82A 1P2MA 5HIYA 4D9RA 2V7QD 2CHAB 2VIWA 3EE7A 1A0HB 2XWAA 3SU0A 5F8ZA 1YP9A 5GIBA 2VNTA 3BTWE 1C2JA 4A1VA 1SGRE 1D3TB 2B7DH 1NFXA 4X2WA 4UE7H 1EJAA 3HGNA 2H9TH 1EUFA 2EI6A 4TWYA 1K1NA 1O3MA 3ZVEA 1ELTA 1SVPA 1C5QA 2P3FH 2JH6D 1ANDA 5TCAA 1W0KD 1GMCG 1XX9A 1KXDA 4JYTA 4TYDA 1DWDH 2GP9B 3WWFA 4B2BA 3HGPA 4FXGH 3FO8D 3D62A 3KQ5A 2HALA 2HPQH 3DFJA 1RIWC 2Z7FE 3BV9B 1F0UA 1HJAB 2SGQE 1SGYE 1Y3VA 2ZTXA 2F3CE 3BTHE 1AN1E 3BTQE 5FHTA 1S0QA 1GBHA 1O3LA 1P3CA 3T5FH 3RXBA 3T28A 1UTPA 3E6PH 4WJG2 2Z9KA 1HIAB 2HNTC 2XBXA 4ZROA 3M5OA 1V2RT 2VIVA 2Q1JA 2QIQA 1P2OA 3KYFA 2XBVA 1UVTH 4MDSA 5CHAB 1O2TA 2G8TA 1ZSLA 2Y5FA 2ZWLH 1QHRB 1MKXH 5EPNA 2FI3E 4X6NA 1SLWB 1CHOG 1F0TA 1RD3B 1OS8A 4NFEA 4OGXA 4NSVA 2BZ6H 4OS2A 4X0WU 2NU4E 2QY0B 3CS7A 3OX7U 4GVUA 1W14U 5EODA 3PV2A 4E7NA 1O3NA 1UO6A 1UMAH 3A7TA 1VZQH 2W5EA 8ESTE 3KIDU 1HAYB 4CH8B 1FMGA 4FUJA 3LDXH 3W1EA 1SB1H 1GJ4H 1GPZA 1KYNA 1OX1A 1YC0A 4Z0KA 1GGDB 2P59A 1P04A 4H4FA 2F9UA 2PUXB 1CBWB 3VGCC 5DKMA 2JIZD 3SW2B 2PV9B 2ZIQH 1GBEA 3P8GA 1T8MA 4HI3A 3BTGE 2AS9A 1W12U 4Y8XA 1CHOF 3QWCH 1YLDA 1O3HA 2JETC 4P00A 9LPRA 3K2UA 1Q3XA 2ZTZA 4I8HA 5FBEA 2EC9H 3KQBA 4IN2A 3ATKA 1AIXH 3MMGA 1HAIH 3RXTA 1AHTH 1Y3YA 1LVBA 1GI9B 1CGHA 2ANKH 2M5TA 1L0ZA 1E1QD 1GBDA 1EOLA 1O39A 1O5GH 1O5AB 3A7VA 4RT1A 2SGFE 2A0QB 1GBIA 5EJZA 4GPGA 3U8OH 2ZFTA 3NXPA 4Y0YE 4X8VH 1GMDF 1Z8RA 1CA0C 2ZHDA 1LKAA 1EZXC 2RA0A 4M7GA 1BMFD 3UUZA 1LHFH 1F0RA 1RIWB 1AI8H 4NZLA 1KXBA 1Z8IB 5TJXA 1ZLRA 5DSFA 1C1PA 2WPHS 2FOFA 2I6SA 3M5MA 1IHTH 1W3CA 3RM0H 2VB0A 1SGFG 2O8TA 3TJUA 1HXEH 2HNTE 4HZHA 3GY6A 5DP3A 4FVBA 1SFIA 4DY7B 1O3OA 1XKAC 2R2WU 1M9UA 3L3TA 1FY4A 2ZZUH 2A4GA 2QA9E 4Y7BA 1G3DA 1EP5A 1GBKA 1HAVB 5F53A 1PQ5A 2BYAX 1MQ6A 2ANMH 1O2UA 1ELCA 1O31A 3ZV9A 2A4OA 1DX5M 3A7YA 4AZ2B 5FXLA 3VB7A 3TU7H 1T31A 1ELVA 1PPFE 1WUNH 3ZIAD 3QTOH 1COWD 3M7TA 3OE7D 3ZV8A 1ETSH 4FUDA 2JKHA 1BOQA 3VFEA 3A81A 3AVZA 3GCTF 8GCHF 4UDWH 3HKIB 2CK3D 1BTHH 3LGUA 3T27A 1BHXB 2ZGJA 1TX8A 2W3KA 4B6EA 2ZGBH 2FMJA 4O03A 2WHXA 1EB2A 1ACBE 2FLRH 2P94A 5I46H 1LMWB 1ZGVA 1S83A 3TJVA 1GBAA 3SV7A 1RTFB 3VGCB 1O2SA 3M35A 3R3GB 1QGFA 3LKWA 1C4Y2 3SUGA 2CJIA 3UB0A 3O8BA 2DE9A 3IITA 7GCHG 1E38B 1O2OA 2M2AA 3NUMA 4CH2B 3O8RA 4MNWA 2JETB 3HATH 2AHME 4YESB 1EFRD 1ZHPA 4MVNA 5JDUB 1UCYH 1AKSB 1MTWA 1SGDE 1W0ZU 2SNWA 2ZKSA 1UHBB 4YOGA 4YT6H 1QL9A 2J95A 1TMBH 2BD3A 1RS0A 3I77A 2F9OA 2BOKA 1TNLA 3UOPA 3TK6A 3PV4A 3OEED 2H5CA 1VITF 2KR7A 2ZCLP 3FVFB 1TBQH 4CRBA 3QUMP 1BT7A 4ZH8A 3GY8A 2FOCA 4CRAA 3ENSB 2ZHWH 1K1LA 1VCQA 1CA0B 2HPPH 3OY5U 1BHXF 1WDIA 2YMSD 4OS5A 1V2UT 1Y8TA 3P6ZB 3BTME 1DWCH 1AFQB 2O8UA 