1TPXC

Ovine recombinant prp(114-234), arq variant in complex with the fab of the vrq14 antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
219
Chain Sequence
DVVMSQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSRLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYFCWQGSHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords major prion protein
publication title Insight into the PrPC -> PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants.
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function
total genus 53
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxC01
4Z7UE 4P4RA 2P4AB 2Z31B 4FXKA 1P7KA 1ZHNA 3TNNB 4Q58C 3NPZB 4W70A 1W72B 4PGBB 4JRXD 2ATPB 4DK3A 2EDFA 5I30H 5I74B 3ROOB 4A6YH 4LVNC 4KKBD 4WHTB 4X5WA 4PJBB 1TCRA 2NY7H 4QHNB 4BA8A 1JNNH 3AXLB 3LSOA 2JB6B 4I18B 4K23L 3TIEA 3ULVH 4JQXA 1MI5E 1NKRA 3BIKB 2Q76B 3KNBB 2RR3A 5EORL 3VGDA 1L4IA 5D93C 4UQ2B 3OBAA 1I3RB 5DHYA 3INUL 3SJVE 1FZKB 3U6RA 3T04D 2P7TA 1XF4A 4YE4L 4NQED 2Y06L 4NWTH 4XPHH 4QCIA 2EIZA 1LHZA 2VLJD 4CUCA 1S7WA 1JYNA 1NDMA 2H26A 2LU4A 4WW1A 5EBLB 3FAWA 3GM0A 5GGSB 3IDGA 1QSEE 3MZTA 4GS7B 2GSIA 3CCHA 4BSWB 4I2XA 5JOEA 2QADD 3V6BR 3OGCB 5D2LA 5FECA 1R5WA 3MLXL 4XVUD 5D1XB 3O4OB 2CKBB 1UACH 1C1EL 5EN2B 2W07A 5EDXA 3V6OE 1EUTA 1X6LA 2WIIA 3GI8H 4D0BA 1JHTA 4LCUA 4PJ7F 4NM8L 3HMWL 1XR8B 3KLHC 3RIAK 4CMHC 2DM4A 4HUUA 1E4WH 3R8BB 1WV7T 2PETA 4MA3B 3PHQB 4MZ3A 1UB5A 1J0KA 4FFZH 4WCYL 4BH8A 4NQVA 3MFFA 3WFBL 5DK3A 4EVNB 1KCUL 2DWDA 3A0OA 1BFOA 3R06A 2APXA 5HGHA 3LKOA 4Y19A 1U8JB 1JUFA 1TXKA 2NYYD 2P5ED 3EYUH 2E7MA 3IXAA 3QI9D 1V3JA 5KTEH 3BZEA 4NC1C 5I73C 1ACZA 3C5SA 2ADJB 1MIEH 5F7MC 5AZ2L 3V4PH 3V6FA 2OR7A 1ZS8A 4GFTB 4K71C 3TBWA 4PB9L 5E2VH 5I1EH 1XH3B 5EORH 4MXQC 