1TPPA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
molecule keywords BETA-TRYPSIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Bos taurus
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tppA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tppA02
5EGMA 1P10A 1FNIA 1L4DA 2OXSA 1W8BH 3MMGA 3SUEA 4AG2A 1KXAA 2A5KA 3UQOA 1QRXA 1DT2A 4VGCB 1SPJA 4GHTA 4AFUA 1UVTH 1V2MT 1FY4A 3TJVA 4ZKRU 1C5RA 2ZCHP 1FXYA 3LH3A 1YM0A 1SR5C 2FOMB 4NIVA 2PSXA 1AI8H 4Z6AH 5LH8A 4Y10E 1MMJN 4LZ4B 2ZHDA 3FANA 3E3TA 1LVBA 3TK5A 3ZZCA 1MTVA 1O35A 2GGVB 2JH6D 2GCTC 3KL6A 3SU6A 1MQ6A 3HK6B 2ZTZA 1AKSA 1JWTA 2ZFSA 1TPOA 3LGUA 5GJ4B 3SI3H 5I46H 2O9QA 3F9HA 1EP5A 2F9VA 3U8OH 3ENSB 3EA8A 2VWOA 4TWYA 3ZYDA 1V2PT 1S83A 1HAGE 1SOZA 4XOJA 1N8OB 2BD2A 1GHXH 3RXRA 4XDEA 2P94A 1F7ZA 4ZUHA 2OC0A 1P03A 3EYDA 2XNIA 3A8DA 4GLYA 2RA0A 4M7GA 1YCPH 3RXLA 1MD8A 1O5AB 1V2VT 4PROA 2AMDA 1DUEA 2PTCE 1EPTA 2VIVA 5IYTA 1IOEA 2OCVB 2R0KA 2RG3A 4ABHA 3GY3A 2BLWA 1YLCA 1P3CA 3C1KA 1OWKA 3S9AA 1CHOG 5DP4A 1RRKA 2G00A 3A83A 2VWLA 1FY8E 2Q6GA 4F49A 1THPB 2WYGA 1AU8A 1C1NA 4NA7A 2Y81A 2ZCKP 3U98H 5C1XA 2VH0A 2UUFB 4SGAE 3M7TA 1IQGA 4A1VA 1O5FH 2F91A 3NXPA 3RDZA 1NFYA 3BEIB 4WY3A 3MNCA 5FBEA 3UFAA 1DPOA 4DURA 1B7XB 1Q3XA 4AN7A 1UK3A 3RXCA 3S7KB 1O5GH 4TPIZ 1DE7H 1C5UA 2PKAB 2VGCB 2PTNA 3BTME 1C1RA 1T8MA 1UTQA 2FYRA 1E37B 3RXOA 1V2LT 3S7HB 2ZDAH 2ANMH 3FZZA 1FDPA 3BTHE 2UWPA 2YNAA 1CVWH 1QHRB 6GCHG 1ZSLA 1O3IA 1W14U 4GSOA 3T28A 2ZDKA 1FIWA 4GVUA 4AORA 1F0TA 1O3GA 1MCVA 1EJMA 2QGRA 1THRH 3Q77A 2ZP0H 3KHVA 2IJOB 4AZ2B 2GT7A 3KEEA 2GCHG 4UFDH 1BB0B 2QYIA 1ELFA 1TQ0B 3M35A 3PLBA 1NFXA 1UVSH 5TJXA 4AG1A 1X7AC 1TA2A 1H8IH 2BX4A 3BN9A 4X0WU 2HPQH 3TH4H 1O38A 1E34B 2BD8A 1C1MA 2BDCA 1TBQH 2CMYA 3RXQA 1GJCB 3I29A 2BD3A 2R3YA 2TGTA 3RU4D 2BDBA 2PGBB 3TH3H 1GBHA 3S9CA 5AFZH 1ELDE 1WTHD 3UR9A 3RLYH 1DS2E 1FQ3A 1K22H 1C5SA 2Y80A 1E38B 1P3EA 3SJIA 2QV1A 1GVLA 2C90B 5LPRA 5CHAB 4MVNA 2FM2A 1SQAA 2OD3B 2TGDA 1FY5A 4DOQA 3F1SB 3BG4B 4X6NA 4UFFH 1P2OA 1BBRK 5GDSH 5E0JA 1CSOE 1S0RA 1SFIA 1GL0E 1QIXB 1C9PA 2V35A 2OBOA 4Y7AA 1CGIE 1EAWA 5FHTA 2J95A 1P02A 2ZI2H 2WPIS 1KY9A 3PMHB 1LVMA 3A8AA 5LGOA 1HAYB 2FI3E 4ISHH 1RIWB 2TRMA 3MH5A 4NCYA 2W26A 1GCTC 1YCPM 2EEKA 5F8TA 9LPRA 1AE5A 2ZGBH 1LQDB 5GCHG 1AIXH 1C2LA 1HXFH 2LNCA 1L2EA 3PLKA 1Y3UA 1NN6A 3UREA 3TGKE 1YPHE 2A1DB 2KAIB 1EZSC 2BVSH 4YESB 9ESTA 1TMUH 1HLTH 1P2IA 1KXFA 4U01A 2ZPRA 1S84A 1TABE 3M3SA 2ZNKH 1ELGA 5FPYA 1PQ7A 3BTKE 4HGCA 2Z3CA 3U8TH 1JOUB 3N7OA 1O2OA 3ZZ4A 2WYJA 2FOBA 5HM2A 1PPBH 1ESBA 1LDTT 1UCYK 5B6OA 2UUYA 1QB1A 1V2QT 1DFPA 3PO1C 3DD2H 1VITF 4FVBA 5BPEA 1DY9A 1GHWH 1BRCE 4MPVA 3MH6A 3ZVAA 2FO9A 2SGDE 2A7JA 1W13U 1O33A 1SLVB 2FTLE 4IW4E 1BBRH 1GJ5H 1WCZA 2BD7A 4BANB 2FOEA 3M5OA 1BCUH 2PKSB 1PFXC 2VVCA 4CRGA 1K1LA 1TX6A 1BJUA 1AWHB 1SB1H 1MTNC 3ZZDA 2GZ8A 2GMTB 1FI8A 5HXFA 5L2YH 1Z1IA 4FUCA 1ANDA 7GCHG 5F8XA 2Y7ZA 5AHGH 2XW9A 1MD7A 3SU5A 4KP0A 3MU8A 3HGNA 3FAOA 4JK6A 4X8VH 1GI8B 5DG6A 2W5EA 1BTXA 2ASUB 1T31A 1EP6A 4GCHF 3RXJA 4MPWA 1O32A 3STIA 4ZKNU 1TRMA 1L1GA 1P2KA 1ZRBA 4ZH8A 3VEQB 1D6WA 1O39A 5HGGA 2Y5GA 3RXMA 1KLJH 1V2TT 1FV9A 1IHTH 3PMAB 3GISB 3VXFH 1BT7A 2HVXA 3MNBA 4X6PA 2YOLA 4ABEA 4B75A 1KXDA 1MH0A 2PUXB 1FJSA 4O97A 1BTUA 1LVYA 1UCYH 1FZZA 2ZU4A 4ABFA 5DP8A 4I8LA 2ZFFH 4MNWA 1ESAA 3RC4A 2FIRH 2ZWLH 1JBUH 3RXSA 2JKHA 1O0DH 4VGCC 1ZZZA 2QY0B 5ETXA 8GCHG 1VJAU 3PROA 1W11U 3GCTG 3SHCH 2GP9B 2Z7FE 3E16B 1G36A 3SNDA 4ABIA 1G2LA 1A5GH 1XUHA 5FAHA 1DANH 2STBE 5JBAS 1DITH 1BRUP 2NU2E 2NWNA 1UCYE 3H7TA 5A2MH 1FMGA 1GBTA 1GDUA 4YTAA 2XC5A 2AIQA 3EGKH 4JYTA 2P3FH 3ZVGA 3UUZA 3LJOA 3SU3A 4K1SA 3ZV8A 3BTQE 5GXPA 1QL9A 1V2OT 3LOXA 1AY6H 4FUHA 1T7CA 1DOJA 1O3EA 1EQ9A 3Q3KA 1ANBA 1N8OC 3ODDA 2C8WB 4CREA 5JPMH 1SGDE 1K1IA 5L6NH 1QQ4A 2GVFA 1LHCH 3A87A 2ODYB 1MQ5A 3S69A 4D9RA 4MNYA 1GPZA 3E0PB 4WWYA 1G2MA 3VPKA 1OP2A 1HAIH 4ISLA 4DW2U 5SGAE 3HATH 3MHWU 2Z9JA 2UUJB 2WUCA 1S5SA 2QCYA 1GI0A 1FAKH 1EAIA 1V2RT 3ZZ6A 1P2NA 1DLEA 3PB1E 1TLDA 2BQ6B 3PYHA 2VVUA 1GHAF 4NIWA 3UWIA 4FUBA 1C2IA 4Y76A 1C2FA 3M3VA 3Q3XA 4FUIA 2TGAA 2O8UA 5F8ZA 3SU1A 1TGSZ 2FEQH 3M61U 2ANYA 1C1WH 2C3SA 1C5WB 3OY5U 2G4UA 4OS6A 1AVGH 3UNRA 3A80A 2VGCC 1W12U 2FOHA 1C5VA 1BDAA 2OC7A 1HPGA 4INLA 2AIPA 2QN5T 1P9UA 1O3JA 1O34A 2AMQA 2FP7B 2GV6A 2FLRH 1WUNH 4YT7H 2ALPA 4K3JA 5C5NA 1MTWA 1GMHG 2AS9A 3T62A 4NFEA 3BTEE 2XRCA 5FCRA 3U1IB 1MTUA 2FI5E 5ESBA 1QCPA 3A7TA 1GVZA 1CE5A 2A7HA 2RDLA 1QB6A 1J15A 1TYNA 4AB8A 1TFXA 4YOGA 3GY2A 1UTMA 1A0LA 3BIVH 2ZHQH 1H9IE 1ESTA 1O2QA 2SGQE 4AFQA 4ABJA 2Q1JA 1SLUB 4OS2A 1DSTA 2ZECA 1UJ1A 2H5DA 2PHBA 2UWOA 1SGFA 2ZGXH 3M5MA 1C2DA 2BZAA 4ZROA 1IAUA 1SI5H 3LC3A 1AWFH 1YPJH 1WU1A 2GTBA 3BTWE 1A61H 3GY7A 1L1NA 2ZPSA 1OOKB 1HIAA 4BAKB 2BXUH 1DLKB 4IN1A 1HV7A 1BMNH 2GZ9A 4WH6A 1O3BA 2H9HA 1AVWA 3PMBB 1TBRH 2FI4E 8KME2 1TA6A 3BG8A 1J16A 1TNIA 1V2UT 2BVXH 1FPCH 3SJ8A 1HXEH 4I8JA 1FN8A 4U2WA 3QX5H 3T5FH 4CR9A 2ZU1A 1D3TB 4ESTE 5A0CA 1UTPA 7LPRA 2D8WA 2IN2A 3BG4C 3V13A 1GL1A 4UDWH 3BEUA 4NIYA 2R2WU 2Z94A 1QTFA 5T6GA 1LHDH 