1TPPA

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tppA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tppA02
3RXBA 3U8TH 1Z8JB 1O38A 1O3MA 1DANH 4JYTA 1PFXC 5C1UA 4NG9H 1LHEH 2UUJB 3B23B 1YPLH 1MTUA 3STIA 3NCLA 2F3CE 4TPIZ 3MO3A 1TABE 3SU1A 3VGCC 1SB1H 2EI6A 1SOZA 1GI0A 5B6OA 3U1JB 3SU4A 1S0RA 3EA8A 4NSYA 1Z8RA 3ENSB 3TJNA 3ODFA 3PWCA 1MD7A 1H1BA 4ISLA 1C5WB 4CH8B 1EQ9A 1UVTH 4AG1A 4GHQA 1BTXA 1ETTH 2AMQA 1QCPA 8GCHF 5JBCS 1NFYA 1UVPA 4H6SB 7KMEH 5A09A 7ESTE 1P03A 3W95A 1Z1IA 2VWNA 2P8OC 3DD2H 2ASUB 5CHAC 4X6OA 1QNJA 3TJOA 3PV4A 3BTFE 5EU8A 1NT1A 2CMYA 1FAXA 1VITF 3F68H 2NU1E 1QTFA 2HLCA 1ZSJA 1GI4A 5A2MH 3O8RA 1J15A 4NCYA 1V2JT 4MNWA 5C67A 4MG3A 1AVXA 1QRWA 4J2YB 4ZHAA 1OP8A 4K3JA 1GL0E 1O30A 1OS8A 1O2UA 1C1UH 3GCTG 1FIZA 5A0CA 1C2MA 1AZZA 2VGCB 3MO9A 1KXBA 1BBRK 1H4WA 3MFJA 1H8IH 3A85A 3BTEE 3SO3A 1TA6A 1F5LA 1F92A 3A83A 3PLPA 5C5OA 3KCGH 3KQBA 1F0SA 2SNWA 2EI7A 1NRPH 4B75A 7GCHG 2A7HA 2J34A 1FN8A 1YPMH 3AAVA 3I77A 1GBTA 3F6UH 1QBOA 4JK5A 3B9FH 3SBKA 3KL6A 3LGUA 2STAE 5GPIB 3SJ9A 4NIVA 1ABIH 4I8JA 4X1PU 5FXLA 4ABEA 1FQ3A 1MMJN 4MNVA 1J14A 3LC5A 1XXFA 1TPOA 1K1PA 3H5CB 1SOTA 3O8DA 3ZZ5A 1HYLA 3RXDA 1AD8H 1THPB 3UUZA 2OQUA 1BITA 2QXJA 5AHGH 1WBGB 1N8OB 2JETB 5SGAE 1EAUA 2PSYA 2ZGXH 5A0BA 1BOQA 3GY4A 8KME2 3P95A 3R0FA 2VIWA 1C4V2 1BMAA 1KIGH 1ESAA 3SHCH 2PKAB 1D9IA 1QRZA 2WPLS 3IWMA 3S69A 5C3NA 3BSQA 5FPSA 3E6PH 2BLQA 1H8DH 4X8SH 1V2UT 3ZV8A 2GZ7A 1PQAA 3SW2B 3QGNB 1UMAH 2BXUH 4JZDH 1W13U 1P2IA 1TRYA 2Y6TA 2V35A 3RXKA 1BJVA 2GT7A 2QV1A 4Y7AA 1THRH 4Y0YE 1G32B 4OGXA 1W14U 1GI7B 1MTNC 1UCYK 2TIOA 1SQOA 4FUFA 5K7RA 4IGDA 1YPHC 1K1IA 1ZTJA 3SOSA 3T29A 1VJAU 3SUEA 3QLPH 2R2WU 2PFEA 3F9FA 3RLYH 4GSOA 1VITG 3GYMA 3URCA 1AIXH 1O5EH 3JZ2B 2LNCA 4WY3A 1IOEA 1HJ9A 1Z7KA 3RXFA 1DY9A 1DICA 2G8TA 2XC0A 5DP3A 3MWIU 4JMYA 1LHGH 1YLDA 2ZGHA 2WINI 4HTCH 4B71A 4IW4E 3M3VA 3TH4H 1S0QA 4FU8A 5F8TA 1G3CA 1GI6A 3LH3A 3SUGA 1GBCA 1QQ4A 1RFNA 3H7TA 1A61H 2AGIX 2Z9GA 1A5GH 5HM9A 1BZXE 3SGBE 2OINA 4MDSA 1ZMJA 2VIQA 1C5PA 2C3SA 2A2QH 1QURH 2A4GA 2FOCA 4ZKNU 5DPAA 3OYPA 1E0FD 3RMLH 1S82A 1C1TA 5E2OA 1MTVA 1SGCA 1DXPA 3T28A 1IHTH 3GDVA 2P3UB 1P2OA 5E0GA 3L3TA 2ILNA 1FY8E 2ZHWH 1ANDA 1GGDB 4RSPA 3UPEA 1EKBB 4NIYA 3DT0H 1ZMNA 2GD4B 3I78A 4FUDA 6CHAB 1QIXB 1AY6H 2CF8H 2ZFPH 5T6GA 2OBOA 3PMBB 1FLEE 1ZPZA 2HPQH 4CR9A 1UTQA 1ARBA 1GDQA 1GVZA 2P59A 4U2WA 2XC4A 3QO6A 1ARCA 1GG6B 5I46H 2BX3A 2BDHA 1YF4A 4DW2U 2XCNA 3LONA 1L1GA 3BTWE 5AFYH 1AO5A 1ELDE 3PYHA 1E34B 4AFSA 1YPHE 5DG6A 2CXVA 3PMJA 3ZZCA 1UK3A 3NK8A 2G55A 3RP2A 1O3CA 2ZI2H 2QXHA 5A8XA 4I8KA 3SNCA 1TRNA 2A4QA 2EC9H 2AH4X 4NFEA 5JBTA 1TMTH 3PO1C 2R0LA 1HPGA 3TGIE 1DS2E 1MKWH 4ZH8A 2ZGCA 1JRTA 1LVYA 1ESTA 1L0ZA 3A7TA 1DUEA 1LVOA 1YCPH 1S6HA 4Y71A 4MPXA 2Y80A 3P8FA 5JB8S 2BDAA 1JIMA 2ZDMA 1HRTH 5ESBA 1BIOA 1P2MA 2FX6A 3A84A 2ZIQH 1O2KA 1V2RT 1IQIA 1ID5H 1OWJA 1DLKB 2C93B 3RMOH 1UHBA 1Z6EA 1O5GH 2ZQ2A 2WYJA 4AORA 2FOFA 2OXSA 4MPUA 1Z1JA 3W94A 4A92A 2BTCE 5L2YH 4CHAC 3TJVA 3DFLA 1GMDG 4KP0A 1VZQH 4CRDA 4ISNA 2Z7FE 3MI4A 1V2LT 4HI3A 3GISB 1O3FA 1FONA 2PKSC 1CA8B 3SI3H 3RXLA 1UVOA 1FNIA 3KEEA 3BTME 4FUJA 1CHOF 4ABBA 1O2LA 4LZ1H 3KNXA 4RKJB 1X7AC 1TNHA 3VFEA 1ZR0A 1IQEA 3LOXA 1TGSZ 2GV7A 2C8XB 1N6XA 1IQKA 4DIIH 2Q6DA 1PPHE 4DOQA 3MNXA 1YGCH 1O3HA 1DITH 2ZDLA 2H5CA 2FP7B 1WQVH 3LT3A 3U8OH 3RXRA 3URDA 1EPTC 1OSSA 3MH5A 1W10U 2UUYA 2C4FH 3PM3A 1FZZA 3R3GB 1HJAB 4TY7A 2ZECA 1NU9A 2I6SA 1KY9A 1SGFG 2D8WA 1KYNA 1HDTH 5JYIA 2FI3E 1O3JA 1A2CH 3MH4A 3A7YA 5C1YA 2AYWA 4LZ4B 3V12A 1TGNA 1GJ7B 1JBUH 2ODPA 2WUCA 3ZV9A 1QR3E 4CBOA 1NRRH 3DFJA 1RRKA 3D65E 3FP6E 4AYYB 2HNTF 1W11U 2GZ8A 1BRBE 2FMJA 2UWPA 1EUFA 3MNSA 4OS6A 2HPPH 5A0AE 5EW1H 1HAOH 2OD3B 4Y8XA 3CS0A 4D76A 1GJ6A 4DCDA 2Y7XA 3Q77A 1AWFH 2IN2A 3RDZA 4FUGA 4INHA 1K1JA 1S84A 1P0SH 4FVBA 2Z6BD 2ZFSA 5DP9A 2FM2A 1VCWA 2SGAA 1C1MA 5G4BA 2QCYA 1V6DA 3DUXH 1C1OA 1NFXA 4HFPB 3SU2A 2VWLA 1FPHH 2AMDA 2O8WA 1GJ5H 2XW9A 5F8XA 4I32A 3SNAA 3FP7E 1EZQA 1HUTH 1GJ8B 3PWBA 5DK1A 1GBLA 4DURA 5BPEA 3QZQA 3FZDA 4Y7BA 3TLOA 2GKVE 4X6MA 4ISOA 5LPRA 2XWBI 1A0JA 1EJMA 1B0FA 4THNH 5GWZA 1W7GH 1TMBH 5T3HA 1HAIH 1QL9A 2NU4E 2K1QA 2R2MB 1A0LA 2CGAA 4K5ZA 1VGCB 2A4RA 3S7KB 3SJ8A 5HGGA 1CHOG 2ZFTA 2GGVB 4X0WU 3ZZ9A 8LPRA 1DFPA 3VXEH 3WY8A 1P2NA 1C4U2 3GY7A 4CRGA 1Q2WA 1QHRB 2FEQH 1V3XA 2ZF0H 3E0NB 1J17T 3GCHB 3RXHA 2O8UA 2BVSH 5EXLA 5JBAS 2UUFB 1Y5UT 1DVAH 2OCVB 1A1RA 1BTZA 3RXIA 1LO6A 4AG2A 1H9IE 4AZ2B 1P2JA 4SGAE 4ABHA 4RN6A 1UK4A 1T4VH 2F9VA 1O31A 2R3YA 3UNQA 2TGDA 1SGIB 1Y3VA 3OU0A 1MCTA 3FAOA 4ZXYH 1SGNE 4FVDA 1KSNA 4ZXXH 2P94A 3LC3A 4WMDA 3RXGA 2QGRA 4ESTE 2JH0D 1FY5A 1O2WA 2GP9B 3BTDE 1PJPA 2YNAA 3SZNA 1C2JA 3QGJA 4WH8A 1O32A 5AF9H 1O5BB 1ANCA 1WSSH 1OWHA 1LPZB 1EAWA 2C8WB 1AVWA 1O5AB 4YT6H 1DWEH 1P06A 1DWBH 1T8LA 1B5GH 1SG8B 2R9PA 3UOPA 4LXBH 1GBHA 1T31A 3GCTF 2CV3A 1WTHD 1TQ7B 1SGFA 1KLIH 1ZZZA 1ZHMA 1GJ9B 1NROH 1O2VA 1THSH 4U30A 3M7UA 3RU4E 3A8BA 1V2MT 3VB3A 2J38A 1TPAE 1NTPA 3E91A 2BQWB 3RXJA 4IS5A 1QB1A 2BY9X 4IN1A 1JIRA 2VGCC 