1TPXC

Ovine recombinant prp(114-234), arq variant in complex with the fab of the vrq14 antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
219
Chain Sequence
b'DVVMSQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSRLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYFCWQGSHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords major prion protein
publication title Insight into the PrPC -> PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants.
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function
total genus 53
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxC01
3U9PL 1NBYB 3ES6A 3WNOA 3LZFL 4S1QH 1MCWM 4BSWB 1YEFL 5A40E 1FNEB 4YDJA 3S5LA 4ONOA 3TIEB 2DKMA 12E8H 3MGOA 3ZE2E 1P4BH 1T7WA 5DMIH 1BVKB 5C07E 4LSQH 1MIMH 1NCDL 4XH2A 4UUJB 1YEHL 1KLUA 3BZ4A 2QL1A 3C5JA 2EE2A 3WIHH 1JZ2A 3MRHA 2LFGA 4LNVA 3K81A 3MV7D 1TZGH 4JGUA 5B8CC 3QAZB 2YD1A 3ARTA 3QISA 4C58B 3W2DH 4HUNB 3GSOB 1BVZA 5E2TH 4AEHL 4WCYL 3EYUL 3BJLA 1N6UA 5EC2A 4UT7H 2I25N 3DIFB 4IS6B 2CH8A 3UYOD 4PV8A 1MCJA 2BVEA 1A6UH 4MX7B 4WWKC 4UNTA 2XA8L 2NX5D 3ZMRA 3RDTD 4Y5YC 3TT3H 1CIDA 4TULH 4Z7VE 4K2UH 3HNTL 3RGVB 1MF2H 4HHAA 3L7EA 1NBZB 2A83A 4X80H 2VZSA 4M7KL 1L7TL 4M62H 4R90L 3N85L 5T5NG 1FGNL 2GY5A 5CJBA 3ZSSA 3IFNH 4I3RH 1E28B 4NJAH 3L5XH 1LP9F 2H2SC 2JJTC 1S7UB 2X4TA 3CMOH 5TQ2L 5I8CB 3QEUA 1ZT7B 3C87A 1CG9B 3MRKA 1NCBL 2GTZA 1F4AA 1MPAL 4NDMB 3RTQA 5AAWA 1MWAA 2EICA 3MRCA 4CMHB 4PB9H 4EVNA 2VWEE 3O6FD 1N5YL 1JTOA 3TZVA 1OP3K 3WFHA 3MRBA 2AJUL 3H0TB 5CSZA 2FIKA 3H9SA 3NFNA 4AYFA 2NNAA 5HY9B 1ES0B 3F58L 2Z9TA 2FYYB 1CZ8L 2G60H 1N59A 5J13B 4HWBH 1RIUL 2LU3A 1QSZA 3RPIB 2AJXH 3SKNB 4XHJC 1BQHA 1A4KA 3HMWH 4MGXA 4RCAA 5E2VL 4EIZC 4RISH 4W81A 2ORBL 3CK0L 1NBYA 3FO1A 1PJ9A 3VFOB 3QA3B 4LLUA 1FORL 4GH7B 1FNEA 3DYMA 3CFJB 1YEIH 4K71C 1JL8A 1J1OL 4M5ZH 2YPVH 3RUGF 4B0MM 4ERSL 5ID0A 1T6VN 1BVKA 3RKDC 5DZLA 4OZGF 4UUJA 3O3EB 4WENB 4MDIB 3SKOB 5IMKB 2FEDD 1CD1B 3K2UL 2F5BL 3HB3D 3ULUD 1WGOA 4WGWB 3CD4A 4QRTB 3GSOA 5IB3B 4QRPA 1ZMYA 5DUBB 4DUWA 3PWVB 2XFXA 1QSEB 2P48B 4YK4C 1I7UB 2EEDA 4QY8B 3GO1L 4U3XA 1U8IB 3U0TA 5HGDB 3MBEB 1RZGB 1S7SB 1BD2B 3BP6B 3TJHD 1WBYB 4GLRH 4YBHA 5GGRA 35C8H 2X42A 4Y88A 4ZSOE 1V8HA 1JGLL 4GKSA 1ULVA 1FDLL 4ZOEA 4G7VL 2BDNL 4P57A 2X7LB 3ZKND 2NR6C 2WV3A 4HGMA 3RY5A 5JXEC 3QEHA 4G5ZL 4D2NA 2RJMA 5GZND 3SE9H 1JZ5A 1QRNE 5B8CA 1DSFH 1QLRB 1Q94B 3BD4A 1X5AA 3V7AE 2X4PA 5FKAA 5FOJA 5EOQL 1GOFA 2W1NA 3CDGA 1YMMA 4MAYB 3CFIC 4OV5B 2IGFL 3MLPA 4ODUB 4F80A 5I8CA 5EULV 4I48B 1CG9A 2VDKH 4H1LA 4WWKA 5D72H 3EYOB 4LVEA 3RY6C 3NN8A 3WSQH 4ETQA 4QRQB 4Y5YA 4B7IA 1CE6B 4UT9L 5L0QB 3WE6B 4XI5D 4PJ7E 2JJWA 4DK6A 3A6CL 4PJEE 2D7QA 4G3YL 5HY9A 3ZDXF 1ACYH 1MHEB 2VXSH 1G7PB 1SJEA 3RPIA 1JCKA 4ZXBD 1DUYB 4MXVE 4EN3C 4KGLA 4X7TA 1G9NL 2JJTA 4P23D 2DLEA 4M61B 2GTWA 4DOHE 3BHBB 3R4DA 5LWYL 3FOLA 4HUXB 5D7JC 3QA3A 3DO7B 3OX8B 3F12B 5HD8D 4I4WA 3E8UH 3KLHD 1F90H 3WS3B 3O6LL 1CDCA 4OLVH 2JJUA 4HG4K 4RFOL 3DX6B 1GGIL 4HWZB 3TV3H 1EAPB 5IMKA 4KUZL 3BRFA 5FYKH 2A1WH 1A1NA 5F9JB 4K8RC 5J7CC 1JE6A 3T4YB 2P5WD 5GGRY 2B1AH 1TQBC 5MI0C 2AVGA 1U8PA 1YYLH 2OLDA 1LDPH 1YNTB 4PJIA 5FYJD 1IM3B 3BP6A 1SM3H 2BNRB 1ORSA 5GQBA 4JANA 2IQ9L 4Q2ZA 3T3PE 4CDHA 1OARH 4Q6IB 1IBGH 5GISH 3U6RB 2EECA 3O6MH 5CKGA 4ELME 2ZCHL 3EYSL 1CICD 5DUPL 15C8H 1BOGB 5JR1H 5K93A 1B0RA 1JV5B 2VR5A 5FOBB 4XCNB 4BZ2L 3UX9B 3I6GB 4M9PA 4OD2A 2H6PB 4A6YH 5MI0B 4K7PH 2VN7A 4CJ1A 1CXEA 5IB2B 1F97A 4X98B 3VXRB 1T7YA 3R0MA 5DURD 2R2EB 1T4KA 5DMJB 4ODUA 1BIIB 1NANI 4JKMA 1VFAB 2J8UA 5JHLH 5C6PB 5IVXA 4LBEA 4RAVA 1BVLB 1S7TA 1QEWB 3OXSB 3QUXD 4JRYE 1HOCA 2ITDA 4M5YL 3FQWB 2DQEL 2HRPL 5JXEA 1CE6A 3O9WC 5DHVA 4XMLL 1OGAE 3VGEA 4GW1B 4MQXC 1K8IB 2DQJL 3X13B 1CDJA 5C1MB 1O7VA 2PYEB 4YZFF 5F7WC 2DM4A 5KSAD 1F6FB 1RUAL 2NCMA 4MA1C 1MHEA 2R56H 1ED3B 4PJAA 3OAZH 4OLZH 1DUYA 1DQML 1FQ9C 4OTXH 4PJCE 3GM8A 2WQRA 4G80B 5GRUH 4MWFA 1YQVL 5T3XL 5HGGS 2R69L 3MV9B 3BHBA 2QQLL 4GG8B 1U95A 2I60L 3RY6A 3GMOB 1HYSD 3OX8A 3O9WB 5FB8B 1A5FL 3EGSB 3ILQC 1JWMB 1EO5A 3WS3A 4FP8H 1PSKH 2I5YH 3GJFA 1PLGH 2F19L 2K3TA 5J1SC 3UJTH 1R5VB 3WFEL 4NOBA 4HWZA 1EAPA 1DP0A 5F9JA 4L29A 4EN3A 3T0EC 4WW2F 5D2LF 4YHOH 5E00A 1MRCL 3GSNH 5TPWH 4C55A 1VSCA 3MLXH 4D9QD 1I8LC 2F74B 3PE9A 4AG4H 2E5EA 2CD0A 1BEYL 1WTLA 1I75A 2Y06L 5CEYA 5D7JA 3TVMD 5FYLL 3WO4C 4BH8A 4XC1H 2BY0A 4FZEH 3HR6A 1F2XK 1CGSL 5DT1H 4LLYA 4F9LC 3WNLA 2N7AA 2AJVH 3FQNB 4E42A 3O2VH 3IJHB 3I75B 5IQ7L 1MLBB 3U6RA 2IPTH 4J2XA 4ZAKC 2HLAB 3NPZB 1NAKH 4HF5L 3K46A 4NKIH 2GAZB 3LB6D 4TQEH 4P2YA 5C0AD 4OCSH 1QPXA 4GSDH 2EDLA 4U1SB 5TE7L 2HTKD 2H6PA 3GBNH 4WI2A 4NC0B 4PREB 5FCUH 4NPYB 2D4DA 1EFXA 3VXRA 3IKKA 3WIHA 4GAGH 1E4WH 2R2EA 5ITBH 4QCIB 1BIIA 1OL0A 4JVWA 2QHRL 1DBBL 3MV8A 4TVPE 5GRJL 4K3GA 5C0CB 3MXVH 4GBXC 3FQWA 1OWWA 4WUUB 1RZIB 2ZKHL 3MLWH 5D2NC 3SGJC 1FFOB 1NFIB 4GW1A 1K8IA 1P1ZB 4PBWD 3X13A 2J1KA 1OAUL 4LF3B 1M7DB 1MHCA 1ZVSB 4G7YL 4Q0XH 5DGRA 1W8OA 3ROLB 4JFDD 3A6OA 3BH8A 3RVXD 1QRND 1ED3A 5JW4M 1FCCA 4KZEH 4JN1L 1U8OB 4G80A 3V6ZA 1DCLA 4EQ3A 5MHSD 4LGSB 3MV9A 4GG8A 1TTUA 