1TABE 2W6ID 4H6TA 1D3QB 1D4PB 1T32A 2FX4A 3RXEA 3SORA 2AGEX 2QAAA 4FVDA 3FP8E 2YMSC 5T1VA 3ITIA 1D9IA 2LNCA 2PLXA 3VB5A 2HLCA 4B75A 5HMAA 3Q3YA 5CMXH 1VGCC 3WWBA 3A8CA 2EA3A 4Q2KA 1V2OT 1NN6A 1HGTH 2FWWA 1BRAA 5DO4H 1N6YA 1QNJA 1KTSB 1A0JA 2FP7B 1H8IH 1PPHE 1GL1A 3QZQA 3NK8A 1PPEE 3ATMA 1C5OH 2BZAA 1AE8H 1UK3A 4KP0A 2GCHG 1J17T 2ILNA 1NFWA 1T8NA 5AHGH 5E2OA 5ABWA 5IDKA 3TGKE 1E37B 1H8HD 1SQRA 4BTIB 2FI5E 2L74A 3K6YA 1QQUA 1T8OA 2Y6TA 4YOJA 3TNTA 1O36A 2QYIA 1KXFA 4J2YB 3S9BA 5GJ4B 1KXCA 1A2CH 4DIHH 1NT1A 1C5XB 3LGVA 4OS1A 5GWZA 3A7WA 1GJCB 3MH7A 3Q76A 1PQ8A 2H1UA 5EQSA 1A61H 2WPIS 3PWBA 3M37A 1EPTC 1TPAE 2C4FH 2Y7ZA 1GHXH 4NA7A 3K9XB 4JZEH 3MI4A 2ZEBA 2ZFFH 1GI2A 4ASUD 3EYDA 4YTAA 5AVDA 1SHYA 1ELDE 3SNBA 2PTCE 2J4IA 4I7YH 1F5LA 3KEEA 1HXFH 2ZGHA 4OS7A 1DY9A 3DCLA 1Y3XA 1AB9C 5AF9H 2KCPA 4A1TA 1AQ7A 2WUBA 3BSQA 4RKJB 1FN8A 1QTFA 2KAIB 3SUFA 4AORA 1TGSZ 2PR3A 3KYGA 5C94A 1HFDA 3OU0A 1ZMJA 5LH8A 1BRCE 5EXLA 3SU3A 1GHZA 3BTEE 1SGFA 1L1JA 3OEHD 1MD8A 4K1SA 1NTPA 1RTKA 1KLTA 4Q80A 1O2NA 4UFEH 1C5NH 4A7IB 3AAVA 1ORFA 3AW0A 4F4OC 3GICB 1G3EA 3OSYA 2UWOA 4B2AA 1W10U 3SYJA 1SHHB 1SGCA 1ELGA 3NWUA 4JYUH 2YMSB 2BD5A 1KDQB 3BG8A 1KY9A 3PMJA 1GJDB 1OWKA 1VGCB 9ESTA 1N1LA 4I32A 1S5SA 3OAAD 1NBMD 3B9FH 3ZVFA 2BQ6B 1IQKA 1MTSA 3LGIA 1GJBB 2FX6A 3GS9A 1GVZA 2QXIA 3TLOA 2FODA 1ZPBA 2ZG0H 3SNEA 2EQNA 4CHAC 2GJGA 3SV9A 2A31A 2VIOA 2IPHA 1DICA 4U01A 1C4U2 5HIZA 1P12E 4ISIH 1QL8A 4ABFA 1NRNH 4JYVH 2R0KA 3BG4C 3MYWA 5A8YA 4CRCA 4ABAA 1DANH 3ATLA 3EGKH 1SR5C 1MCTA 3TH3H 3M5NA 1CO7E 3SO3A 3FOAA 1ZMNA 4NGAH 2NU2E 2VINA 4IW4E 2C8YB 3SV8A 3QZRA 3UR6A 1EB1H 2V3OH 1BTUA 1W13U 2PGQB 2FDAA 3SJ9A 3F9HA 3SJ8A 2QC2A 1L1NA 3OY6U 1O2GH 2ZGXH 1HB0B 1AUTC 4TPIZ 2IN2A 1EPTB 2XC0A 5EPYA 5C17A 1EAWA 4Y8YA 1VITH 2XC5A 1EJMA 4JZIA 3SNDA 5J4QA 4TSFD 1TBRH 1GJ9B 1TB6H 3TGIE 1WAYB 3UTUH 2Y7XA 2BVSH 3RUOA 3A84A 1MAXA 1AB9B 4LXBH 1Q2WA 2J98A 5L6NH 1SFQB 2BDBA 2Q6DA 1FV9A 1G3BA 3EA9A 5A0AE 3MU0A 1C1VH 3SV2H 1G2LA 2B5TB 5C3NA 4FOUC 5FPYA 3HKJB 1ELBA 4U2WA 1JMOH 3T26A 1HAHH 3UNSA 2STAE 1QBVH 4AFZA 1EX3A 1MABB 3ZZ8A 1O30A 3UIRA 1O2LA 1TA2A 2C93B 2ZDMA 3QGNB 3MOCA 4TWWA 3RXPA 3TH2H 1G37A 1UVSH 2VIQA 1OPHB 3UNRA 1SG8B 3MNXA 2ZDVH 3QX5H 3VEQB 4FU7A 3L6PA 2FM2A 2FS8A 1NO9H 7ESTE 3ZVBA 4X6PA 2EI7A 1GBBA 4DW2U 1IQIA 4RSPA 4NIVA 3SI3H 3P92A 1DE7H 1SLUB 3DSOA 2ZPQA 1W2KH 3MNSA 3MH6A 3TJNA 1O3EA 3Q00A 1TBZH 2J97A 2FS9A 2VGCC 3AW1A 1YPJH 1DXPA 4TT3D 4XBDA 1O2HA 1NBME 3P8NA 1ZTKA 2HLDD 1UW7A 3IG6B 3QDZB 1TGBA 2J34A 2EEKA 2WYGA 1C5ZB 1FONA 1P11E 2Y5GA 3TK9A 3BG4B 1MKXK 1HAZB 3F0OA 2B9LA 1GDNA 3KN2A 2R3YA 3MU8A 