1N5AA 4F58H 3QR2A 3F12A 3MCG1 5FM4A 3CUPB 3O11B 3QIWA 1WT5A 4NNYA 5KSBA 4XRCB 1S5HB 1NBZA 3ARWA 1J05A 5B38A 4PRNA 4JY6A 2MPAH 4UB0L 4MD5A 1KXTB 1YEFH 2OR9L 4OD3L 4AEIL 4QXUL 4W6XB 4X7TA 4OCMC 3WFEL 1J1PH 3HNTH 4NRYA 1NQBA 3BGMB 1QBLL 1CT8B 5DRXA 2IQ9L 1FC1A 5I2IB 1CFQB 2DQEL 5DJ0B 2IGFH 4F7MB 1F02I 2WK2A 4U31A 3J7HA 3KYNB 3B6SB 5HVFB 4HS6A 4XMLL 3HB3D 3T0BA 3PWNB 4IRJD 5HGBA 1A6UL 2HT4C 2XTJB 5DEZA 1TTGA 1IGIH 3W9EB 2OSLB 3T3MF 1U8HB 3LDBC 2DN7A 1FNSL 3EBAA 4BQ6A 1X4YA 1W72L 4XP9H 4JFEA 4YAQA 2NQCA 4LARH 4E0RB 1J0IA 5E00A 3V0WL 4X0KA 4I0PB 5D8JL 5E08H 4NZDA 4YDVB 1YNKL 4LEOA 1H15B 1QRNA 5ACZA 4MNQE 2I9LB 4M5ZH 2NY0D 3HC3H 4KRPD 3FT2B 3RZCC 4YR6A 2EYSA 3WFCL 4WI4A 4WO4B 1PG7L 5TE6L 4N8PA 4AM0B 1XF1A 3CZFA 1A7QL 2F53A 1RY7B 4U1SB 2OQJB 3L3IB 5FOBB 5HDLA 3FQRA 5D70H 5GPRA 1SQ2N 1UXSA 1OGTA 3RU8H 3VGGA 1GZPB 1JPFB 3TCXA 1UKTA 3KJ4B 4JZJA 1RJLA 3E6HB 5MEQB 4NT6B 3KYKL 3SKNB 3QFJA 3QHZL 1BF2A 3S3JA 1F6AB 4XNZB 4NDMB 5EOQL 4F3FB 5CBEB 4YDIH 4PJIF 3SKMB 1SEQH 3S4SG 3C6SB 4DVBB 2R4RH 3WUWA 3H9SB 2GTZB 4MMZC 1MFEH 3MROB 3DO7A 4M7LT 1G7LA 2B5IB 4KKCD 3PGCA 3RQ3A 3U4BH 5E6YA 3FT4A 3MUHL 1S7QB 5C7XH 3FQUB 1CGSL 4H25B 3WFEH 1XT5A 4KTYA 4UU9B 3TT1H 1EV2E 2ZCHH 3ZE1F 5FB8A 3KPQA 2HFGH 3DTXA 5AD0A 1R3HA 4JB9H 5JPNB 4JQIL 4Z76A 3LQZA 3OG6B 4PJFA 4S1QL 2BC4A 5EWIL 3O9WC 3HLAB 2QHLA 2ZNWA 1MAML 2EDXA 3Q5OA 3ULUF 4K8RH 4NP4H 4C54A 4NZTH 4NN6C 5E8EB 5I8OH 4Z7OE 5DSCB 1T04B 3U0WL 4UV7L 4Y4HC 4MA1B 1S7RB 1D6EA 3U4EB 4CDGC 1R5VB 1NMBL 4IHOB 4WY7H 3RWHB 3GMPB 2XA3A 3RJQB 5T5FH 2NY6C 5FA4B 1JRHH 3QEUA 5DURB 3V5KA 4EQ2A 2FZ3A 5CGMA 2HMID 4J8RB 1A7NL 1FSKC 3VH8G 4EN3D 2EYTB 3PL6A 5TF0A 1A2YB 4R26L 2VJXA 1MFBH 1S8DB 3BQUA 5TGBA 4U1KB 5FA3A 1OCWL 3MRHA 4ZG1A 2V2WB 1H9VA 1BD2D 3SO5A 3OKLB 