4FU9A 5C2ZA 4YOJA 1AQ7A 2FMJA 4GHQA 3MTYA 1K1MA 2WV4A 1NPMA 2HOBA 1GJ4H 3ELAH 1C1PA 1Y5AT 3V12A 4GAWA 1D9IA 2P93A 4YZUA 2ZZUH 4INKA 3TU7H 3SU2A 3SU0A 1RIWC 1T8LA 3M5NA 4Y7BA 4NZLA 4A7IB 2CHAC 3GOVB 1V2NT 2BD4A 1SC8U 2LPRA 3TH2H 3PWCA 1A3BH 1NY22 4KELA 3SV6A 1FN6A 1BMLA 3NUMA 1F5LA 2IPHA 2BTCE 1VZQH 1EJNA 4AFZA 3QDZB 3QO6A 3OYPA 4A6LA 4E05H 4WVPE 3TITA 1ELVA 1O2WA 1ID5H 4CBNA 5JBCS 3UPEA 4YT6H 2B0FA 2J34A 1DWEH 1D3DB 3MO6A 4DGJA 1Z7KA 3ZZBA 4X1NU 5A8XA 2FOFA 1O2MA 3AVZA 4X2WA 2BX3A 1ELCA 1MAXA 3KCGH 2BY7X 3LGIA 3TVJB 3L33A 4IGDA 3TGIE 4O03A 1C4Y2 3QZRA 1ETTH 2C8XB 1BRBE 1YPLH 3LGTA 3RXFA 1THSH 1CGHA 3OTJE 1QRWA 1P57B 2A5IA 2V6NA 4K1TA 4X1SU 5E8EH 1C2MA 1ACBE 1KXCA 2PKSC 2BMGB 2JETB 5AF9H 3A82A 2A4GA 4JZ1A 1K1OA 3V7TA 2GMTC 3EA7A 3ATLA 1BMMH 3R3GB 2BDGA 1EOJA 1ZJKA 2BD9A 3PTBA 1HUTH 1O3KA 3OY6U 1BOQA 1O2GH 1TNKA 4CRDA 1O36A 3STJA 1O2KA 4TYDA 1AB9B 1OWEA 1EATA 1YPHC 3JZ1B 1W10U 4MPUA 2QF3A 2XCNA 3PMJA 1G3DA 3ATMA 4DVAU 2FS9A 5DP7A 1AFEH 1TGTA 1OWIA 4B73A 1SLXB 1O2RA 3DFJA 3URDA 4FUEA 2K1QA 5J4QA 1SGPE 1DVAH 3P8FA 1SG8B 5E2OA 1RXPA 3RXUA 1OWHA 1TNHA 4AX9H 1ETRH 3P95A 1Q31A 1G3CA 3TLOA 4MPXA 2BDIA 1ZSKA 3FFGA 2FZZA 4AB9A 4X1RU 2ZU2A 3HKJB 1SHHB 4MLFB 1C5QA 5GPIB 5C67A 3V3MA 3KQEA 3GCHC 4BXSA 1A4WH 3SJ9A 1JIMA 1LHEH 3E0NB 3T2NA 1H4WA 1MTSA 1NROH 1SGEE 2BB4A 5EQRA 1AO5A 2OC1A 1MBMA 1DSUA 4THNH 3RMNH 4CH2B 4B74A 1Z6EA 1TRNA 2CGAA 1SVPA 1CHOF 3TK9A 2VH6A 3SUFA 1AKSB 2VJ1A 3M36A 4U32A 3KN2A 3NK8A 3CP7A 3BEFB 3F6UH 4DJZB 3QTVH 1W0YH 2FYQA 3ATWA 5ABWA 2QXHA 2F9BH 4A92A 2AEIH 3O8BA 5EW1H 3GDSA 3QUMP 3LC5A 1IQNA 4Y79A 1OKXA 3ZYEA 1T32A 3GCNA 1P09A 2SFAA 2OTVA 1SLWB 5AVDA 2P8OB 3K65B 4NIXA 1AZZA 1TPAE 4BTIB 1TX7A 1QR3E 1Y3YA 4ZXYH 4YOIA 3RMLH 2OBQA 1BHXF 4TY6A 3RU4T 1EPTB 4INHA 2HPPH 1B5GH 3DHKH 2G51A 5EPNA 4B1TA 1VR1H 3OX7U 4NSVA 2BD5A 4AOQA 3K2UA 3K6YA 4AYYB 1IQJA 3SQEE 3HGPA 3SQHE 6GCHF 3RC6A 1XVMA 3KGPA 1TAWA 5CE1A 2P16A 2JH0D 1UTJA 2BY5X 2YNBA 1LPGB 3P6ZB 4ZAEA 3Q3YA 1CA0C 3HK3B 1YLDA 2C8YB 4U30A 1AMHA 2BXTH 3FP6E 1S85A 5HYOA 2V0BA 3UIRA 4AFSA 2O8LA 1C5OH 4I8HA 2D2DA 1KXBA 2ZC9H 3LDXH 1TWXB 1GI6A 1GI7B 1OPHB 3ITIA 3I77A 3M3TA 4D8NA 4BXWA 2H1UA 5A09A 1AUTC 4XFQA 1VITG 4AGJA 1TGBA 2NU0E 4GUXA 4WXIA 1P05A 1CO7E 2FOAA 3AW1A 3G01A 1SGCA 4O3UA 1O31A 1C2GA 1NZQH 2XCFA 2ZGJA 1PPHE 3A86A 4K2YA 1HNEE 5JBBS 1UTOA 5T6FA 5EQSA 4BTTB 1SGTA 2O8WA 3AW0A 1P01A 1AVXA 4D7FA 3MO9A 5K7RA 1JMOH 3ATIA 2IOTA 1KIGH 5EG4A 5DP6A 2BDHA 5A8YA 2QF0A 3RC5A 1XUJA 1FAXA 3NPSA 1TPPA 1BTYA 2A7CA 1ZYOA 2BOKA 3NKKA 1W2KH 1N1LA 3QGJA 2ALVA 3LGYA 4R8TB 2AMPA 1SGYE 1OXGA 2UWLA 3SI4H 4RKOB 2O8TA 6CHAC 3QGNB 5C1UA 4X2YA 4HI3A 5C3NA 2FLBH 5DGJA 1XKAC 3P70B 1JXPA 3BSQA 1Z71A 2ZTYA 1GBKA 2I6QA 3A7ZA 3B9FH 4NWKA 1GBFA 4CR5A 1K21H 2ZU3A 1O30A 2C8ZB 2G52A 1HAZB 2A2QH 4DIHH 1Y3XA 2QAAA 1GMCG 5GCHF 3ZZ3A 1HCGA 1U6QA 1GDQA 4BOHA 3A85A 1LO6A 3VB4A 2JH5D 1HAOH 4I32A 4KTSA 1BTHH 2BYAX 4K1EA 4OS4A 1O3DA 1HAVA 1H8DH 2AERH 2BY9X 2ODPA 3A7YA 1IQMA 1CGJE 3A7XA 4JYUH 3E90B 3RXIA 3MNSA 2ZDMA 3IWMA 1HJ8A 1AFQB 1SGRE 2F9NA 1GI9B 1C5ZB 5EPYA 3L3TA 1O5BB 3UR6A 1RFNA 2XC4A 1BMAA 4E7RG 1BTZA 3PWBA 1A0HB 3TJOA 1UK2A 4I31A 1MKXK 4XBDA 3KQBA 1YGCH 1O3MA 3NZIA 2XC0A 1IQEA 2ANKH 3UOPA 1GBDA 3W95A 3T26A 1C5NH 3IG6B 1EJAA 3K6ZA 1EXFA 3SU4A 2AGIX 4XBBA 2G81E 1ZTJA 3ZZAA 2XXLA 1XXDA 1DM4B 2ESTE 3BTTE 1TMBH 1GI1A 2VB0A 1YBWA 1GJ8B 3BF6H 3MU0A 1MZDA 2B7DH 5EQQA 1MZAA 3SV8A 1SGFG 1S6FA 3HPTB 5TCAA 1QFKH 2G4TA 4B2CA 4B2BA 1HJAB 1YP9A 1O2JA 2ZG0H 1RTLA 3TGJE 1O2PA 1RD3B 3TNSA 2Z6BD 4JYVH 5T6DA 2PGQB 2ZGCA 1OWJA 2QXJA 1DXPA 4NA9H 4WF8A 1O2XA 1AE8H 4I33A 1VITH 1IQKA 1BHXB 4BAMB 4BNRA 2FESH 3LT3A 1GHYH 1V2ST 3UNQA 2EI8A 1E35B 4FUFA 3GYLB 4I7YH 1B0EA 1QL8A 3MH4A 3UTUH 1TGCA 4K5ZA 1G3EA 5J4SA 2GV7A 3RXAA 4CH8B 1MU6B 1GBCA 1C1OA 3S9BA 4FUGA 2M5TA 1ZHRA 1TQ7B 3GCOA 3FZDA 4Y71A 1W7GH 1AUJA 2BDYA 5EXMA 1O2HA 3H5CB 1GHVH 3KQDA 2GX4A 1TX8A 4O9VA 7ESTE 1FY1A 2ZO3H 1MKXH 1HAVB 2JETC 1AN1E 3SZNA 2FODA 2VWNA 3SV9A 1C1TA 1D3PB 3VB5A 3BTGE 1T4VH 1WBGB 2WPMS 2A31A 2BY6X 1ORFA 1TOCB 3RXPA 3VGCB 2TPIZ 6ESTA 1DUAA 1EKBB 3AAVA 2XWBI 5C20A 1V2JT 3D23A 3UWJH 3BTFE 1AB9C 1ZSJA 2GD4B 3U1JB 3VXEH 1OYQA 5HM9A 3VB7A 1O2IA 1WSSH 4FUJA 1OP0A 2BVRH 1EB1H 2XBXA 4TPYA 1ZHPA 1GMDF 2NU1E 4Q7ZA 4E06H 3A8CA 1FY3A 1QA7A 2D1JA 1QQUA 3A7VA 1ZR0A 3MYWA 1TNLA 3AASA 1RGQA 1ZOMA 2XBYA 4FU7A 1BRAA 5E0GA 4ABGA 3GICB 2WINI 1QY6A 2PLXA 4CRBA 3P17H 1BUIA 4X2XA 3EE0B 4IBLH 5FX5A 4FUDA 3I78A 5GWZA 1YYY1 1NRPH 2ZQ1A 1JRTA 2Y7XA 1NRQH 2AGGX 2G5VA 2XBWA 2O8MA 1EZXC 2QC2A 4WXVA 4K60A 3TPIZ 1QBVH 1KDQA 4YLUA 4ABAA 3TNTA 4Y8XA 4O3TA 4R0IA 1NRRH 3KNXA 2J2UA 2A2XH 1YPKH 1JRSA 3CS7A 1B0FA 4NZQA 3ZVCA 1TPSA 1DWCH 1RTKA 2PUQH 1KTSB 1WTGH 4WMFA 1TMTH 4RKJB 4X6OA 1BZXE 1XVOA 1Q2WA 3EQ0H 1NESE 1AHTH 4ISOA 1ZPZA 1DWDH 1LCYA 4BAOB 4NWLA 1EASA 4WMDA 1OWDA 2CF8H 2P8OC 3SJOA 1ZGIA 2I6SA 3RP2A 1SBWA 2ZDVH 3IITA 2BHGA 1C5XB 1GHBF 1Z8IB 3LONA 1EPTC 4NGAH 1H1BA 2DUCA 2ZHFH 1A5IA 1O3CA 5JB8S 3LKWA 1XKBC 2RCEA 3DUXH 2EC9H 1BTPA 4KTUA 3MWIU 4Y8ZA 4ZHLU 1C5PA 1VJ9U 