4YZUA 1XM1A 1AE5A 4ZUHA 1LVMA 4U30A 1QIXB 2PFEA 1CVWH 1KXEA 1NU7B 2ZU4A 4NFFA 5CE1A 1SGQE 3DSPA 1C2GA 2BDGA 3A8DA 1PFXC 2OK5A 1OWHA 5GDSH 2O8WA 3BTFE 3T62A 1OWIA 1D6WA 1IAUA 3S69A 3MU4A 3RC6A 3LC5A 3E3TA 1PPZA 3E16B 1DITH 1FY1A 1NRQH 1SI5H 4MQAA 4RN6A 5E0GA 4LZ1H 3KQDA 4AYYB 4KELA 4NA8A 2J38A 1FI8A 2ZQ2A 5E2PA 1GI6A 4INLA 1H9HE 1HPGA 2BMGB 4HGCA 4ZKNU 2BDYA 2WUCA 4X1PU 1TYNA 5AFZH 1TMTH 2ANWA 1TFXA 2K0QA 1C2EA 1XXFA 1LO6A 2Z9IA 5LPFA 2A1DB 4TPYA 3SJOA 1ZGIA 1BMMH 5EU8A 1EOJA 1CU1A 1TQ7B 4XDEA 1K9OE 1W11U 4ZKOU 2B8OH 1LPZB 1GBMA 1O2RA 2A2XH 2CMYA 3RXIA 2VBCA 3KNXA 2SNVA 2BX3A 1QBNA 2XBWA 3MU5A 5KGOA 1IQNA 1S6HA 1BCUH 1E34B 3SZEA 3M7QA 2WINI 4INKA 1FPCH 4ISLA 2HOBA 1ZOMA 3ZVAA 3FZDA 5F8TA 3UY9A 4AFSA 1VKYA 1F0SA 4MTBA 2VJ1A 2YOLA 3OFND 3URDA 1PQ7A 2HRVA 4BAQB 4SGBE 1QJ7B 3N7OA 2VGCB 2BDAA 1GI7B 2XWBI 1N8OC 7KMEH 5JB9S 4BAHB 1MQ5A 2A5IA 4XOJA 2W26A 4X1NU 1C5UA 4DCDA 1QA0A 1S82A 1SBWA 3RXVA 1O35A 1ZJDA 3NZIA 3O8DA 2QXGA 1MU8B 2ALPA 1AMHA 2QF0A 1O3CA 3SQEE 1GJAB 1OXGA 1C5PA 3ZZCA 1ESBA 1THPB 1QB9A 2BD7A 3ATWA 3GY2A 5B6LA 1TOCB 5AFYH 3PMBB 1LTOA 1FXYA 4AB8A 2P95A 5A8ZA 1GJ5H 1V2QT 4I8LA 2ZI2H 1TGCA 1CQQA 2ZU3A 3E1XB 1QY6A 2P8OC 1IQHA 1O3FA 4I8GA 1INCA 1O38A 3WY8A 3P70B 1F5RA 1Y5AT 1GMDG 3ZVCA 1A5GH 1GHWH 2ULLA 3SGBE 5GNDA 2OXSA 4BANB 1P06A 3RMNH 1HAXB 4FUGA 1S6FA 1DSTA 3GDVA 1BBRH 2GDEH 4AFUA 5FBIA 5EJLA 1MZAA 3SBKA 1A3EH 1CHGA 3A89A 2G5NA 2XNDD 1UCYK 3M3SA 5L2YH 1FY8E 4XD7D 4BXSA 3M3VA 4IN1A 4BNRA 1K1OA 2BB4A 3G01A 3SGQE 3BF6H 4Q7YA 3ZZ9A 5E0HA 1J15A 2JH5D 2ZFSA 1ZZZA 2CF9H 1BDAA 4X1SU 3AASA 3PB1E 2AMDA 1MAYA 2GCTC 1GMHG 1BITA 1HNEE 2PWXA 1BUIA 8GCHG 3DT0H 1V2ST 3GCTG 1P02A 1P0SH 3KGPA 1HRTH 2J5UA 1AGJA 1ARBA 4Q7ZA 2LELA 2F9PA 2ZU2A 5EJ1A 2RFKC 1C2MA 4NZQA 1WTHD 1EZUC 1JBUH 1IQGA 2ZQ1A 2ZU1A 5ETXA 5E8EH 2AMPA 1S85A 1GBCA 1GBFA 5BPEA 1TIOA 1H9IE 1NRRH 1T4VH 3A8BA 5EOKA 3PRBA 3ZZ5A 2R2MB 1XKBC 1GBTA 5EQRA 3PLBA 1YWUA 1V2JT 1N8OB 2XYAA 3PROA 1GCTC 3BEUA 1PPCE 1LHDH 3A8AA 1V2KT 1P03A 1GHVH 2ZHFH 2GD4B 2GZ7A 3R0FA 2ZDLA 4WXVA 3QLPH 1QJ6B 3TPIZ 1JXPA 1MBMA 4X6OA 4BOHA 1GMHF 2AERH 3M3TA 4FUCA 1F92A 1ZPCA 3M61U 4WWYA 1MZDA 5BRRE 4H6SB 3V13A 2WYJA 1MMJN 1P2QA 2GZ8A 1C1OA 1EZQA 3H7TA 3QK1A 3LT3A 4GHQA 2TGPZ 1SQOA 3BEIB 1A5HA 6CHAC 1L1GA 1O3GA 5C1UA 2OC1A 1O2QA 1O3JA 2BLWA 2G51A 1LDTT 1V2WT 1GBJA 1VITG 5JBBS 5ESBA 1C5WB 4ABGA 3VB6A 5FCRA 2P8OB 3FFGA 1FNIA 4MNYA 2H2ZA 3D65E 1DUAA 2FPZA 1FIZA 1SC8U 1C2KA 3QTVH 1H9LB 2HNTF 2W7UA 4XBCA 4NSYA 4GUXA 2A4RA 3E0PB 3BIUH 2Z3DA 3LJOA 1WXRA 1B0EA 1QZ8A 4DJZB 2WSSD 2XTTB 1IQJA 3MWIU 2KFWA 2TBSA 1EKBB 1C2DA 1W0JD 3RXRA 1ZTLA 