1GCDA 3UY9A 4B73A 2BD8A 1O39A 2Q6FA 2OC1A 3BTQE 2Z3EA 3MTYA 3VB5A 3UNSA 4NZLA 1XKAC 5TJXA 2Z3CA 3Q3XA 2J4IA 5EXNA 1CHGA 3TIUA 1RJXB 3UNRA 1AUTC 2GMTB 4WXVA 1TPPA 1QY6A 2LPRA 1UTLM 3STJA 3VEQB 1QB9A 4X1NU 1N8OC 1EB2A 1V2ST 4MTBA 2GT8A 1ZJKA 1GI8B 4ISHH 1SGDE 3LH1A 4CR5A 3AAUA 3EYDA 1EX3A 4B2CA 2ZDAH 2A4OA 4AX9H 2PGQB 4XE4A 1XUIA 1RTFB 4XBDA 1GMHF 4O9VA 1ZGIA 3RXPA 4BTIB 1V2OT 1P10A 1O0DH 2DUCA 2GZ9A 2SFAA 2F9UA 3Q3KA 3T25A 3H7OA 1O5CB 2P3FH 1C5VA 1ETSH 3TNSA 1MH0A 2P3TB 1GI1A 2ULLA 2FTLE 4XBCA 5DP5A 1QBVH 2WPIS 3RU4D 1UTJA 3RM0H 3RM2H 1XVMA 1WYKA 3KHVA 1KXFA 2ODQA 3GDUA 1DUAA 1ZPCA 3A8CA 1C9PA 1D6WA 1S5SA 3NKKA 1GL1A 4ZKRU 3S7HB 2PUXB 1O37A 1C1SA 3ZVGA 1UHBB 1YC0A 2BOHB 4K1TA 5DP7A 1YM0A 4ABIA 3SNBA 2ZTYA 3BEIB 4FUBA 5FAHA 3SJKA 2XWAA 1YLCA 3BG4C 3F9HA 4GCHF 2R0KA 5E0HA 4IN2A 1OYQA 1EASA 3N7OA 3PMHB 2CHAC 4ZMAH 1GHAF 1TNLA 1CT4E 1WQSA 4FXGH 2IOTA 4F49A 4Y79A 3ZZDA 1BTUA 1KXAA 2ZEBA 3T62A 2ZHDA 4INLA 5DJ7A 4ASHA 5JDUB 3D23A 1PPCE 1Q31A 2GVFA 2VJ1A 2W3IA 2ZGBH 3P70B 2OC7A 4U32A 3S9AA 1ORFA 1FPCH 1P9SA 1GHVH 1Y3WA 5FPYA 1RGQA 2GCHF 3MU1A 1AQ7A 5LPEA 1Y5AT 1GI2A 4YOJA 1CVWH 2ZNKH 3A86A 4ZKOU 3A7VA 4XSKU 2VIVA 2CJIA 1LVBA 1W2KH 3K6YA 1GBJA 1S83A 1TMUH 1CO7E 3TITA 1AKSA 1CQQA 2F9OA 4Y8YA 5TCCA 3BIVH 1LPGB 3RXCA 2FPZA 1E36B 2GDEH 3SUFA 3CS7A 4H4FA 1BTWA 1BB0B 3HK3B 2W3KA 1NRQH 4NIWA 1T32A 4NIXA 2BDCA 1TBQH 3M5NA 2EA3A 3F9EA 4GLYA 1DPOA 1D3DB 1GMHG 3KQEA 3PROA 2G00A 1IQNA 2A7JA 1TPSA 1O2QA 4FUHA 2Y5FA 1ZHRA 1XUFA 2R3UA 1GG6C 1BDAA 1GMCF 2HWLB 4FU9A 1PPGE 2EI8A 1ANEA 3ZZ7A 2G4TA 3C27B 3NPSA 1C5YB 1MKXH 4HZHA 1W0ZU 2ANYA 1QBNA 3TK6A 2AIPA 1K9OE 2SGEE 2WPJS 3LDXH 1HAHH 2BQ7B 2BY5X 4CRAA 8ESTE 1P01A 2A45B 4ZAEA 2Z94A 7LPRA 2C8ZB 1GHXH 4ZHMU 1A5HA 3K65B 1CE5A 3FFGA 3FZZA 4AFZA 4YM9A 1NFWA 1TX8A 3A8DA 1MQ5A 1C2FA 4JZFH 1AU8A 3MO6A 1NC6A 1H9LB 2VB0A 1D4PB 2DE9A 4GCHG 2XBYA 4NWLA 1KDQA 2ZHFH 2B9LA 4XOJA 1GHAG 3UQVA 4X1QU 2ZHEH 3K9XB 2UUKB 2ODYB 2ZKSA 1G2LA 3ELAH 1FIWA 3RXAA 5F8ZA 3Q00A 4KTCA 2ZPQA 4X2WA 3U9AH 1TOCB 1AFEH 1DOJA 1EP6A 1OYTH 1F0UA 2F83A 4BXSA 1AB9B 1ABJH 1HB0B 1HJ8A 1D3PB 1PPFE 1GMDF 1GVKB 1OOKB 1YPGH 2AEIH 3VXFH 1TIOA 3S9BA 1TGCA 1C5LH 2O8MA 5J4QA 2GCHG 4JZEH 2RCEA 3BEFB 3GY3A 1F7ZA 1YYY1 2FOEA 1C1QA 1LKBA 2ZPSA 1G37A 1BRAA 4DJZB 1P02A 1ELCA 2SGPE 2RA3A 5EPNA 2G4UA 1XX9A 4Q2KA 3T26A 3BEUA 4DT7B 1EOJA 2ZDVH 2Q6GA 1AI8H 5J4SA 1NY22 1BMMH 1ELVA 3QX5H 2AFQB 3RLWH 4MNYA 1DT2A 1MTSA 2VVVA 1O3GA 3GICB 1Y3UA 1O3IA 2FOAA 1O3OA 1GJAB 5FCRA 1A3BH 1LKAA 2FOBA 1E35B 1XM1A 2C90B 2FIRH 1HAGE 6GCHF 2B0FA 4KTUA 3HGPA 2XRCA 1GMCG 1ZJDA 4WWYA 4LOYH 3TU7H 4BAQB 2FO9A 4AGJA 5DO4H 1HJAC 1ZMLA 1O2HA 1TGTA 2BLOA 4AGKA 2H9TH 2PR3A 2BXTH 1PQ8A 3RXVA 1T8MA 3TH3H 1JWTA 1AWHB 1GBFA 4Y10E 1MTNB 1TGBA 1XUKA 3BTTE 3GYLB 1DSTA 1WCZA 2PWXA 1MAXA 1WV7H 1G3BA 1V2VT 4I7YH 1GHZA 1NESE 4J1YA 2FYRA 5C2ZA 1MU6B 1C5SA 5EQQA 3K2UA 1GBIA 4JZIA 1C1WH 1FI8A 2HNTC 1SPJA 3TVJB 3P8GA 1TX7A 4UE7H 1RIWB 1DY8A 4WJG2 3SNEA 4U01A 4IC6A 3A80A 2XYAA 3ZVAA 1K22H 4O03A 2BB4A 1ZRBA 4JYVH 3U98H 3ZVDA 4HGCA 5HM2A 4BAHB 1SLWB 5LPFA 1MD8A 1LHFH 4I33A 1QJ7B 2VH0A 2P16A 3EA7A 1OWIA 1SLXB 3C1KA 2ZDKA 2BD9A 5GDSH 1KTTB 1SR5C 4GVUA 1C1RA 1IQFA 2BX4A 1LHCH 4B2BA 1AFQB 1QA0A 2QY0B 1LQEA 2A31A 2AS9A 2ZHQH 5E2PA 1W8BH 4KELA 1SFQB 1IHSH 5A8YA 1BUIA 4F4OC 5LGOA 1QA7A 1SQAA 2ZFQH 3RXMA 1O2JA 1L1NA 4NGAH 2RA0A 4NA9H 1ANBA 3RMMH 2ZFRH 1O2NA 1QJ1B 1PQ7A 1C4Y2 3L33A 5I25A 5EOKA 4KTSA 1SGPE 1CBWB 2HALA 2FXRA 4O97A 4A7IB 3D62A 1A0HB 2Z9LA 1SGEE 1SGTA 4R0IA 1O2IA 3BTKE 3ATWA 2EEKA 4CRCA 3A82A 2FZZA 1BMLA 5FBIA 1V2QT 1HAXB 3TJUA 5EXMA 1EAXA 1MBQA 4NWKA 1UK2A 1OWEA 1NS3A 3PLKA 2VVCA 6GCHG 1GCTB 1F0RA 2J92A 1CU1A 1QFKH 3AW0A 1O3EA 4DIHH 1YPEH 1P3CA 5IDKA 2FLBH 3ZZ3A 2B5TB 2D1JA 3HKJB 3A87A 1QQUA 4I8LA 3ATIA 5GXPA 1HAVA 3A8AA 3OTJE 1O35A 1O3DA 1PQ5A 2AERH 2STBE 4BAKB 2DE8A 1SQTA 1TAWA 2WUBA 3M5LA 1ZHPA 3D49H 1SGYE 1GJ4H 2HNTE 2TBSA 5EG4A 1LPKB 3LGTA 2G51A 4BOHA 3GY6A 2FODA 1PPEE 1DDJA 1P09A 1GI3A 2FOMB 1Y5BT 1TQ0B 1S85A 4D9RA 1P2QA 4PROA 4X8UH 1W7XH 2VNTA 1HFDA 5EGMA 5ETXA 1AKSB 1ZYOA 2G5VA 2GCTB 2BMGB 3ATKA 4AFQA 4TWYA 2NWNA 3ZZ6A 4YOIA 2FDAA 4K1EA 2BDBA 1C5QA 4YESB 2BZ6H 5C1XA 1FY4A 4TY6A 2HRVA 3BG8A 2SNVA 1V2PT 3HKIB 2BZAA 5ABWA 2ZP0H 3BV9B 3M36A 2WYGA 2ESTE 5L2ZH 1TBRH 4CH2B 1CA0B 2WV4A 1O2OA 2F9PA 3HATH 1G3EA 2G81E 2OP9A 1PYTC 3MYWA 1TNIA 1HAZB 2GMTC 3MU8A 2ZFFH 1Y59T 2A7CA 1AN1E 4NFFA 1FDPA 2PKSB 2FS9A 3UFAA 1P3EA 3LJJA 1TFXA 1OPHB 1TE0A 3CENA 1KXEA 1Y3XA 2ANWA 2QF3A 2ZCHP 3O8CA 3A88A 2ZU5A 2AMPA 2A0QB 1HLTH 1YCPM 4X6PA 5HYOA 4VGCB 3ZZ8A 4X8TH 1C2HA 3EA9A 2O9QA 1IQJA 1OX1A 1BBRE 1P2KA 5CE1A 1WOFA 3P6ZB 2AGEX 4I31A 2H2ZA 1KDQB 1TWXB 1C1PA 1MCVA 2ZCKP 4ZROA 4ZUHA 4AB9A 1C2DA 2FOGA 1O2RA 1KLTA 4K8YA 2UWLA 3ZVBA 4X2YA 1EZUC 2F9BH 1HXFH 1DSUA 2BLWA 3KQDA 5FBEA 3M37A 1JRSA 2NU2E 1UVSH 2OC8A 2WPKS 4D7FA 1EB1H 2TGTA 2W7SA 3SV2H 4H42U 4IMQA 1A3EH 2D2DA 4YLQH 3SU5A 2BD5A 4MPVA 1BA8B 1HXEH 3RUOA 4UEHH 3QTOH 4X6NA 4SGBE 2JKHA 2ZA5A 1L1JA 1LTOA 3P92A 4Y8ZA 2FWWA 2ZTZA 3MU0A 