3ATKA 5CHAC 2HALA 4HTCH 1NS3A 1P2MA 4AGKA 2H6MA 1LTOA 5H4IB 3ZZ9A 1QNJA 1C1UH 2AH4X 1MUEB 4Q7YA 3TJNA 1BQYA 4B71A 1P12E 2HGTH 1A5HA 1BTWA 3PLPA 4LK4A 1S6HA 5LPFA 1CBWB 3CS0A 1NU7B 1K9OE 4A1XA 4NG9H 3T25A 2DE9A 2WV5A 2P95A 1GG6B 3FVFB 1LQEA 2CN0H 5EXNA 2VVVA 3Q00A 1ZTKA 2F83A 1NRNH 1TALA 3ZV9A 4D76A 2WPHS 1TIOA 1CT2E 2VNTA 1RS0A 1O3NA 8LPRA 1GGDB 2BZ6H 4K8YA 2P3UB 1PQAA 5L30H 2THFB 3SBKA 3LIWA 1HJ9A 1KDQB 1ABIH 1PPEE 3MNXA 1DX5M 1D4PB 1K2I1 1Y5BT 4KTCA 1GJBB 2CXVA 2HNTF 1YPMH 3T29A 1EAXA 1W3CA 1L4ZA 1XX9A 1T8NA 3RXTA 1FPHH 3FP8E 1G9IE 1PJPA 4OS5A 1YKTA 1F92A 3QLPH 1OYTH 1IQFA 5DKMA 2J38A 1V6DA 3SV7A 4IC6A 1GHZA 1WQVH 5ESTE 4BAHB 1K28D 4JZFH 2CF9H 2WPJS 2Z9GA 1UVOA 1TONA 4TY7A 2PKAA 1NFUA 1TE0A 1O5CB 1QBOA 3ZVFA 2GDEH 2Y6TA 2ZFRH 1HIAB 2XYAA 3CENA 1P0SH 3E6PH 2WUBA 2OLGA 1DY8A 3QZQA 2OUAA 1O2VA 1J17T 3K9XB 4Y11E 3E1XB 1LMWB 3LJJA 1C5TA 4NSYA 3EA9A 4BAQB 4AYVB 1DICA 4X8SH 3MU1A 2Q6FA 5F6MA 5LPEA 3SUDA 2ZFTA 5JBTA 1SGNE 1OX1A 3P8OA 3HKIB 1GVKB 4WJG2 1Z8GA 4ZXXH 2SGFE 5FX6A 1J9CH 3PTNA 1O2UA 3MU4A 2GDDA 4X2VA 1BA8B 1LKAA 1ARCA 3UNSA 1OS8A 1Y59T 3KF2A 3D62A 4WH8A 2WPLS 1T8OA 1MCTA 2V3OH 3ZZ5A 4D9QA 1TNJA 3H7OA 4YO9A 1SSXA 3RXGA 3UQVA 3A84A 4JMYA 1F2SE 1ZMNA 1AFQC 2GKVE 4K8BA 3ZVBA 3PM3A 1A7SA 2F3CE 2BLQA 3OSYA 3GDVA 3MI4A 3C27B 4JZIA 5FPTA 1GBBA 1H9HE 1C2JA 4WMEA 1G32B 2SNVA 1C2HA 1GBEA 1O3HA 3SJKA 4B2AA 5AFYH 2Y5FA 4IC5A 1SQOA 1YPEH 1EZQA 4IMZA 2J92A 2ODQA 3L6PA 4FXGH 3F9EA 3MU5A 1XUIA 1C5LH 1AZ8A 2CJIA 1LKBA 5DPAA 1LPZB 1Z8JB 5EW2H 3SNCA 1YC0A 3SOSA 1BITA 2R2MB 3RMMH 5L2ZH 1QA0A 1NFWA 1UTNA 4A5TS 2BY8X 3GY6A 1Y8TA 1HJAC 2ZKSA 3LPRA 1J8AA 3M7UA 1HFDA 3SGBE 2ZHWH 2ZDNA 3QK1A 2H9EH 3P8NA 1WOFA 3B23B 3KIDU 4DIIH 2EI7A 4Y0YE 1GI4A 1VGCB 1HGTH 2A32A 2HNTE 1XUKA 2A45B 1GJ7B 2A5AA 3LGVA 2R3UA 2KAIA 3SNEA 1UO6A 3Q76A 2OP9A 4ZHMU 2C93B 3U8RH 3S0NA 4MNXA 2G8TA 1SOTA 2PR3A 3LH1A 1GI3A 3F9GA 2G55A 2TGPZ 1IQLA 3URCA 2B8OH 4H4FA 4CHAB 2XBVA 1P04A 2Z3DA 1MBQA 1Y3VA 1TGNA 1SFQB 3QWCH 4DT7B 4K69A 1GJDB 3RXKA 2Z9KA 1IHSH 4J1YA 1F0RA 3A7WA 4X6MA 2Z9IA 4RSPA 5FCKA 4JCNA 3A81A 1NO9H 4CRCA 1EZUC 1ZHMA 8ESTE 1C2KA 1O3FA 1UTLM 3VGCC 1G30B 2BDAA 1YPGH 1XMNB 5DP5A 3ZZ8A 4YLQH 4TWWA 2GCHF 2FPZA 2FX4A 3P8GA 4ISNA 3RXBA 4OGYA 4ZMAH 3BIUH 1N6YA 4KKDA 2ZGHA 1TBZH 1W0ZU 1A3EH 3UOUA 5DP3A 4D7GA 1PYTC 4UFEH 4OS7A 3ODFA 3M37A 1LHGH 1A0JA 5GIBA 2VU8E 1M9UA 1CA8B 1BJVA 2FXRA 1GI2A 4J2YB 4MQAA 4H42U 3SGQE 1F5KU 3F68H 1FLEE 1ARBA 2PWXA 4CRAA 1K1PA 1EX3A 1WV7H 5DP9A 3GYMA 3UY9A 1KXEA 1L1JA 1ZJDA 1Y3WA 4XBCA 4Q80A 1QGFA 2Y5HA 2PV9B 5A8ZA 2C4FH 2CHAB 1PYTD 3GY5A 4X8UH 1CQQA 1D3QB 3GY4A 5I25A 5DO4H 3SGAE 1NU9A 1WAYB 3VFEA 4DG4A 5TCCA 1HAXB 1QB9A 3BV9B 4ZKSU 3RXEA 3ZZ7A 1DWBH 1ELBA 1HBTH 3MOCA 1GJ9B 1HAHH 5CMXH 1A1RA 4DY7B 3D65E 4B76A 5A0AE 1Z6JH 2OQUA 3KQCA 4GCHG 4OGXA 1HB0B 5JYIA 1NT1A 2ZFPH 1HDTH 1V2KT 2QIQA 3A8BA 3U69H 4NFFA 4I8GA 2VIWA 4ASHA 4A1TA 1C4U2 1O5EH 1GI5A 4HZHA 1P2QA 1LHFH 1EB2A 2GCTB 1ELEE 3E91A 3V0XA 1XUGA 2PW8H 4XSKU 4BTUB 4UFGH 1A2CH 2PSYA 3A89A 1A46H 4JZEH 1H9LB 2AYWA 3ZVEA 4H6TA 4X8TH 1PPGE 2A4OA 1KYNA 4XE4A 2A4RA 1FIZA 1CU1A 1DDJA 2F9PA 2ILNA 5EU8A 2W7SA 4E7NA 4RN6A 1C5MD 4FVDA 4X1PU 2NU4E 3RXVA 1KSNA 1C4V2 2R0LA 3VB6A 3SN8A 2FX6A 5K0HA 3DFLA 6LPRA 4Z0KA 1UVPA 3LGWA 5FBIA 2A0QB 3RU4E 2FWWA 3E8LA 1KLTA 1WYKA 1O3AA 1O2LA 1CBWC 1GCDA 2F9UA 1NRSH 4ZHAA 1OP8A 3TJUA 3M5LA 2XTTB 3SW2B 3RXHA 1T4UH 1TOMH 1GG6C 1EOLA 1ZPCA 1F0SA 5EODA 2H9TH 1TNGA 1CT4E 4Y8YA 1BBRE 1OSSA 5JB9S 1SMFE 4MNVA 4SGBE 1O3OA 1TB6H 2H2ZA 1KLIH 4JK5A 4I8KA 1GGDC 2HWLB 1P8VC 1MU8B 2CV3A 1HYLA 1SQTA 4MDSA 1ZTLA 4HFPB 3RXDA 2D26C 1P06A 1GJAB 2BQWB 2BLVA 1GMCF 1INCA 7GCHF 1F5RA 1ZMJA 2VINA 5E2PA 2BM2A 7KMEH 2WPKS 2Z3EA 2V3HH 2P59A 4X1QU 1VCPA 2ZCLP 5A0BA 1L0ZA 2ZQ2A 2VWMA 1UTKA 3GCHB 4KGAA 1ZMLA 2ANWA 3R0FA 3D49H 3EAJA 4JZDH 2ZEBA 1CHGA 1C1QA 3FP7E 1BIOA 3JZ2B 1AGJA 1N6XA 1ZGVA 1QL7A 3BTDE 4GPGA 3O8DA 1O2TA 3DT0H 1HAPH 1G3BA 1GBAA 4Q7XA 3U9AH 1ZRKA 1NTPA 1V2WT 1LVOA 1S81A 5T3HA 3NCLA 1O37A 2OINA 4IMQA 4CRFA 1GHAG 2A4QA 3OU0A 1ELAA 1GMDG 1LPKB 5JDUB 1CT0E 2ZA5A 5DK1A 2ZTXA 2VIDA 3O8RA 2F9OA 4H6SB 1EUFA 1PPZA 2BQ7B 1K1NA 3AAUA 1P2JA 1EAUA 1ZLRA 2B9LA 8GCHF 2UUKB 2Z9LA 5HMAA 3SNAA 3GCTF 3MO3A 3O8CA 2ZFQH 5FPSA 2ULLA 1O5DH 1O2SA 3P92A 1Y5UT 2ZU5A 3SUGA 2TIOA 2ZDLA 4ABBA 5G4BA 3SV2H 2AFQB 2EA3A 1O3LA 3TK6A 2ZHEH 3GY8A 2W3IA 3WY8A 2XWAA 2RA3A 4UONA 2SNWA 3RLWH 3QTOH 1VCWA 4MG3A 4ISIH 2W3KA 1QURH 3SNBA 4LXBH 1ABJH 2SGEE 2ZIQH 1XUFA 1C1VH 1F0UA 4OS1A 2QXGA 2B5TB 2STAE 2FOGA 1UVUH 2FDAA 2SGAA 1CA0B 2OC8A 4YM9A 4IN2A 3GDUA 1HRTH 3T27A 3RM2H 3B8JA 4QT8C 4Y0ZE 3RUOA 1DXWA 4FU8A 1O2YA 5C5OA 4DCDA 1MAYA 1YF4A 2GZ7A 1W7XH 1GBLA 3SO3A 2BOHB 1GBJA 4UEHH 5EOKA 1UHBA 1WQSA 1MKWK 2FTMA 3LU9B 2HRVA 1FONA 5DJ7A 1IQHA 4NA8A 1JIRA 1GCTB 4UE7H 5PTPA 3DA9B 1ZPBA 1GHBG 2H5CA 1SL3A 2J4IA 1GBIA 3SHAH 2J9NA 1P9SA 3VB3A 1KTTB 4ABDA 5FXLA 1K1JA 1ANCA 1GBMA 1C5YB 4ZKOU 2QXIA 1SGQE 2G5NA 3W94A 2VIOA 1O2ZA 1GDNA 1PPFE 2P3TB 1P11E 5BRRE 1VGCC 1S82A 1QJ6B 5C1YA 3SORA 1PQ5A 1QJ1B 2Q6DA 1SGIB 5EXLA 1XM1A 2NU3E 2R9PA 3PO1B 2PFEA 1C9TA 1E36B 3M7QA 2ZF0H 2FOCA 1UMAH 3EDXB 6CHAB 4CHAC 1PQ8A 4LZ1H 3RMOH 3QN7A 1Z8RA 1SHYA 2ZPQA 5IDKA 1GWAA 1IQIA 1S0QA 1GJ6A 3ESTA 1GMHF 2AGEX 1ETSH 3MH7A 2VIQA 3PV4A 3F9FA 1MTNB 1RJXB 1C2EA 3TIUA 1O3PB 1D6RA 1FUJA 1VCQA 4IS5A 1QBNA 5E0HA 5F03A 4Q2KA 1QJ7B 1RTFB 1MKWH 3NWUA 1PPCE 2W7UA 1TRYA 2DE8A 4MTBA 2GT8A 1O2NA 3A88A 4F4OC 4CBOA 2J94A 2Y82A 4UD9H 2HNTC 4LOYH 2HLCA 1C1SA 2BLOA 2VIPA 3RM0H 2TBSA 1UHBB 1XXFA 3MFJA 2QA9E 1QRZA 1YCPK 1Z1JA 1G37A 2FS8A 2SGPE 1NM6A 1ANEA 1E0FD 3ZVDA 1J14A 1ELTA 2EI6A 1NC6A 2OQ5A 1UK4A 4Y6DA 1AD8H 1V3XA