1IM9D 1L0YA 4M8QA 3OX8A 3OAZK 1BLNA 2B1AH 3DARA 1RJYB 4WTXA 4L3EB 3W0WD 3DI3B 2DQIL 4U3HA 5E95B 5EBMA 1YJDC 3MRMB 3QDJD 2ATKB 1KV3A 2GAZA 4PJHE 1O5DT 2B1HL 3TN0B 1FFNA 3ILQC 2HJLA 1RU9L 3UTQB 3UROR 4PV8B 1A1OA 2NY3D 1CBVH 1RHFA 5CINH 3IDNA 5DYOB 1WZKA 4Z95L 4YK4C 2CH8A 3QIBC 3LD8B 1MRCH 5DLMH 3JSSA 1MEXL 3MJ7B 5SWSB 3OB8A 2V17H 4UOJA 2P1YA 1S9WA 4JFFD 4J2XA 2V7NB 4UIKL 4J12A 2Q3ZA 2QQKH 3H7BA 2VITB 3AVEA 1JZ8A 5EC1A 3B2VL 3W5MA 5GISL 3KPSE 3MRLA 4FZ8L 2JCCA 1BF8A 2CKBH 3ZKNC 2XICA 2F5AH 5KOMC 1UKQA 5C3LD 5JQ6H 2YC1A 1JWMA 1MRFL 3T1FB 4Z7VF 5F89B 2FHFA 5HPMB 3I9GH 4F8QA 4Y8DC 5JHDE 3BUYB 5HHMD 2FD6L 1MREL 1B9ZA 1E6JL 4G9FD 4TSBH 5DMGC 4LCCB 3REVA 5J9PB 4MD0A 3GSOB 2HKHL 1XGRA 2UZXB 3FQXA 1EAPA 1LEKB 3CPLB 4B7IA 3GSVB 4MWFB 5DQJA 1Q9OB 4HKXB 3BE1L 3GSRA 4P3DA 3STZB 4NZUH 1OB1B 2CIIA 2L0DA 3ELAT 3OKKB 1FFPA 4XAKE 3W9DA 5B8CA 2XWJA 1NGZB 4PJAB 3VWKC 4G80A 4G7YL 3OKMB 3V6OC 3BDYH 3SE8L 2YD3A 3T77A 3F5WA 3CDCA 1E27A 2IPUG 1NAKL 2DQUL 3QNZB 3NCYS 3HFML 5CEYA 1PFCA 5JXAH 1NCDH 3OAZH 4FQLH 1FNFA 1U8LB 4R4ND 4WRLA 4BZ1H 1MIML 5MHSD 2OK0H 1GPOH 3VGBA 1C5BL 2CXKA 2O5YH 2W60A 5DK2A 5DWUH 2JJSC 4DN4L 2YKLL 4M1GH 5DZNA 5C9JB 4R97C 5IJVA 4XTRD 1Q9WA 3LS5H 5TH2B 4PJ9B 1YA5A 1PW3A 5DD1H 5ESVB 2BZDA 1AJ7H 1EX0A 5JXEA 5A2KH 1DQQB 5CGYC 3GSXA 5L88L 3B2VH 5GISH 4OKVB 4OFDA 3HE7B 1S78D 3EUUA 1DE4A 5HYFA 4OGAC 5B39B 3RA7H 4W4NA 2PTUA 4GBXD 3SY0A 1XEDA 1REIA 1KYOK 3UTSA 1G7MB 2J4WL 2YBRB 3FB5B 1GGIL 1RAMA 2GK0B 2VLME 3VFTB 4JPWL 4I77L 4YHYB 1A3RL 1ZXQA 4ZSOA 3CSPA 5DVNA 3KYOA 1F4HA 4PIRF 4AT6B 1Z0NA 1WTLA 4HWBL 1Z3GH 1HHKA 2VXVH 3C5ZA 3VJ6B 4M1DH 5T1LB 4Y16A 3B4NA 2ARJQ 2XACC 3AREB 5C0IA 1NC2A 2YD1A 5DUBB 1KFAL 2VISA 4FNLL 2MSPA 4M1CC 3SHSA 1U3HD 4DJMA 5EU6E 4GG8A 3CU1A 4FQHA 3QUKB 