1YLNA 2BD8A 2JH0D 2THFB 4AFQA 4AN7A 3TNSA 1P2JA 2ZNKH 4Q4LA 1O2XA 3W95A 4A6LA 1DS2E 3CNRA 5B6OA 5E0JA 1XUJA 3NKKA 4ABDA 1SMFE 1YGCH 1V3XA 5JBAS 1MD7A 2XNIA 4GCHF 1DSUA 2Z9GA 1P10A 4BAMB 3UNQA 4A1XA 4THNH 4K2YA 5A09A 5JBCS 2GCTB 4NIYA 4QT8C 4ABEA 2ESTE 2SFAA 1SPJA 3FAOA 3TITA 1ELEE 3RXSA 1TWXB 1YKTA 4VGCC 2FESH 2H6MA 4IGDA 1CGJE 3PLKA 1WBGB 1FZZA 4ASHA 3DHKH 3LPRA 4K1TA 3VB3A 3Q3KA 1HLTH 2G4UA 3LH1A 4OS4A 6GCHF 1GCTB 3A88A 2UUYA 2DUCA 4ACAA 4B73A 1O3IA 1G2MA 2O8LA 1TPPA 5DP9A 1P9UA 1SGNE 3E8LA 3LGYA 1FQ3A 2GX4A 3RXMA 4UFFH 2PGBB 2NWNA 2A4QA 5DN6D 1UTQA 2F83A 2BXUH 5DP6A 5T6FA 4D8NA 1RXPA 3F2HA 3RP2A 3K6ZA 3A7ZA 2W6JD 1O34A 2QF5A 1YCPH 1Z7KA 3SU1A 3STIA 4CRGA 6CHAB 1UTKA 2ZPRA 1W7XH 5HKKD 1XXDA 1EAUA 2EI8A 1BRUP 2D2DA 2W3IA 5GCHF 3EE0B 4MPXA 2ZFQH 1JWTA 1TNHA 1V2LT 4X1RU 4ZMAH 1TLDA 3UWIA 2FXRA 3MTYA 1JIMA 1FY3A 1AD8H 5HYOA 5DJ7A 3SV6A 5DP4A 1WOFA 1C5LH 3RC4A 2AIPA 1UTLM 1YCPM 3Q77A 4JMYA 1ZTJA 1SQTA 4FUBA 4WY3A 2ODPA 4YO9A 3T2NA 1DVAH 1ZRBA 1KTTB 1XVOA 2FOAA 3V12A 1NRSH 3P95A 5FPTA 4AYVB 4Z6AH 3F3BA 2RDLA 2XCNA 4GLYA 3SNCA 2CN0H 1DWBH 2ZECA 4ZHAA 2CV3A 2Q6GA 2BD4A 3P8OA 2O8MA 2UUJB 3BIVH 4K5ZA 1A5IA 1YPMH 2BLQA 5DP8A 3RXGA 1TPOA 3OYPA 4B1TA 4B74A 1T7CA 4GHTA 1RRKA 2KX4A 1SL3A 1Q31A 1BJVA 4KTUA 1ELFA 2ZDNA 4KKDA 3A80A 3AK5A 1GDQA 3SGAE 1WQSA 1O2YA 4F49A 1AFEH 1P05A 1O2WA 4OM9A 4F55A 2SGAA 4YXWD 2FO9A 3STJA 3FP7E 4X8UH 5JBTA 2ZGCA 1HAPH 3E0NB 1ANBA 4ISNA 2YNAA 3BEFB 4VGCB 2IJOB 4U32A 1TE0A 4A5TS 2BY6X 3RXKA 5CDFE 2OQUA 1NS3A 3NPSA 3EDXB 2O9QA 3VXFH 2J92A 1KXAA 3KCGH 2ALVA 3VG8A 2EY4C 2OINA 1GJ7B 1RGQA 2ASUB 4AC9A 3V0XA 2BX4A 2GKVE 4FU8A 2BY8X 3PTNA 1OP2A 4JK6A 3DFLA 1ABJH 2J94A 1CE5A 4IMZA 3GYLB 3A85A 3C27B 1CT4E 2JDID 1FN6A 1MKWH 1P01A 3GISB 1K1MA 2BXTH 3CENA 4UD9H 1KIGH 4FU9A 2BDHA 5C1XA 3U69H 5FL7D 3HK3B 2V35A 3SQHE 1BMLA 2C8XB 1QR3E 3PLPA 3RU4D 1IQMA 2WPDD 1GBLA 3F9GA 2ZDKA 1ZRKA 1OWEA 1LQDB 1LHGH 1AKSA 1ARCA 1ABIH 2WV5A 1UHBA 1H8ED 1O33A 4K60A 5I25A 2WPKS 2QE7D 4INHA 1AU8A 3N7DA 2Y80A 1D3PB 1U6QA 1TNKA 3B8JA 3N99A 2FOHA 1Z71A 3SU4A 1Y5UT 1DLKB 2PKSC 2F4LA 1HBTH 1GVKB 1UTMA 1F2SE 1QCPA 4IBLH 1MU6B 2FYRA 1DLEA 1Z6JH 3ESTA 2G4TA 2CHAC 2PHBA 2QN5T 1A4WH 1FIWA 2GVFA 1V2VT 2BLVA 4X2XA 1E1RD 3DUXH 1BTPA 2VVCA 2P3UB 4KTCA 3ATIA 5EXMA 1RJXB 3I29A 2UUKB 1V2PT 3UAIC 1JRSA 3KF2A 1SLVB 4XRNA 4GSOA 4O97A 4RKOB 1Z8JB 1S84A 1C1WH 1Y3UA 1SQAA 4Y76A 1Z1JA 1SSXA 1J16A 1LPKB 1QJ1B 1XUHA 3UOUA 3PTBA 1AZZA 2L6OA 3LU9B 2ODYB 1E79D 2KCYA 2XOKD 4WMFA 3SU2A 4NCYA 5EG4A 1LCYA 4JCNA 2D26C 3F9FA 3QO6A 1P2NA 4I86A 2ZTYA 1YPGH 4X1QU 1S6LA 7LPRA 3RXDA 1T8LA 4CHAB 1GHYH 4O9VA 