4UDTA 2NTFB 3BIBX 3O8XD 3O9WA 3M8OH 4RMRA 5D2NB 2EIZA 3NH7H 4Q97A 2D7PA 2GJJA 2VDLL 2W0LA 3KGRA 4MQ7A 3VXME 4LAJH 1DLFL 3ZKXC 3OGCA 5EPMA 1S7VB 2NY3D 1A7PL 3WXWH 3U1SL 1CXLA 1CFQA 1XF5B 5FA3B 1RVFL 1L9MA 5F1SA 4KK6C 3KPNA 1MCCA 4HWBA 4YHPB 4Z18A 5I1LB 4GKOA 3OJ2C 2AI0L 3IJHA 2BVPB 4OFVA 3ZE2F 2OYPA 4EUPG 2BSSB 3RHWF 4X9GA 4HKJA 3KPRE 4HKXB 1Q1JL 4NRXB 5F9DC 1D9KC 1S7XB 5FYJU 4MNGA 2G5RA 1I8LA 4Y5VB 3QEQA 4PREA 1K85A 3ARDD 1FCGA 4NPYA 3CX5K 2ADGB 2JF1A 2OJEA 4QCIA 3MTRA 1WWCA 3ARBB 4WHDA 4AEIH 2J8OA 3GMQB 3IFLL 5BOPA 4ZAKA 2GI7A 1EO7A 2IQAB 4HEME 4LPCA 5I1EL 4E41D 3ZO0A 5D4QA 4CDGC 1FFOA 3PL6B 2EH7L 4LF3A 1M7DA 32C2B 4PRIB 4Z7VF 4KTDH 4MSWB 3I6LE 4WFED 1T3FB 1ZSDB 2A38A 4JPKH 3FRUB 3U83A 4HS8H 4MAUH 3CSBA 1MCOL 3PXJA 1LO0L 1U3HD 4GBXA 4FFZH 4I1NB 5CGYD 5DK2A 1JWUA 5D2NA 3MRRB 3SGJA 3C2SA 1LO5B 2KQMA 4KY1H 4QRUB 4S1QL 4JRYD 2FECL 2EDJA 1P7KA 3TBWB 3D2UD 1OGAD 1P4BL 3QG6B 5F1NA 4EDXB 2FO4B 2CXKA 5IQ9A 4LSQL 1FYTE 1MIML 4LMQI 2DQCH 5HGHA 5INDA 1IC4H 3IJSB 3EDDA 5CBEA 2A9MH 5F6IC 3WIHL 4KKBD 1RUMH 4AZ8A 1TZGL 1I3GH 4YHPA 3KS0H 1SY6H 5B4MC 5E2TL 4L4TB 3V0WL 5I1LA 2R8SH 1FZKB 4XMPL 3B2VH 3GZKA 5EBWB 4FZ8H 4WV1B 5J89A 5LKNA 1DQQB 5H94B 2BVPA 1WF5A 4UT7L 2F54E 3QIWC 3MV11 1D5XA 1A6UL 3W0WA 2E6PA 4I18C 4HKXA 4PJXE 4F37F 5ISZA 3TT3L 3HUJF 3BDXA 5GRZA 4P2QE 3BMVA 4TULL 5F6IB 4Y5VA 1F3JB 4MB3A 1C7SA 1T1ZA 1BREA 2DM3A 2FJHB 4K2UL 4L5FH 4JKKA 1MF2L 2AK1H 3WMSA 3MJ9H 2UWEF 3PV6B 4M62L 4ENEC 5FXCH 4OCMC 4I3SH 3MRMB 1HCFX 3ARBA 3IFNL 4I3RL 4YDVB 4NJAL 3L5XL 2YD7A 3RWDB 3MUGA 3CMOL 4YDKH 5BW7C 1HKLL 3BXNA 3RIFK 5ESQB 1H3UA 4I18B 3JTTB 3V8CA 4LFHD 3BQUC 1D9KA 2EDRA 3BKMH 3EYFB 1HSAB 1KV3A 1KCVH 4NWUH 3SDDB 4OZHF 3LEXA 4WUKH 4XVJH 1AFVH 2GJZB 5EO1B 3UZQA 5SWZB 3AFLA 1ZSDA 3WNKA 1IC1A 1SJXA 2G60L 4HWBL 5TE6H 4N9OB 1KELH 1WWWX 2AJXL 4NQCE 4PRHE 4A6YA 2X5PA 1E4JA 2J5LB 5TQ0H 5IESL 4OIAA 4RISL 2C4FT 2XKNA 3BQUB 3MRRA 5LBSH 4AEFA 4TVPD 1I7TB 3C60C 3NACL 3TBSA 4PJ7F 4Y8DC 3NVQA 4ZDHB 1YEIL 1Q0XH 3P4MA 4PJEF 4N0UA 2FH8A 4RFNB 3TBWA 4F2MA 5BJTB 2BOCA 2NY0B 2QQNH 1A7RH 1U8MB 3X14A 4XRCA 3OKMB 4BK5A 5IJVB 4FXGB 4MXVF 4U1NA 4WO4C 1G9EA 3KPPB 3EZ8A 3GI8H 4MLIA 4L4VD 1KUMA 2AABH 1N64L 3IF1B 1CQYA 4JY6B 5I74C 4O2EB 1DQQA 4RNRB 4PJ5B 5HVGB 3QB7C 1OB1B 1IQWH 3ULUH 3FRPG 4KTYA 1QZ1A 3O6KH 3VXMD 1R24A 4A2MA 5CD3B 2ILLA 1YEGH 3SE9L 4QF1A 1U58A 1X5HA 2X9WA 4NM8H 1DSFL 3T65B 3PWUA 4JJ5B 3NA9L 4X9IA 5MEND 3PDOA 5DD1H 3IRZA 2DLTA 3GSNA 4QXGH 3MRMA 1MRDH 2WBKA 4YR6B 4C59B 5HPOA 5L2KA 1XCQA 5EO0B 1I85C 2YN3A 2IPKB 4XZUB 3WYRA 4HG4J 2CDGB 5GS1B 2VDKL 3ILPA 4I18A 5TDPB 4CVUA 1CL7I 5D72L 1NEUA 3MLTB 3WSQL 3EYFA 1HSAA 1EEYB 3NPSC 4AQOA 3KPRD 4R0LB 2DQDH 4K7PY 1CVSC 1R3KB 1KB9K 1LD9B 1KG0B 1OGTA 4HSQA 5IW1A 5J56B 1T6WA 1I4FB 2VZVA 5JQ6H 1ACYL 5HHPB 3K4AA 2VXSL 5AAMA 4MJ5A 1HQ4B 3KHOA 4LLWB 4NN6C 1R5IB 2ZUUA 5BW7A 3D25A 3B3IB 4U1IB 4N8VB 1QFWH 1UA6L 4HKBB 1JNNH 3BQUA 2FGZA 1I7TA 4WU5B 2NYYC 1NFDB 1S8DA 2YWZA 1J7VR 3NPSB 4ZDHA 3E8UL 4PJGE 2YPLD 1F90L 1LILA 1QO3B 2RIKA 3VD9A 1JI1A 1SVCP 2DMKA 3TV3L 4L3EA 3REVB 5FYKL 4OF8A 4YDLB 4Y4HD 2A1WL 3I6LD 3IDGA 4UOJA 5AWNH 5KSUB 1WAAA 2AERT 4M4RA 4PJCF 1GAFH 2EDBA 4ZQKB 2APVA 5ERWB 4HWNA 4UT6H 1AE6H 4FQHA 1RHFA 1IGFH 4XWGL 1YYLL 2VERN 3C60A 1A47A 1A6TA 5I1CH 1LDPL 3FHQA 3RGHA 4RNRA 4PJ5A 3EFDH 3LKNA 1SM3L 4DGIH 4JFEB 3U30C 1CR9H 1FRGH 5DMKB 1VFUA 1OPGL 2E3VA 1OARL 1IBGL 5GISL 3O6ML 4IRZH 4K9EL 5CILH 4W4OC 5JHDE 3X3FH 1PYWB 5CD3A 1AHWC 5D1QB 4HPOH 4WO4A 3ULVF 15C8L 5JR1L 5FYJH 1QLFB 3T65A 1IAMA 4H20H 2WBJD 3RI5F 4A6YL 1OF2B 4JHZA 4MCYB 1I8KA 4O00A 4LCIH 5FHBH 4YR6A 3FT4A 5BRZD 5GS2H 2IPKA 5GIRB 2BZDA 4R4BB 4LARH 5JHLL 3HC0A 2CDGA 2EZ0D 5HDOA 5IM7A 4JRXD 3MLTA 4NBXB 4MJ2A 3RDTC 1EEYA 3FN0H 4QRRE 2Y36H 1VGEH 4Y4KD 2WAHA 3EJZD 3MV7B 1R3JA 2IH1B 1OTTD 1AGEB 4QWWD 1JZ4A 1KG0A 3EJYD 3ZHKA 4G8GB 3VDAA 3ZYJA 1CGUA 1I1FB 3JUYA 4IOSD 5D9SB 1CK0H 3VMNA 4FOMA 4P2QD 1TCRB 3FQTA 2R56L 3VMPA 4GRMB 4OLZL 5HHME 2V7HB 1I85A 3PQYE 2F5AL 4OTXL 3VGHA 1ITCA 4XCEB 5EUOB 5GRUL 3B3IA 4FQJL 4N8VA 1U8LB 3OXRB 4D9RD 5D7LE 3EO1A 1FG9C 1A1OB 3IB4A 4GXUM 1I9RH 1NFDA 2NX5B 4MCZB 3RDTB 5KANI 4HFUH 1FL6B 3DVGA 4FP8L 1PSKL 2I5YL 1PLGL 3U9UA 4LCYB 3BO8B 2R1XB 4YPGB 1RPQA 2FJGB 3V6FB 3D39A 4JFYB 3REVA 2P8LB 3HA0A 3PGFH 4NJ9H 3B6SB 1S9WB 5KSUA 1QSVA 2I9LB 2XYCA 1QSFE 4YHOL 3BMWA 3AXLA 5TFSH 1O7SA 3T0VA 3GK8H 4ZQKA 5TPWL 3MLXL 3FN9A 1HHIA 4AG4L 3IAGC 5CGMA 1CFVH 4PRHD 1X5IA 2LE9A 3QZWB 1HH9A 5T5NF 3GHBH 3O6FB 4XC1L 5ETUA 3OKYA 4OFIA 4LASH 3IDJB 2FD6H 5DMKA 3HE6D 2AJVL 3UC0L 1FZOB 1IGCH 2OBGA 3O2VL 2BRQA 3O4LA 3V7MA 4I2XB 2VDPH 2IPTL 1NAKL 1GGYA 4NKIL 1NC4D 4MNQD 4TQEL 4OCSL 3HB3C 3ULUC 3VFVB 3BOVA 1XGRB 4GSDL 1FVEB 2XPGB 3GBNL 1FFNB 3M17A 3VD7A 4HKZB 2JKXA 5FCUL 3V6BR 4LCWE 2IMNA 4OLWL 4GAGL 1E4WL 1UCTA 5ITBL 3MNZB 1G0YR 4OFYD 4MLSA 4PJBF 5GIRA 3HI1B 4U1MB 1A6VH 5F7NC 1SY6A 1N8ZA 3MXVL 4W4OA 1T1YB 1AHWA 2IG2L 1KYOJ 3MLWL 3VE0B 3MV7A 1OQXA 1AGEA 1FAIL 1ORQB 1FL3A 4Q0XL 1I1FA 1PG7W 4AH2B 4GMTH 3UTSE 4HH9A 2CR3A 4GRMA 3RWJB 3IVKB 4KZEL 2MKWA 5EUOA 1SQ2N 3F6LA 3MJ9A 2BSTB 1A1OA 2VH5H 2X1OA 