3LGIA 3CP7A 1XUGA 1C5NH 3A89A 3LGVA 3SU3A 4E06H 1HV7A 1AUJA 1C5MD 1DWDH 1HIAA 4X2XA 3UOUA 4O3TA 1YP9A 3MH6A 3NZIA 3V3MA 3SJOA 1O2ZA 2Z9IA 1SHYA 2BQ6B 5H4IB 4FUIA 4B76A 1G2MA 1GJBB 3LIWA 2ZZUH 3UREA 1UCYE 3UWIA 1O33A 3DA9B 2PGBB 2J2UA 3GCNA 3E3TA 4K1SA 4E7RG 3IG6B 4MLFB 2V3OH 3M35A 3MU5A 1N6YA 2NU0E 2JETC 1O3LA 1C2IA 5L30H 4AOQA 5FHTA 2VWOA 2JH6D 1UTPA 2GX4A 1MTWA 2ZGJA 9ESTA 3QWCH 3TPIZ 5EODA 1MQ6A 5GCHF 3ZVFA 1B7XB 4Y0ZE 4UDWH 3MOCA 4BTUB 3OX7U 4JZ1A 3SI4H 3KF2A 4YO9A 5FCKA 1VJ9U 1QB6A 1Z8GA 4OS5A 3UIRA 2OLGA 1SLUB 3NWUA 4YTAA 4TPYA 2ZU2A 4OGYA 3SJIA 2G5NA 1FAKH 2G52A 2ZO3H 6ESTA 1B0EA 1ZTLA 3SV9A 4D7GA 4TYDA 2H1UA 3SU6A 3GY8A 3UQOA 2A5AA 4YT7H 3FVFB 1KXDA 1LQDB 1PYTD 4X1SU 3ZYDA 1A46H 2ZU4A 2CF9H 1ZSKA 1XXDA 1UJ1A 3E16B 1SC8U 2A32A 3GCOA 1D3TB 4JYUH 3E0PB 2FESH 1V2TT 4D9QA 2RDLA 4AFUA 4AN7A 2ZC9H 3AW1A 3S0NA 1K1OA 3MHWU 1EZSC 2OBQA 1A5IA 2Y5GA 1C1NA 3FP8E 3VB4A 1H9HE 3G01A 1GBMA 1MZDA 4E05H 1GBBA 2OTVA 3P8NA 4A1VA 1K1LA 2VIPA 3ZZ4A 1BT7A 2FLRH 1O36A 2PLXA 3F9GA 4YOGA 3TH2H 2A1DB 4IMZA 1K1NA 3UTUH 2Q1JA 1GHBG 4E7NA 4UD9H 4B1TA 3PMAB 2A5KA 2QXIA 3LU9B 1AB9C 2PHBA 3LGYA 3QTVH 4ABAA 1W0YH 3UR6A 2H9EH 3SV6A 1ZGVA 4KKDA 3T5FH 1QL7A 2P93A 1KTSB 1TNGA 1GHYH 4ZHLU 1T8NA 1TRMA 1V2WT 1FY1A 1F5KU 2OQ5A 1UTOA 1P57B 4A1XA 1M9UA 3RC5A 2ZU3A 4LK4A 2TGAA 3KQCA 1LVMA 1IQMA 1GGDC 1SFIA 1GJCB 6CHAC 1MKWK 1ELBA 1CT2E 1GBEA 2Z9KA 1ZOMA 2QYIA 2HOBA 2BVXH 3SQEE 2BM2A 3VGCB 1HAVB 1KLJH 1TOMH 1YCPK 5GCHG 2H9HA 2ALPA 1ZLRA 4BXWA 2PW8H 2CN0H 2ZQ1A 1C2KA 1W3CA 1MU8B 1T8OA 4XBBA 1BTHH 1FN6A 5L6NH 1S6FA 2Z9JA 1DLEA 4INKA 3E8LA 1NFUA 4K2YA 1GI5A 3E90B 4Q7YA 3ESTA 4BTTB 2QA9E 2HVXA 1CGHA 3M7TA 4DVAU 3ODDA 3SV8A 1GBAA 4A1TA 1QL8A 3Q76A 3SHAH 2P95A 3LGWA 8GCHG 4Y6DA 3ZVCA 1XVOA 2P8OB 4WMFA 2VIDA 5CHAB 3TK5A 2AGGX 2BY7X 1O3KA 4AB8A 2Z3DA 1C5TA 1OWKA 5PTPA 1SGQE 4Q80A 1AVGH 5EW2H 1AHTH 9LPRA 1TYNA 2H6MA 4Y76A 1EPTA 4IBLH 1CGJE 4GAWA 3M5MA 3NXPA 3SNDA 3BG4B 1GHWH 1WTGH 2SGFE 1EOLA 1LMWB 4A6LA 3RMNH 3HGNA 3M61U 3ZYEA 1RIWC 1FXYA 2BDIA 2CHAB 1C5ZB 2BD4A 1SBWA 1W12U 1ELAA 1L4DA 1FV9A 2W7UA 1MUEB 2O8TA 4BAOB 5JB9S 2HGTH 1EP5A 1NRSH 2TGPZ 1EXFA 4UFFH 2BHGA 2XBWA 2VVUA 1ESBA 1O3PB 2ZCLP 1K2I1 1TA2A 2ZG0H 4XFQA 1P04A 3BIUH 2FYQA 4YZUA 4FU7A 1SHHB 1FMGA 1A4WH 3RXUA 1AFQC 3SORA 1AMHA 4UFGH 4BANB 1SGRE 1GI9B 2YOLA 4X1RU 2FTMA 1F5RA 3RXTA 1O2XA 4O3UA 4Q7XA 2TPIZ 3O8BA 2KAIB 4UFEH 5DGJA 1G9IE 3A7XA 3JZ1B 1OP2A 3MNCA 3OY5U 1O2YA 1CBWC 4NZQA 1NO9H 1O5DH 2XTTB 1L2EA 1ELGA 1FUJA 1NN6A 1BBRH 2W5EA 1AZ8A 5FX5A 5EPYA 4MPWA 2WPHS 1C2LA 3RXSA 2UWOA 1T4UH 1O3NA 1IAUA 3KN2A 1ELEE 4QT8C 1O34A 4JK6A 1SVPA 3GOVB 1YPKH 1AE8H 1K1MA 1V2NT 3RXEA 1VCQA 5DP4A 5T6FA 4X8VH 1DWCH 1GCTC 4K60A 5JBBS 1C5OH 2I6QA 3NUMA 3M7QA 5AFZH 2D26C 5GIBA 2GV6A 1WU1A 5DP6A 5K0HA 4GUXA 5HXFA 1HIAB 5ESTE 2BD7A 1YBWA 2ANKH 4UFDH 1JOUB 4DY7B 1Z6JH 3LJOA 3EAJA 1XUJA 3SGAE 3TNTA 1OXGA 3PLBA 1O3AA 1UTMA 1YPJH 2WV5A 2BY8X 1O2GH 2XXLA 4GHTA 4UONA 2Y5HA 5GJ4B 1TBZH 1FJSA 1WAYB 5LH8A 2BLVA 3GY5A 2NU3E 4NSVA 2BYAX 1BTPA 2V3HH 5BRRE 1MZAA 1V2KT 2VINA 2QF0A 2BD2A 2C8YB 1SLVB 1WUNH 3ATMA 4OS1A 4DGJA 2FI5E 1QRXA 4M7GA 3QN7A 2Y82A 1C9TA 2J95A 3L6PA 2GCTC 1BRCE 4RKOB 1O3BA 1UCYH 2QXGA 5E8EH 2VIOA 4KGAA 4BAMB 1INCA 3M3SA 1RXPA 4OS7A 1N1LA 3SUDA 1LCYA 1XKBC 1SI5H 1C5UA 3VB7A 4TWWA 3UWJH 1NM6A 3E1XB 1P9UA 2FS8A 4CRFA 1CA0C 3EQ0H 1UTKA 1BHXF 2QC2A 1J9CH 2XNIA 4B74A 6LPRA 3ZZAA 1J16A 1VGCC 2A2XH 3HPTB 1T7CA 2QN5T 1XUHA 4CBNA 1TONA 2PSXA 1O2SA 1SMFE 3A7ZA 1BHXB 1GVLA 3P17H 3BN9A 1EJNA 3SN8A 1K21H 1G30B 3GCHC 1RTLA 3MMGA 1KXCA 3HK6B 1S81A 4Y11E 4WXIA 1DX5M 2ZU1A 2BVRH 1HAPH 4MVNA 1C2GA 1JXPA 3Q3YA 4VGCC 3V0XA 1OKXA 3U8RH 1YKTA 1GDNA 1O2MA 4MNXA 1GBKA 3EGKH 2BDYA 2J94A 5HMAA 1D3QB 4CRBA 1TNKA 1F2SE 1G3DA 1ZSLA 1HCGA 2ZTXA 2VU8E 5JPMH 1OP0A 1TALA 3KGPA 3OSYA 2TRMA 1VITH 3KIDU 4ABDA 1MBMA 2FI4E 3IITA 2B7DH 2F91A 1SSXA 4ABJA 3BTHE 2SGDE 2F9NA 1BCUH 2PKAA 3SU0A 1ZTKA 2AIQA 1TX6A 1Y8TA 5CMXH 2W26A 1TB6H 3PO1B 1PPBH 2ALVA 3PTBA 1P12E 1GBDA 1Z71A 1O2TA 2ZDNA 3K6ZA 3ITIA 1C5XB 1CGIE 1UTNA 1GPZA 1VR1H 3QZRA 5FX6A 2GTBA 5DP8A 1UO6A 1ETRH 4X2VA 2B8OH 4NA8A 3EDXB 1BJUA 2XBVA 2OUAA 4FUEA 1TLDA 4B2AA 2ANMH 4XDEA 2IPHA 3EE0B 1ELTA 1C5RA 5TCAA 2BD3A 2IJOB 2J9NA 1BMNH 3A7WA 1MAYA 2QAAA 4MQAA 2ZWLH 1DE7H 1HNEE 4Z0KA 2PTNA 3I29A 3GY2A 4K8BA 1NU7B 2BY6X 3MH7A 2Y7ZA 2GDDA 3PB1E 3TK9A 3A81A 1K28D 2VWMA 1RD3B 4CHAB 3M3TA 4AYVB 4OS2A 1AE5A 1BQYA 1P11E 4FUCA 3ZVEA 2PUQH 1ELFA 2V6NA 3FANA 1E37B 2A5IA 1Q3XA 2BOKA 4CREA 1HBTH 1Y3YA 4WF8A 5C5NA 2OC0A 3M5OA 3RU4T 1C1VH 4IC5A 1EAIA 3QUMP 3GDSA 3OY6U 1IQGA 5A8ZA 4WH6A 4JCNA 1D6RA 1TNJA 3MU4A 4BNRA 1RS0A 4H6TA 3V7TA 3SQHE 2XCFA 3T2NA 1LDTT 4Q7ZA 1QJ6B 3ATLA 3LPRA 1EATA 1ZPBA 1AGJA 1BRUP 3RC6A 1G36A 5F03A 1EPTB 4OS4A 1SL3A 3VB6A 1O5FH 3RXQA 2PV9B 4GPGA 2KAIA 2WPMS 3AVZA 1GWAA 5IYTA 3BTGE 1EJAA 1ACBE 4ISIH 3PTNA 1DM4B 1BTYA 1Z8IB 4WMEA 3VPKA 1HAYB 2JH5D 3QK1A 1P8VC 2BDGA 3B8JA 1CT0E 4ABGA 1PPZA 3BF6H 3SV7A 5DKMA 2XBXA 1DXWA 2FOHA 1U6QA 1IQLA 2ZPRA 3F1SB 1O2PA 3TGKE 2M5TA 1J8AA 2THFB 2YNBA 5T6DA 1GDUA 1FY3A 5AVDA 4A5TS 3S9CA 4ABFA 2SGQE 1F0TA 1E38B 2FX4A 1IQHA 2Y81A 1QGFA 2V0BA 5FPTA 5C20A 5F6MA 2H5DA 3DHKH 3QDZB 3T27A 3V13A 3P8OA 1NRNH 2PTCE 2QIQA 3LKWA 1UVUH 2XC5A 4I8HA 3ZZBA 1XMNB 1CSOE 1GJDB 5EQRA 3SGQE 1GHBF 1NZQH 1ZRKA 4I8GA 2VH6A 1HGTH 1EZXC 5E0JA 1LHDH 1VCPA 4DG4A 3AASA 1JMOH 3RXOA 3TGJE 3RC4A 3MNBA 3U69H 4WVPE 4ZKSU 1C2EA 4R8TB 1RTKA 1L4ZA 4D8NA 4K69A 4YLUA 7GCHF 4NA7A 1A7SA 1NPMA 1P05A 3UR9A 2RG3A 1OWDA 4Z6AH 3U1IB 5EQSA 2O8LA 1MKXK