chains in the Genus database with same CATH superfamily
5EGMA 1P10A 1FNIA 1L4DA 2OXSA 1W8BH 3MMGA 2J98A 3SUEA 4AG2A 1KXAA 2A5KA 3UQOA 1QRXA 1DT2A 4VGCB 1SPJA 4GHTA 4AFUA 1UVTH 1V2MT 1FY4A 3TJVA 4ZKRU 1C5RA 2ZCHP 1FXYA 3LH3A 1YM0A 1SR5C 2FOMB 4NIVA 2PSXA 1AI8H 4Z6AH 5LH8A 4Y10E 1MMJN 4LZ4B 2ZHDA 3FANA 3E3TA 1LVBA 3TK5A 3ZZCA 1MTVA 1O35A 2GGVB 2JH6D 2GCTC 2CK3D 3ZIAD 3KL6A 3SU6A 1MQ6A 3HK6B 2ZTZA 1AKSA 1JWTA 2ZFSA 1TPOA 3H09A 3LGUA 5GJ4B 3SI3H 2XNDD 5I46H 2O9QA 3F9HA 1EP5A 2F9VA 3U8OH 1YLNA 3ENSB 3EA8A 2VWOA 4TWYA 3ZYDA 1V2PT 1S83A 1HAGE 1SOZA 4XOJA 1N8OB 2BD2A 1GHXH 3RXRA 4XDEA 2P94A 1F7ZA 4ZUHA 5IK2D 2OC0A 1P03A 3EYDA 2XNIA 3A8DA 4GLYA 2RA0A 4M7GA 1YCPH 3RXLA 1MD8A 1O5AB 1V2VT 4PROA 2AMDA 1DUEA 2PTCE 1EPTA 2VIVA 5IYTA 1IOEA 3OEHD 2OCVB 3UAIC 2R0KA 2RG3A 4ABHA 3GY3A 2BLWA 1YLCA 1P3CA 3C1KA 1OWKA 3S9AA 1CHOG 5DP4A 1RRKA 2G00A 3A83A 2VWLA 1FY8E 2Q6GA 4F49A 1THPB 2WYGA 1AU8A 1C1NA 4NA7A 2Y81A 2ZCKP 3U98H 5C1XA 2VH0A 5B6LA 2UUFB 4SGAE 3M7TA 1IQGA 4A1VA 1O5FH 2F91A 3NXPA 3RDZA 1NFYA 3BEIB 4WY3A 3MNCA 5FBEA 3UFAA 1DPOA 4DURA 2J98B 1B7XB 1Q3XA 4AN7A 1UK3A 3RXCA 3S7KB 1O5GH 4TPIZ 1DE7H 1C5UA 2PKAB 2VGCB 2PTNA 3BTME 1C1RA 1T8MA 1UTQA 2FYRA 1E37B 3RXOA 1V2LT 3S7HB 4YXWD 2ZDAH 2ANMH 3FZZA 1FDPA 3BTHE 2UWPA 2YNAA 1CVWH 1QHRB 6GCHG 1ZSLA 1O3IA 1W14U 4GSOA 5DSFA 1WDIA 3T28A 2ZDKA 1FIWA 4GVUA 4AORA 1F0TA 1O3GA 1MCVA 3W1EA 1EJMA 2QGRA 1THRH 3Q77A 2ZP0H 3KHVA 2IJOB 4AZ2B 2GT7A 3KEEA 2GCHG 4UFDH 1BB0B 2QYIA 1ELFA 1TQ0B 3M35A 3PLBA 1NFXA 1UVSH 5TJXA 4AG1A 1X7AC 1TA2A 2M2AA 1H8IH 2BX4A 3BN9A 4X0WU 2HPQH 3TH4H 1O38A 1E34B 2BD8A 1C1MA 2BDCA 1TBQH 2CMYA 3RXQA 1GJCB 3I29A 2BD3A 2R3YA 2TGTA 3RU4D 2BDBA 2JIZD 2PGBB 3TH3H 1GBHA 4F48B 3S9CA 5AFZH 1ELDE 1WTHD 3UR9A 2LP6A 3RLYH 1DS2E 3DSOA 1FQ3A 4RT1A 1K22H 1C5SA 2Y80A 1E38B 1P3EA 3SJIA 2QV1A 1GVLA 2C90B 5LPRA 5CHAB 4MVNA 2FM2A 1SQAA 2OD3B 2TGDA 1FY5A 4DOQA 3F1SB 3BG4B 4X6NA 4UFFH 1P2OA 1BBRK 5GDSH 1VKYA 5E0JA 1CSOE 1S0RA 1SFIA 1GL0E 1QIXB 1C9PA 2V35A 2OBOA 4Y7AA 1CGIE 1EAWA 2IPQX 5FHTA 2J95A 2JJ1D 1P02A 2ZI2H 2WPIS 1KY9A 3PMHB 1LVMA 3A8AA 5LGOA 1HAYB 3N7EA 2FI3E 4ISHH 1RIWB 2TRMA 2KCOA 3MH5A 4NCYA 2W26A 1GCTC 1YCPM 2EEKA 5F8TA 9LPRA 1AE5A 3F2GA 2ZGBH 1LQDB 5GCHG 1AIXH 1C2LA 1HXFH 2LNCA 1L2EA 3PLKA 1Y3UA 1NN6A 3UREA 3TGKE 1YPHE 2A1DB 4FOUC 2KAIB 1EZSC 2BVSH 4YESB 9ESTA 1TMUH 1HLTH 1P2IA 1KXFA 4U01A 2ZPRA 1S84A 1TABE 3M3SA 2ZNKH 3EE7A 1ELGA 5FPYA 1PQ7A 3BTKE 4HGCA 2Z3CA 3U8TH 1JOUB 3N7OA 1O2OA 3ZZ4A 2WYJA 2FOBA 1YWUA 5HM2A 1PPBH 1ESBA 1LDTT 1UCYK 5B6OA 2UUYA 1QB1A 1V2QT 1DFPA 3PO1C 3DD2H 1VITF 4FVBA 5BPEA 1DY9A 1GHWH 1BRCE 4MPVA 3MH6A 3ZVAA 2FO9A 2SGDE 2A7JA 1W13U 1O33A 1SLVB 2FTLE 4IW4E 1BBRH 1GJ5H 1WCZA 2BD7A 4BANB 2FOEA 3M5OA 1BCUH 2PKSB 1PFXC 2VVCA 4XD7D 4CRGA 1K1LA 1TX6A 1BJUA 2F43B 1AWHB 1SB1H 1MTNC 3ZZDA 2GZ8A 2GMTB 1FI8A 5HXFA 5L2YH 1Z1IA 4FUCA 2QF4A 1ANDA 7GCHG 5F8XA 2Y7ZA 4XRNA 5AHGH 2XW9A 1MD7A 3SU5A 4KP0A 3MU8A 3HGNA 3FAOA 4JK6A 4X8VH 1GI8B 5DG6A 2W5EA 1BTXA 2ASUB 1T31A 1EP6A 4GCHF 3RXJA 2PP6A 1O32A 4MPWA 4ZKNU 3STIA 1TRMA 4TSFD 1L1GA 2JJ2D 1P2KA 1ZRBA 4ZH8A 3VEQB 1D6WA 1O39A 5HGGA 2Y5GA 3RXMA 1KLJH 1V2TT 1FV9A 1IHTH 3PMAB 3GISB 3VXFH 1BT7A 2HVXA 3MNBA 4X6PA 2YOLA 4ABEA 2KM0A 4B75A 1KXDA 1MH0A 2PUXB 1FJSA 4O97A 1BTUA 1LVYA 1UCYH 1FZZA 2ZU4A 4ABFA 5DP8A 4I8LA 2ZFFH 4MNWA 1ESAA 3RC4A 2FIRH 2ZWLH 1JBUH 3RXSA 2JKHA 1O0DH 4VGCC 1ZZZA 2QY0B 5ETXA 8GCHG 1VJAU 3PROA 1W11U 3GCTG 3SHCH 2GP9B 2Z7FE 3E16B 1G36A 3SNDA 3SYJA 4ABIA 4ZCNA 1G2LA 1A5GH 1XUHA 5FAHA 1DANH 2STBE 5JBAS 1DITH 1BRUP 2NU2E 2NWNA 1UCYE 3H7TA 5A2MH 1FMGA 1GBTA 1GDUA 4YTAA 2XC5A 2AIQA 3EGKH 4JYTA 2P3FH 3ZVGA 3UUZA 3LJOA 3SU3A 4K1SA 3ZV8A 3BTQE 5GXPA 1QL9A 1SKYE 1V2OT 3LOXA 1AY6H 4FUHA 1T7CA 1DOJA 1O3EA 3WWFA 1EQ9A 3Q3KA 1ANBA 1N8OC 3ODDA 2C8WB 4CREA 5JPMH 1SGDE 1K1IA 5L6NH 1QQ4A 2GVFA 1LHCH 3A87A 2ODYB 1MQ5A 3S69A 4D9RA 4MNYA 1GPZA 3E0PB 4WWYA 1G2MA 3VPKA 1OP2A 1HAIH 4ISLA 4DW2U 5SGAE 3HATH 4FETA 3MHWU 2Z9JA 2UUJB 2WUCA 1S5SA 2QCYA 1GI0A 1FAKH 1EAIA 1V2RT 3ZZ6A 1P2NA 1DLEA 3PB1E 1TLDA 2BQ6B 3PYHA 2VVUA 1GHAF 4NIWA 5C17A 3UWIA 4FUBA 1C2IA 4Y76A 1C2FA 3M3VA 3Q3XA 4FUIA 2TGAA 2O8UA 5F8ZA 3SU1A 1TGSZ 2FEQH 3M61U 2ANYA 1C1WH 2C3SA 1C5WB 3KQ5A 3OY5U 2G4UA 4OS6A 1AVGH 3UNRA 3A80A 2VGCC 1W12U 2FOHA 1C5VA 1BDAA 2OC7A 1HPGA 4INLA 2AIPA 2QN5T 1P9UA 1O3JA 1O34A 2AMQA 2FP7B 2GV6A 2FLRH 1WUNH 4YT7H 3DSPA 2ALPA 4K3JA 5C5NA 1MTWA 1GMHG 2AS9A 3T62A 4NFEA 3BTEE 2XRCA 3N99A 5FCRA 