4G8FA 2NX5A 4MCZA 3RDTA 2M26A 3M8OL 4XI5C 4PBXA 3NH7L 5D7IF 1IGTA 4PLKD 3BO8A 4YPGA 3NGBC 5D6CB 3PUCA 3CX5J 3V6FA 4BSVB 1MCSA 1A1MA 3B6SA 1S9WA 4ZXBC 3TPKA 3U48A 1WVZA 2I9LA 3OKEB 4KROD 4P23C 1VFMA 1TITA 3GIVA 1OP5K 3X11B 3QZWA 2EDHA 5HD8C 3KLHC 2CR6A 2D9CA 3HHRB 4PY8I 3O41A 1WFNA 3MLSH 3FJTA 5C0DB 2XWJB 2RQ8A 3ZTNH 2RGSA 1PW3A 5DUMH 2IADB 3NGBB 2FCBA 5L8LB 4YUEH 2HLFD 3KDMB 4XPGL 3ZTJG 2APXA 1J5OH 3AVEA 1C1EL 3TGXA 4G8IA 1RUPH 1DUZB 1F11A 1WQVT 2DDQH 2VZTA 1WIPA 3GB7A 2LU4A 4KC3B 4BK4A 4JM4L 3TH4T 4O02H 4U1MA 3DGCR 1JWSA 4QRSB 2BRRH 3A6BL 1KGCE 2AV1A 2R2HB 3VE0A 1JN6A 5BMFH 5BZWA 4O2CB 1OQOA 4AH2A 1E4KA 5K9JH 3AREC 3G9VA 1HKFA 4JPKL 4HS8L 3S3SA 3ZE0F 4MAUL 5KZCD 1REIA 2FWOA 1TQCC 3Q5TA 3OAYH 1C5BL 1TPXB 3QUXC 4FFZL 4P46C 4M48H 1CICB 1IAOB 1J1PH 3NFPA 2ATPB 4KY1L 2NY4D 5I76B 5C6TH 1KTRL 4OLEA 5LGJA 5F72S 3QNYA 5DQ9B 3D69B 2FATH 5KSBE 2DQCL 1U8KB 5E2WH 5HHVH 1RMFH 1IC4L 3EAKA 4ZUSB 1YC7A 3C6SA 5EU7E 2A9ML 3CFKA 1TQCB 3U46B 1KEMH 1RUML 3UTTB 3PQYD 2WWKO 3P4LA 1SY6L 2FDBP 2R8SL 5SWSE 1IAKB 3B2VL 4FZ8L 4J1UA 4P3CL 4ODHH 3OMZA 5ESVB 5F9WC 4QTHA 3TBTB 2VWEC 5AYQA 5F70A 3KWWB 3STLA 4BH7A 4KWUA 5KSAB 2C3VB 5FCSH 2XNAB 1FLTX 3CZFA 2BVOB 4ZXBA 1MFEH 4P23A 4NWTL 3VG9B 3IDIB 3P4OB 3JV6B 1Y18B 2WNGA 3F7YB 2NY6C 1KPRB 2ENYA 2V2XB 1PZUB 1DUZA 4L5FL 3MBXH 1RJLA 1QSFD 2AK1L 3TVMC 3D3VE 3MJ9L 1TXKA 4C56E 4K23H 3VXOB 4I0CC 4I3SL 5EA0L 4DKFL 3UMTA 5F9WB 5IMOB 3BEWB 5DFVD 2VOTA 3RQ3A 5HHOE 3L3JB 3HMXL 1GHFL 1T21B 3KPQA 3LB6C 4KI5E 5C09E 1J8KA 2ZOLA 1IKFH 2P5WA 3BKML 1DBKL 3VMOA 5HJ3B 1TJHL 4O2CA 1KCVL 1V7NH 1YYMH 4NWUL 2HTKC 3FQRA 2X4UB 4WUKL 4XVJL 4UTBH 2NY7H 1AFVL 1RULH 5DJCB 2P45B 3TVMB 4HXBL 3UPCA 5C70A 1MNUH 5TE6L 4CADB 2Z4QA 2BX5A 2PTVA 1YN6A 2P4AB 4ZOBA 4LCWD 4XPTH 5TQ0L 5I0ZA 3DGGB 3SGEI 2EH8L 3RZCC 1C16A 4GQ9H 5DYOB 1B2WH 5C0AB 4I13B 5LBSL 2DQIL 2FJFB 2ATPA 5C07A 2HJLB 3C5ZD 3QFJE 4U05A 1UM6L 1HSBA 2YBRB 1TTGA 1Q0XL 4M93C 5DQ9A 3RVXC 3GDBA 5C08D 1A7RL 2WLZA 1F3DH 2APFA 3D69A 4OZFH 5INCB 1U8KA 1M71B 4TVPH 2FB4H 1M05B 5I17B 4M7ZC 2OZ4H 4YGVB 3CFCH 3QUXA 5IIEB 1ZA6A 2EO9A 4P46A 1CFSA 1JYVA 1DFBH 2BNUB 5E1AA 2AABL 1RD6A 3C6LD 3QO0B 1IAKA 2X4SB 3LHPH 1M7IB 5JW4Q 3QWOB 4PJGF 1AD0B 1GZQB 4Z8FH 1S5HA 4FQ1H 1B90A 5DD0H 2GJ6E 1KB9J 4JFDB 1IQWL 2R1WB 3BP7B 3ULUL 5GGUB 4M93B 3W5MA 4DCQB 1QRNB 1IGMH 4IRSD 4OF5A 3T8XB 4K7FB 4P5TD 3IDIA 4M7ZB 2DN7A 1EK3A 1YEGL 1KPRA 4NYLA 5DF0A 3EOBA 4NM8L 1DN2A 2DLFH 1TZIB 3O8XB 2IBGA 4U0RB 5DD1L 2YD9A 3VXOA 5D93B 1MRDL 3H9HB 1CF8H 3BEWA 4U6HB 1CDUA 1BLNA 1JF1B 1T0NA 2W9DH 3MRIB 2NY3B 1GRWA 1J0YA 4X6DB 2BVTA 3I6KB 3FL7A 1R6VA 1T04A 4Y1AE 1L6ZA 2DQDL 3DVFA 5T3ZE 1QKZH 3ARDC 4KVCH 1KJ2H 5DJCA 5HI4D 1TETH 3TVMA 43C9B 5JQ6L 4ODWB 4DOHB 1RK1B 1G7JB 4CADA 2WWMD 4DZBB 3OJVC 2G9HA 4DQOH 2IAMD 5EFIB 3C09B 1FVDB 2DQHL 3QI9D 3UJJL 4G6KH 1P7HL 2QKIB 1QFWL 5DYOA 1JNNL 3CC5A 5JZ7D 4ZUWA 4NKOB 4RWYH 3MLUH 1JUFB 5HVWA 2VLJE 3B9KD 3ESVF 2HFTA 2YBRA 3RWGA 1BFSA 1BQHG 3GJFK 3PGDB 3WBDA 4AT6A 4EZMA 1M71A 4HCRH 4R7NA 1J86A 2WWKT 5I17A 2YXFA 4HT1H 2BJMH 5F97E 5FIEA 5AWNL 1U3HC 2XG5A 3BP4B 1GAFL 5IBLC 3RZCA 5CGYC 4E41B 1AE6L 2XTLA 3QO0A 4ZSOA 1NLDH 1QLEL 3S37X 1M7IA 3QWOA 3K3QA 3O45A 5ECJE 2VZUA 1FO0H 1B9ZA 4DGIL 1CR9L 1FRGL 3FOMB 5GGUA 4DCQA 1QRNA 2ICES 4YDIH 5L9DH 3G9AB 4IRZL 4K7FA 5CILL 1QBMH 3RIAK 3X3FL 1KOAA 1AJ7L 3MRJB 4HIIA 5TDOB 3MJ8B 4DEPC 4KKBC 5FYJL 4LLQA 4MB5A 5JNYB 2YEZA 1TZIA 3O8XA 3SGDH 1Y6MR 5J1TC 3BVNA 2VISA 5I1DA 5FHBL 3H9HA 4U1JA 1JZ6A 3HZMB 5I16A 5HTSA 4Z0XA 3INUH 2IANE 4YHKH 4HK0A 4X7FC 3D2UB 4F57H 4PJ7A 4LSTH 5SWSD 3L1OH 3MRIA 3FQUB 4IHOB 5ACZB 3I6KA 1R3HA 4RFEB 4QT5A 5FO8A 2ARJB 3FN0L 4JHAH 1BBDH 1VGEL 3PWNB 2LQRA 1T7VA 3VW3H 2CJUH 3HR5A 1KTDB 4V1DD 1CK0L 4MQTB 43C9A 3Q48A 1G7JA 2CSPA 2X2YA 4JAMB 4UDUB 4DZBA 4DJMA 5E99L 5EFIA 3MROB 4S1DC 3D3VD 2C3HA 2X10A 2VLKD 4JKWA 4C56D 4HK3J 3ARGC 2O93L 3H7BA 5KS9E 1ZHNA 3QUKB 1G7HB 4R8WH 1I9RL 1JUFA 2ARWA 3VRIA 4X8JA 1INEH 5H2BA 3EFFA 3TN0D 1BP3B 1NMAH 3ZT7A 1JPFB 4KI5D 4N0CD 5C09D 3ARDA 3QPQC 4OIIH 3RVTC 3MJ7B 5SWQA 3PXHA 3QQ3A 3B2UD 4KJYB 1BFOA 5C2BH 1JP5A 4NJ9L 5DI8A 3P3YA 5TFSL 3MFGB 3GK8L 5SX4H 5C86A 1HI6B 3MOBH 1CFVL 4JKLA 4HWEH 1HILB 3GHBL 2QADD 4ELMA 5HGBA 2RHEA 3IGAB 1NDMB 4LASL 2WIIA 1MCWW 1T5XB 3FOMA 5ESAA 4FQIH 3CH1B 1IGCL 2VDPL 4GKNA 5EB9A 2A74B 3WL9B 3QFJD 1U3YA 2W07A 2ZUQB 3DV4A 5TDOA 4KTEH 3MJ8A 4TSAH 4G6FD 1U3HA 1J8HE 2VRAA 3LSOB 5JNYA 3CCHB 3JBG7 4OZFB 1ZEAH 4ZG1A 4JRYA 2EDOA 1FHGA 3HZMA 4JGJA 1JTPA 3VCLB 1VADB 5I8KH 3D2UA 5DRNA 1OGAA 2ADJA 5KVMC 2GHWB 3P0YL 1K5NA 3FQUA 3FB6B 5ACZA 1DQLH 1A6WH 1WIUA 1AGDB 2ARJA 3ARXA 3LKPB 2P7TB 1XGTA 4L4VB 3GI9H 4PJCA 4GMTL 4F7TA 4IRJD 3Q1SH 4JFQA 2Q86B 3MRLB 4UDUA 3S9DB 3LKOB 2VSDA 3MROA 4LKCB 1AQDB 2EDKA 5I2IA 2PW2B 3MJ6A 1YQ2A 2VH5L 3HN3A 1OM3H 5EO9B 3VXMB 1MFAH 4P9ML 3OR7B 4OI9A 3CSYB 3D5OF 1HXMB 3VXPA 1JRHI 1NPUA 5K9QI 1JPFA 4OZIE 3SGKC 1RUQH 2Y07H 1SJVA 5MENB 4Y1AD 2QTEA 4KJYA 1IRAY 2V5SA 2EIBA 5T3ZD 3L3IA 1KCKA 2UV3A 4HPYH 4NRYB 1A4JB 3ARGA 4X7DC 3BW9A 2P42B 4NHCH 2HT3D 4JPWH 4JPVL 1T66C 1N5AA 4LLVA 4XWOD 2BSED 5CJ5A 2P5ED 1NDMA 