chains in the Genus database with same CATH superfamily
3RXBA 3U8TH 4F55A 4M9FA 1Z8JB 1O38A 1O3MA 1DANH 3AK5A 4JYTA 1PFXC 5C1UA 4NG9H 1LHEH 2EQNA 2UUJB 3B23B 1YPLH 1MTUA 3STIA 3NCLA 2F3CE 4TPIZ 3MO3A 1TABE 3SU1A 3VGCC 1SB1H 2EI6A 1SOZA 1GI0A 5B6OA 3U1JB 3SU4A 1S0RA 3EA8A 3PRDA 4NSYA 1Z8RA 3ENSB 3TJNA 3ODFA 3PWCA 1MD7A 1H1BA 4ISLA 1C5WB 4CH8B 1EQ9A 1UVTH 4AG1A 4GHQA 1BTXA 1ETTH 2AMQA 1QCPA 8GCHF 5JBCS 1NFYA 1UVPA 4H6SB 7KMEH 5A09A 7ESTE 1P03A 3W95A 1Z1IA 2VWNA 2P8OC 3DD2H 2ASUB 5CHAC 4X6OA 1QNJA 3TJOA 3PV4A 3BTFE 5EU8A 1NT1A 2CMYA 1FAXA 1VITF 3F68H 2NU1E 1QTFA 2HLCA 1ZSJA 1GI4A 5A2MH 3O8RA 1J15A 4NCYA 1V2JT 5HIZA 4MNWA 5C67A 4MG3A 3U28C 1AVXA 1QRWA 4J2YB 4ZHAA 1OP8A 4K3JA 1GL0E 1O30A 1OS8A 1O2UA 1C1UH 3GCTG 1FIZA 5A0CA 1C2MA 2J98B 1AZZA 2VGCB 3MO9A 1KXBA 1BBRK 1H4WA 3MFJA 1H8IH 3A85A 2XNDD 3BTEE 3SO3A 1TA6A 1F5LA 1F92A 3A83A 3PLPA 5C5OA 3KCGH 3KQBA 1F0SA 4XD7D 2SNWA 2EI7A 1NRPH 4B75A 7GCHG 2A7HA 2J34A 1FN8A 1YPMH 3AAVA 3I77A 1GBTA 3F6UH 1QBOA 4JK5A 3B9FH 3SBKA 3KL6A 3LGUA 2STAE 5GPIB 5EJLA 4NIVA 3SJ9A 1ABIH 4I8JA 4X1PU 5FXLA 4ABEA 1FQ3A 1MMJN 4MNVA 1J14A 3LC5A 1XXFA 1TPOA 1K1PA 3H5CB 1SOTA 3O8DA 3ZZ5A 1HYLA 3RXDA 1AD8H 1THPB 3UUZA 2OQUA 1BITA 2M2AA 2QXJA 5AHGH 1WBGB 1N8OB 2JETB 5SGAE 1EAUA 2PSYA 2ZGXH 5A0BA 1BOQA 3GY4A 8KME2 3P95A 3R0FA 2VIWA 1C4V2 1BMAA 1KIGH 1ESAA 3SHCH 2PKAB 1D9IA 1QRZA 2WPLS 3IWMA 3S69A 5C3NA 3BSQA 5FPSA 3E6PH 2BLQA 1H8DH 4X8SH 5T1VA 1V2UT 3ZV8A 2GZ7A 2F43B 1PQAA 3SW2B 3QGNB 1UMAH 2BXUH 4JZDH 1W13U 1P2IA 1TRYA 2Y6TA 2V35A 3RXKA 1BJVA 2GT7A 2QV1A 4Y7AA 1THRH 4Y0YE 1G32B 4OGXA 1W14U 1GI7B 1MTNC 1UCYK 2TIOA 1SQOA 4FUFA 5K7RA 4IGDA 1YPHC 1K1IA 1ZTJA 3SOSA 3T29A 1VJAU 3SUEA 3QLPH 2R2WU 2PFEA 2KFWA 3F9FA 3RLYH 4GSOA 1VITG 3GYMA 3URCA 1AIXH 1O5EH 1WDIA 3JZ2B 2LNCA 4WY3A 1IOEA 1HJ9A 1Z7KA 3RXFA 1DY9A 4YXWD 1DICA 2G8TA 2XC0A 5DP3A 3MWIU 4JMYA 1LHGH 1YLDA 2ZGHA 2WINI 3VG8A 4HTCH 4B71A 4IW4E 3M3VA 3TH4H 1S0QA 4FU8A 5F8TA 3N99A 1G3CA 3OEHD 1GI6A 3LH3A 3SUGA 1GBCA 1QQ4A 1RFNA 3H7TA 1A61H 2AGIX 2Z9GA 1A5GH 2KCPA 5HM9A 1BZXE 3SGBE 2OINA 4MDSA 1ZMJA 2VIQA 1C5PA 2C3SA 2A2QH 1QURH 2A4GA 2FOCA 4ZKNU 5DPAA 3OYPA 1E0FD 3RMLH 1S82A 1C1TA 5E2OA 1MTVA 1SGCA 1DXPA 2IJD1 3T28A 1IHTH 3GDVA 2P3UB 1P2OA 5E0GA 3L3TA 2ILNA 1FY8E 3N7EA 2ZHWH 1ANDA 1GGDB 4RSPA 3UPEA 3F2HA 1EKBB 4NIYA 3DT0H 1ZMNA 2GD4B 3I78A 4FUDA 6CHAB 1QIXB 1AY6H 2CF8H 2ZFPH 5T6GA 2OBOA 3PMBB 1FLEE 1ZPZA 1WXRA 2HPQH 4CR9A 1UTQA 1ARBA 1GDQA 1GVZA 2P59A 4U2WA 1E1RD 2XC4A 3QO6A 1ARCA 1GG6B 5I46H 2BX3A 2BDHA 1YF4A 4DT4A 3H09A 4DW2U 2XCNA 3LONA 1L1GA 3BTWE 5GNDA 5AFYH 1AO5A 1ELDE 3PYHA 1E34B 4AFSA 1YPHE 5DG6A 2CXVA 3PMJA 3ZZCA 1UK3A 3NK8A 2G55A 3RP2A 1O3CA 2ZI2H 2QXHA 5A8XA 4I8KA 3SNCA 1TRNA 2A4QA 2EC9H 2AH4X 4NFEA 5JBTA 1TMTH 3PO1C 2R0LA 1HPGA 3TGIE 1DS2E 1MKWH 4ZH8A 2ZGCA 1JRTA 1LVYA 1ESTA 1L0ZA 3A7TA 1DUEA 1LVOA 2V3MA 1YCPH 1S6HA 4Y71A 4MPXA 2Y80A 3P8FA 5JB8S 2BDAA 1JIMA 2ZDMA 1HRTH 5ESBA 1BIOA 1P2MA 2FX6A 3A84A 2ZIQH 1O2KA 1V2RT 1IQIA 1ID5H 1OWJA 1DLKB 2C93B 3RMOH 1UHBA 1Z6EA 1O5GH 2ZQ2A 2WYJA 4AORA 2FOFA 2OXSA 4MPUA 1Z1JA 3W94A 4A92A 1EFRD 2BTCE 5L2YH 4CHAC 4P00A 3TJVA 3DFLA 1GMDG 4KP0A 1VZQH 4CRDA 4ISNA 2Z7FE 3MI4A 1V2LT 4HI3A 3GISB 1O3FA 1FONA 2PKSC 1CA8B 3SI3H 3RXLA 1UVOA 1FNIA 3KEEA 3BTME 1K0HA 4FUJA 1CHOF 4ABBA 1O2LA 4LZ1H 3KNXA 4RKJB 1X7AC 1TNHA 3VFEA 1ZR0A 1IQEA 2W6JD 4RT1A 3LOXA 1TGSZ 5EJZA 2GV7A 2C8XB 1N6XA 1IQKA 4DIIH 2Q6DA 1PPHE 4DOQA 3MNXA 1YGCH 1O3HA 1DITH 2ZDLA 2H5CA 2FP7B 1WQVH 3LT3A 4FETA 3U8OH 1S6LA 3RXRA 3URDA 1EPTC 1OSSA 3MH5A 2YMSB 1W10U 2UUYA 2C4FH 3PM3A 1FZZA 3R3GB 2RFKC 1HJAB 4TY7A 2ZECA 1NU9A 2I6SA 1KY9A 1SGFG 2D8WA 1KYNA 1HDTH 2K0QA 5JYIA 2FI3E 3PRBA 1O3JA 1A2CH 3FKSD 3MH4A 3A7YA 5C1YA 2AYWA 4LZ4B 1NBME 3V12A 1TGNA 1GJ7B 1JBUH 2ODPA 2WUCA 3ZV9A 1QR3E 4CBOA 1NRRH 3DFJA 1RRKA 2KCAA 3D65E 3FP6E 4AYYB 2HNTF 1W11U 2GZ8A 1BRBE 2FMJA 2UWPA 2VBCA 1EUFA 3MNSA 4OS6A 2HPPH 5A0AE 5EW1H 1HAOH 2OD3B 2JJ1D 4Y8XA 3CS0A 4D76A 1GJ6A 4DCDA 2Y7XA 3Q77A 1AWFH 2IN2A 3RDZA 4P02A 4FUGA 4INHA 1K1JA 3GS9A 1S84A 1P0SH 4FVBA 2Z6BD 2ZFSA 5DP9A 2FM2A 1VCWA 2SGAA 1C1MA 5G4BA 2QCYA 1V6DA 3DUXH 1C1OA 1NFXA 4HFPB 3SU2A 2VWLA 1FPHH 2AMDA 2O8WA 1BMFD 1GJ5H 2XW9A 5F8XA 4I32A 3SNAA 2EY4C 3FP7E 1EZQA 1HUTH 1GJ8B 3SYJA 3PWBA 5DK1A 1GBLA 4DURA 5BPEA 3QZQA 3FZDA 4Y7BA 3TLOA 2GKVE 4X6MA 4ISOA 5LPRA 2XWBI 1A0JA 1EJMA 1B0FA 4THNH 3OTPA 1W7GH 5GWZA 3F3BA 1TMBH 5T3HA 1HAIH 1QL9A 2NU4E 2K1QA 2R2MB 1A0LA 2CGAA 4K5ZA 1VGCB 2A4RA 3S7KB 2LELA 3SJ8A 5HGGA 1CHOG 2ZFTA 1NBMD 2GGVB 4X0WU 3ZZ9A 