5EUOE 4WVRA 3ZYOA 3HC0A 3IT8D 1KB9K 4P2RB 3OJDB 4L9DA 4ZPTB 3BOVA 1D6VH 3KS0J 1U91B 1LEIB 2DLFL 4NKDB 4OCRL 2O61A 1W8OA 3ZT7A 1WBYA 5FGBC 2X9WA 1D5BB 3SGKA 4NKIH 2VDPL 4X80H 4RFOL 4OTXL 1OAUH 2R1YB 4YGVB 3F65A 3VXMA 5LGJB 1HQRB 4ZTOL 4XXDB 4EJ1C 1JNJA 1FAKT 1G0YR 4LEXH 3GDBA 2I5YH 1KENH 2YKLH 1NJ9A 2ZCLL 1KC5L 4KK6D 5D1QB 3EFDH 5EIQA 4HJGA 4G8GE 5KVDL 2ED7A 4MJ4A 4K7FA 3WYRA 3F58H 1M05B 4N1CA 5KAQG 4QY8B 3X14B 2AJXH 5TDNB 3BW9A 1XGPB 4IS6B 2D3VA 1ZT7B 3ARVA 4JFPA 2A74B 4ENED 2QR0B 2PR4H 2QHRH 1EGJA 3BVNB 1JP5A 1AR1C 1QNZH 3TPUB 4E41A 5IMOB 3OKOA 3HZKA 5KJRH 1HYSD 3C6LD 4OI8A 1AC0A 1VERA 1AQDA 1NCWH 4N0FA 1AGCB 4HF5H 1Q1JH 5TJWK 2ZG3A 2FJHA 5CEZH 4D8PB 4GAFB 4YDJA 5C0RL 3ZKSD 4XVTL 4U33A 1B4RA 1E4XL 3IXTB 1F4AA 4NQSA 4QRPB 1OP3K 4IJ3C 3VXSB 4XB8A 1VACB 1QO3B 2M2DA 1UCBH 3KXFB 1X7QA 5FO9A 4JZNB 4J1UB 4ELME 4MDJB 1F3JA 1GGYA 4PRIE 2F5BL 4ONFH 1FL5B 3JV6A 3EOTL 5ANMB 1FBIH 5D6CB 1OTSD 5ACMA 2R0LH 3WFZA 3AB0C 3V95A 1MJUL 5CLWA 2P8PA 5E2UL 5ESAB 1NFDA 3LB6C 2K7QA 2XRAH 4TSCH 4PJ5A 1ND0B 1UWEL 3V2AR 1IEHA 3SE9H 4LRNH 2HVJB 4L4TA 2ZP0T 3EJYD 3BPNC 4OTXH 1OLZA 1YNTA 2LQRA 5F9JB 1RIHL 4P2YA 3HNSH 1FGNL 2A6IA 4KDWA 4R2GC 3SDDC 4N0RA 3R1GH 3DX8B 4PJEB 1JNHA 3RWIB 4FZEH 4DGIH 1I7TA 3ZLQC 5JDJA 4F7EA 2P47B 2AVGA 2BNRD 4X6BA 4NO0B 2FGZA 3UTTB 1EFXD 1JZ7A 3HUJB 1T21B 3S7GA 1LDPL 2FHBA 1PDKA 2X4PB 4JG1H 1EO5A 3RZCA 3HCVB 4NKOB 3FMGH 3HZVB 4GG6B 2OTUA 1XF3B 1ZHBA 5DR5L 1L6XA 3RDTA 3Q1SH 3CXDL 4HUVB 4P23C 1CVSC 2EO1A 4XP5H 5DHVH 4BQ9A 4F15C 3EO9H 1JZ4A 4AJ0A 4XP6L 4BZYA 3U36B 4FABL 1PLGH 3DRQB 2BOBA 1QVOB 4NQXB 3DURA 2ICEA 3RKDC 7FABL 4RSVA 2QBWA 4JDZB 2XA8H 1CGXA 2AJUH 4G3YH 5TE4H 4PJ7E 5E2WH 3DSNA 4MNGE 2Y72A 1ULVA 3D0VA 5GGVH 4H26B 3ZDZF 3C87A 3TYFA 4KDTC 2VLKA 4WGWB 5I1AA 2XQYK 