3U1IB 1MTUA 2FI5E 5KECA 5ESBA 1QCPA 3A7TA 1GVZA 1CE5A 2A7HA 2RDLA 1QB6A 1J15A 1TYNA 4AB8A 1TFXA 4YOGA 3GY2A 1UTMA 1A0LA 1K0HA 3BIVH 2ZHQH 5C0TA 1H9IE 1ESTA 1O2QA 2SGQE 4AFQA 4ABJA 2Q1JA 5GNDA 1SLUB 4OS2A 1DSTA 2ZECA 1UJ1A 2H5DA 2PHBA 2UWOA 1SGFA 2ZGXH 1KMHB 3M5MA 1C2DA 1E1RD 2BZAA 1IAUA 1SI5H 3LC3A 4ZROA 1AWFH 1YPJH 1WU1A 2GTBA 3BTWE 1A61H 3GY7A 1L1NA 2ZPSA 1OOKB 1HIAA 4BAKB 2BXUH 1DLKB 4IN1A 1HV7A 1BMNH 2GZ9A 4WH6A 1O3BA 2H9HA 1AVWA 3PMBB 1TBRH 2FI4E 8KME2 1TA6A 3BG8A 1J16A 1TNIA 1V2UT 2BVXH 1FPCH 3SJ8A 1HXEH 4I8JA 1FN8A 4U2WA 3QX5H 3T5FH 4CR9A 3FO8D 2ZU1A 1D3TB 4ESTE 5A0CA 1UTPA 7LPRA 2D8WA 2IN2A 3BG4C 3V13A 1GL1A 4UDWH 3BEUA 4NIYA 2R2WU 1UW7A 2Z94A 1QTFA 5T6GA 1LHDH 4FU9A 5C2ZA 4YOJA 1AQ7A 2FMJA 4GHQA 3MTYA 1K1MA 4TT3D 2WV4A 1NPMA 2HOBA 1GJ4H 3ELAH 1C1PA 1Y5AT 3V12A 4GAWA 1D9IA 2P93A 5DN6D 4YZUA 2ZZUH 4INKA 3TU7H 3SU2A 3SU0A 1RIWC 1T8LA 3M5NA 4Y7BA 4NZLA 4A7IB 2CHAC 3GOVB 1V2NT 2BD4A 1SC8U 2K0QA 2LPRA 3TH2H 3PWCA 1A3BH 1NY22 4KELA 3SV6A 1FN6A 1BMLA 3NUMA 1F5LA 2IPHA 2BTCE 1VZQH 1EJNA 4AFZA 3QDZB 3QO6A 3OYPA 4A6LA 4E05H 4WVPE 3TITA 1ELVA 1O2WA 1ID5H 4CBNA 5JBCS 3UPEA 4YT6H 2B0FA 2L74A 2J34A 1DWEH 1D3DB 3MO6A 5HIZA 1Z7KA 4DGJA 3ZZBA 5T1VA 4X1NU 5A8XA 2W6ID 2FOFA 1O2MA 2QF5A 3AVZA 4X2WA 2BX3A 1ELCA 1MAXA 3KCGH 2BY7X 3LGIA 3TVJB 3L33A 4IGDA 3TGIE 4O03A 1C4Y2 3KYGA 3QZRA 2LELA 1ETTH 2C8XB 1BRBE 1YPLH 3LGTA 3RXFA 1THSH 1CGHA 3OTJE 1QRWA 1P57B 2A5IA 2V6NA 4K1TA 4X1SU 5E8EH 1C2MA 1ACBE 1KXCA 2PKSC 2BMGB 2JETB 5AF9H 3A82A 2A4GA 4JZ1A 1EFRD 1K1OA 3V7TA 2GMTC 3EA7A 2YMSC 3ATLA 1BMMH 3R3GB 2BDGA 1EOJA 1ZJKA 2BD9A 3PTBA 1HUTH 1O3KA 2AHME 3OY6U 1BOQA 1O2GH 1TNKA 4CRDA 1O36A 3STJA 1O2KA 4TYDA 1AB9B 1OWEA 1EATA 1YPHC 3JZ1B 1W10U 4MPUA 2QF3A 2XCNA 3PMJA 1G3DA 3ATMA 4DVAU 2FS9A 5DP7A 1AFEH 1TGTA 1OWIA 4B73A 1SLXB 1O2RA 3DFJA 3URDA 4FUEA 2K1QA 5J4QA 1SGPE 1DVAH 3P8FA 1SG8B 5E2OA 1RXPA 3RXUA 4RT0A 1OWHA 1TNHA 4AX9H 1ETRH 2YMSD 3P95A 1Q31A 1G3CA 3TLOA 4MPXA 2BDIA 1ZSKA 3FFGA 2FZZA 4AB9A 4X1RU 2ZU2A 3HKJB 1SHHB 4MLFB 5EIYA 1C5QA 5EJLA 5GPIB 5C67A 3V3MA 3KQEA 3GCHC 4BXSA 1A4WH 3SJ9A 1JIMA 1LHEH 3E0NB 3T2NA 1H4WA 1MTSA 1NROH 1SGEE 2BB4A 5EQRA 1AO5A 2OC1A 1MBMA 1DSUA 4THNH 3RMNH 4CH2B 4B74A 1Z6EA 1TRNA 4DT4A 2CGAA 1SVPA 1CHOF 3TK9A 2VH6A 3SUFA 1AKSB 2VJ1A 3M36A 4U32A 3KN2A 3NK8A 3CP7A 3BEFB 3F6UH 4DJZB 3QTVH 1W0YH 2FYQA 3ATWA 5ABWA 2QXHA 2F9BH 4A92A 2AEIH 3O8BA 2WZQA 5EW1H 3GDSA 3QUMP 3LC5A 1IQNA 4Y79A 1OKXA 3ZYEA 1T32A 3GCNA 1P09A 2SFAA 2OTVA 1SLWB 5AVDA 2P8OB 3K65B 4NIXA 1AZZA 1TPAE 4BTIB 1TX7A 1QR3E 1Y3YA 4ZXYH 4YOIA 3RMLH 2OBQA 1BHXF 4TY6A 3RU4T 1EPTB 4INHA 2HPPH 1B5GH 3DHKH 2G51A 5EPNA 4B1TA 1VR1H 3OX7U 4NSVA 2BD5A 4AOQA 2KR7A 3K2UA 3K6YA 4AYYB 1IQJA 3SQEE 3HGPA 3SQHE 1WXRA 6GCHF 3RC6A 1XVMA 3KGPA 1TAWA 5CE1A 2P16A 2JH0D 5HIYA 1UTJA 2BY5X 2YNBA 1LPGB 3P6ZB 4ZAEA 3Q3YA 1CA0C 3HK3B 1YLDA 2C8YB 4U30A 1AMHA 2BXTH 3FP6E 1S85A 2KZ4A 5HYOA 2V0BA 3UIRA 4AFSA 2O8LA 1C5OH 4I8HA 2D2DA 1KXBA 2ZC9H 3LDXH 1TWXB 4Z1MD 1GI6A 1GI7B 1OPHB 3ITIA 3I77A 3M3TA 4D8NA 4BXWA 2H1UA 5A09A 1W0JD 1AUTC 4XFQA 1VITG 4AGJA 1TGBA 2NU0E 4GUXA 4WXIA 1P05A 1CO7E 2FOAA 3AW1A 3G01A 1SGCA 4O3UA 1O31A 1C2GA 1NZQH 2XCFA 2ZGJA 1PPHE 5HKKD 3A86A 4K2YA 1HNEE 5JBBS 1UTOA 5T6FA 5EQSA 4BTTB 1SGTA 2O8WA 3AW0A 1P01A 1AVXA 4D7FA 3MO9A 3DSGA 1JMOH 5K7RA 3ATIA 2IOTA 1KIGH 5EG4A 5DP6A 2BDHA 5A8YA 2KCPA 2QF0A 3RC5A 1XUJA 1FAXA 3NPSA 1TPPA 1BTYA 2A7CA 1ZYOA 2BOKA 3NKKA 1W2KH 1N1LA 3QGJA 2ALVA 3LGYA 4R8TB 2AMPA 1SGYE 1OXGA 2UWLA 3SI4H 4RKOB 2O8TA 6CHAC 3QGNB 5C1UA 1NBME 2IJD1 4HI3A 4X2YA 5C3NA 2FLBH 5DGJA 1XKAC 3P70B 1JXPA 3BSQA 1Z71A 2ZTYA 1GBKA 2I6QA 3A7ZA 3B9FH 2L6OA 4NWKA 1GBFA 4CR5A 1K21H 2ZU3A 1O30A 2C8ZB 2G52A 1HAZB 2WHXA 2HVYB 2A2QH 4DIHH 1Y3XA 4F55A 2V7QD 2QAAA 1GMCG 5GCHF 3WWBA 3ZZ3A 1HCGA 1U6QA 1W0KD 1GDQA 4BOHA 3A85A 1LO6A 3VB4A 2JH5D 1HAOH 4I32A 4KTSA 1BTHH 2BYAX 4K1EA 4OS4A 1O3DA 1HAVA 1H8DH 2AERH 4ACBA 2BY9X 2ODPA 3A7YA 1IQMA 4ACAA 1CGJE 3FOAA 3A7XA 4JYUH 3E90B 3RXIA 3MNSA 2ZDMA 3IWMA 1HJ8A 1AFQB 1SGRE 2F9NA 1COWD 1GI9B 1C5ZB 3VG8A 5EPYA 3L3TA 1O5BB 3UR6A 1RFNA 2XC4A 1BMAA 4E7RG 1BTZA 3PWBA 1A0HB 3TJOA 1UK2A 4I31A 1MKXK 4XBDA 3KQBA 1YGCH 1O3MA 3NZIA 2XC0A 1IQEA 2ANKH 3UOPA 1GBDA 3MQKC 3W95A 3T26A 1C5NH 3IG6B 1EJAA 3K6ZA 1EXFA 3SU4A 2AGIX 4XBBA 2G81E 1ZTJA 3ZZAA 2XXLA 1XXDA 1DM4B 2ESTE 3BTTE 1TMBH 1GI1A 2VB0A 1YBWA 1GJ8B 2EQNA 3BF6H 3MU0A 1MZDA 2B7DH 5EQQA 1MZAA 3SV8A 1SGFG 1S6FA 3HPTB 5TCAA 1QFKH 2G4TA 4B2CA 4B2BA 1HJAB 1YP9A 1O2JA 2ZG0H 1RTLA 3TGJE 1O2PA 1RD3B 3TNSA 2Z6BD 4JYVH 5T6DA 2PGQB 2ZGCA 1OWJA 2QXJA 1DXPA 4NA9H 4WF8A 1O2XA 1AE8H 4I33A 1VITH 1IQKA 1BHXB 4BAMB 4BNRA 2FESH 2OK5A 3LT3A 1GHYH 1V2ST 3UNQA 2EI8A 1E35B 4FUFA 3GYLB 4I7YH 1B0EA 1QL8A 3MH4A 3UTUH 1TGCA 3KYFA 4K5ZA 1G3EA 5J4SA 1FX0B 2GV7A 3RXAA 4CH8B 1MU6B 1GBCA 1C1OA 3UB0A 3S9BA 4FUGA 2M5TA 1ZHRA 1TQ7B 3GCOA 3FZDA 4Y71A 1W7GH 1AUJA 2BDYA 5EXMA 1O2HA 3H5CB 1GHVH 3KQDA 2GX4A 1TX8A 4O9VA 7ESTE 1FY1A 2ZO3H 1MKXH 1HAVB 2JETC 1AN1E 3SZNA 2FODA 2VWNA 2KCAA 3SV9A 1C1TA 1D3PB 3VB5A 3BTGE 1T4VH 1WBGB 