2VZ3A 3DWTA 4Q7DA 4YHIB 4PJ9D 2XQYG 3MLSL 4U4BA 3ZTNL 3TM6A 2VAJA 2VLJD 5DUML 3WL9A 4L9LB 4YUEL 4Y4HC 3GBLA 5KSBF 4ONHB 2EYSB 3QULA 5A2FA 5JLZB 3V5HB 1J88A 3LSOA 1J5OL 3CCHA 2XI9A 2AEWA 4OZFA 1RUPL 3QCUH 1NBQA 2DDQL 5KJRH 3DV6B 4X6BB 5KOMC 5E70A 2YPLB 3NIDE 1KNOA 1VADA 1CXFA 4PGEA 5FAAA 1FE8H 4O02L 3TPUA 1E4XI 2VIRB 3QFDA 3U7YL 5DJDB 3BWUC 4RMSA 2BRRL 1I1YA 3KYOB 3LKPA 2QQKH 4OBRA 3SDAD 2P7TA 5BMFL 1URLA 2E9JA 3QUZC 2WBJC 4JQIH 3RWFB 4Q9QH 1JF6A 1QFOA 4S0TD 5K9JL 3MRLA 5E5UB 3WUWB 4LKCA 2QBWA 4MXQD 1AQDA 1F8TH 3ZKMD 2ZNWA 5CP3H 1OTUD 2Z0BA 3OAUH 1OAKH 1U8NB 1NKOA 2EZ0C 1GIGH 2AK4B 3VXMA 4M48L 2IAND 2Z92A 1J1PL 1D6EA 3W81A 1RU9H 5K9OA 2H32H 4Y4KC 5EOCH 1E0OB 5FGCB 2ZSVA 2H26B 3RNQA 1OTTC 3L95A 3B9AA 4M6AA 2X1QA 5B39B 3BZFA 1E27B 2WBJB 4HW6A 5C6TL 4RQQB 4PD4J 3UTQB 3LD8B 4FG6C 1VERA 1XR9B 2NXYD 4M8QA 2KDGA 4JO2H 5BRZB 3K8MA 2FATL 3WS6C 2A0LD 5E2WL 5HHVL 3WFBH 1RMFL 4NRYA 1KJ2A 3B4NA 1WFOA 3UBXI 4EXKA 4L3AA 1KEML 3I3EA 1QVOB 1CBVH 5BQ7B 4JRXB 4OM1H 4EIGB 2SEBB 4NCC2 3OAZK 4WHYG 4YFLF 3A67H 4CBPA 5C0RH 4APQD 4IDLA 2M8XA 4UQ3A 3DETD 4Y4KB 3MODH 3KPRA 2DTMH 3SGKA 2LAGB 4PJXB 1LEGB 1PQZA 2AKRB 2CIIA 3NZ8B 1FV1A 2X09A 3I50H 4XNXH 2EYSA 2Q3AA 2J3SA 2WINA 1MFEL 4M3JA 1R5WB 5B38B 1OAZH 4ELKB 1I1RA 3SDXE 3VFNA 1G0DA 4HCRA 1AD9A 3MBXL 2GCYB 4X6BA 5FF6A 1UVQB 1V3JA 2ATKA 4ODTH 4F7MA 1QFUH 2EE3A 4K23L 4IJ3C 1C5DB 3HE6C 1D7FA 5EIVA 4LKXB 3LEYH 1RK0A 1H3PH 4Y4HA 4HXAH 1CT8B 1G1YA 1MCRA 1FO0A 1IKFL 4NZTH 1TFHA 1RV6X 1V7NL 1YYML 4FQCH 3VXTB 4F9PC 2W9LA 2C1OA 1YY8B 2HAZA 3RWFA 2NY7L 1RULL 1LK2B 3BWAA 4FFVD 2R0WH 4TOYH 1WBXB 2DWDB 1N4XH 4RIRB 1HINH 1MNUL 3IXAA 5T3XE 5JDJA 4IDJH 4UIMB 2HJFB 5A2KH 1D5IL 1BZ9B 1ETZA 1KT2A 3GSXA 5DRZB 4MNQB 4YO0B 1B2WL 3TNMB 1P4IH 4DK3A 3GMLA 1EUTA 4GAFB 4XCCH 5B39A 5ICXA 3QUZA 2WBJA 4M7LT 2NW2A 3P77B 4TRPH 4TYUA 1XR9A 3RWCB 5BRZA 2COQA 3KPLB 4FTVD 4TVPL 2Q6WA 2FB4L 1K4DB 3WEXB 4MD0B 4X5WB 2JCCB 2OZ4L 3CFCL 5FYLE 4LPXA 4JRXA 3FTGA 4JY5H 3AM8C 2F54A 5DTFA 1LP9B 1MVFA 4Y4KA 1MAMH 4JHBA 4PJXA 4UAOC 4PLKC 4HIHA 1S3KH 4M1GL 5HXMA 5CCKL 3RJQB 1DVFD 5DD0L 1NGWA 3NFSH 5ILTH 4ODVH 4BUGA 4P2QA 2XG4A 2QSVA 3PABA 1J18A 5D70H 1XIWD 1IGML 3WS6A 1R5WA 5B38A 4ELKA 1CDYA 5EDXA 2G2RB 4MJID 3IETB 4N68A 3O3BA 1INQA 4HK3N 1DLHB 3TO2A 3V79C 1BX2B 1NGQH 1UVQA 5TDNA 1DE4A 4HIEB 5IUSA 3QIUD 4QXWA 4U6VL 2EO1A 3ZYIA 1NCCH 1MCNA 1IEAB 1IGIL 1G7QB 1T7XA 4HUMB 5KTEH 3VFPB 2W9DL 4LKXA 4PGJA 4PRPD 4UMGA 4KROB 4CNIB 3E3QE 4NGHH 3R8QA 1I9IH 2K7PA 3VXTA 4KI1A 1YY8A 3LV3B 4NQCA 1QKZL 4PRHA 4KVCL 1KJ2L 1KPVB 2VXTL 1TETL 2DWDA 2EDFA 1LWRA 1QSEE 3EYVA 2EDNA 2ZP0T 3AMKA 1WITA 1M4KA 3HE6A 4Z9KB 4WEBH 1BD2E 5T1KB 1C08B 4ONGH 4G6KL 1T2XA 3LQAH 5GSVB 4D0CB 1NC4A 5DRZA 3TF7C 1CI5A 3QXUA 2FBJH 4PJHE 3ZKQD 4X6FB 1S9KC 4RWYL 3MLUL 2C4FU 2O5ZH 1BFVH 2OL3B 4F7CA 4P2RD 3QQNA 4F9PA 1A21A 1RIHH 4O5LH 2YD4A 3RWCA 4TUOB 4PRDA 2HFFB 3NCYS 3M07A 3LQMA 1N0LA 4OFYA 3AU1B 3PHSA 2BJML 4MD0A 4X5WA 2JCCA 5M95B 3UDWC 1MOEA 1I1AC 1UCBH 4LEOA 3NZHH 3O11B 4XVTH 5MEOA 4RX4D 1NLDL 3K4ZA 1KCSH 5IGXH 4RDQG 4W6XB 1G7MB 2ZCLH 2C26A 3K8LA 3MCKB 2X05A 5I8OL 1MH5B 4YDIL 4NQSB 5L9DL 1QBML 2FZ3B 3QJHB 2AS5M 3E6HB 5IB1A 1KACB 2I24N 3L3GB 4OKDA 1CQKA 2G2RA 4M00A 3LKSA 4U2ZA 3AM8A 2XY2A 2IPUG 3CUPB 4HMDA 1HWGB 4NZJA 4S2SB 2NY4B 3INUL 3ARFB 3SO3C 2R2BB 4YHKL 4F57L 3VFPA 4IOIA 4LSTL 3L1OL 4NNYB 3T0BA 2PUQT 2H3NA 4CNIA 4JHAL 1BAFH 1BBDL 4Y4FD 1MFCH 1DBAH 2RFXA 3D85D 3LKQA 4ONFH 5LGKA 3VW3L 2CJUL 1S7RB 3O3DB 2UZIL 1VEOA 4KK9C 3KR3H 1J11A 3QP3A 3VFGH 5I30H 2GSIB 3S36L 1EFQA 1B6DA 5A2JH 2BNRE 2Z91B 3SO3B 1IAIM 3VFWA 1Q72H 5J11C 1XH3B 4GXUN 4X83A 3GMRA 5IHZB 3VXNA 5MP6L 3MGTB 4TTDD 1NAMH 5DDHA 1P53A 2AEIT 5ID1B 3QXDA 3ZL4H 1QSFB 4OIIL 5ICYB 1NANH 1NUDA 5BXFB 3MRNB 3BD3A 4OLXH 5C2BL 5L8JB 1LVEA 1DDHB 3FAWA 2QSCH 3O11A 3DYOA 4TUJB 3MOBL 1SYVB 2BHYA 5CP3A 1A14H 3DX7B 1UM4L 5GPRA 4AM0B 4ZNCD 2BHUA 3C5ZC 4F33A 5JHDA 3FT2B 4OZIF 3L7FB 3MCKA 5GRVL 1NMCC 2PYEE 4HJGB 4XVUD 4FQIL 1MH5A 1N26A 1ZVYA 4Z0BH 5IBUB 2H32A 2FZ3A 3FB7A 5I1GH 3BPCA 3RGVD 4KTEL 3L3GA 1H3XA 3UDWA 1I1AA 1UWEH 1JI2A 2Y7QB 4C54A 3D0VB 3JWNC 1KCRH 2A6DB 1Q0YH 4FQXD 2Q76A 3CUPA 1ZEAL 3C6LC 3B5HA 1KTKE 4S2SA 3C5ZB 4OGAD 3DI3B 5L88H 4POZC 1PKQB 2R2BA 4QRRA 5I8KL 1NMCB 4KQ3H 2DL2A 4ZOAA 2KKQA 3WLBB 5C08B 1KXQE 4IRSC 1DQLL 1A6WL 4P5TC 4JREB 3MC0A 4HFWB 5K9KB 3MACH 2CLRB 5IW6A 3PQYA 2HMID 1M6OB 4ZFZB 2GSIA 4WW2B 2FEEL 3DSFH 5D7LA 4UQ2B 3GMMB 4OLYH 5E2JA 3S96B 1AC0A 4X0KA 3F7RA 2HKHH 2YD3A 4JDZB 4IRSB 4EI5C 3UEZA 5J1AA 1OM3L 4P5TB 1MFAL 3BRGC 1ZWIB 4K7PX 4GG6E 5I9QC 3HTLX 3LQAC 4HUUB 3MREA 5CD5C 5JXAH 1QSFA 5ICYA 4N8VG 2XZQL 5BXFA 1WCBB 2LTQB 3K1KC 3MRNA 3T2PA 2K7QA 2BSRA 2WWMC 7FABH 1EGJH 3GSQA 2ZUTA 1UWGH 2HWZL 4XP9L 1QSED 1DDHA 1UC6A 5C0CE 4NHCL 4JPWL 4TUJA 3MBED 1BD2D 5JZ7C 4WUUE 1SYVA 4JZJB 1FSKC 1P6FA 1OTSD 2J12B 5T3ZH 1VA9A 2CDFB 3L7FA 2GK0B 4HJGA 1VACB 3O3AB 5DEGA 4MB4A 5JOFA 4I5BB 2Q3ZA 3L3HB 3PP3K 4EXPX 2IAMB 3VXSB 3QI9B 4Y19E 4LCWA 3OHXB 4YFDB 4MAYD 5DVLA 1JK8B 4MHHI 3QCUL 5I66B 3DRQA 4P99A 4YIQA 4X7CC 3B9KB 2EXWD 3C5ZA 2G5BA 1LO3H 4HLZG 1FE8L 