2N4IA 3QCVL 2UUDH 1WVZA 1RK1B 3GO1H 1RMFL 2FO1A 1BGXL 1WICA 3EOTH 5C71A 1CICC 1CL7L 2IWGA 3WMSA 1N7ML 3O3DA 4EUPA 1CVRA 3QZWG 1UWEH 3AC0A 5CEXA 3CFEA 4R8WH 3FRPA 3VFVB 32C2A 3K3QA 5IW1A 4ODTH 5DMKA 3I3BA 5IB5B 5C07B 3TJHC 4EQ3A 4U1IA 4HG4J 1XZ0B 1NCAH 4P3CL 5IG7B 4N0UA 2BNQE 1WGOA 4KROD 4R4FH 4GRLC 2X4QB 3A6BH 1F4YL 2J5LC 3G5YB 3V4UL 3O0RL 4MJ2A 1QFUH 4OI9A 5L6YL 5HHVL 1N6QL 1WWWX 2Z35A 1JV5B 3VFMA 2FGWH 4PV9A 3JWOL 1GOFA 3LHPH 4LHJB 1FL3A 2NZ9D 4GQ9L 1UM5H 1SJVA 2BSRA 3KPMB 3NCJL 1MSPA 3BJLA 1NLDL 2KUTA 1IBGH 1VADB 3X13A 4MLIA 3CDFA 2MHAA 2P5WB 2XN9B 3X3FH 4FABH 4O9HL 4M7JL 2VIRB 4MB5A 1NL0L 3VXOB 4ACPA 2C4XA 3MGOA 5C2BH 4XGZB 1X5FA 4OIBA 1UYWL 3UJJH 3T3ME 3PQYA 4JN2A 4OZFA 4PJXF 2WAHA 3VFWA 3C2AL 4NUGL 1EJOL 4HWUA 2O93L 5FF6B 1ZHKB 4UT7H 3LIZH 4L9LC 5CWSA 4YJZL 1AKJA 5KSAA 4OD1H 2X4RA 4G7VL 2QQLH 1DZBA 5HGAA 3DETC 2VZTA 4KZDL 5EIIB 2IH1B 5KAQF 3QQ3A 2FR4A 3KPRB 3BT2L 2HP4A 5C1MB 1U3JA 2D03L 3HNVL 4S1SH 2WBJA 3PWPB 4F9LA 1Q94B 4PTUA 2YSSA 1BQLH 1N26A 5IWLA 3FQNA 1T2QL 1HOCA 2ZOKB 3EO1B 3SBWA 2DAVA 5EBWB 5M94B 4JVUA 4IOIB 4MJ5B 3MGTB 3MRDA 3SDCB 4ZUVB 2DMCA 2Y4SA 3BHBA 3QDGE 4Y4KB 1IGTB 4P3CH 4Y19D 5LGHL 1H5BB 5IOPA 1KTKE 1E4XI 2YD8A 1QSEA 1DSFL 1G1CA 6FABH 4PJIE 4JZOA 4MCYA 1A6WL 1KN2L 1Z9SA 1IL1A 3D69A 3L6FA 5J12B 3MCLL 1A21A 2VXTL 4Z0XB 1XIWA 4ZAKA 3HRZB 3CVHA 5KW9H 3HE7D 2WLZA 3TBVB 4B7LA 3JUZA 2APFA 2IEPA 4X6EA 3ZE1E 4OCWL 4UILH 1FYTB 4XMPL 4J3WA 3QIWD 4OZIB 4XNXL 1FNAA 3EO0B 2D0GA 4TNWK 5CD5D 2H8PB 3LPFA 1YZZA 4GSDL 4ELKA 1T6VN 3QUYB 1DANT 2VQUA 2NY2D 4O9HH 2FJGA 4QRRE 4NSKA 2C9AA 3O2VH 3ULUE 2GEEA 4Y1AA 1HHJA 4FTVB 5F9OH 3RIFK 4P2OB 1FIGL 1CFVH 3NH7L 2EICA 3ARED 4BK4A 2PNDA 4XC3H 5C09A 15C8L 3MPCA 3NACL 4HIEB 2FX7H 1PBYA 2EEBA 3QDME 1M6OB 2GUOB 3TNMB 