2FYQA 1PPBH 1CA8B 1BIOA 3VPKA 3ZZ4A 2VH0A 2Y82A 4WXIA 3VB4A 2RDEA 1UTNA 3MQKC 4D7GA 1WCZA 3D49H 1WU1A 1FPHH 1GHBF 3U9AH 5H4IB 1NROH 1SGTA 3GDUA 1BMAA 5IYTA 2OTVA 1QL7A 1GI8B 1V2MT 2ANYA 2A5KA 1H8DH 4Y10E 1EP6A 1YPEH 4DVAU 4ZCNA 3M7UA 1XUKA 3FP6E 2Z3EA 2TGTA 4DURA 1UCYE 1GHAF 3FANA 5CHAC 1O5CB 1O5DH 2UWPA 2AIQA 5GXPA 3SNAA 1E0FD 1L2EA 1AWFH 1QFKH 2HVXA 2BVXH 2GT7A 2WZQA 4P02A 4XBBA 1N6XA 1NC6A 1Y5BT 3HPTB 2OD3B 1MTNC 1V2NT 3ZZ6A 3RU4E 1VJ9U 3ELAH 1E36B 4FUEA 1O2PA 2ZO3H 4MLFB 1A3BH 1GGDC 1SGPE 3TGJE 1WTGH 4J1YA 5EIYA 1BBRK 1C2HA 4ISHH 2KAIA 1UK2A 1AUJA 3RMOH 2SGPE 4NIXA 4K69A 5GPIB 1XUFA 4K8YA 1UTJA 1Z8GA 1O3DA 2ODQA 1EASA 1SLXB 4CRDA 2ZP0H 3SU6A 2D8WA 1D6RA 2QXHA 4YLUA 3RXFA 1S81A 1KLIH 2FTLE 5A0BA 1IQEA 1O2JA 4DG4A 1OWDA 2ZPSA 3MH5A 4IC6A 3RXJA 3DA9B 3B23B 5A0CA 3TJOA 3UFAA 2XRCA 3F2GA 2WV4A 3RXQA 4XSKU 5JYIA 3RLYH 4JZFH 2Z9JA 1KDQA 1C5YB 1OYTH 2ZCKP 3P8FA 4NWKA 2NU0E 3EQ0H 4ZKRU 4BAKB 2KCOA 2ZF0H 5EXNA 4DGJA 1W8BH 1SOZA 1G3CA 1OP0A 1UTOA 4FUIA 2P16A 4K3JA 3WW7A 3S9CA 1O32A 3NRLA 4AG1A 3AAUA 4MNVA 2OC7A 3QGJA 3TIUA 1C1SA 4I8KA 1TGNA 3H7OA 1HYLA 1S0RA 1VJAU 2CF8H 4A92A 5KECA 1C5SA 1UVUH 4ZKSU 3ZYDA 1GI1A 1NY22 3A83A 3RU4T 1H4WA 1TNIA 1K22H 1G32B 2PKAA 1FAXA 3SI4H 2A32A 3MHWU 4D7FA 1ZJKA 3H5CB 2G5VA 2FOEA 1QBOA 1C9TA 4O3TA 3UQOA 1GMCF 1BTZA 3F6UH 1D3DB 2GV7A 4LZ4B 4LK4A 1Y59T 4AGJA 2GDDA 4Y8ZA 2W7SA 4UEHH 1DDJA 2Z6BD 1C1MA 2VWOA 4D76A 3FKSD 2V6NA 2QCYA 3DSGA 1K21H 1C5MD 2V0BA 1MH0A 1DM4B 2V3HH 1EPTA 1IQLA 1LVOA 2ZFRH 1ETTH 4KGAA 8KME2 5K7RA 1RFNA 3ZVGA 1GJ8B 4RI0A 1YPLH 2PTNA 1LHCH 1MTNB 2A5AA 4CBNA 4Y0ZE 1YF4A 3S9AA 1C1NA 2QXJA 1K2I1 3F9EA 5JB8S 1BTWA 1CSOE 1AWHB 1YM0A 3A87A 5HM2A 3ZZ3A 2GT8A 1DUEA 2GZ9A 2BHGA 4GAWA 3U1IB 1NESE 1YLCA 2TPIZ 2BOHB 3PRDA 1NRPH 1TQ0B 2FOGA 1Y3WA 3GY5A 1P8VC 4MG3A 1QA7A 1HJ8A 1OP8A 4WH8A 1BB0B 4YT7H 4RT0A 4ZHLU 1QRWA 1NZQH 2CXVA 1F5KU 3N7EA 1C2LA 1O2KA 2OC0A 1TALA 3M5LA 2ZC9H 2XXLA 1CGIE 2CGAA 3U8RH 5DGJA 2Z3CA 5F6MA 1IQFA 3K65B 5PTPA 2YNBA 3TVJB 2XC4A 1GCDA 4FETA 1NU9A 1NPMA 2BY9X 1A1RA 1G9IE 3GCOA 4DIIH 2DE8A 2QF3A 3QN7A 3VXEH 1BQYA 1GDUA 5G4BA 5SGAE 5EW2H 1L4DA 5T3HA 1K1IA 2VH6A 2UUFB 5T6DA 4ABIA 1P57B 2NU3E 1WYKA 4BTTB 4R0IA 1O2IA 1QB6A 2C3SA 1AFQC 1KSNA 3T29A 1K0HA 2JJ2D 1DT2A 3SOSA 4AB9A 5FCKA 4AX9H 1E35B 3SHCH 3HK6B 4Z1MD 2IOTA 4X2YA 4CREA 3BTKE 3W94A 3MO9A 1O5BB 3FZZA 4TY6A 1PYTD 4WF8A 3EA8A 3MO6A 1C9PA 4Y79A 1EXFA 2BDIA 1IHSH 1UVPA 3BTTE 4ZXYH 1HAOH 2J2UA 3SHAH 5C20A 1LQEA 1THRH 1HCGA 1A7SA 3MH4A 1RTLA 3SUDA 1YCPK 5JPMH 1C1RA 1P09A
chains in the Genus database with same CATH topology