2WPMS 2A31A 2BY6X 1ORFA 1TOCB 3RXPA 3VGCB 2TPIZ 6ESTA 1DUAA 1EKBB 3AAVA 2XWBI 5C20A 1V2JT 3D23A 3UWJH 3BTFE 1AB9C 1ZSJA 2GD4B 3U1JB 3VXEH 1OYQA 5HM9A 3VB7A 1O2IA 1WSSH 4FUJA 1OP0A 2BVRH 1EB1H 2XBXA 4TPYA 1ZHPA 1GMDF 4Q63A 2NU1E 4Q7ZA 4E06H 3A8CA 1FY3A 1QA7A 2D1JA 4AC9A 1QQUA 3A7VA 1ZR0A 3MYWA 1TNLA 3AASA 1OHHD 1RGQA 1ZOMA 2F4LA 2XBYA 4FU7A 1BRAA 5E0GA 4ABGA 3GICB 2WINI 1QY6A 2PLXA 4CRBA 3P17H 1BUIA 4X2XA 3EE0B 4IBLH 5FX5A 4HG6A 4FUDA 3I78A 5GWZA 1YYY1 1NRPH 2ZQ1A 1JRTA 2Y7XA 1NRQH 2AGGX 2G5VA 5FL7D 2XBWA 2O8MA 1EZXC 2QC2A 4WXVA 4K60A 3TPIZ 1QBVH 1KDQA 4YLUA 4ABAA 3TNTA 4Y8XA 4O3TA 4R0IA 1NRRH 3KNXA 2J2UA 2A2XH 1YPKH 1JRSA 3CS7A 1B0FA 4NZQA 3ZVCA 1TPSA 1DWCH 1RTKA 2KFWA 2PUQH 1KTSB 1WTGH 4WMFA 1TMTH 4RKJB 4X6OA 1BZXE 1XVOA 1Q2WA 3EQ0H 1NESE 1AHTH 4ISOA 1ZPZA 1DWDH 1LCYA 4BAOB 4NWLA 1EASA 4WMDA 3PRBA 1OWDA 2CF8H 5C0UA 2P8OC 3SJOA 1ZGIA 2I6SA 3RP2A 1SBWA 2ZDVH 3IITA 2BHGA 1C5XB 1GHBF 1Z8IB 3LONA 1EPTC 4NGAH 1H1BA 2DUCA 2ZHFH 1A5IA 4I86A 1O3CA 5JB8S 3LKWA 1XKBC 2RCEA 3DUXH 2EC9H 1BTPA 4KTUA 3MWIU 4Y8ZA 2RDEA 4ZHLU 1C5PA 1VJ9U 3ATKA 5CHAC 2HALA 4HTCH 1NS3A 1P2MA 4AGKA 2H6MA 4OM9A 1LTOA 5H4IB 3ZZ9A 1QNJA 1C1UH 2AH4X 1MUEB 4Q7YA 5CHBA 3TJNA 1BQYA 4B71A 1P12E 2HGTH 1A5HA 1BTWA 3PLPA 4LK4A 1S6HA 5LPFA 1CBWB 3CS0A 1NU7B 1K9OE 4A1XA 4NG9H 4P00A 3T25A 2DE9A 2WV5A 2P95A 1GG6B 3FVFB 1LQEA 2CN0H 5EXNA 2VVVA 3Q00A 1ZTKA 2F83A 1NRNH 1TALA 3ZV9A 4D76A 2WPHS 1TIOA 1CT2E 2VNTA 1RS0A 1O3NA 8LPRA 1GGDB 2BZ6H 4K8YA 2P3UB 1PQAA 5L30H 2THFB 3SBKA 3LIWA 1HJ9A 3F3BA 1KDQB 1ABIH 1PPEE 3MNXA 1DX5M 1D4PB 1K2I1 1Y5BT 4KTCA 1SQRA 1GJBB 2CXVA 2HNTF 1YPMH 3T29A 1EAXA 1W3CA 1L4ZA 1XX9A 1T8NA 3RXTA 1FPHH 3FP8E 1E1QD 1G9IE 1PJPA 4OS5A 1YKTA 1F92A 3QLPH 1OYTH 1IQFA 5DKMA 2J38A 1V6DA 3SV7A 4IC6A 1GHZA 1WQVH 5ESTE 4BAHB 1K28D 4JZFH 2CF9H 2WPJS 2Z9GA 1UVOA 1TONA 4TY7A 2PKAA 1NFUA 1TE0A 1O5CB 1QBOA 3ZVFA 2GDEH 2Y6TA 2ZFRH 1HIAB 2XYAA 3CENA 1P0SH 3E6PH 2WUBA 2OLGA 3NRLA 1DY8A 3QZQA 2RFKC 2OUAA 1O2VA 1J17T 3K9XB 4Y11E 3E1XB 1LMWB 3LJJA 1C5TA 2J5UA 4NSYA 3EA9A 4BAQB 4AYVB 1DICA 4X8SH 3MU1A 2Q6FA 5F6MA 5LPEA 3SUDA 2ZFTA 5JBTA 1SGNE 1OX1A 3P8OA 3HKIB 1GVKB 4WJG2 1Z8GA 4ZXXH 2SGFE 3F0PA 1J9CH 3PTNA 5FX6A 1O2UA 3MU4A 2GDDA 4X2VA 1BA8B 1LKAA 1ARCA 3UNSA 1OS8A 1Y59T 3KF2A 3D62A 2WPDD 4WH8A 2WPLS 1T8OA 1MCTA 2V3OH 3ZZ5A 4D9QA 1TNJA 3H7OA 4YO9A 1SSXA 3RXGA 3UQVA 3A84A 4JMYA 4Q4LA 1F2SE 1ZMNA 1AFQC 2GKVE 4K8BA 3ZVBA 3PM3A 1A7SA 2F3CE 2BLQA 3OSYA 3GDVA 3MI4A 3C27B 4JZIA 5FPTA 1GBBA 1H9HE 1C2JA 4WMEA 1G32B 2SNVA 1C2HA 1GBEA 1O3HA 3DCLA 3SJKA 4B2AA 5AFYH 2Y5FA 4IC5A 1SQOA 1YPEH 1EZQA 4IMZA 2J92A 2ODQA 3L6PA 4FXGH 3F9EA 3MU5A 1XUIA 1C5LH 1AZ8A 2CJIA 1LKBA 5DPAA 1LPZB 1Z8JB 5EW2H 3SNCA 1YC0A 3SOSA 1BITA 2R2MB 3AK5A 2VBCA 3RMMH 5L2ZH 4ASUD 1QA0A 1NFWA 1UTNA 5C94A 4A5TS 2BY8X 3GY6A 2W6JD 1Y8TA 1HJAC 2ZKSA 3LPRA 1J8AA 3M7UA 1HFDA 2JDID 2QE7D 3SGBE 2ZHWH 2ZDNA 3QK1A 2H9EH 3P8NA 4B6FA 1NBMD 1WOFA 3B23B 3KIDU 4DIIH 2EI7A 4Y0YE 1GI4A 1VGCB 1HGTH 2A32A 2HNTE 1XUKA 2A45B 1GJ7B 2A5AA 3LGVA 2R3UA 2KAIA 3SNEA 1UO6A 3Q76A 2OP9A 4ZHMU 2C93B 3U8RH 3S0NA 4MNXA 2G8TA 1SOTA 2PR3A 3LH1A 1GI3A 3F9GA 2G55A 2TGPZ 1IQLA 3URCA 2B8OH 4H4FA 4CHAB 2XBVA 1P04A 2Z3DA 1MBQA 5KGOA 1Y3VA 1TGNA 1SFQB 3QWCH 4DT7B 4K69A 1GJDB 3RXKA 2Z9KA 1IHSH 4J1YA 1F0RA 3A7WA 4X6MA 3F0OA 2Z9IA 4RSPA 5FCKA 4JCNA 3A81A 1NO9H 4CRCA 1EZUC 1ZHMA 8ESTE 1C2KA 1O3FA 3GS9A 1UTLM 3VGCC 1G30B 2BDAA 2KCYA 1YPGH 1XMNB 5DP5A 3ZZ8A 4YLQH 4TWWA 2GCHF 2FPZA 2FX4A 3P8GA 4ISNA 3RXBA 3OAAD 4OGYA 4ZMAH 3BIUH 1N6YA 4KKDA 2ZGHA 1TBZH 1W0ZU 1A3EH 3UOUA 5DP3A 4D7GA 1PYTC 4UFEH 4OS7A 3ODFA 3M37A 1LHGH 1A0JA 5GIBA 2VU8E 1M9UA 1CA8B 1BJVA 2FXRA 1GI2A 4J2YB 4MQAA 4H42U 3SGQE 1F5KU 3F68H 5EJZA 1FLEE 1ARBA 2PWXA 4CRAA 3F2HA 1K1PA 1EX3A 1WV7H 5DP9A 3GYMA 3UY9A 1KXEA 1L1JA 1ZJDA 1Y3WA 4XBCA 3OFND 4Q80A 1QGFA 2Y5HA 2PV9B 5A8ZA 3OE7D 2C4FH 2CHAB 1PYTD 3GY5A 4X8UH 1CQQA 3PV2A 1D3QB 3GY4A 5I25A 5DO4H 2HLDD 1NU9A 1WAYB 3SGAE 3VFEA 4DG4A 1H8ED 3PV5A 5TCCA 1HAXB 1QB9A 3BV9B 4ZKSU 3RXEA 3ZZ7A 1DWBH 1ELBA 1HBTH 3MOCA 1GJ9B 1HAHH 5CMXH 1A1RA 4DY7B 3D65E 4B76A 5A0AE 1Z6JH 2OQUA 3KQCA 4GCHG 4OGXA 1HB0B 5JYIA 1NT1A 2ZFPH 1HDTH 1V2KT 2QIQA 3A8BA 3U69H 4NFFA 4I8GA 2VIWA 4ASHA 4A1TA 1C4U2 1O5EH 1GI5A 4HZHA 1P2QA 1LHFH 1EB2A 2GCTB 1ELEE 3E91A 3V0XA 1XUGA 2PW8H 4XSKU 4BTUB 4UFGH 1A2CH 2PSYA 3A89A 1A46H 4JZEH 1H9LB 2EY4C 2AYWA 3ZVEA 4H6TA 4X8TH 1PPGE 2A4OA 1KYNA 4XE4A 2A4RA 1FIZA 1CU1A 1DDJA 2F9PA 2ILNA 3FN8A 5EU8A 2W7SA 4E7NA 3FKSD 4RN6A 1C5MD 3PRDA 4FVDA 4X1PU 2NU4E 3RXVA 1KSNA 1C4V2 2R0LA 3VB6A 3SN8A 2FX6A 5K0HA 2GJGA 3DFLA 6LPRA 4Z0KA 1UVPA 3LGWA 5FBIA 2A0QB 3RU4E 2FWWA 2YMSB 1KLTA 3E8LA 1WYKA 1O3AA 1O2LA 1CBWC 1GCDA 2F9UA 1NRSH 4ZHAA 1OP8A 3TJUA 3M5LA 2XTTB 3SW2B 2K8IA 3RXHA 1T4UH 1TOMH 1GG6C 1S6LA 1EOLA 1ZPCA 1F0SA 5EODA 2H9TH 1TNGA 1CT4E 4Y8YA 1BBRE 1OSSA 5JB9S 1SMFE 4MNVA 4SGBE 1O3OA 1TB6H 4M9FA 2H2ZA 1KLIH 4JK5A 4I8KA 1GGDC 2HWLB 1P8VC 1MU8B 2WSSD 2CV3A 3CNRA 1HYLA 1SQTA 4MDSA 1ZTLA 4HFPB 3RXDA 1QZ8A 2D26C 1P06A 1GJAB 2BQWB 2BLVA 1GMCF 1INCA 7GCHF 