8LPRA 1DFPA 3VXEH 3WY8A 1P2NA 1C4U2 3GY7A 4CRGA 1Q2WA 1QHRB 2FEQH 5KGOA 1V3XA 2ZF0H 3E0NB 1J17T 3GCHB 3RXHA 2O8UA 2BVSH 5EXLA 5JBAS 2UUFB 2HVYB 1Y5UT 1DVAH 2OCVB 1A1RA 1BTZA 1KMHB 3RXIA 1LO6A 4AG2A 1H9IE 4AZ2B 1P2JA 4SGAE 4ABHA 4RN6A 1UK4A 1T4VH 2F9VA 1O31A 2R3YA 3UNQA 2TGDA 1SGIB 1Y3VA 3OU0A 1MCTA 3FAOA 4ZXYH 1SGNE 4FVDA 1KSNA 4ZXXH 2P94A 3LC3A 4WMDA 3RXGA 2QGRA 4ESTE 2JH0D 1FY5A 1O2WA 2GP9B 3BTDE 1PJPA 2YNAA 3SZNA 1C2JA 3DSPA 3QGJA 4AC9A 4WH8A 1O32A 5AF9H 1O5BB 1ANCA 1WSSH 1OWHA 1LPZB 1EAWA 2C8WB 1AVWA 1O5AB 4YT6H 1DWEH 3OE7D 1P06A 1DWBH 1T8LA 1B5GH 1SG8B 2R9PA 3UOPA 4LXBH 1GBHA 1T31A 3GCTF 2CV3A 1WTHD 1TQ7B 1SGFA 1KLIH 1ZZZA 1ZHMA 1GJ9B 1NROH 1O2VA 1THSH 4U30A 3M7UA 3RU4E 3A8BA 1V2MT 3VB3A 2J38A 1TPAE 1NTPA 3E91A 2BQWB 3RXJA 4IS5A 1QB1A 2BY9X 4IN1A 1JIRA 2VGCC 1GCDA 3UY9A 4RI0A 2BD8A 4B73A 2F4LA 1O39A 2Q6FA 2OC1A 3BTQE 2HLDD 2Z3EA 3MTYA 3VB5A 3UNSA 4NZLA 1XKAC 5TJXA 2Z3CA 3Q3XA 2J4IA 5EXNA 1CHGA 3TIUA 1RJXB 3UNRA 1AUTC 2GMTB 4WXVA 1TPPA 1QY6A 2LPRA 1UTLM 3STJA 3VEQB 1QB9A 4X1NU 1N8OC 1EB2A 1V2ST 4MTBA 2GT8A 1ZJKA 1GI8B 3PV5A 4ISHH 1SGDE 3LH1A 4CR5A 3AAUA 3EYDA 1EX3A 4B2CA 2ZDAH 2A4OA 4AX9H 2PGQB 4XE4A 1XUIA 1RTFB 4XBDA 1GMHF 4O9VA 1ZGIA 3RXPA 4BTIB 1V2OT 1YY3A 1P10A 1O0DH 2DUCA 2GZ9A 2SFAA 2F9UA 3Q3KA 3T25A 3H7OA 1O5CB 2P3FH 1C5VA 1ETSH 3TNSA 1MH0A 2P3TB 1GI1A 2ULLA 2FTLE 4XBCA 5DP5A 1QBVH 2WPIS 3RU4D 1UTJA 3RM0H 3RM2H 1XVMA 1WYKA 3KHVA 1KXFA 2ODQA 3GDUA 1DUAA 5B6LA 1ZPCA 3A8CA 1C9PA 1D6WA 1S5SA 3NKKA 1GL1A 4ZKRU 3S7HB 2PUXB 1O37A 1C1SA 3ZVGA 1UHBB 1YC0A 2BOHB 4K1TA 5DP7A 1YM0A 4ABIA 3SNBA 2ZTYA 3BEIB 4FUBA 5FAHA 3SJKA 2XWAA 1YLCA 3BG4C 3WWFA 3F9HA 4GCHF 2R0KA 5E0HA 4IN2A 1OYQA 1EASA 3N7OA 3PMHB 2CHAC 4ZMAH 1GHAF 1TNLA 1CT4E 1WQSA 4FXGH 2IOTA 4F49A 4Y79A 3ZZDA 1BTUA 1KXAA 2ZEBA 4B6FA 3T62A 2ZHDA 4INLA 5DJ7A 4ASHA 5JDUB 3D23A 1E1QD 1PPCE 1Q31A 2GVFA 3KYFA 4Q4LA 3NRLA 2VJ1A 2W3IA 2ZGBH 3P70B 2OC7A 4Q63A 4U32A 3S9AA 1ORFA 1FPCH 1P9SA 1GHVH 1Y3WA 5FPYA 1RGQA 2GCHF 3MU1A 3MQKC 1AQ7A 5LPEA 1Y5AT 1GI2A 4YOJA 1CVWH 2ZNKH 3A86A 4ZKOU 3A7VA 4XSKU 2VIVA 2CJIA 1LVBA 1W2KH 3K6YA 1GBJA 1S83A 1TMUH 1CO7E 3TITA 1AKSA 1CQQA 2F9OA 4Y8YA 5TCCA 3BIVH 1LPGB 3RXCA 2FPZA 1E36B 2GDEH 3SUFA 2GJGA 3CS7A 4H4FA 1BTWA 1BB0B 3HK3B 2W3KA 1NRQH 4NIWA 1T32A 4NIXA 2BDCA 1TBQH 3M5NA 2EA3A 3F9EA 4GLYA 1DPOA 1D3DB 1GMHG 3KQEA 3PROA 2G00A 1IQNA 2A7JA 1TPSA 1O2QA 4FUHA 2Y5FA 1ZHRA 1XUFA 2R3UA 1GG6C 1BDAA 1GMCF 2HWLB 4FU9A 1PPGE 2EI8A 1ANEA 3ZZ7A 2G4TA 3C27B 3NPSA 1C5YB 1MKXH 4HZHA 1W0ZU 1SKYE 2ANYA 1QBNA 3TK6A 2AIPA 1K9OE 2SGEE 2WPJS 2KCYA 1HAHH 2BQ7B 3LDXH 2BY5X 4CRAA 8ESTE 1P01A 2A45B 4FOUC 4ZAEA 2Z94A 7LPRA 1E79D 2C8ZB 1GHXH 4ZHMU 1A5HA 3K65B 1CE5A 3FFGA 3FZZA 4AFZA 4YM9A 1NFWA 1TX8A 3A8DA 1MQ5A 1C2FA 4JZFH 1AU8A 3MO6A 1NC6A 1H9LB 2VB0A 1D4PB 2DE9A 4GCHG 2XBYA 4NWLA 1KDQA 2ZHFH 2B9LA 4XOJA 1GHAG 3UQVA 4X1QU 2ZHEH 3K9XB 2UUKB 2ODYB 2ZKSA 1G2LA 3ELAH 1FIWA 3RXAA 1W0JD 5F8ZA 3Q00A 4KTCA 2ZPQA 4X2WA 3U9AH 1TOCB 1AFEH 1DOJA 1EP6A 1OYTH 2K8IA 1F0UA 2F83A 4BXSA 1AB9B 1ABJH 1HB0B 1HJ8A 3DSGA 1D3PB 1PPFE 1GMDF 1GVKB 1OOKB 1YPGH 2AEIH 3VXFH 1TIOA 3S9BA 1TGCA 1C5LH 2KM0A 2O8MA 5J4QA 2GCHG 4JZEH 2RCEA 3BEFB 3GY3A 1F7ZA 1YYY1 2FOEA 1C1QA 1LKBA 2XOKD 2ZPSA 1G37A 1BRAA 4DJZB 2QF5A 1P02A 1ELCA 2SGPE 2RA3A 5EPNA 2G4UA 1XX9A 4Q2KA 3T26A 3BEUA 4DT7B 1EOJA 2ZDVH 2Q6GA 1AI8H 5J4SA 1NY22 1BMMH 1ELVA 3QX5H 2AFQB 3RLWH 4MNYA 1DT2A 1MTSA 4B6EA 2VVVA 2JIZD 1O3GA 1Y3UA 1O3IA 2FOAA 3GICB 1O3OA 1GJAB 5FCRA 1A3BH 1LKAA 2FOBA 1E35B 1XM1A 2C90B 2FIRH 1HAGE 6GCHF 2B0FA 4KTUA 3HGPA 2XRCA 1GMCG 1ZJDA 4WWYA 2QF4A 4LOYH 3TU7H 4BAQB 2FO9A 4AGJA 5DO4H 1HJAC 1ZMLA 1O2HA 1TGTA 2BLOA 4AGKA 2H9TH 2PR3A 2BXTH 1PQ8A 2IPQX 3RXVA 1T8MA 3TH3H 1JWTA 1AWHB 1GBFA 4Y10E 1MTNB 1TGBA 1XUKA 3BTTE 3GYLB 1DSTA 1WCZA 2PWXA 1MAXA 1WV7H 1G3BA 1V2VT 4I7YH 1GHZA 2J97A 1NESE 4J1YA 2FYRA 5C2ZA 1MU6B 1C5SA 5EQQA 3K2UA 5KEDA 1GBIA 1YLNA 4JZIA 1C1WH 1FI8A 2HNTC 1SPJA 3TVJB 5DN6D 3P8GA 1TX7A 4UE7H 1RIWB 1DY8A 3EE7A 4WJG2 3SNEA 4U01A 4IC6A 3A80A 2XYAA 3ZVAA 4Z1MD 1K22H 4O03A 2BB4A 1ZRBA 4JYVH 3U98H 3ZVDA 4HGCA 5HM2A 4BAHB 1SLWB 5LPFA 1MD8A 1LHFH 1UW7A 4I33A 1QJ7B 2VH0A 2P16A 3EA7A 1OWIA 1SLXB 3C1KA 2ZDKA 2BD9A 5GDSH 1KTTB 1SR5C 4GVUA 1C1RA 1IQFA 2BX4A 1LHCH 4B2BA 1AFQB 1MABB 1QA0A 2QY0B 1LQEA 2A31A 2AS9A 2ZHQH 5E2PA 1W8BH 4KELA 1SFQB 1IHSH 5A8YA 1BUIA 4F4OC 5LGOA 1QA7A 1SQAA 2ZFQH 3RXMA 4I86A 1O2JA 1L1NA 4NGAH 2RA0A 4NA9H 1ANBA 3RMMH 2ZFRH 1O2NA 1QJ1B 1PQ7A 1C4Y2 3L33A 5I25A 5EOKA 4KTSA 1SGPE 1CBWB 2HALA 2FXRA 2W6ID 4O97A 4A7IB 3D62A 1A0HB 2Z9LA 1SGEE 1SGTA 4R0IA 1O2IA 3BTKE 3ATWA 2EEKA 4CRCA 3A82A 2FZZA 1BMLA 5FBIA 3WW7A 1V2QT 1HAXB 2KX4A 3TJUA 5EXMA 1EAXA 1MBQA 4NWKA 1UK2A 1OWEA 1NS3A 3PLKA 2VVCA 6GCHG 1GCTB 1F0RA 2J92A 1CU1A 1QFKH 3AW0A 1O3EA 4DIHH 1YPEH 1P3CA 5IDKA 2FLBH 3ZZ3A 2B5TB 2D1JA 4ACBA 3HKJB 3A87A 1QQUA 4I8LA 3ATIA 5GXPA 1HAVA 3A8AA 3OTJE 1O35A 1O3DA 1PQ5A 2AERH 2STBE 4BAKB 2DE8A 1SQTA 1TAWA 2WUBA 3M5LA 1ZHPA 3D49H 1SGYE 1GJ4H 2HNTE 2TBSA 5EG4A 1LPKB 3LGTA 2G51A 4BOHA 