2OL3L 3IDMB 3WLBA 1R0AH 4G9DB 4P2OD 4R96A 4ZS6D 3D87B 1LMKA 5JOPD 4LSRH 4JFFD 1BOYA 3G6JB 2QQKL 1QG3A 4NQXB 4GJTB 2CLRA 1Y6KR 5JORB 5EU5A 1EXUA 4JQIL 3C6LA 4Q9QL 5EU7C 2D3VA 3HC4H 4D0DA 5GJTL 5DQDH 3BIAX 3GMMA 4M1CD 2QHLA 5I6XC 2CUIA 4OQTA 1F8TL 1ZT1B 2BC4B 4ZO9A 1OAKL 3OAUL 4F7PB 1OWRM 5CZXD 4IRSA 1GIGL 2XA3A 4C57C 4HGWB 4P5TA 1ZWIA 1RU9L 4U2YA 2XZAH 2CIKB 5EOCL 3RHWK 1HK6A 2ERJC 3DOSA 2FECI 4HUUA 1UQSB 4YEFA 1JFQH 3FQXB 3OKOB 1WCBA 5FUZH 2IBZY 3BGFC 2A2QT 2CK2A 5C71A 2VABA 3WLWC 4JO2L 4YHNB 4PJFB 4RZCA 1NUFA 1IMHC 4BZ1H 3QQ9C 3WFBL 3P4NB 4I77H 2BERA 5SWSB 1TNNA 2DLIA 4EI5A 1CBVL 2O61A 2BNRD 4AL8L 1E6OH 5FO7B 4OM1L 4JVUA 4UNVA 3VRJB 2C7UA 2ZOKB 3A67L 3TFKC 5IR1B 2CDFA 1TJIH 4PRIE 2DTML 2GK0A 4KI5C 4N0CC 1VACA 1QNZL 3EBAA 4V1DB 5I1HH 3IDXH 3KPTA 3ZTJH 1JPGA 2AV7A 3BGFB 4I5BA 3I50L 4XNXL 3MCG1 3QZWG 4QNPE 4E9LA 3PIQB 1PG7H 2W38A 3RPKA 5HVHB 1WSST 4WRLA 2VLKB 3OHXA 3TYFA 3ZYOA 3KYMB 1JK8A 2VDOH 3AS1A 1IC5H 5I66A 4JY4B 2HFEB 2L4OA 3V6OE 4TSCL 3B9KA 4ODTL 3TN0B 1QTYT 4X9FA 2VAAA 1QFUL 2NXZD 4LCCB 4XB7A 5JW5B 5GRXG 3IDMA 4XNQA 3VWKC 1JF5A 3LEYL 3P73A 1H3PL 1MCBA 2PYED 4K07A 4HXAL 5C0ND 5J6GB 4M6NH 1Q9KA 4AEHH 1T1XB 4IIQC 1CLOH 1AR2A 4NZTL 4K3EH 3PNWA 5CBAA 4FQCL 4KUCD 2NW3B 4UZGA 4YBLC 1JNLH 2DAVA 2VDRH 5F1IB 1WUNT 1U8JB 5DVNA 4L4TE 2R0WL 4TOYL 1RQ5A 2QADB 3DX8B 3KLAB 1N4XL 4OCXH 2BC4A 1HINL 4JCMA 4Z76B 2DJSA 3LOWA 4IDJL 3HRZB 5DHYB 4PP1D 2X4NA 4GRWB 2VL5A 3QFJB 2DYPB 4GAYA 4HGWA 5D96B 2BVUA 3BGMB 1IM9D 4G6FB 4K94C 1P4IL 1MCFA 1SEBB 1RZ8B 2A6IB 3FO2A 1HYRC 1FGNH 5KSBA 1KJVB 4XCCL 1G1CA 1J0IA 2HJKA 4H5SB 4YBLB 4F37K 2YHGA 3G5XB 1HEZB 4TRPL 3P30H 3PWLA 3HUJB 5C0GB 2QR0B 3DVNB 1BQSA 3L5WB 5ENWA 4CL7A 5SWSA 1F00I 5GHWH 1A6PA 4R26H 4LEXH 3KPMA 4HJJH 5FO7A 2HRLA 3ORJA 2AJUH 1ZLUH 4JY5L 3S97C 2AW2A 2A73B 5HI3D 5DZNA 1MAML 3P9LA 1BGXH 3BPLC 3SKMB 3V4UH 5F7LB 1S3KL 4ZOCA 1Q9OA 4DAGL 4OSUH 5SWZE 5ILTL 4ODVL 4IRJB 4KKLD 3MRFA 2VZ1A 1NAMA 1QFHA 5D70L 3PIQA 5E2VH 5J6HA 4OZHB 2YUXA 3IFPA 1IGJB 5IHLB 1AP2B 1RJZA 3D3VA 5IB4A 3CFDA 4C56A 2VLKA 5TH2B 4BQ9A 2E7LC 1L0YA 2J8UF 3C5SA 1UXWB 2HT3C 2X4OA 3JUZA 2OSLA 2YRLA 4JY4A 2WQ8A 2R1YA 4XWOC 3ARVA 5HHOA 3TN0A 3CLEH 1C12B 2WUCH 1NCCL 5C09A 1KCUH 2LVCA 5AEAA 4WUUD 3SJVD 1F02I 3AROA 1ZT4A 4GMSH 5KTEL 2Y6SD 4YWGL 5EBLA 1ZV5A 2ICWI 4PGBB 2YC1B 5J6GA 4PJAF 2J4WH 3RJDA 1X9QA 1T1XA 2NY2C 4NGHL 1I9IL 2NW3A 4N5EC 2XQBH 4HZLB 4Y19D 2AXGB 2P5EB 3KLAA 3SHSA 1FDLH 1WT5C 4CN4A 4PJ9B 4Z76A 2YUVA 3HRZA 4WEBL 3HPJA 4WI8A 2IH3A 5DMGC 4LHUD 3VWKA 1PX3A 3QFJA 3DPBA 4NNXA 5J9PB 3BGMA 4PRBB 3VXQB 2FBJL 4YNYB 1CD8A 4IIQA 1BFVL 3SDAC 1RZ8A 2A6IA 4WTWA 5IMMB 1KJVA 2YUWA 4ZO7A 5EOQH 3G5XA 1PKOA 1HEZA 4O5LL 3LVEA 4Z5RA 2JB5H 5C0GA 2QR0A 3DVNA 4IOFD 3L5WA 4ODSH 4MXQC 3ARYA 1OTUC 1UH2A 4HV8B 4P5MB 5JIHA 4PV9B 4EKXA 1OSZA 3CFBA 3RVWD 1UCBL 3KS0J 2XACC 4Z7WE 4GRLD 4QTIH 3NZHL 5JTWA 4XVTL 4XPBH 4X4XA 2DQUH 2X70B 3IJYB 4WIQA 1KCSL 3SKMA 5IGXL 3OAYK 1FJ1A 3DHMA 4EEEA 3EOAB 4Y16D 3C2AH 2ZCLL 3SEPA 4IRJA 3UZEA 1QD0A 1Z0NA 1AR1D 2NXYC 2F8XC 5IMLA 2A0LC 4H26B 1FYHB 3SY0B 5LWYH 2FIRT 5CSGA 1HH6A 4U7SA 5IB5A 1UXWA 5DJYB 3KXFE 1A3LL 1GGBH 1GC1H 1QR1B 1EGJA 4LVNC 1MCKA 5HHQB 1KF9B 1U91A 3DRTB 1NH6A 2EE6A 4JEGB 1AI1H 4Y1AA 3PL6D 1ZOXA 3NCEB 1U2CA 2X40A 2NXYB 5TE4H 3E6FA 5IW3A 5HYSB 3L5JA 3T08A 2E9BA 1PZ5A 3CVIH 2E7LA 2CRMA 1MFCL 3KNBB 1DBAL 4KRLB 1AH1A 4CJ0A 4ONFL 2D0HA 1A9BA 1R3LB 4BFIA 4HZLA 1T80A 3P9WB 3I9GH 4N0YH 2P5EA 4APQB 3AGVA 4LVNB 3VFGL 5I30L 8FABB 2ITCB 2W9EH 1BPVA 3EYSH 3IFOB 4KXZH 4JFEE 1ZE3C 2VLJA 1Q72L 1ZLVH 4OI8A 4MZ2A 2GFBB 2GT9B 4UOW0 2HH0H 4NN5C 4NQED 1ZLWH 4UNUA 3V95A 4G9FB 4H88L 2CLVA 3SE8H 3ZL4L 3HI5H 4U1KB 3ARQA 1XAUA 1U2HA 4RMWA 3UP1A 5B3JE 1WBZA 1WT5A 3RI5K 4HV8A 5I1KH 2HRPH 4F58L 4JZNB 4PV9A 4XMLH 3ALPA 5L6YH 2QSCL 2CPCA 3IJYA 2XN9B 4N0FB 4XNMA 3SDAA 5E6ID 3EOAA 2NLJB 4TNVK 4LPUA 1A6AB 4G8GE 1GOGA 3FZUD 2I07B 3QT2A 2X6MA 4Z0BL 3NA4A 5T3XH 1DEEB 4DVBA 4H26A 2B5IC 1ZK9A 4NQDE 5I1GL 2I60H 1LO2H 2DRUA 3AS2A 2Q87A 2F58L 3S4SB 5EUOE 1UWEL 1I8MA 3PJSB 4YXHL 5GSRB 5ICZB 1KCRL 1Q0YL 3V5KB 5KG9B 2IANA 1N6VA 1QR1A 3W82A 4UI2A 2NX5E 3LY6A 1V7MH 5FA4B 2RAMA 3LN9A 5DS8B 3BN9D 4OCYL 5L88L 2MPAH 1Y0LA 4KQ3L 3MRGA 1MFBH 4BUHA 4XBGB 1MRCH 1CTOA 2PYFA 3SDDD 4LSSH 4FTVB 4OV6F 3HE7D 1YMHB 3BZEB 1N3NA 2IEPA 2Y06H 4LIQE 1ZTXL 4J23A 4K3JH 5FYLH 5DJAA 1S9YA 1ZHLA 5GGVH 4CW1A 5J0BA 4KJPC 3MACL 1R3LA 2VUOA 1KIQB 1S9XB 5MERA 5IQ7H 3TYGH 2YA2A 4RWHA 4ZPVB 8FABA 2RBLA 3DSFL 5KS9A 1CFNA 2V5RA 4F15B 3UCRA 4OLYL 1X7QA 2QV2A 1KENH 1DVFB 3U2SB 2ENSA 1XF2B 1N2RB 1X3DA 4I2XE 1JGUH 1Q9WB 3HZKB 1XIWB 2CLZB 1KPUB 4X4YB 2HYMA 3IDNA 1W0WB 1CWVA 2NY0D 2XTJE 1XGQA 4MJIB 3U4EB 4ZNEE 3P0GB 4QHNB 5IJKC 2R39A 5JXAL 4MJ4A 3MJGX 3QIUB 5A43C 1K9TA 3Q0HA 1NBVH 4L3CB 1NCAH 1FVCA 3DTXA 7FABL 3CDCA 4WDIA 1UZ6E 1EGJL 4JZNA 3UPAA 3HZVB 3LS5H 1UWGL 5EU4B 3OSKA 5FDYA 3DROB 4FS0A 3DX9B 3RNKB 2NMSA 4N0FA 4PJBB 5F7FA 4ISVA 4PRPB 2DI9A 5T3ZL 5E9DD 1OW0C 3KJ6H 1A6AA 4H0IA 1J8HA 2ADIB 2I07A 3RX5A 2K1MA 4MD5A 3OKNB 3I84A 1S5IH 1FNHA 3RVUD 4ESKA 1EUUA 2P24A 2MOVA 1JPST 5ICZA 2FSEB 2DJ4A 3V5KA 