5C5NA 3RXLA 1PYTC 5C5OA 1O3AA 1ZSJA 2UWLA 2A7CA 1ZYOA 4KTSA 3SU5A 5TCCA 3I78A 5FAHA 2VWMA 3RXAA 3GY4A 2FLBH 1TX7A 1O0DH 1NM6A 5EW1H 1K1PA 3C1KA 1F7ZA 2AYWA 1GI4A 2BD2A 1T4UH 2XBYA 4GCHG 1ZMLA 1OYQA 1G30B 1WV7H 2ZU5A 2BY7X 2G00A 4Y6DA 3RM2H 4CR5A 2F9NA 1TAWA 4LOYH 3CS0A 2FTMA 2B0FA 4E06H 2TGAA 2QGRA 2Y81A 1ZSKA 4Y7AA 1C5TA 1MUEB 3DD2H 4OGYA 3LONA 1EQ9A 3IWMA 1ZHMA 4CR9A 4WMDA 2R3UA 1EAIA 1PQAA 4X2VA 4XE4A 2Z94A 1OWJA 1TNJA 4DOQA 6GCHG 1TGTA 3EA7A 1TA6A 1C2IA 1C1UH 3UREA 1ESTA 1A46H 2OBOA 2ZFPH 5C1YA 5K0HA 3KQCA 3V3MA 1GI3A 2Y5HA 2VVUA 3GDSA 1O3BA 1P2IA 5FPSA 1DXWA 3S7KB 4R8TB 3RMMH 1OSSA 1GG6C 2TRMA 4NA9H 1CT0E 1GWAA 2G55A 3V7TA 1QQ4A 2R0LA 5T6GA 2P93A 1UVOA 1SGEE 3SJIA 3F68H 1VCPA 1B0FA 7GCHF 2G52A 1FY5A 1GI0A 1HIAA 2RA3A 2ZCHP 5GCHG 1GI5A 1QURH 3RXOA 3SZNA 3PYHA 2PSXA 1L4ZA 2BQWB 2QV1A 3BN9A 2D1JA 2OBQA 1YPKH 2C8WB 1AZ8A 2VIDA 3NCLA 3T25A 5A8XA 3ODFA 3S7HB 3EAJA 1C4V2 4MPUA 1FDPA 4BTUB 1NFUA 1GJ6A 3UR9A 3LIWA 1O5EH 1NFYA 2F91A 1GVLA 2OP9A 1LPGB 3U8TH 2FI4E 5HM9A 2OQ5A 3RLWH 1EAXA 1MKWK 4SGAE 8LPRA 1TRYA 3PWCA 2RCEA 3PM3A 1C5RA 1TOMH 2H5DA 3GCNA 1Z1IA 4IS5A 2FEQH 1QRZA 1SOTA 1AO5A 3A7XA 3ZZAA 5C2ZA 1BMNH 1FAKH 2SGEE 3RXHA 1EZSC 4CRFA 4UFDH 2AFQB 1O2ZA 5FX6A 2WPLS 3E90B 3JZ2B 1C1QA 3SN8A 3UQVA 3SUEA 4PROA 1ANEA 3RDZA 3ZZDA 1G36A 4I31A 2PW8H 5L30H 4ZXXH 2OUAA 2P3TB 5A2MH 4OS6A 2VU8E 4ABJA 1ESAA 3L33A 4IC5A 1J9CH 2H9EH 4UONA 1ELAA 4IMQA 1ID5H 2J9NA 1TPSA 2GV6A 4YM9A 2GCHF 2A2QH 1O37A 1IOEA 1PPGE 3ODDA 1EJNA 1OOKB 5DPAA 4FUFA 4D9QA 1J14A 4I33A 1YYY1 1XUGA 4JZ1A 2AH4X 3KQEA 5DP5A 1GG6B 1ANCA 4AOQA 4ZHMU 3E91A 3MFJA 2FIRH 4K1EA 2A45B 2BY5X 1UJ1A 1WQVH 4HFPB 2VVVA 1C2FA 4BAOB 1XVMA 3GCHC 1THSH 3MO3A 3D23A 1YPHC 1KLJH 1VR1H 2XW9A 5DK1A 1TNGA 3LH3A 4WVPE 1HAVA 1LKBA 2BM2A 3KHVA 1QRXA 2TIOA 3GY7A 3M36A 4E05H 4Q7XA 2AGIX 2OLGA 4AG2A 2G81E 2WPJS 4ESTE 4DT7B 3BTDE 1O5FH 1OKXA 1B5GH 1HJ9A 1BTXA 2F9VA 3SJKA 3LOXA 3TK5A 3RXUA 3ZZ7A 1ZHRA 5F03A 1PJPA 4I8JA 1LVYA 4YOIA 3GY3A 4B71A 3U1JB 1P9SA 2K1QA 2TGDA 1TX6A 1C5VA 1ZR0A 5HXFA 1BBRE 2PKAB 1O2VA 3PO1C 4Y11E 1WSSH 5HGGA 3P17H 1A0LA 1TONA 2NU1E 1LHEH 4JZDH 1CT2E 4TY7A 3ZYEA 5F8XA 3MU1A 3MNBA 1V6DA 2WPMS 2AEIH 2ZA5A 5ESTE 1C1TA 4X8SH 1XUIA 5DG6A 3MNCA 5L2ZH 3OTJE 2I6QA 1AY6H 3S0NA 1P2KA 4K8BA 1B7XB 5LPEA 1J8AA 1HAGE 5EGMA 2GMTC 2SGDE 2STBE 1Z6EA 1W7GH 1W0YH 6LPRA 1DOJA 1FLEE 4ZAEA 2OCVB 3U98H 1AVGH 1UK4A 2BVRH 2C90B 2LPRA 1JIRA 1O2MA 4HTCH 1O3PB 4B2CA 4FUHA 1MTVA 4JK5A 2VWNA 3LGWA 4MPWA 1O3KA 3A86A 1GHBG 1BA8B 3UPEA 6ESTA 1QB1A 1X7AC 4NG9H 3URCA 1XMNB 4NIWA 1DPOA 3RC5A 2VIPA 1AVXA 1FJSA 1YPHE 3GCHB 3UWJH 4MPVA 1K1JA 4AGKA 1BJUA 4X6MA 2FOBA 