3WW7A 4B6EA 1F5RA 1ZMJA 2VINA 5E2PA 2BM2A 7KMEH 2WPKS 2Z3EA 2V3HH 2P59A 2J97A 1VCPA 2ZCLP 4X1QU 1L0ZA 2ZQ2A 5A0BA 2VWMA 1UTKA 3GCHB 4KGAA 1ZMLA 2ANWA 3R0FA 1YY3A 3D49H 3EAJA 4JZDH 2ZEBA 1CHGA 1C1QA 3FP7E 1BIOA 3JZ2B 1AGJA 1N6XA 1ZGVA 1QL7A 3BTDE 4GPGA 3O8DA 1O2TA 3DT0H 1HAPH 1G3BA 1GBAA 4Q7XA 3U9AH 1ZRKA 1NTPA 1V2WT 4RI0A 1LVOA 1S81A 5T3HA 3NCLA 1O37A 2OINA 4IMQA 4CRFA 1GHAG 2A4QA 3OU0A 1ELAA 1GMDG 1LPKB 5JDUB 1CT0E 2ZA5A 5DK1A 2ZTXA 2VIDA 3O8RA 2F9OA 4H6SB 1EUFA 3OTPA 1PPZA 2BQ7B 1K1NA 3AAUA 1P2JA 1EAUA 1ZLRA 2B9LA 8GCHF 2UUKB 2Z9LA 5HMAA 3SNAA 3GCTF 3MO3A 3O8CA 2ZFQH 5FPSA 2ULLA 1O5DH 1O2SA 3P92A 1Y5UT 2ZU5A 3SUGA 2TIOA 2ZDLA 4ABBA 5G4BA 3SV2H 2AFQB 3F2FA 2EA3A 1O3LA 3TK6A 2ZHEH 3GY8A 2W3IA 3WY8A 2XWAA 2RA3A 4UONA 2SNWA 3RLWH 3QTOH 1VCWA 4MG3A 4ISIH 2W3KA 1QURH 3SNBA 4LXBH 2XOKD 1ABJH 2SGEE 2ZIQH 1XUFA 1C1VH 1F0UA 4OS1A 2QXGA 2B5TB 2STAE 2FOGA 1UVUH 2FDAA 2SGAA 1CA0B 2OC8A 4YM9A 4IN2A 3GDUA 1HRTH 3T27A 3RM2H 3B8JA 4QT8C 4Y0ZE 3RUOA 1DXWA 4FU8A 1O2YA 3OEED 5C5OA 2WV9A 4DCDA 1MAYA 1YF4A 2GZ7A 1W7XH 1GBLA 3SO3A 2BOHB 1GBJA 4UEHH 5EOKA 5CDFE 1UHBA 1WQSA 1MKWK 2FTMA 3LU9B 2HRVA 1FONA 5DJ7A 1IQHA 4NA8A 5EJ1A 1JIRA 1GCTB 4UE7H 5PTPA 3DA9B 1ZPBA 1GHBG 2H5CA 1SL3A 2J4IA 1GBIA 3SHAH 2J9NA 1P9SA 3VB3A 1KTTB 4ABDA 5FXLA 1K1JA 1ANCA 1GBMA 3U28C 1C5YB 4ZKOU 2QXIA 1SGQE 2G5NA 3W94A 2VIOA 1O2ZA 1GDNA 1PPFE 2P3TB 1P11E 5BRRE 2V3MA 1VGCC 1S82A 1QJ6B 5C1YA 3SORA 1PQ5A 1QJ1B 2Q6DA 1SGIB 5EXLA 1XM1A 2NU3E 2R9PA 3PO1B 2PFEA 1C9TA 1E36B 3M7QA 1H8HD 2ZF0H 2FOCA 1UMAH 3EDXB 6CHAB 4CHAC 1PQ8A 4LZ1H 3RMOH 1BMFD 3QN7A 1Z8RA 1SHYA 2ZPQA 5IDKA 1GWAA 1IQIA 1S0QA 1GJ6A 3ESTA 1GMHF 2AGEX 1ETSH 4P02A 3MH7A 2VIQA 3PV4A 3F9FA 1MTNB 1RJXB 1C2EA 3TIUA 1O3PB 1D6RA 1FUJA 1VCQA 4IS5A 1QBNA 5E0HA 5F03A 4Q2KA 1QJ7B 1RTFB 3SZEA 1MKWH 3NWUA 1PPCE 2W7UA 5KEDA 1TRYA 2DE8A 4MTBA 1MABB 2GT8A 1O2NA 3A88A 4F4OC 4CBOA 2J94A 2Y82A 3N7DA 5F53A 2KX4A 4UD9H 2HNTC 4LOYH 2HLCA 1C1SA 2BLOA 2VIPA 3RM0H 2TBSA 1UHBB 1XXFA 3MFJA 2QA9E 1QRZA 1YCPK 1Z1JA 1G37A 2FS8A 2SGPE 1NM6A 1ANEA 1E0FD 3ZVDA 1J14A 1ELTA 1E79D 2EI6A 1NC6A 2OQ5A 1UK4A 4Y6DA 1AD8H 1V3XA
chains in the Genus database with same CATH topology
5EGMA 1P10A 1FNIA 1L4DA 2OXSA 1W8BH 3MMGA 3SUEA 4AG2A 1KXAA 2A5KA 3UQOA 1QRXA 1DT2A 4VGCB 1SPJA 4GHTA 4AFUA 1UVTH 1V2MT 1FY4A 3TJVA 4ZKRU 1C5RA 2ZCHP 1FXYA 3LH3A 1YM0A 1SR5C 2FOMB 4NIVA 2PSXA 1AI8H 4Z6AH 5LH8A 4Y10E 1MMJN 4LZ4B 2ZHDA 3FANA 3E3TA 1LVBA 3TK5A 3ZZCA 1MTVA 1O35A 2GGVB 2JH6D 2GCTC 3KL6A 3SU6A 1MQ6A 3HK6B 2ZTZA 1AKSA 1JWTA 2ZFSA 1TPOA 3LGUA 5GJ4B 3SI3H 5I46H 2O9QA 3F9HA 1EP5A 2F9VA 3U8OH 3ENSB 3EA8A 2VWOA 4TWYA 3ZYDA 1V2PT 1S83A 1HAGE 1SOZA 4XOJA 1N8OB 2BD2A 1GHXH 3RXRA 4XDEA 2P94A 1F7ZA 4ZUHA 2OC0A 1P03A 3EYDA 2XNIA 3A8DA 4GLYA 2RA0A 4M7GA 1YCPH 3RXLA 1MD8A 1O5AB 1V2VT 4PROA 2AMDA 1DUEA 2PTCE 1EPTA 2VIVA 5IYTA 1IOEA 2OCVB 2R0KA 2RG3A 4ABHA 3GY3A 2BLWA 1YLCA 1P3CA 3C1KA 1OWKA 3S9AA 1CHOG 5DP4A 1RRKA 2G00A 3A83A 2VWLA 1FY8E 2Q6GA 4F49A 1THPB 2WYGA 1AU8A 1C1NA 4NA7A 2Y81A 2ZCKP 3U98H 5C1XA 2VH0A 2UUFB 4SGAE 3M7TA 1IQGA 4A1VA 1O5FH 2F91A 3NXPA 3RDZA 1NFYA 3BEIB 4WY3A 3MNCA 5FBEA 3UFAA 1DPOA 4DURA 1B7XB 1Q3XA 4AN7A 1UK3A 3RXCA 3S7KB 1O5GH 4TPIZ 1DE7H 1C5UA 2PKAB 2VGCB 2PTNA 3BTME 1C1RA 1T8MA 1UTQA 2FYRA 1E37B 3RXOA 1V2LT 3S7HB 2ZDAH 2ANMH 3FZZA 1FDPA 3BTHE 2UWPA 2YNAA 1CVWH 1QHRB 6GCHG 1ZSLA 1O3IA 1W14U 4GSOA 3T28A 2ZDKA 1FIWA 4GVUA 4AORA 1F0TA 1O3GA 1MCVA 1EJMA 2QGRA 1THRH 3Q77A 2ZP0H 3KHVA 2IJOB 4AZ2B 2GT7A 3KEEA 2GCHG 4UFDH 1BB0B 2QYIA 1ELFA 1TQ0B 3M35A 3PLBA 1NFXA 1UVSH 5TJXA 4AG1A 1X7AC 1TA2A 1H8IH 2BX4A 3BN9A 4X0WU 2HPQH 3TH4H 1O38A 1E34B 2BD8A 1C1MA 2BDCA 1TBQH 2CMYA 3RXQA 1GJCB 3I29A 2BD3A 2R3YA 2TGTA 3RU4D 2BDBA 2PGBB 3TH3H 1GBHA 3S9CA 5AFZH 1ELDE 1WTHD 3UR9A 3RLYH 1DS2E 1FQ3A 1K22H 1C5SA 2Y80A 1E38B 1P3EA 3SJIA 2QV1A 1GVLA 2C90B 5LPRA 5CHAB 4MVNA 2FM2A 1SQAA 2OD3B 2TGDA 1FY5A 4DOQA 3F1SB 3BG4B 4X6NA 4UFFH 1P2OA 1BBRK 5GDSH 5E0JA 1CSOE 1S0RA 1SFIA 1GL0E 1QIXB 1C9PA 2V35A 2OBOA 4Y7AA 1CGIE 1EAWA 5FHTA 2J95A 1P02A 2ZI2H 2WPIS 1KY9A 3PMHB 1LVMA 3A8AA 5LGOA 1HAYB 2FI3E 4ISHH 1RIWB 2TRMA 3MH5A 4NCYA 2W26A 1GCTC 1YCPM 2EEKA 5F8TA 9LPRA 1AE5A 2ZGBH 1LQDB 5GCHG 1AIXH 1C2LA 1HXFH 2LNCA 1L2EA 3PLKA 1Y3UA 1NN6A 3UREA 3TGKE 1YPHE 2A1DB 2KAIB 1EZSC 2BVSH 4YESB 9ESTA 1TMUH 1HLTH 1P2IA 1KXFA 4U01A 2ZPRA 1S84A 1TABE 3M3SA 2ZNKH 1ELGA 5FPYA 1PQ7A 3BTKE 4HGCA 2Z3CA 3U8TH 1JOUB 3N7OA 1O2OA 3ZZ4A 2WYJA 2FOBA 5HM2A 1PPBH 1ESBA 1LDTT 1UCYK 5B6OA 2UUYA 1QB1A 1V2QT 1DFPA 3PO1C 3DD2H 1VITF 4FVBA 5BPEA 1DY9A 1GHWH 1BRCE 4MPVA 3MH6A 3ZVAA 2FO9A 2SGDE 2A7JA 1W13U 1O33A 1SLVB 2FTLE 4IW4E 1BBRH 1GJ5H 1WCZA 2BD7A 4BANB 2FOEA 3M5OA 1BCUH 2PKSB 1PFXC 2VVCA 4CRGA 1K1LA 1TX6A 1BJUA 1AWHB 1SB1H 1MTNC 3ZZDA 2GZ8A 2GMTB 1FI8A 5HXFA 5L2YH 1Z1IA 4FUCA 1ANDA 7GCHG 5F8XA 2Y7ZA 5AHGH 2XW9A 1MD7A 3SU5A 4KP0A 3MU8A 3HGNA 3FAOA 4JK6A 4X8VH 1GI8B 5DG6A 2W5EA 1BTXA 2ASUB 1T31A 1EP6A 4GCHF 3RXJA 4MPWA 1O32A 3STIA 4ZKNU 1TRMA 1L1GA 1P2KA 1ZRBA 4ZH8A 3VEQB 1D6WA 1O39A 5HGGA 2Y5GA 3RXMA 1KLJH 