4CVZB 3I3DA 4U3CA 5FA4A 4JM2B 5KOVC 1HNGA 4P2RB 4PJ8C 2VITB 1VESA 4LQFH 1LO3L 2Z35B 4ORGB 1LEIB 2E7BA 3UYRL 1GC1C 3DHJA 4KPHH 1NLBH 1BQLH 4XXCA 5SV3A 1R0AL 4FTVA 3VFSB 3HAEH 5F1OB 4LSRL 2C1PA 3UPRA 4E5XA 3ZLQC 1KIQA 3KYNA 5J06A 2RR3A 4ZPVA 3HC4L 1QACA 1MJ8H 3KXFD 4KKCC 1CDIA 4DGVL 3RTQC 4ZTPH 1XF2A 1IEBB 1XIWA 4LNRA 4Z7UB 5LQBH 1CFTA 3SCMB 2PO6D 4ZUTA 2VDQH 4JRWA 1IE5A 4O4YH 1W0WA 5IG7B 4R4NC 4MJIA 1ZHKA 2XZAL 3G5ZB 4YHLH 3U4EA 5M94B 4Y4FC 2NY1C 4RDQF 1LEKA 3FB8A 1JFQL 5FUZL 1YPZB 5I1EH 3WO3B 4BZ1L 1IKNC 2APBA 3G08B 1AKJD 1UXSA 4QHUB 3BPNB 4I77L 3NTCL 3LPWA 3DROA 3P9MB 1AIFB 1E6OL 4Z7OE 5IKCB 4L8DA 2V5MA 2GITA 4MDJA 1A3QA 2XKUA 4GW4A 1TJIL 4P3DB 1A8JH 5I1AB 5IJKA 2E6QA 3NMEA 1H3VA 5D1QD 3GNMH 5JIKA 3U7AA 5I1HL 3IDXL 4LFHG 4NQVB 1TTFA 2PN5A 3MNVB 3OKNA 3SDXB 1F4WH 4B53A 3QAZC 3JTSB 1QA9B 2EKSB 3LRSA 4XAKE 2K9UA 1EBAA 4L8BA 2KL6A 4CVZA 5GGSA 2BNQD 2I9TA 1A0QH 2VDOL 1IC5L 4KDTA 1I3RA 3BUYA 4M8VA 3MLRH 3SKUD 5EC1B 1JGDA 1UYWL 1OW0A 1XGPB 5DRWA 1ADQH 4YHYB 4HGKC 3VJ6B 2OTUB 4H25A 5F9AC 1ZXQA 2CQVA 4FFYH 43CAB 4MJ6B 5DO2D 5JMOC 4OZFG 1KIRA 3QDAA 3V2AR 4KK5D 3VFSA 4GS7B 3RGVC 3ZDYF 4NN7B 1RZFH 2Z8VC 4G8GD 4M6NL 4NKMB 5GRVK 5AUMB 3V0WH 4XMPH 1CLOL 4KVNH 3C8KA 4K3EL 4NQDD 4FQXC 1JNLL 3UTTE 2VDRL 2Z31D 4CVWA 4RX4A 1DANT 4I9WE 3MFFB 3P11H 4PJ8A 5DJ8B 2BMKB 4OGAC 1R3IH 1BJ1H 4OCXL 3STZA 3Q3GB 1VCAA 4CMHC 1IEBA 5JO5B 1TLKA 5CZVH 4DW2H 3G5ZA 1FFPA 4AIZB 3SE3C 4PGCA 1WAAF 4HS3B 4JFHE 5J13C 1PX4A 2HMIC 4FQXB 1W0VB 3HFML 4RBPH 3VFTB 3CDYA 3C8DA 3BEVB 3ARPA 3P30L 1YPZA 1S7WB 1HKLH 3JV0A 1ITBB 1P2CB 2XXCB 4HIJA 2ZUXA 4QHUA 3H3KA 5GHWL 4WHYH 4R26L 2H2PC 3B9DA 1CLCA 4LEXL 1AIFA 4M7JL 5CWSB 4HJJL 2B4CH 1GCFA 5F44A 2V2WB 3DURB 3GKZA 4Y4FA 2J7LA 3DLQR 4P3DA 1VGKA 3D85A 1BGXL 4D9QE 2WSKA 3V4UL 4OSUL 3L3DB 5JUEH 5IEKA 3E3QC 4QOKB 5KSVA 4NQVA 2XTJD 2ICEA 4KK8D 1LO4H 1LE9B 3SDXA 5IESH 4X9HA 1QA9A 1IKNA 2EKSA 1T0PB 4BSWA 3NACH 1J05B 1GGUA 1OLLA 3MBEC 3TIEA 3GMPB 3DXAB 2VB5A 5C0AE 2NPLX 1OTSC 1YNLH 3CLEL 4NUJB 1KN4H 5EC1A 2WUCL 1XGPA 2W59A 1KCUL 3VJ6A 3L3KB 43CAA 4YX2H 4PGDB 1GYAA 1VHPA 4GMSL 4QKXB 2DM2A 2YMXH 3CFEB 2HTLD 5F9OH 4NKMA 2J4WL 3O3UN 2DMCA 1N64H 4PP2B 5CSBA 4G43B 4MAYC 3BESR 3T3MF 1KJMB 1A2YB 2XQBL 3DIFA 4IS6A 4U6TA 1NFDF 2B2XH 4MX7A 2EXWC 3PG2A 4PJHB 4ZUUB 2Z8SA 1UB5B 4JFDE 5L0QC 2D03H 3GSUB 4LVHB 4TN9A 5JO5A 1X4YA 3RGVA 1QFWI 4J3SA 1NBZA 3NA9H 3OKLB 3H3BC 3WUWG 4AIZA 4BKLB 3VXUD 4HS3A 5MHSE 1E28A 4FQXA 3VFTA 4I0KA 1S7UA 3HAEB 1S7WA 1ZT7A 2JB5L 4TVSa 3U7WH 2DS4A 2ED7A 4NDMA 4ODSL 5EORL 5KN5B 5B39G 5GS3A 5IFAH 5CWSA 4P2OB 4QTIL 3RZWA 1ZGLB 3H0TA 5C0EB 4X6DE 4XPBL 4JFFB 2DQUL 4O51B 3VD5A 1ES0A 5D5ME 2FYYA 3SE3A 4WHTB 3DECA 3SKNA 3C2AL 4XCFH 1IAII 2R2CA 3BX7C 1Q8MA 3U79A 5B3JF 1UA6H 1OCWL 2VDMH 3MPCA 1X5GA 3T04D 3VFOA 1J05A 4HULB 4HUWB 3CFJA 1EHAA 5BS0E 1GGBL 1GC1L 1LK3H 4Q6IC 4QHMB 4XP5H 2P49B 4KAQH 3O3EA 3SKOA 1EERB 4MDIA 4Z7QE 3L3KA 5B38G 1CD1A 1CGTA 1MCEA 3F5WB 3T0DA 4UBDD 1AI1L 3X12B 2VLRE 1H5BB 3F6IA 5TE4L 4QRTA 5IVZB 5IB3A 1EDQA 2YD8A 3C9NB 3CGTA 4XWGH 4F7EB 5DUBA 3CVIL 3PWVA 5FECB 5IK3B 1QSEA 1I7UA 4QY8A 3QG7H 4RGND 2DIJA 1U8IA 4G43A 4KMTH 5EUOF 1TNMA 5HGDA 4GQPH 3MBEA 1RZGA 1S7SA 1BD2A 4ZUVB 4E41E 1A2YA 4X7SL 1WBYA 3I9GL 1OPGH 4XAKD 3VGDA 4N0YL 4RAUB 4L8CB 2J8HA 2UY7A 1IGYB 1RFDH 1CDBA 1ZS8B 2NXZC 4K9EH 2X7LA 3B43A 2W9EL 4PJHA 1UB5A 2LVEA 4WFEE 3GSUA 1MI5B 1Q38A 2HFGH 3B8YA 1MQKH 1MJ7L 4OBSA 5GGVY 1QLRA 2HH0L 1Q94A 2R29L 4BKLA 2EDDA 4CRPA 4MAYA 4OV5A 1BZ7B 3SE8L 2C4XA 1F3DJ 3HAEA 4MA7L 3HI5L 4I48A 2H41A 2WUBH 4JO1L 1RY7B 3EYOA 2NXZB 3UTTD 3KLSA 5I1KL 4QRQA 3D1MC 1OD7A 3WE6A 4I9WD 2Y1VA 5L6YL 5C0EA 1H8NA 4UIKH 2R0ZH 4KKAC 5K59E 4JFFA 1K6QH 4JN2B 5E8OB 5FV2A 3L6FB 3ARSA 3OF6A 3NOIA 4WHTA 1G7PA 1K8DB 4B5EA 3FB5B 2F5AH 3TJEH 2B4CC 4M61A 2QLVB 1HE7A 4FQJH 4XPAH 1MELA 3G5VB 4JFHD 4LPTA 5I75C 1DBJH 1LO2L 3FKUS 4HUXA 3DO7A 3F12A 2MQCA 2XV6B 1SVZA 1BWWA 4JFPB 1SYSB 1IM9B 5HI3C 1YMMD 4QHMA 3DX6A 1V7ML 1MFDH 3ULUF 1NGXB 2ZG3A 3CX2A 2MPAL 1DZBA 4WWKD 5SX5H 3T4YA 4PBVC 5DHXB 3SKJL 1MFBL 1H5BA 3BN3B 4K3DL 1NC2D 2CK0H 4LSSL 4Z7NE 4Y5XB 5I75B 3IS1X 2VKXA 5GGVL 4K3JL 1YNTA 5IF0B 5F6HJ 1IM3A 2BNRA 3RVVD 1XCTB 1MCHA 3EO0B 4NKDB 5DQJB 3UC0H 1XGUB 1ZAGA 1HQRB 1PAMA 4Q6IA 3TYGL 1FNGB 1U8QB 1ZS8A 5FUOH 2PR4H 4PG9B 2Y5EA 3WNMA 1KENL 1OOAA 1N6QH 1BOGA 1NEZB 4GG6B 1ERNA 2I26N 5HI5D 1JV5A 3TBYB 2Y6SC 5FOBA 4MXWH 4XCNA 1JGUL 4XNYH 4TSBH 3I6GA 1IILE 1OLZA 4Q74A 4XNUH 1T2JA 3HPLB 1ADQA 2JK5B 5IB2A 4X98A 4XP6H 3VG0L 3GKWH 4OLWH 1MLCB 4N1HB 1VFAA 1HWHB 5HYQB 4UINH 1BVLA 1QEWA 3OXSA 1NBVL 5C0BE 1NCAL 3W11D 3NIFF 2IG2H 3SJVB 4OFDA 3LS5L 5CP7B 1FAIH 2EC8A 2PYEA 3UTPE 1B88A 3I2CL 3WKNA 1K8DA 3FAXA 1T1WB 3RKDD 4L4VE 2X89A 3KJ6L 1G9MH 4Y19B 2CKBB 4IOFC 5E4IA 2OMNA 1S5IL 3KJ4B 3GMOA 2CMRL 5DJ2B 5FB8A 3EGSA 4LHUB 1JWMA 3QYCA 2H1PH 4GRLC 2X41A 4WVRA 1R5VA 5C0IB 4Z7OF 3UO1H 3N1QC 4HUVB 4XPFH 4ZFOB 4LQFL 4NT6B 5DVOA 1KYOK 2NR6D 4KPHL 5MENE 1NLBL 1AR1C 1BQLL 2YWYA 5JXED 2F74A 3TCLB 4Y5VC 4X5XB 1F45A 4QXUH 3WHE0 5DFWH 5IF0A 4GRLB 3I85A 1XCTA 5DQJA 3ARBC 2A9NH 3FQNA 4CVXB 3I75A 1MLBA 2GSGB 