2AGGX 2HGTH 1GHAG 4ISOA 5EQQA 1HJAC 1MCVA 1EATA 1SGIB 2GGVB 3JZ1B 2BLOA 4E7RG 2VWLA 4ABHA 5LGOA 2XCFA 4YLQH 4MNXA 4B76A 1VCWA 3LC3A 1V2TT 1TMUH 5FX5A 2A7HA 1H1BA 2FOMB 2HWLB 4O3UA 1P3EA 2BD9A 2PSYA 4WMEA 2ZDAH 3TH4H 2ZHEH 2AMQA 4XFQA 4NWLA 5J4SA 1JOUB 1ZPZA 2BTCE 2R9PA 1DFPA 4CBOA 1BRBE 3ZVDA 2ZHQH 1HUTH 3PO1B 4UFGH 1DY8A 2F9BH 3O8CA 1YBWA 2BDCA 2GTBA 2C8ZB 1DWEH 3PMHB 3RXCA 1BZXE 1ETRH 1HDTH 3ZZBA 2FZZA 5C67A 4H42U 1K28D 1AVWA 4Y71A 3LJJA 2A7JA 1GL0E 3RMLH 2Z9LA 1FUJA 1BTYA 1HV7A 1MTUA 2PUQH 3LGTA 5LPRA 1TRNA 3F1SB 4X8TH 2H9HA 2RG3A 3GYMA 2OC8A 3Q3XA 2GMTB 1CBWC 3PMAB 1TRMA 3KL6A 2PKSB 1MBQA 4BXWA 5DP7A 4WH6A 2Q6FA 4ABBA 1JRTA 2BQ7B 3CP7A 3GOVB 3A82A 1P2MA 4D9RA 2CHAB 2VIWA 1A0HB 2XWAA 3SU0A 5F8ZA 1YP9A 5GIBA 2VNTA 3BTWE 1C2JA 4A1VA 1SGRE 1D3TB 2B7DH 1NFXA 4X2WA 4UE7H 1EJAA 3HGNA 2H9TH 1EUFA 2EI6A 4TWYA 1K1NA 1O3MA 3ZVEA 1ELTA 2P3FH 1SVPA 1C5QA 2JH6D 1ANDA 5TCAA 1GMCG 1XX9A 1KXDA 4JYTA 4TYDA 1DWDH 2GP9B 4B2BA 3HGPA 4FXGH 3D62A 2HALA 2HPQH 3DFJA 1RIWC 2Z7FE 3BV9B 1F0UA 1HJAB 2SGQE 1SGYE 1Y3VA 2ZTXA 2F3CE 3BTHE 1AN1E 3BTQE 5FHTA 1S0QA 1GBHA 1O3LA 1P3CA 3T5FH 3RXBA 3T28A 1UTPA 3E6PH 4WJG2 2Z9KA 1HIAB 2HNTC 2XBXA 4ZROA 3M5OA 1V2RT 2VIVA 2Q1JA 2QIQA 1P2OA 2XBVA 1UVTH 4MDSA 5CHAB 1O2TA 2G8TA 1ZSLA 2Y5FA 2ZWLH 1QHRB 1MKXH 5EPNA 2FI3E 4X6NA 1SLWB 1CHOG 1F0TA 1RD3B 1OS8A 4NFEA 4OGXA 4NSVA 2BZ6H 4OS2A 4X0WU 2NU4E 2QY0B 3CS7A 3OX7U 4GVUA 1W14U 5EODA 4E7NA 1O3NA 1UO6A 1UMAH 3A7TA 1VZQH 2W5EA 8ESTE 3KIDU 1HAYB 4CH8B 1FMGA 4FUJA 3LDXH 1SB1H 1GJ4H 1GPZA 1KYNA 1OX1A 1YC0A 4Z0KA 1GGDB 2P59A 1P04A 4H4FA 2F9UA 2PUXB 1CBWB 3VGCC 5DKMA 3SW2B 2PV9B 2ZIQH 1GBEA 3P8GA 1T8MA 4HI3A 3BTGE 2AS9A 1W12U 4Y8XA 1CHOF 3QWCH 1YLDA 1O3HA 2JETC 9LPRA 3K2UA 1Q3XA 2ZTZA 4I8HA 5FBEA 2EC9H 3KQBA 4IN2A 3ATKA 1AIXH 3MMGA 1HAIH 3RXTA 1AHTH 1Y3YA 1LVBA 1GI9B 1CGHA 2ANKH 2M5TA 1L0ZA 1GBDA 1EOLA 1O39A 1O5GH 1O5AB 3A7VA 2SGFE 2A0QB 1GBIA 3U8OH 4GPGA 2ZFTA 3NXPA 4Y0YE 4X8VH 1GMDF 1Z8RA 1CA0C 2ZHDA 1LKAA 1EZXC 2RA0A 4M7GA 3UUZA 1LHFH 1F0RA 1RIWB 1AI8H 4NZLA 1KXBA 1Z8IB 5TJXA 1ZLRA 1C1PA 2WPHS 2FOFA 2I6SA 3M5MA 1IHTH 1W3CA 3RM0H 2VB0A 1SGFG 2O8TA 3TJUA 1HXEH 2HNTE 4HZHA 3GY6A 5DP3A 4FVBA 1SFIA 4DY7B 1O3OA 1XKAC 2R2WU 1M9UA 3L3TA 1FY4A 2ZZUH 2A4GA 2QA9E 4Y7BA 1G3DA 1EP5A 1GBKA 1HAVB 1PQ5A 2BYAX 1MQ6A 2ANMH 1O2UA 1ELCA 1O31A 3ZV9A 2A4OA 1DX5M 3A7YA 4AZ2B 5FXLA 3VB7A 3TU7H 1T31A 1ELVA 1PPFE 1WUNH 3QTOH 3ZV8A 3M7TA 1ETSH 4FUDA 2JKHA 1BOQA 3VFEA 3A81A 3AVZA 3GCTF 8GCHF 4UDWH 3HKIB 1BTHH 3LGUA 3T27A 1BHXB 2ZGJA 1TX8A 2W3KA 2ZGBH 2FMJA 4O03A 1EB2A 1ACBE 2FLRH 2P94A 5I46H 1LMWB 1ZGVA 1S83A 3TJVA 1GBAA 