3GY6A 2FODA 2JJ2D 1PPEE 1DDJA 1P09A 1GI3A 2FOMB 1Y5BT 1TQ0B 1S85A 4D9RA 1P2QA 4PROA 4X8UH 1W7XH 2VNTA 1HFDA 5EGMA 2OK5A 5ETXA 1AKSB 1ZYOA 2G5VA 2GCTB 2BMGB 3ATKA 4AFQA 4TWYA 2NWNA 3ZZ6A 4YOIA 2FDAA 4K1EA 2BDBA 1C5QA 4YESB 2BZ6H 5C1XA 1FY4A 4TY6A 2HRVA 3BG8A 2SNVA 1V2PT 3HKIB 2BZAA 5ABWA 2ZP0H 3BV9B 3M36A 2WYGA 2ESTE 5L2ZH 1TBRH 4CH2B 1CA0B 2WV4A 4TSFD 1O2OA 2F9PA 3HATH 1G3EA 2G81E 2OP9A 1PYTC 3MYWA 1TNIA 1HAZB 2GMTC 3MU8A 2ZFFH 1Y59T 2A7CA 1AN1E 4NFFA 1FDPA 2PKSB 2FS9A 3UFAA 1P3EA 3LJJA 1TFXA 1OPHB 3DCLA 1TE0A 3CENA 1KXEA 1Y3XA 2ANWA 2QF3A 2ZCHP 3O8CA 3A88A 2ZU5A 2AMPA 2A0QB 1HLTH 1YCPM 4X6PA 5HYOA 4VGCB 3ZZ8A 4X8TH 1C2HA 3EA9A 2O9QA 1IQJA 5DSFA 1OX1A 1BBRE 1P2KA 5CE1A 1WOFA 3P6ZB 2AGEX 4I31A 2H2ZA 1KDQB 1TWXB 1C1PA 1MCVA 2ZCKP 4ZROA 4ZUHA 4AB9A 1C2DA 2FOGA 1O2RA 1KLTA 4K8YA 2UWLA 3ZVBA 4X2YA 1EZUC 5C0TA 2F9BH 1HXFH 1DSUA 2BLWA 3KQDA 5FBEA 3M37A 1JRSA 2NU2E 1UVSH 2OC8A 2WPKS 4D7FA 1EB1H 2TGTA 2W7SA 3SV2H 4H42U 4IMQA 1A3EH 2D2DA 2WHXA 4YLQH 3SU5A 2BD5A 4MPVA 1BA8B 1HXEH 3RUOA 4UEHH 3QTOH 4X6NA 4SGBE 2JKHA 2ZA5A 1L1JA 1LTOA 3P92A 4Y8ZA 2FWWA 2ZTZA 3MU0A 3LGIA 3CP7A 1XUGA 1C5NH 3A89A 3LGVA 3SU3A 5EJ1A 4E06H 1HV7A 1AUJA 1C5MD 1DWDH 1HIAA 4X2XA 3UOUA 4ASUD 3F0OA 4O3TA 1YP9A 3PV2A 3MH6A 3NZIA 3V3MA 3SJOA 1O2ZA 2Z9IA 3UAIC 1SHYA 2BQ6B 5H4IB 4FUIA 4B76A 1G2MA 1GJBB 3LIWA 2ZZUH 3UREA 1UCYE 3UWIA 1O33A 4ZCNA 3DA9B 2PGBB 2J2UA 3GCNA 3E3TA 4K1SA 4E7RG 3IG6B 2KZ4A 4MLFB 2V3OH 3M35A 3MU5A 1N6YA 2NU0E 2JETC 1O3LA 1C2IA 5L30H 2L74A 4AOQA 5FHTA 2VWOA 4RT0A 2JH6D 1UTPA 2GX4A 1MTWA 2ZGJA 9ESTA 3QWCH 3TPIZ 5EODA 5C94A 1MQ6A 5GCHF 3ZVFA 1B7XB 4Y0ZE 4UDWH 3MOCA 4BTUB 3OX7U 4JZ1A 3SI4H 3KF2A 4YO9A 5FCKA 1VJ9U 1QB6A 1Z8GA 4OS5A 1OHHD 3UIRA 2OLGA 1SLUB 3NWUA 4YTAA 4TPYA 2ZU2A 4OGYA 3SJIA 3DSOA 2G5NA 1FAKH 2G52A 2ZO3H 6ESTA 1B0EA 1ZTLA 3SV9A 4D7GA 4TYDA 2H1UA 3SU6A 3GY8A 3UQOA 2A5AA 4YT7H 2JDID 3FVFB 1KXDA 1LQDB 1PYTD 4X1SU 3ZYDA 1A46H 2WV9A 2ZU4A 2KCOA 2CF9H 1ZSKA 1XXDA 1UJ1A 3E16B 1SC8U 2A32A 4ACAA 3GCOA 1D3TB 4JYUH 3E0PB 2FESH 1V2TT 4D9QA 2RDLA 4AFUA 4AN7A 2ZC9H 3AW1A 3S0NA 1K1OA 3MHWU 1EZSC 2OBQA 1A5IA 2Y5GA 1C1NA 3FP8E 3VB4A 1H9HE 1W0KD 3G01A 1GBMA 1MZDA 4E05H 1GBBA 2OTVA 3P8NA 4A1VA 1K1LA 2VIPA 3ZZ4A 1BT7A 2FLRH 1O36A 2PLXA 3F9GA 4YOGA 3TH2H 2A1DB 4IMZA 1K1NA 3UTUH 2Q1JA 1GHBG 4E7NA 4UD9H 4B1TA 3PMAB 2A5KA 2QXIA 3LU9B 1AB9C 2PHBA 3LGYA 3QTVH 4ABAA 1W0YH 3UR6A 2H9EH 3SV6A 1ZGVA 4KKDA 3T5FH 1QL7A 2P93A 1KTSB 1TNGA 1GHYH 4ZHLU 1T8NA 1TRMA 5C0UA 1V2WT 1FY1A 1F5KU 2OQ5A 1UTOA 5KECA 1P57B 4A1XA 1M9UA 3RC5A 2ZU3A 4LK4A 2TGAA 3KQCA 1LVMA 1IQMA 3ZIAD 1GGDC 1SFIA 1GJCB 6CHAC 1MKWK 3WWBA 1ELBA 1CT2E 1GBEA 2Z9KA 1ZOMA 2QYIA 2HOBA 2BVXH 3SQEE 2BM2A 3VGCB 1HAVB 1KLJH 1TOMH 3F2FA 1YCPK 5GCHG 2H9HA 2ALPA 1ZLRA 4BXWA 2PW8H 2CN0H 2ZQ1A 1C2KA 1W3CA 1MU8B 1T8OA 4XBBA 1BTHH 1FN6A 5L6NH 1S6FA 2Z9JA 1DLEA 4INKA 3E8LA 5IK2D 1NFUA 4K2YA 1GI5A 3E90B 4Q7YA 2CK3D 3ESTA 4BTTB 2QA9E 2HVXA 1CGHA 3M7TA 4DVAU 3ODDA 3SV8A 1GBAA 4A1TA 5HKKD 1QL8A 3Q76A 3SHAH 2P95A 3LGWA 8GCHG 4Y6DA 3ZVCA 1XVOA 2P8OB 4WMFA 2VIDA 5CHAB 3TK5A 2AGGX 2BY7X 1O3KA 3UB0A 4AB8A 2Z3DA 1C5TA 2WSSD 1OWKA 5PTPA 1SGQE 4Q80A 1AVGH 5EW2H 1AHTH 9LPRA 1TYNA 2H6MA 4Y76A 1EPTA 4IBLH 1CGJE 4GAWA 5HIYA 3M5MA 3NXPA 3SNDA 3BG4B 1GHWH 1WTGH 2SGFE 1EOLA 1LMWB 1VKYA 4A6LA 3RMNH 3HGNA 3M61U 3ZYEA 1RIWC 1FXYA 2BDIA 2CHAB 4OM9A 1C5ZB 2BD4A 1SBWA 1W12U 1ELAA 1L4DA 5CHBA 1FV9A 3OFND 2W7UA 1MUEB 2O8TA 4HG6A 4BAOB 5JB9S 2HGTH 1EP5A 1NRSH 2TGPZ 1EXFA 4UFFH 2BHGA 2XBWA 2VVUA 1ESBA 2PP6A 4F48B 1O3PB 2ZCLP 1K2I1 1TA2A 2ZG0H 4XFQA 1P04A 3BIUH 2FYQA 4YZUA 4FU7A 3CNRA 1SHHB 1FMGA 1A4WH 3RXUA 1AFQC 3SORA 1AMHA 4UFGH 4BANB 1SGRE 1GI9B 2YOLA 4X1RU 3KQ5A 2FTMA 2AHME 1F5RA 3RXTA 1O2XA 4O3UA 4Q7XA 2TPIZ 3O8BA 2KAIB 4UFEH 5DGJA 1G9IE 3A7XA 3JZ1B 1OP2A 3OAAD 3MNCA 3OY5U 1O2YA 1CBWC 4NZQA 1NO9H 1O5DH 2XTTB 1L2EA 1ELGA 1FUJA 1NN6A 3KYGA 1BBRH 4TT3D 2W5EA 1AZ8A 5FX5A 5EPYA 4MPWA 2WPHS 1C2LA 3RXSA 2YMSC 2UWOA 1T4UH 1O3NA 1IAUA 3KN2A 1ELEE 4QT8C 2RDEA 1O34A 4JK6A 1SVPA 3GOVB 1YPKH 1AE8H 1K1MA 1H8HD 1V2NT 3RXEA 1VCQA 5DP4A 5T6FA 4X8VH 1DWCH 1GCTC 4K60A 5JBBS 1C5OH 2I6QA 3NUMA 3M7QA 5AFZH 2D26C 5GIBA 2GV6A 1WU1A 5DP6A 5K0HA 4GUXA 5HXFA 1HIAB 5ESTE 2BD7A 3OEED 1YBWA 2ANKH 4UFDH 1JOUB 4DY7B 1Z6JH 3LJOA 5F53A 5EIYA 3EAJA 1XUJA 3N7DA 3SGAE 3TNTA 1OXGA 3PLBA 1O3AA 1UTMA 1YPJH 2WV5A 2BY8X 1O2GH 2XXLA 4GHTA 4UONA 2Y5HA 5GJ4B 1TBZH 1FJSA 1WAYB 2KR7A 5LH8A 2BLVA 3GY5A 2NU3E 4NSVA 2BYAX 2J5UA 1BTPA 2V3HH 5BRRE 1MZAA 1V2KT 2VINA 2QF0A 2BD2A 2C8YB 1SLVB 1WUNH 3ATMA 4OS1A 4DGJA 2FI5E 1QRXA 4M7GA 3QN7A 2Y82A 1C9TA 2J95A 3L6PA 2GCTC 1BRCE 4RKOB 1O3BA 1UCYH 2QXGA 5E8EH 2VIOA 4KGAA 4BAMB 1INCA 3M3SA 1RXPA 4OS7A 1N1LA 3SUDA 1QZ8A 2WPDD 1LCYA 1XKBC 1SI5H 1C5UA 3VB7A 4TWWA 3UWJH 1NM6A 3E1XB 1P9UA 2FS8A 4CRFA 1CA0C 3EQ0H 1FX0B 1UTKA 1BHXF 2QC2A 1J9CH 2XNIA 4B74A 6LPRA 3ZZAA 1J16A 1VGCC 2A2XH 3HPTB 1T7CA 2QN5T 1XUHA 4CBNA 1TONA 2PSXA 1O2SA 1SMFE 3A7ZA 1BHXB 1GVLA 3P17H 1H8ED 2J98A 3BN9A 1EJNA 3SN8A 1K21H 1G30B 3GCHC 1RTLA 3MMGA 