1V2TT 1FV9A 1IHTH 3PMAB 3GISB 3VXFH 1BT7A 2HVXA 3MNBA 4X6PA 2YOLA 4ABEA 4B75A 1KXDA 1MH0A 2PUXB 1FJSA 4O97A 1BTUA 1LVYA 1UCYH 1FZZA 2ZU4A 4ABFA 5DP8A 4I8LA 2ZFFH 4MNWA 1ESAA 3RC4A 2FIRH 2ZWLH 1JBUH 3RXSA 2JKHA 1O0DH 4VGCC 1ZZZA 2QY0B 5ETXA 8GCHG 1VJAU 3PROA 1W11U 3GCTG 3SHCH 2GP9B 2Z7FE 3E16B 1G36A 3SNDA 4ABIA 1G2LA 1A5GH 1XUHA 5FAHA 1DANH 2STBE 5JBAS 1DITH 1BRUP 2NU2E 2NWNA 1UCYE 3H7TA 5A2MH 1FMGA 1GBTA 1GDUA 4YTAA 2XC5A 2AIQA 3EGKH 4JYTA 2P3FH 3ZVGA 3UUZA 3LJOA 3SU3A 4K1SA 3ZV8A 3BTQE 5GXPA 1QL9A 1V2OT 3LOXA 1AY6H 4FUHA 1T7CA 1DOJA 1O3EA 1EQ9A 3Q3KA 1ANBA 1N8OC 3ODDA 2C8WB 4CREA 5JPMH 1SGDE 1K1IA 5L6NH 1QQ4A 2GVFA 1LHCH 3A87A 2ODYB 1MQ5A 3S69A 4D9RA 4MNYA 1GPZA 3E0PB 4WWYA 1G2MA 3VPKA 1OP2A 1HAIH 4ISLA 4DW2U 5SGAE 3HATH 3MHWU 2Z9JA 2UUJB 2WUCA 1S5SA 2QCYA 1GI0A 1FAKH 1EAIA 1V2RT 3ZZ6A 1P2NA 1DLEA 3PB1E 1TLDA 2BQ6B 3PYHA 2VVUA 1GHAF 4NIWA 3UWIA 4FUBA 1C2IA 4Y76A 1C2FA 3M3VA 3Q3XA 4FUIA 2TGAA 2O8UA 5F8ZA 3SU1A 1TGSZ 2FEQH 3M61U 2ANYA 1C1WH 2C3SA 1C5WB 3OY5U 2G4UA 4OS6A 1AVGH 3UNRA 3A80A 2VGCC 1W12U 2FOHA 1C5VA 1BDAA 2OC7A 1HPGA 4INLA 2AIPA 2QN5T 1P9UA 1O3JA 1O34A 2AMQA 2FP7B 2GV6A 2FLRH 1WUNH 4YT7H 2ALPA 4K3JA 5C5NA 1MTWA 1GMHG 2AS9A 3T62A 4NFEA 3BTEE 2XRCA 5FCRA 3U1IB 1MTUA 2FI5E 5ESBA 1QCPA 3A7TA 1GVZA 1CE5A 2A7HA 2RDLA 1QB6A 1J15A 1TYNA 4AB8A 1TFXA 4YOGA 3GY2A 1UTMA 1A0LA 3BIVH 2ZHQH 1H9IE 1ESTA 1O2QA 2SGQE 4AFQA 4ABJA 2Q1JA 1SLUB 4OS2A 1DSTA 2ZECA 1UJ1A 2H5DA 2PHBA 2UWOA 1SGFA 2ZGXH 3M5MA 1C2DA 2BZAA 4ZROA 1IAUA 1SI5H 3LC3A 1AWFH 1YPJH 1WU1A 2GTBA 3BTWE 1A61H 3GY7A 1L1NA 2ZPSA 1OOKB 1HIAA 4BAKB 2BXUH 1DLKB 4IN1A 1HV7A 1BMNH 2GZ9A 4WH6A 1O3BA 2H9HA 1AVWA 3PMBB 1TBRH 2FI4E 8KME2 1TA6A 3BG8A 1J16A 1TNIA 1V2UT 2BVXH 1FPCH 3SJ8A 1HXEH 4I8JA 1FN8A 4U2WA 3QX5H 3T5FH 4CR9A 2ZU1A 1D3TB 4ESTE 5A0CA 1UTPA 7LPRA 2D8WA 2IN2A 3BG4C 3V13A 1GL1A 4UDWH 3BEUA 4NIYA 2R2WU 2Z94A 1QTFA 5T6GA 1LHDH 4FU9A 5C2ZA 4YOJA 1AQ7A 2FMJA 4GHQA 3MTYA 1K1MA 2WV4A 1NPMA 2HOBA 1GJ4H 3ELAH 1C1PA 1Y5AT 3V12A 4GAWA 1D9IA 2P93A 4YZUA 2ZZUH 4INKA 3TU7H 3SU2A 3SU0A 1RIWC 1T8LA 3M5NA 4Y7BA 4NZLA 4A7IB 2CHAC 3GOVB 1V2NT 2BD4A 1SC8U 2LPRA 3TH2H 3PWCA 1A3BH 1NY22 4KELA 3SV6A 1FN6A 1BMLA 3NUMA 1F5LA 2IPHA 2BTCE 1VZQH 1EJNA 4AFZA 3QDZB 3QO6A 3OYPA 4A6LA 4E05H 4WVPE 3TITA 1ELVA 1O2WA 1ID5H 4CBNA 5JBCS 3UPEA 4YT6H 2B0FA 2J34A 1DWEH 1D3DB 3MO6A 4DGJA 1Z7KA 3ZZBA 4X1NU 5A8XA 2FOFA 1O2MA 3AVZA 4X2WA 2BX3A 1ELCA 1MAXA 3KCGH 2BY7X 3LGIA 3TVJB 3L33A 4IGDA 3TGIE 4O03A 1C4Y2 3QZRA 1ETTH 2C8XB 1BRBE 1YPLH 3LGTA 3RXFA 1THSH 1CGHA 3OTJE 1QRWA 1P57B 2A5IA 2V6NA 4K1TA 4X1SU 5E8EH 1C2MA 1ACBE 1KXCA 2PKSC 2BMGB 2JETB 5AF9H 3A82A 2A4GA 4JZ1A 1K1OA 3V7TA 2GMTC 3EA7A 3ATLA 1BMMH 3R3GB 2BDGA 1EOJA 1ZJKA 2BD9A 3PTBA 1HUTH 1O3KA 3OY6U 1BOQA 1O2GH 1TNKA 4CRDA 1O36A 3STJA 1O2KA 4TYDA 1AB9B 1OWEA 1EATA 1YPHC 3JZ1B 1W10U 4MPUA 2QF3A 2XCNA 3PMJA 1G3DA 3ATMA 4DVAU 2FS9A 5DP7A 1AFEH 1TGTA 1OWIA 4B73A 1SLXB 1O2RA 3DFJA 3URDA 4FUEA 2K1QA 5J4QA 1SGPE 1DVAH 3P8FA 1SG8B 5E2OA 1RXPA 3RXUA 1OWHA 1TNHA 4AX9H 1ETRH 3P95A 1Q31A 1G3CA 3TLOA 4MPXA 2BDIA 1ZSKA 3FFGA 2FZZA 4AB9A 4X1RU 2ZU2A 3HKJB 1SHHB 4MLFB 1C5QA 5GPIB 5C67A 3V3MA 3KQEA 3GCHC 4BXSA 1A4WH 3SJ9A 1JIMA 1LHEH 3E0NB 3T2NA 1H4WA 1MTSA 1NROH 1SGEE 2BB4A 5EQRA 1AO5A 2OC1A 1MBMA 1DSUA 4THNH 3RMNH 4CH2B 4B74A 1Z6EA 1TRNA 2CGAA 1SVPA 1CHOF 3TK9A 2VH6A 3SUFA 1AKSB 2VJ1A 3M36A 4U32A 3KN2A 3NK8A 3CP7A 3BEFB 3F6UH 4DJZB 3QTVH 1W0YH 2FYQA 3ATWA 5ABWA 2QXHA 2F9BH 4A92A 2AEIH 3O8BA 5EW1H 3GDSA 3QUMP 3LC5A 1IQNA 4Y79A 1OKXA 3ZYEA 1T32A 3GCNA 1P09A 2SFAA 2OTVA 1SLWB 5AVDA 2P8OB 3K65B 4NIXA 1AZZA 1TPAE 4BTIB 1TX7A 1QR3E 1Y3YA 4ZXYH 4YOIA 3RMLH 2OBQA 1BHXF 4TY6A 3RU4T 1EPTB 4INHA 2HPPH 1B5GH 3DHKH 2G51A 5EPNA 4B1TA 1VR1H 3OX7U 4NSVA 2BD5A 4AOQA 3K2UA 3K6YA 4AYYB 1IQJA 3SQEE 3HGPA 3SQHE 6GCHF 3RC6A 1XVMA 3KGPA 1TAWA 5CE1A 2P16A 2JH0D 1UTJA 2BY5X 2YNBA 1LPGB 3P6ZB 4ZAEA 3Q3YA 1CA0C 3HK3B 1YLDA 2C8YB 4U30A 1AMHA 2BXTH 3FP6E 1S85A 5HYOA 2V0BA 3UIRA 4AFSA 2O8LA 1C5OH 4I8HA 2D2DA 1KXBA 2ZC9H 3LDXH 1TWXB 1GI6A 1GI7B 1OPHB 3ITIA 3I77A 3M3TA 4D8NA 4BXWA 2H1UA 5A09A 1AUTC 4XFQA 1VITG 4AGJA 1TGBA 2NU0E 4GUXA 4WXIA 1P05A 1CO7E 2FOAA 3AW1A 3G01A 1SGCA 4O3UA 1O31A 1C2GA 1NZQH 2XCFA 2ZGJA 1PPHE 3A86A 4K2YA 1HNEE 5JBBS 1UTOA 5T6FA 5EQSA 4BTTB 1SGTA 2O8WA 3AW0A 1P01A 1AVXA 4D7FA 3MO9A 5K7RA 1JMOH 3ATIA 2IOTA 1KIGH 5EG4A 5DP6A 2BDHA 5A8YA 2QF0A 3RC5A 1XUJA 1FAXA 3NPSA 1TPPA 1BTYA 2A7CA 1ZYOA 2BOKA 3NKKA 1W2KH 1N1LA 3QGJA 2ALVA 3LGYA 4R8TB 2AMPA 1SGYE 1OXGA 2UWLA 3SI4H 4RKOB 2O8TA 6CHAC 3QGNB 5C1UA 4X2YA 4HI3A 5C3NA 2FLBH 5DGJA 1XKAC 3P70B 1JXPA 3BSQA 1Z71A 2ZTYA 1GBKA 2I6QA 3A7ZA 3B9FH 4NWKA 1GBFA 4CR5A 1K21H 2ZU3A 1O30A 2C8ZB 2G52A 1HAZB 2A2QH 4DIHH 1Y3XA 2QAAA 1GMCG 5GCHF 3ZZ3A 1HCGA 1U6QA 1GDQA 4BOHA 3A85A 1LO6A 3VB4A 2JH5D 1HAOH 4I32A 4KTSA 1BTHH 2BYAX 4K1EA 4OS4A 1O3DA 1HAVA 1H8DH 2AERH 2BY9X 2ODPA 3A7YA 1IQMA 1CGJE 3A7XA 4JYUH 3E90B 3RXIA 3MNSA 2ZDMA 3IWMA 1HJ8A 1AFQB 1SGRE 2F9NA 1GI9B 1C5ZB 5EPYA 3L3TA 1O5BB 3UR6A 1RFNA 2XC4A 1BMAA 4E7RG 1BTZA 3PWBA