2P47B 5KVDH 2HLAA 1II4E 2UVEA 1MJ8L 3BYYA 5BS0D 2GAZA 4M4PA 1NEZA 4XPGH 4Y16B 3VFMB 4GG6A 4ZTPL 1H0DB 3PL6C 2XOTA 3TBYA 2BK8A 4U1SA 5FGBC 4V2CB 4IMKC 5LQBL 4WI7A 1C1EH 3O81A 3ARUA 4K9EC 3QDMD 2VDQL 5C7XL 2DI8A 3MMEB 4O4YL 2VLRD 4YHLL 4UTAH 5F88B 4JM4H 3EZJB 1UZ8B 4LU5H 1U92B 4RMUA 4UU9B 2ZWLT 4LDEB 4EN3D 5C0CA 3CZJA 4M7LH 2FRGP 1HHHB 4R7DB 3A6BH 3Q2CA 4BQCA 4WUUA 2YPLE 4LHJB 1RZIA 3SJVA 1HXYB 4QHKJ 4AY0A 1NFIA 3V6OC 1P1ZA 1MUJB 2UZXB 3AB0B 4KRNA 1S9VB 2HVKB 5D7JD 5EIIB 2XZZA 1ZVSA 3KPSE 1X4ZA 3ROLA 2WM0A 2OJZH 3T0XA 4X99B 5KVEH 1T1WA 1NKRA 1U8OA 3GNML 4Y19A 2OQJB 5I18H 4K8RD 3V52H 4M03A 1C5BH 1PDKA 1SBSH 1F4WL 4DKEH 3FT3B 2NTFA 4LHUA 1CDHA 3MZTA 4BQ8A 4WV1C 2AK4E 1A0QL 5IBUG 1OAXH 4NQEB 4HBQA 4HLZH 5ALBH 4HUVA 1S7VA 3MLRL 5FGCE 3HCVB 3U0WL 4NT6A 5BOZG 4RGMB 1ADQL 4FFYL 1XF5A 5FA3A 4FA8A 3QBTB 3TCLA 2YS4A 4X5XA 3SQOL 5BRZE 3LKRB 2A6KB 2DICA 3VH8B 1RZFL 3MA9H 4KVNL 4GRLA 1GSMA 2MTPA 4PTUB 5J8OA 4P3CH 4R97B 5E94B 4JRXE 4ODXB 2GSGA 4KJQD 4U1HB 4NO5B 4U31A 2Z93B 3OPZH 2BSSA 3P11L 1RAMA 3D6GA 3QDJE 3BN9C 1R3IL 4M6OL 5E6IB 1KLFA 4Y16A 4NRXA 4NWTH 1S7XA 4AIOA 5CJ8A 3WN5B 3SDDC 1NFKA 1QR4A 4OF3A 3D48R 3MMEA 4X6EB 5EU6B 3ZDZE 5CZVL 4DW2L 2ADGA 2HT2C 2PXYD 1UZ8A 1U92A 3EHBC 4D9RE 5EA0H 2EC9T 4DKFH 4UU9A 3GMQA 1PY9A 2J5LC 2IQAA 4R7DA 5DSCB 3HMXH 1GHFH 1JNHB 4EDWH 4OCRH 3QH3B 1MUJA 3PL6A 5F3HB 32C2A 1S9VA 1DBKH 1H8OA 5FGBA 5DR5L 1TJHH 4PRIA 4IMKA 1EAJA 4MSWA 1BMGA 4LIQH 4RFNC 2B4CL 3HE7B 1T3FA 4HXBH 2NY0C 1I7ZB 3FRUA 3EDKA 2AJZB 5HVFB 1XR8B 4NO3B 2OQJA 1QYGH 1JHKL 5JUEL 1TVBB 4U1GC 1LO4L 2UUDH 3T0ED 2D0GA 2EH8H 2BY2A 4G8EB 3PHOB 5DGQA 3V6OA 2DQIH 1A9EB 1LO5A 4HH8A 4QRUA 3CVHB 3QO1B 5C0BD 1UM6H 3TO4D 4MNQE 4NQEA 1PVHA 3I02B 3QG6A 4EDXA 1OHQA 2FO4A 1YNLL 3HCVA 5K33A 1KN4L 1BF8A 5E8NB 1ACZA 3UTPD 4WU7B 4KDWA 4TPRH 3IJSA 2AEQL 4YX2L 1MCLA 1KFAH 4LL9A 4U1GB 2GUOB 2YMXL 2A6KA 4U6YB 3SQBA 5EZLB 4JZOB 5F9OL 4M02A 3QXAB 3RVUC 4L4TA 1FZKA 3JV4B 2JCCE 5EBWA 4PTUA 4WV1A 3L5HA 4LLMB 5H94A 1AXIB 3FCTB 3W9DB 1A6ZB 3LN4B 2ZSWB 4U1HA 3QPXH 1LP9E 2B2XL 2R0LL 5GS1C 2Y25A 5E9DB 1LGVA 2MJWA 4XT1C 4Z7QF 4GBXD 1F2QA 1FNLA 2E9WA 5CIPB 3U0PB 2D03L 5ADPH 1F3JA 1KB5B 4R0LC 2FJHA 5EOCJ 4X6EA 2YSSB 4JHWH 3VA6A 3QWQB 3PWPB 3PV6A 2DLGA 3ZT6A 4YDVA 3OJDB 4DVRH 3RWDA 3T3PF 2VO5A 2N4IA 5DSCA 3U7WL 5ESQA 4D0BB 4Z7WB 4KJWD 2EYRB 3JTTA 4ELMF 2GEEA 5F3HA 2BXZA 3HLAB 4ZFOL 4IMLB 1RJYB 3SDDA 5E24E 3LQZB 5IFAL 5D7KD 3OG6B 1AXTH 2PO6C 2GJZA 2M2DA 5EO1A 3BZDA 5SWZA 5FGRA 2IBBA 1QFPA 4U33A 1OP5H 1MHHB 3JWDH 4YDLC 4OZGE 2IBZX 1XR8A 2VR9A 3W0WD 1PBYA 5JIPA 2JB6B 3UJJH 2DQHH 4XCFL 3W39B 5ISZD 1U93B 3KXFB 3PHOA 5D1ZB 4HZAA 2OM5A 5JDSB 2VDML 4KK6D 5FHAL 5FYKD 3QO1A 3T09A 4YE4H 3MNWB 2PO6B 3IXTB 3LS4H 5BJTA 5DD3H 1LK3L 4KRPB 3DBXB 1KULA 4BJLA 1YDPB 4WNQB 4XP5L 1U8MA 3B9EA 5E8NA 3OKMA 1CXIA 3KPSD 4KAQL 4NO2B 1EEZB 5IJVA 1PEZA 4FXGA 5D1QC 2P8PB 1IL1B 1TDQA 3KPPA 1UB6B 3QRGH 3E2HB 1D9KD 1KCLA 4U6YA 1VFBB 4WW1B 2J2ZA 1KXVC 3QXAA 1AKJB 3GSWB 1QLEH 2ZJSL 3IF1A 3QG7L 4JY6A 4KMTL 4LLMA 4O2EA 2X4QB 1A6ZA 2ZSWA 1OB1A 4CUCA 5FM4A 2BCKB 3ZE1E 1CGXA 1JGVH 5E9DA 1RFDL 1BM3H 2AK4D 3Q6FB 1D6VH 1RUKH 1AC6A 1AJ7H 2OCFD 2YPKB 3MOAH 1EVTC 5DO2C 2L0DA 2R4RH 3MLYH 2HFGL 4KK5C 4NC1E 1MQKL 2DB8A 4KRMB 4JJ5A 1D5ZB 4JFZL 2D31B 1CGYA 3ZDXE 5BV7B 2P8MB 1W72B 4Z78B 2BNQB 3UBXB 2WW8A 5EO0A 3WNPA 1EZVX 4XZUA 3U4AA 5GS1A 4Z7WA 3N50A 2WUBL 5TDPA 3T77B 6FABH 1FAKT 5C6WH 5JW3L 3QJFB 4IMLA 4TNVF 3LQZA 3QDJD 2ZUSA 1FIEA 4R0LA 2ED8A 4QHKI 5SX4I 1R3KA 2XZCH 4UIKL 1DN0B 1LD9A 1ZHBB 4L8SB 5IFJB 1E6JH 2R0ZL 4PB0H 3H6JA 2Y23A 1I4FA 1K6QL 4Y2OA 5HHPA 4W70A 4D9LH 4NQDB 5EUKB 5E99H 1HQ4A 1T20B 4LLWA 5LAXB 2Z31B 1R5IA 4XBPB 3TJEL 1IEHA 1IZKA 1VKXB 3SDYH 4XPAL 4U1IA 1I3VA 3KXFA 4MD4B 4HKBA 4WEUD 5JDSA 4WU5A 1DBJL 4JLRB 5AZEH 3O6FC 1ND0B 3MNWA 2PO6A 3IXTA 2PW1B 4WFGD 1QO3A 1MAKA 1UG9A 3DBXA 1MCDA 3CPLB 5CS7A 4JQVC 3B5TA 1MFDL 3B83A 5I1JH 4P4KD 3NBNA 3QIWD 1IL1A 1P4LB 4HBCH 3W9EB 4WY7H 1VEMA 2FL5B 1ZLUK 2XTJC 1CLZH 2FR4B 4Y2DD 4PJDB 5ERWA 1VFBA 3BDYL 2CK0L 5E8EB 4M6MH 3T2QA 1AKJA 2MNUA 1AGCB 1U3ZA 4O2FB 3T1FB 3CJJA 4JFEA 4ZMAT 4QYOB 1MSPA 3ME0A 4NCC1 4LLDB 2Q1EA 3RWHB 3HZYB 2FEEI 4BZYA 3IYLW 5FUOL 2PR4L 1PYWA 2YPKA 5D1QA 2FEDC 1N6QL 1I9JL 2XTJB 5DJZB 1QLFA 3WFZA 4MXWL 2BVQB 4XNYL 4TSBL 2DQTH 2HTLC 2YZ8A 4XNUL 1OF2A 4MCYA 5EN2B 2BY1A 4YZFE 1E4KC 1JYNA 4XP6L 3GKWL 3MR9B 2BNQA 5ANME 1NDGB 3UBXA 3LEVL 2ZPKH 1WZ1H 3V9FA 2F53D 3NCJH 1QQDB 3TJHC 4R4BA 2JTDA 4L3ED 4UINL 3P0YH 4P3WA 3RWIB 1T0MB 3T77A 3WFCL 1NGPH 3ZKNC 1Z9LA 3PDGA 1PKQE 5E6YA 4WFHE 5GZNC 2IH1A 5C08E 1UJ3B 3ARZA 4QGTA 4G8GA 4CMMB 2X44D 2IALB 5D9SA 4NFDA 4XCYB 1TCRA 4NQDA 1T20A 2V7HA 4LSDA 4RMTA 4XBPA 4XCEA 1G9ML 4GFTB 2PTTB 5D2LE 2V17H 1U8LA 3OXRA 4WO4D 2PKDA 1BBJB 3JVGC 2WZPD 3JWDC 4P9MH 4U6XB 1FL6A 1ND0A 4RMQA 5IV2B 1JHLH 5A2LH 2H1PL 3ES6B 1C7TA 3HMXA 3OKDB 4LCYA 2R1XA 2VYRE 3UO1L 4YDJB 2FJGA 2V5YA 3S5LB 5CUSH 3VXUB 4JFYA 3ALWA 4XPFL 2P8LA 5FYKU 3THMH 4CN1A 4XH2B 3VWJD 2YD2A 4PY7B 1KLUB 2EDEA 3BZ4B 3C5JB 4JPVH 3MRHB 1WEJH 3EKCA 4O58H 4FABL 4QXUL 3O6FA 4DKAA 4BQ6A 3VDBA 4O2FA 3KHQA 3IDJA 