1KXCA 3HK6B 1S81A 4Y11E 4WXIA 1DX5M 2ZU1A 2BVRH 1HAPH 4MVNA 2L6OA 1C2GA 1JXPA 3Q3YA 4VGCC 3V0XA 1OKXA 3U8RH 1YKTA 1GDNA 1O2MA 4MNXA 1GBKA 3EGKH 2BDYA 2J94A 2V7QD 5HMAA 1D3QB 4CRBA 1TNKA 1F2SE 1G3DA 1ZSLA 1HCGA 2ZTXA 2VU8E 5JPMH 1OP0A 1TALA 3KGPA 3OSYA 2TRMA 1VITH 3KIDU 4ABDA 3W1EA 1MBMA 2FI4E 3IITA 2B7DH 2F91A 1SSXA 4ABJA 3BTHE 2SGDE 2F9NA 1BCUH 2PKAA 3SU0A 1ZTKA 2AIQA 1TX6A 1Y8TA 5CMXH 2W26A 1TB6H 3PO1B 1PPBH 2ALVA 3PTBA 1P12E 1GBDA 1Z71A 1O2TA 2ZDNA 3K6ZA 3ITIA 1C5XB 1CGIE 1UTNA 1GPZA 1VR1H 3QZRA 5FX6A 2GTBA 5DP8A 1UO6A 1ETRH 4X2VA 2B8OH 4NA8A 3EDXB 1BJUA 2XBVA 2OUAA 4FUEA 1TLDA 4B2AA 2ANMH 4XDEA 2IPHA 3EE0B 1ELTA 1C5RA 2YMSD 5TCAA 2BD3A 2IJOB 2J9NA 1BMNH 3A7WA 1MAYA 2QAAA 4MQAA 2ZWLH 1DE7H 1HNEE 4Z0KA 2PTNA 3I29A 3GY2A 4K8BA 1NU7B 2BY6X 3MH7A 2Y7ZA 2GDDA 3PB1E 3TK9A 3A81A 1K28D 2VWMA 1RD3B 4CHAB 3M3TA 4AYVB 4OS2A 1AE5A 2LP6A 1BQYA 1P11E 4FUCA 3ZVEA 2PUQH 1ELFA 2V6NA 3FANA 1E37B 2A5IA 1Q3XA 2BOKA 4CREA 1HBTH 1Y3YA 4WF8A 3F2GA 5C5NA 2OC0A 3M5OA 3RU4T 1C1VH 4IC5A 1EAIA 3QUMP 3GDSA 3OY6U 1IQGA 5A8ZA 4WH6A 4JCNA 1D6RA 1TNJA 3MU4A 1COWD 4BNRA 1RS0A 4H6TA 3V7TA 3SQHE 2XCFA 3T2NA 1LDTT 4Q7ZA 1QJ6B 3ATLA 3LPRA 1EATA 1ZPBA 1AGJA 1BRUP 3FO8D 3RC6A 1G36A 5F03A 1EPTB 4OS4A 5FL7D 1SL3A 3VB6A 1O5FH 3RXQA 2PV9B 4GPGA 2KAIA 2WPMS 3AVZA 1GWAA 5IYTA 3BTGE 1EJAA 1ACBE 4ISIH 3PTNA 3FN8A 1DM4B 1BTYA 1Z8IB 4WMEA 3VPKA 1HAYB 2JH5D 3QK1A 1P8VC 2BDGA 3B8JA 1CT0E 4ABGA 1PPZA 3BF6H 3SV7A 5DKMA 2XBXA 1DXWA 2FOHA 1U6QA 1IQLA 2ZPRA 3F1SB 1O2PA 3TGKE 2M5TA 1J8AA 2THFB 2YNBA 5T6DA 5CDFE 1GDUA 1FY3A 5AVDA 4A5TS 3S9CA 4ABFA 2SGQE 1F0TA 1E38B 1SQRA 2FX4A 1IQHA 2Y81A 1QGFA 2V0BA 5FPTA 5C17A 5C20A 1YWUA 5F6MA 2H5DA 3DHKH 3QDZB 3T27A 3V13A 3P8OA 1NRNH 2PTCE 2QIQA 3FOAA 3LKWA 1UVUH 2XC5A 4I8HA 3ZZBA 1XMNB 1CSOE 1GJDB 5EQRA 4XRNA 1GHBF 3SGQE 1NZQH 1ZRKA 4I8GA 2VH6A 1HGTH 1EZXC 2QE7D 5E0JA 1LHDH 1VCPA 4DG4A 3AASA 1JMOH 3RXOA 3TGJE 3RC4A 3MNBA 3U69H 4WVPE 4ZKSU 1C2EA 4R8TB 1RTKA 3F0PA 1L4ZA 4D8NA 4K69A 4YLUA 7GCHF 4NA7A 2WZQA 1A7SA 1NPMA 1P05A 3UR9A 2RG3A 1OWDA 4Z6AH 3U1IB 5EQSA 2O8LA 3SZEA 1MKXK
chains in the Genus database with same CATH topology
3RXBA 3U8TH 1Z8JB 1O38A 1O3MA 1DANH 4JYTA 1PFXC 5C1UA 4NG9H 1LHEH 2UUJB 3B23B 1YPLH 1MTUA 3STIA 3NCLA 2F3CE 4TPIZ 3MO3A 1TABE 3SU1A 3VGCC 1SB1H 2EI6A 1SOZA 1GI0A 5B6OA 3U1JB 3SU4A 1S0RA 3EA8A 4NSYA 1Z8RA 3ENSB 3TJNA 3ODFA 3PWCA 1MD7A 1H1BA 4ISLA 1C5WB 4CH8B 1EQ9A 1UVTH 4AG1A 4GHQA 1BTXA 1ETTH 2AMQA 1QCPA 8GCHF 5JBCS 1NFYA 1UVPA 4H6SB 7KMEH 5A09A 7ESTE 1P03A 3W95A 1Z1IA 2VWNA 2P8OC 3DD2H 2ASUB 5CHAC 4X6OA 1QNJA 3TJOA 3PV4A 3BTFE 5EU8A 1NT1A 2CMYA 1FAXA 1VITF 3F68H 2NU1E 1QTFA 2HLCA 1ZSJA 1GI4A 5A2MH 3O8RA 1J15A 4NCYA 1V2JT 4MNWA 5C67A 4MG3A 1AVXA 1QRWA 4J2YB 4ZHAA 1OP8A 4K3JA 1GL0E 1O30A 1OS8A 1O2UA 1C1UH 3GCTG 1FIZA 5A0CA 1C2MA 1AZZA 2VGCB 3MO9A 1KXBA 1BBRK 1H4WA 3MFJA 1H8IH 3A85A 3BTEE 3SO3A 1TA6A 1F5LA 1F92A 3A83A 3PLPA 5C5OA 3KCGH 3KQBA 1F0SA 2SNWA 2EI7A 1NRPH 4B75A 7GCHG 2A7HA 2J34A 1FN8A 1YPMH 3AAVA 3I77A 1GBTA 3F6UH 1QBOA 4JK5A 3B9FH 3SBKA 3KL6A 3LGUA 2STAE 5GPIB 3SJ9A 4NIVA 1ABIH 4I8JA 4X1PU 5FXLA 4ABEA 1FQ3A 1MMJN 4MNVA 1J14A 3LC5A 1XXFA 1TPOA 1K1PA 3H5CB 1SOTA 3O8DA 3ZZ5A 1HYLA 3RXDA 1AD8H 1THPB 3UUZA 2OQUA 1BITA 2QXJA 5AHGH 1WBGB 1N8OB 2JETB 5SGAE 1EAUA 2PSYA 2ZGXH 5A0BA 1BOQA 3GY4A 8KME2 3P95A 3R0FA 2VIWA 1C4V2 1BMAA 1KIGH 1ESAA 3SHCH 2PKAB 1D9IA 1QRZA 2WPLS 3IWMA 3S69A 5C3NA 3BSQA 5FPSA 3E6PH 2BLQA 1H8DH 4X8SH 1V2UT 3ZV8A 2GZ7A 1PQAA 3SW2B 3QGNB 1UMAH 2BXUH 4JZDH 1W13U 1P2IA 1TRYA 2Y6TA 2V35A 3RXKA 1BJVA 2GT7A 2QV1A 4Y7AA 1THRH 4Y0YE 1G32B 4OGXA 1W14U 1GI7B 1MTNC 1UCYK 2TIOA 1SQOA 4FUFA 5K7RA 4IGDA 1YPHC 1K1IA 1ZTJA 3SOSA 3T29A 1VJAU 3SUEA 3QLPH 2R2WU 2PFEA 3F9FA 3RLYH 4GSOA 1VITG 3GYMA 3URCA 1AIXH 1O5EH 3JZ2B 2LNCA 4WY3A 1IOEA 1HJ9A 1Z7KA 3RXFA 1DY9A 1DICA 2G8TA 2XC0A 5DP3A 3MWIU 4JMYA 1LHGH 1YLDA 2ZGHA 2WINI 4HTCH 4B71A 4IW4E 3M3VA 3TH4H 1S0QA 4FU8A 5F8TA 1G3CA 1GI6A 3LH3A 3SUGA 1GBCA 1QQ4A 1RFNA 3H7TA 1A61H 2AGIX 2Z9GA 1A5GH 5HM9A 1BZXE 3SGBE 2OINA 4MDSA 1ZMJA 2VIQA 1C5PA 2C3SA 2A2QH 1QURH 2A4GA 2FOCA 4ZKNU 5DPAA 3OYPA 1E0FD 3RMLH 1S82A 1C1TA 5E2OA 1MTVA 1SGCA 1DXPA 3T28A 1IHTH 3GDVA 2P3UB 1P2OA 5E0GA 3L3TA 2ILNA 1FY8E 2ZHWH 1ANDA 1GGDB 4RSPA 3UPEA 1EKBB 4NIYA 3DT0H 1ZMNA 2GD4B 3I78A 4FUDA 6CHAB 1QIXB 1AY6H 2CF8H 2ZFPH 5T6GA 2OBOA 3PMBB 1FLEE 1ZPZA 2HPQH 4CR9A 1UTQA 1ARBA 1GDQA 1GVZA 2P59A 4U2WA 2XC4A 3QO6A 1ARCA 1GG6B 5I46H 2BX3A 2BDHA 1YF4A 4DW2U 2XCNA 3LONA 1L1GA 3BTWE 5AFYH 1AO5A 1ELDE 3PYHA 1E34B 4AFSA 1YPHE 5DG6A 2CXVA 3PMJA 3ZZCA 1UK3A 3NK8A 2G55A 3RP2A 1O3CA 2ZI2H 2QXHA 5A8XA 4I8KA 3SNCA 1TRNA 2A4QA 2EC9H 2AH4X 4NFEA 5JBTA 1TMTH 3PO1C 2R0LA 1HPGA 3TGIE 1DS2E 1MKWH 4ZH8A 2ZGCA 1JRTA 1LVYA 1ESTA 1L0ZA 3A7TA 1DUEA 1LVOA 1YCPH 1S6HA 4Y71A 4MPXA 2Y80A 3P8FA 5JB8S 2BDAA 1JIMA 2ZDMA 1HRTH 5ESBA 1BIOA 1P2MA 2FX6A 3A84A 2ZIQH 1O2KA 1V2RT 1IQIA 1ID5H 1OWJA 1DLKB 2C93B 3RMOH 1UHBA 1Z6EA 1O5GH 2ZQ2A 2WYJA 4AORA 2FOFA 2OXSA 4MPUA 1Z1JA 3W94A 4A92A 2BTCE 5L2YH 4CHAC 