3SV7A 1RTFB 3VGCB 1O2SA 3M35A 3R3GB 1QGFA 3LKWA 1C4Y2 3SUGA 2CJIA 3O8BA 2DE9A 3IITA 7GCHG 1E38B 1O2OA 3NUMA 4CH2B 3O8RA 4MNWA 2JETB 3HATH 4YESB 1ZHPA 4MVNA 5JDUB 1UCYH 1AKSB 1MTWA 1SGDE 1W0ZU 2SNWA 2ZKSA 1UHBB 4YOGA 4YT6H 1QL9A 2J95A 1TMBH 2BD3A 1RS0A 3I77A 2F9OA 2BOKA 1TNLA 3UOPA 3TK6A 3PV4A 2H5CA 1VITF 2ZCLP 3FVFB 1TBQH 4CRBA 3QUMP 1BT7A 4ZH8A 3GY8A 2FOCA 4CRAA 3ENSB 2ZHWH 1K1LA 1VCQA 1CA0B 2HPPH 3OY5U 1BHXF 4OS5A 1V2UT 1Y8TA 3P6ZB 3BTME 1DWCH 1AFQB 2O8UA 1TABE 4H6TA 1D3QB 1D4PB 1T32A 2FX4A 3RXEA 3SORA 2AGEX 2QAAA 4FVDA 3FP8E 3ITIA 1D9IA 2LNCA 2PLXA 3VB5A 2HLCA 4B75A 5HMAA 3Q3YA 5CMXH 1VGCC 3A8CA 2EA3A 4Q2KA 1V2OT 1NN6A 1HGTH 2FWWA 1BRAA 5DO4H 1N6YA 1QNJA 1KTSB 1A0JA 2FP7B 1H8IH 1PPHE 1GL1A 3QZQA 3NK8A 1PPEE 3ATMA 1C5OH 2BZAA 1AE8H 1UK3A 4KP0A 2GCHG 1J17T 2ILNA 1NFWA 1T8NA 5AHGH 5E2OA 5ABWA 5IDKA 3TGKE 1E37B 4BTIB 2FI5E 3K6YA 1QQUA 1T8OA 2Y6TA 4YOJA 3TNTA 1O36A 2QYIA 1KXFA 4J2YB 3S9BA 5GJ4B 1KXCA 1A2CH 4DIHH 1NT1A 1C5XB 3LGVA 4OS1A 5GWZA 3A7WA 1GJCB 3MH7A 3Q76A 1PQ8A 2H1UA 5EQSA 1A61H 2WPIS 3PWBA 3M37A 1EPTC 1TPAE 2C4FH 2Y7ZA 1GHXH 4NA7A 3K9XB 4JZEH 3MI4A 2ZEBA 2ZFFH 1GI2A 3EYDA 4YTAA 5AVDA 1SHYA 1ELDE 3SNBA 2PTCE 2J4IA 4I7YH 1F5LA 3KEEA 1HXFH 2ZGHA 4OS7A 1DY9A 1Y3XA 1AB9C 5AF9H 4A1TA 1AQ7A 2WUBA 3BSQA 4RKJB 1FN8A 1QTFA 2KAIB 3SUFA 4AORA 1TGSZ 2PR3A 1HFDA 3OU0A 1ZMJA 5LH8A 1BRCE 5EXLA 3SU3A 1GHZA 3BTEE 1SGFA 1L1JA 1MD8A 4K1SA 1NTPA 1RTKA 1KLTA 4Q80A 1O2NA 4UFEH 1C5NH 4A7IB 3AAVA 1ORFA 3AW0A 4F4OC 3GICB 1G3EA 3OSYA 2UWOA 4B2AA 1W10U 1SHHB 1SGCA 1ELGA 3NWUA 4JYUH 2BD5A 1KDQB 3BG8A 1KY9A 3PMJA 1GJDB 1OWKA 1VGCB 9ESTA 1N1LA 4I32A 1S5SA 3B9FH 3ZVFA 2BQ6B 1IQKA 1MTSA 3LGIA 1GJBB 2FX6A 1GVZA 2QXIA 3TLOA 2FODA 1ZPBA 2ZG0H 3SNEA 4CHAC 3SV9A 2A31A 2VIOA 2IPHA 1DICA 4U01A 1C4U2 1P12E 4ISIH 1QL8A 4ABFA 1NRNH 4JYVH 2R0KA 3BG4C 3MYWA 5A8YA 4CRCA 4ABAA 1DANH 3ATLA 3EGKH 1SR5C 1MCTA 3TH3H 3M5NA 1CO7E 3SO3A 1ZMNA 4NGAH 2NU2E 2VINA 4IW4E 2C8YB 3SV8A 3QZRA 3UR6A 1EB1H 2V3OH 1BTUA 1W13U 2PGQB 2FDAA 3SJ9A 3F9HA 3SJ8A 2QC2A 1L1NA 3OY6U 1O2GH 2ZGXH 1HB0B 1AUTC 4TPIZ 2IN2A 1EPTB 2XC0A 5EPYA 1EAWA 4Y8YA 1VITH 2XC5A 1EJMA 4JZIA 3SNDA 5J4QA 1TBRH 1GJ9B 1TB6H 3TGIE 1WAYB 3UTUH 2Y7XA 2BVSH 3RUOA 3A84A 1MAXA 1AB9B 4LXBH 1Q2WA 5L6NH 1SFQB 2BDBA 2Q6DA 1FV9A 1G3BA 3EA9A 5A0AE 3MU0A 1C1VH 3SV2H 1G2LA 2B5TB 5C3NA 5FPYA 3HKJB 1ELBA 4U2WA 1JMOH 3T26A 1HAHH 3UNSA 2STAE 1QBVH 4AFZA 1EX3A 3ZZ8A 1O30A 3UIRA 1O2LA 1TA2A 2C93B 2ZDMA 3QGNB 3MOCA 4TWWA 3RXPA 3TH2H 1G37A 1UVSH 2VIQA 1OPHB 3UNRA 1SG8B 3MNXA 2ZDVH 3QX5H 3VEQB 4FU7A 3L6PA 2FM2A 2FS8A 1NO9H 7ESTE 3ZVBA 4X6PA 2EI7A 1GBBA 4DW2U