4UV4L 1A3RH 3WIFB 2A9NL 4QXTB 5T1KD 1FZOA 4PUBH 4LLDA 4I2XA 5HYSG 1MY7A 4JQVA 1FZMB 3HZYA 3ECBB 5KVDL 2X1PA 4POUB 3PGCB 4PV8B 1L6XA 3SDCD 4UBDC 2B39A 1XF3B 5DJZA 3VFVA 4ZNEA 1XGRA 1FVEA 2XPGA 4CKVX 1FFNA 1O5DT 3ULSB 4HKZA 2YN5A 5H37H 4A2LA 4X9BA 5IROC 3VXSE 1RJCA 4HHAB 5E08H 5FKPB 3L7EB 3MR9A 4N9GB 4UTAL 2A83B 3MNZA 2J6EL 5I0DA 4LU5L 3D39D 3HI1A 3TC9A 1UKQA 4WFFD 4DGYH 1T0MA 3U7YH 4M43H 1TPXC 4M7LL 1PY4A 2X4TB 1T1YA 3MO1B 3QEUB 1CICC 5BO1H 4PJXF 1AO7E 5D8JH 2WLYA 2AJSH 1TZHB 5CLTA 2NYYD 1MWAB 3MRCB 2VLME 3DUSB 1ORQA 4XNZC 4WTZA 1EEUA 3H2WA 4CMMA 3GUTB 5C9JB 2OJZL 3G6JE 1LE5B 2AXFB 5CSZB 2FIKB 3H9SB 4RGNB 3MV01 5KVEL 3O4LD 2NNAB 1XF1A 1ZLVK 3RWJA 3IVKA 2HN7B 2P1YA 1YEDB 1T03H 3K0WA 5I18L 3V52L 2BSTA 2KUTA 1SBSL 5ALCH 1A4KB 3N1MC 1ZLWK 4DKEL 5IV2A 3MCLH 5GS0D 3OKDA 1WZMA 3FO1B 4XNZB 3QHFH 4LLUB 4MA3B 1CS6A 4K8RH 3ARFD 1OAXL 5FDWB 5ALBL 4UV7H 5D6CA 5KSAC 3VXUA 4BSVA 4XXDB 2DIBA 3S4SG 5ID0B 4CGTA 4LSPL 5EZOH 3OKEA 3VG9C 5BV7L 3S35H 4PY7A 1FZJB 1W72L 2MQ0A 2L7UA 3X11A 3JVGA 1TJGH 1IC7H 4PJFE 3RAJL 1HYSC 4QRPB 3MA9L 2Q7YB 2XFXB 3WIFA 4QXTA 2IFFL 1D5MB 5C0DA 3U0TB 2O5XL 2XWJA 1FZMA 1U6AH 3ECBA 2IADA 1GPOH 3OPZL 2XICA 5GGRB 3PGCA 4JG0H 4TNWF 3KDMA 3L9RB 4GKSB 1XF3A 4IM8A 4P57B 4P59H 4V1DE 5E8PB 3QEHB 3ULSA 4ALAH 3O0RH 4PD4K 5B8CB 4DFIA 5FKPA 4N9GA 2VLKE 2JCCF 4HS6B 5EOTB 3NCCB 3OKKB 5LCVH 3RVVC 2X4PB 5FKAB 3CDGB 1YMMB 4QRSA 1VEPA 3MO1A 4EDWL 1MCIA 2OMBA 2C5DC 5CEZE 1U8HB 4OCRL 2R2HA 4H1LB 4WWKB 1VENA 5HI5C 1TZHA 3DUSA 4XBEH 3NN8B 4ETQB 1NC2B 4Y5YB 3GUTA 1F58H 4LIQL 3K74B 5C9JA 5IROA 1LE5A 2AXFA 4NO0D 3S37L 2V2TB 2HN7A 4YHMH 1YEDA 3MQIA 2P43B 1QYGL 5A2IH 1D5IH 1SJEB 1YZZA 1PD6A 4X7TB 4HUKB 3W11C 1CICA 1IAOA 2GTWB 3BT2H 5DXWA 3DJ9A 3CSPA 3MUZ1 3FOLB 4GRWE 1EJOL 4MA3A 1IT9H 5I76A 4I4WB 5FDWA 1A7QH 4LRIC 1UT9A 4WFHD 4OZ4B 2A6JB 5HBBA 4FHBD 4XXDA 1WV7T 4WI9A 1WZKA 4NNPH 5EWIH 5GGQL 4TPRL 4ZUSA 1KFAL 1FZJA 1A1NB 3U46A 3HUJE 1MQ8A 3UTTA 4G6MH 1JZ8A 2R9HD 3O8XC 4U0RC 4AEEA 1U8PB 2UZYB 5D93C 1F4XL 2Q7YA 2UWEE 1D5MA 4M1GH 5ESVA 1N7MH 5CCKH 3TBTA 1UEMA 4PJIB 3KWWA 4K71B 2B20A 3QPXL 5KSAA 1A22B 1ORSB 2C3VA 2XNAA 2NY3C 4JANB 3DO3A 4Q2ZB 4BFBD 1DANU 4Y89A 2BVOA 3L9RA 1PG7X 3P4OA 4OB5H 3JV6A 1Y18A 3F7YA 5E8PA 5ADPL 3QQ4B 4N8PA 5IHBA 2V2XA 1V5JA 1B0RB 4OZHE 3QUYD 5KVFH 3VD3A 4LHQB 5I19H 4OD2B 4JHWL 4HS6A 4U6VH 5EOTA 3OKKA 5KAQG 1YEJH 2C9AA 3KAAA 4YK4B 1IGIH 4X4ZA 1CDGA 5IMOA 2WBWB 1GXEA 1UWXH 3C09C 4DVRL 1T4KB 3ZE1F 3CAFA 4LP4A 3L3JA 1T21A 2J8UB 5IVXB 4LBEB 1U8HA 4OGXH 4RAVB 1S7TB 5F93C 3VGAC 5LGHH 4N8CH 1HOCB 5D5MB 2ITDB 5HJ3A 3VI3E 1NC2A 3FO0H 2X4UA 5DHVB 1AXTL 5BCAA 5C8JB 3UZVB 2VXTH 4NZUH 2V2TA 2XIDA 5DD6B 5EZIH 3JWDL 4LQ1A 5T5FH 4PJAB 3VXSD 3WIIH 3VD4A 3DGGA 2P5EE 5DD5H 5BS0B 4MWFB 4OUUB 1RZKH 5C0AA 3VGAB 2FJFA 3Q5OA 2HJLA 4N90D 1U95B 3GSRB 4YE4L 3WXVH 3LS4L 5DD3L 3QDMB 1AO7D 4OZ4A 2A6JA 1G0XA 2CDEB 2VLRB 3GJFB 4EJ1C 5CEXB 2VLMD 5INCA 4FMFA 3TT1H 1M05A 3L5IA 3MGAA 4YGVA 5T1MB 4L29B 5B21A 4EN3B 3R1GL 4OD1H 5IIEA 3QRGL 2XQYK 5E00B 2B0SH 2BNUA 4AIXA 3O2WH 2X4SA 1JBJA 5FM8A 1JZ3A 5TGBB 5CEYB 5D7JB 1AD0A 1GZQA 4RRPG 2EKJA 4BH8B 4JFDA 3MUY1 2R1WA 3BP7A 4LRIA 4Y0GA 2ZUYA 3LPFA 4LLYB 1MWAL 1G6RH 5I8OH 1JGVL 4LOUD 4E42B 4X4ME 1BM3L 1FNSL 1D6VL 1RUKL 3T8XA 4HC1H 3MOAL 3REWB 5GS2D 3QQ4A 4ZS7H 1EO8H 2R4RL 1KJ3L 3MLYL 5FO9B 1YN7B 5C07D 3BRDA 3T2NH 1TQBB 1TIUA 2ZUVA 5KANG 5DFTA 3ARED 5JA9A 2FLRT 1EFXB 5KBNC 1YA5A 4U6HA 4KJQC 3SPVB 3WJLC 1JF1A 1NCWH 4ZTOH 2EIDA 3MV8B 6FABL 4X6DA 1FIGH 3DARA 5H35B 1KN2H 4P46D 5D5MA 3E1F1 5GXBB 4IBLT 2D7OA 5C8JA 1D5BB 2XZCL 2UZIH 2ZUWA 1E6JL 4KHTH 5A3ID 4ZODA 4PB0L 3AMLA 1MHCB 4ETYA 1RZ7H 1KBGL 4ODWA 5DD6A 2PXYC 3S36H 1RK1A 4BFEA 1QBBA 3BH8B 4D9LL 1CD9B 3KG5A 2B1HH 1XF4B 1FVDA 4GUPB 2AXJA 2FHCA 3SDYL 5A1AA 5I1IL 3OZ9H 5BS0A 2QKIA 3V6ZB 2EDTA 1J10A 2VN4A 4OUUA 5E95B 5MP6H 4NKOA 4YGAB 1KXTB 3T0AA 3HS0B 5AZEL 4RBPK 3GSRA 3ZSTA 2OR7A 4UDTB 5C0FB 5CEZD 2EIZB 4YFLI 5DK0B 3PGDA 3QDMA 1JPSH 2CDEA 2VLRA 5CEXA 4D3CL 4MQ7B 4LMQE 5JA8B 4NC2B 2PXYB 5I1JL 2ZUQC 2AXHA 2E8YA 3OGCB 5EPMB 4MA1B 1EX0A 4G9FE 4HBCL 5T1MA 4WY7L 2VQUA 3BP4A 2A77L 1CLZL 3GJEB 3ULVE 4E41A 1CFQB 3IU3B 2AAVA 1WTGT 2NY6D 4M6ML 3KPNB 4JE4B 4K55A 5TGBA 1UM4H 4KQ4L 4J12A 3BE1H 3CU7A 3TO4C 4PPTA 2XN9E 1FPTL 2CGRH 1BFTA 5CFHA 2C3WA 2DYPD 1F6AB 3MRJA 4NBZB 2VXUH 4HKJB 3REWA 4OF0A 5FO9A 1JPTH 1YN7A 1P84K 3T0EB 2DQTL 4MNGB 1OSPL 3D9AL 4XMKL 3SE4C 2ZZUT 3QEQB 3ZKSD 4KV5E 3WO4B 5C0BB 2ZPKL 1WZ1L 3TO4B 3NCJL 1J0JA 4OQ1A 3SPVA 3QCVH 2OJEB 3ETBF 4OAWB 4IHOA 5H35A 4RFEA 2IJ0C 1NGPL 4ZAKB 3H42L 3EUUA 3RZCD 2W91A 3PWNA 3K80A 2OR9H 3HAEG 1D5BA 4FTVE 2CRYA 1KTDA 4J3TA 1G6VK 5IVNA 4R3SB 4JAMA 3IKCB 1GJIA 5DA4A 2BY3A 3DSNA 1CFBA 1XF4A 4OF7A 3WJLA 4GUPA 2LABA 3BD5A 1EH9A 2OS7A 2V17L 1OT2A 4KJWC 1V3LA 2X1WL 2HT4D 3QUKA 1G7HA 5CJQL 4GBXB 3WFDH 2DL9A 3HS0A 4EI6B 2FX9H 5DK2B 1FFRA 1JWUB 5C0FA 1JHLL 5DK0A 3BKJL 5BZDB 2XZQH 2IWGA 3MJ7A 5F7KC 1RZKC 2ICWB 3WDJA 1P7KB 2PXYA 3G6JF 4L9LC 5CUSL 5DLMH 1H3GA 4MJIE 5F1NB 5ITFB 4JO4L 2NQCA 3MRPB 4G42B 5CINH 5F7DB 5IQ9B 3THML 3GJEA 2HWZH 4XP9H 1WFTA 4QLRA 4XPHH 5HGHB