3TJVA 3DFLA 1GMDG 4KP0A 1VZQH 4CRDA 4ISNA 2Z7FE 3MI4A 1V2LT 4HI3A 3GISB 1O3FA 1FONA 2PKSC 1CA8B 3SI3H 3RXLA 1UVOA 1FNIA 3KEEA 3BTME 4FUJA 1CHOF 4ABBA 1O2LA 4LZ1H 3KNXA 4RKJB 1X7AC 1TNHA 3VFEA 1ZR0A 1IQEA 3LOXA 1TGSZ 2GV7A 2C8XB 1N6XA 1IQKA 4DIIH 2Q6DA 1PPHE 4DOQA 3MNXA 1YGCH 1O3HA 1DITH 2ZDLA 2H5CA 2FP7B 1WQVH 3LT3A 3U8OH 3RXRA 3URDA 1EPTC 1OSSA 3MH5A 1W10U 2UUYA 2C4FH 3PM3A 1FZZA 3R3GB 1HJAB 4TY7A 2ZECA 1NU9A 2I6SA 1KY9A 1SGFG 2D8WA 1KYNA 1HDTH 5JYIA 2FI3E 1O3JA 1A2CH 3MH4A 3A7YA 5C1YA 2AYWA 4LZ4B 3V12A 1TGNA 1GJ7B 1JBUH 2ODPA 2WUCA 3ZV9A 1QR3E 4CBOA 1NRRH 3DFJA 1RRKA 3D65E 3FP6E 4AYYB 2HNTF 1W11U 2GZ8A 1BRBE 2FMJA 2UWPA 1EUFA 3MNSA 4OS6A 2HPPH 5A0AE 5EW1H 1HAOH 2OD3B 4Y8XA 3CS0A 4D76A 1GJ6A 4DCDA 2Y7XA 3Q77A 1AWFH 2IN2A 3RDZA 4FUGA 4INHA 1K1JA 1S84A 1P0SH 4FVBA 2Z6BD 2ZFSA 5DP9A 2FM2A 1VCWA 2SGAA 1C1MA 5G4BA 2QCYA 1V6DA 3DUXH 1C1OA 1NFXA 4HFPB 3SU2A 2VWLA 1FPHH 2AMDA 2O8WA 1GJ5H 2XW9A 5F8XA 4I32A 3SNAA 3FP7E 1EZQA 1HUTH 1GJ8B 3PWBA 5DK1A 1GBLA 4DURA 5BPEA 3QZQA 3FZDA 4Y7BA 3TLOA 2GKVE 4X6MA 4ISOA 5LPRA 2XWBI 1A0JA 1EJMA 1B0FA 4THNH 5GWZA 1W7GH 1TMBH 5T3HA 1HAIH 1QL9A 2NU4E 2K1QA 2R2MB 1A0LA 2CGAA 4K5ZA 1VGCB 2A4RA 3S7KB 3SJ8A 5HGGA 1CHOG 2ZFTA 2GGVB 4X0WU 3ZZ9A 8LPRA 1DFPA 3VXEH 3WY8A 1P2NA 1C4U2 3GY7A 4CRGA 1Q2WA 1QHRB 2FEQH 1V3XA 2ZF0H 3E0NB 1J17T 3GCHB 3RXHA 2O8UA 2BVSH 5EXLA 5JBAS 2UUFB 1Y5UT 1DVAH 2OCVB 1A1RA 1BTZA 3RXIA 1LO6A 4AG2A 1H9IE 4AZ2B 1P2JA 4SGAE 4ABHA 4RN6A 1UK4A 1T4VH 2F9VA 1O31A 2R3YA 3UNQA 2TGDA 1SGIB 1Y3VA 3OU0A 1MCTA 3FAOA 4ZXYH 1SGNE 4FVDA 1KSNA 4ZXXH 2P94A 3LC3A 4WMDA 3RXGA 2QGRA 4ESTE 2JH0D 1FY5A 1O2WA 2GP9B 3BTDE 1PJPA 2YNAA 3SZNA 1C2JA 3QGJA 4WH8A 1O32A 5AF9H 1O5BB 1ANCA 1WSSH 1OWHA 1LPZB 1EAWA 2C8WB 1AVWA 1O5AB 4YT6H 1DWEH 1P06A 1DWBH 1T8LA 1B5GH 1SG8B 2R9PA 3UOPA 4LXBH 1GBHA 1T31A 3GCTF 2CV3A 1WTHD 1TQ7B 1SGFA 1KLIH 1ZZZA 1ZHMA 1GJ9B 1NROH 1O2VA 1THSH 4U30A 3M7UA 3RU4E 3A8BA 1V2MT 3VB3A 2J38A 1TPAE 1NTPA 3E91A 2BQWB 3RXJA 4IS5A 1QB1A 2BY9X 4IN1A 1JIRA 2VGCC 1GCDA 3UY9A 4B73A 2BD8A 1O39A 2Q6FA 2OC1A 3BTQE 2Z3EA 3MTYA 3VB5A 3UNSA 4NZLA 1XKAC 5TJXA 2Z3CA 3Q3XA 2J4IA 5EXNA 1CHGA 3TIUA 1RJXB 3UNRA 1AUTC 2GMTB 4WXVA 1TPPA 1QY6A 2LPRA 1UTLM 3STJA 3VEQB 1QB9A 4X1NU 1N8OC 1EB2A 1V2ST 4MTBA 2GT8A 1ZJKA 1GI8B 4ISHH 1SGDE 3LH1A 4CR5A 3AAUA 3EYDA 1EX3A 4B2CA 2ZDAH 2A4OA 4AX9H 2PGQB 4XE4A 1XUIA 1RTFB 4XBDA 1GMHF 4O9VA 1ZGIA 3RXPA 4BTIB 1V2OT 1P10A 1O0DH 2DUCA 2GZ9A 2SFAA 2F9UA 3Q3KA 3T25A 3H7OA 1O5CB 2P3FH 1C5VA 1ETSH 3TNSA 1MH0A 2P3TB 1GI1A 2ULLA 2FTLE 4XBCA 5DP5A 1QBVH 2WPIS 3RU4D 1UTJA 3RM0H 3RM2H 1XVMA 1WYKA 3KHVA 1KXFA 2ODQA 3GDUA 1DUAA 1ZPCA 3A8CA 1C9PA 1D6WA 1S5SA 3NKKA 1GL1A 4ZKRU 3S7HB 2PUXB 1O37A 1C1SA 3ZVGA 1UHBB 1YC0A 2BOHB 4K1TA 5DP7A 1YM0A 4ABIA 3SNBA 2ZTYA 3BEIB 4FUBA 5FAHA 3SJKA 2XWAA 1YLCA 3BG4C 3F9HA 4GCHF 2R0KA 5E0HA 4IN2A 1OYQA 1EASA 3N7OA 3PMHB 2CHAC 4ZMAH 1GHAF 1TNLA 1CT4E 1WQSA 4FXGH 2IOTA 4F49A 4Y79A 3ZZDA 1BTUA 1KXAA 2ZEBA 3T62A 2ZHDA 4INLA 5DJ7A 4ASHA 5JDUB 3D23A 1PPCE 1Q31A 2GVFA 2VJ1A 2W3IA 2ZGBH 3P70B 2OC7A 4U32A 3S9AA 1ORFA 1FPCH 1P9SA 1GHVH 1Y3WA 5FPYA 1RGQA 2GCHF 3MU1A 1AQ7A 5LPEA 1Y5AT 1GI2A 4YOJA 1CVWH 2ZNKH 3A86A 4ZKOU 3A7VA 4XSKU 2VIVA 2CJIA 1LVBA 1W2KH 3K6YA 1GBJA 1S83A 1TMUH 1CO7E 3TITA 1AKSA 1CQQA 2F9OA 4Y8YA 5TCCA 3BIVH 1LPGB 3RXCA 2FPZA 1E36B 2GDEH 3SUFA 3CS7A 4H4FA 1BTWA 1BB0B 3HK3B 2W3KA 1NRQH 4NIWA 1T32A 4NIXA 2BDCA 1TBQH 3M5NA 2EA3A 3F9EA 4GLYA 1DPOA 1D3DB 1GMHG 3KQEA 3PROA 2G00A 1IQNA 2A7JA 1TPSA 1O2QA 4FUHA 2Y5FA 1ZHRA 1XUFA 2R3UA 1GG6C 1BDAA 1GMCF 2HWLB 4FU9A 1PPGE 2EI8A 1ANEA 3ZZ7A 2G4TA 3C27B 3NPSA 1C5YB 1MKXH 4HZHA 1W0ZU 2ANYA 1QBNA 3TK6A 2AIPA 1K9OE 2SGEE 2WPJS 3LDXH 1HAHH 2BQ7B 2BY5X 4CRAA 8ESTE 1P01A 2A45B 4ZAEA 2Z94A 7LPRA 2C8ZB 1GHXH 4ZHMU 1A5HA 3K65B 1CE5A 3FFGA 3FZZA 4AFZA 4YM9A 1NFWA 1TX8A 3A8DA 1MQ5A 1C2FA 4JZFH 1AU8A 3MO6A 1NC6A 1H9LB 2VB0A 1D4PB 2DE9A 4GCHG 2XBYA 4NWLA 1KDQA 2ZHFH 2B9LA 4XOJA 1GHAG 3UQVA 4X1QU 2ZHEH 3K9XB 2UUKB 2ODYB 2ZKSA 1G2LA 3ELAH 1FIWA 3RXAA 5F8ZA 3Q00A 4KTCA 2ZPQA 4X2WA 3U9AH 1TOCB 1AFEH 1DOJA 1EP6A 1OYTH 1F0UA 2F83A 4BXSA 1AB9B 1ABJH 1HB0B 1HJ8A 1D3PB 1PPFE 1GMDF 1GVKB 1OOKB 1YPGH 2AEIH 3VXFH 1TIOA 3S9BA 1TGCA 1C5LH 2O8MA 5J4QA 2GCHG 4JZEH 2RCEA 3BEFB 3GY3A 1F7ZA 1YYY1 2FOEA 1C1QA 1LKBA 2ZPSA 1G37A 1BRAA 4DJZB 1P02A 1ELCA 2SGPE 2RA3A 5EPNA 2G4UA 1XX9A 4Q2KA 3T26A 3BEUA 4DT7B 1EOJA 2ZDVH 2Q6GA 1AI8H 5J4SA 1NY22 1BMMH 1ELVA 3QX5H 2AFQB 3RLWH 4MNYA 1DT2A 1MTSA 2VVVA 1O3GA 3GICB 1Y3UA 1O3IA 2FOAA 1O3OA 1GJAB 5FCRA 1A3BH 1LKAA 2FOBA 1E35B 1XM1A 2C90B 2FIRH 1HAGE 6GCHF 2B0FA 4KTUA 3HGPA 2XRCA 1GMCG 1ZJDA 4WWYA 4LOYH 3TU7H 4BAQB 2FO9A 4AGJA 5DO4H 1HJAC 1ZMLA 1O2HA 1TGTA 2BLOA 4AGKA 2H9TH 2PR3A 2BXTH 1PQ8A 3RXVA 1T8MA 3TH3H 1JWTA 1AWHB 1GBFA 4Y10E 1MTNB 1TGBA 1XUKA 3BTTE 3GYLB 1DSTA 1WCZA 2PWXA 1MAXA 1WV7H 1G3BA 1V2VT 4I7YH 1GHZA 1NESE 4J1YA 2FYRA 5C2ZA 1MU6B 1C5SA 5EQQA 3K2UA 1GBIA 4JZIA 1C1WH 1FI8A 2HNTC 1SPJA 3TVJB 3P8GA 1TX7A 4UE7H 1RIWB 1DY8A 4WJG2 3SNEA 4U01A 4IC6A 3A80A 2XYAA 3ZVAA