4P59H 2CMRH 2C4FU 3QIUA 3TO4A 4GRWF 1NUFA 1NEZB 1S7UA 2EDTA 5HDOA 5B3JF 3MRRA 4LRIC 4TTDC 4LASL 3VXQA 3G5VA 1GCFA 4O2FA 3QJHB 1FN4A 1KTDB 3FCTA 1ZVYA 2RFXB 4EBQH 3EW3B 5IJKC 5SWZE 4D3CH 1TQCC 1HILB 3GSUA 1Q9LA 5T1KA 2D03H 2VDKL 1KULA 4FQPA 3BD5A 3VD4A 4JFED 4GO6B 1T2QH 1NDGB 3KYMB 4XMKL 3DECA 3RNQB 4Y5XB 3QUXC 5F6IB 4Z8FL 1IAIH 1A9BA 1QBBA 2Q8BL 1QRND 5ITFB 3GIVB 3RIAF 4P2QB 5HVHC 2WZPD 4WIQA 2Z92A 1T0NA 1G9NC 2O5XL 3PGFH 3WXVH 3WS6A 2VKWA 4HAGA 4TUOB 1KPRA 4K7PY 2F53D 2WWKO 5EULV 3KLDA 1YUHB 5BO1H 5HDQL 3L9RB 4H5SA 1L0XA 4XVSL 1BECA 4RGNE 4XH2A 5ALCL 3MUJA 4DZ8A 1PKQA 5CP3H 3O2DA 4Y4FD 3O3AA 4OZHF 1AGEB 3HHRB 4MX7B 5I1KH 3WNKA 3QFJD 4RWHA 3VDCA 1T2XA 1T22B 3HPLA 3MLVH 5CMAB 2H41A 1LNUB 1DN0A 2K3TA 1WFOA 1T89C 3KS0H 4W4OC 5D2NE 3RWFA 3WEXA 4U2ZA 1KJVA 3PDOB 3VG9C 3MACL 3OR7B 3PGDA 4JRYA 5FYJL 4IMLA 3MRJA 4Z7VE 5IK3B 4KKLD 2BCKA 5GSVB 4YHIB 2G75A 4OCNC 4MJIB 5DT1L 2V2XA 1E28A 2HFEA 3TVMB 3TBSB 4OFIA 4S2SA 1ZVHA 4R90L 2DL9A 3GKWL 5ICYB 1AHWB 2IPKB 1XGYL 3QO0A 1KIRB 1FYHB 2CDEB 4AK1A 4QYOA 3FHQA 3SKJH 5CJXC 4QF1B 4R3SB 1FAIL 4V1DA 4MAYD 1D5ZB 5IEHB 2YA0A 4BFGA 5ISZB 2D4DA 4P4KC 5HGGS 2M1KA 4X5XA 3T3PF 1PX3A 1P4BL 1WLHA 4TULL 4WW2B 3STBA 3FTGB 2QJDA 5CJOH 2R69L 1HH9A 1BQHG 5J1AA 3JVGC 3HG1E 4KHTL 1G9ML 4U1HA 2F9BT 1F90L 4N8VA 4N0CD 4PRDB 2GITA 3BP6A 4YBLC 3PL6D 2X4SB 3L3DB 4TVPH 1ED3A 5IT2H 3ES6B 2FECL 4QTHA 1ZT1B 4AH2B 3MR9A 2VXUL 4FQ2H 3FN0H 2DRUA 3MV8E 1CN4A 2YEZB 4WFEE 2I24N 3BP4A 4QWWD 1MVUB 3TM6A 3ARGC 3S37L 2A73B 1WJ3A 3C60D 1TETH 4PBWD 3SDYH 5ALCH 5GGRB 3SE4A 5IVZB 5D5MA 2ESVE 3SO3B 3MJ9A 5J7CC 1DLHB 2O5ZL 3IAPA 3MRKB 1QKZH 1W0WB 4RFEA 2CO6B 2NY5H 1K5NA 2R1XA 4OAWB 4GXUN 3EGSA 3SGDH 3VCLB 3OKEA 5D7IF 2WINA 2WBWB 3IGAB 3OQ3B 4P49A 4XPGH 3LN5B 4ZS6D 1QLFA 3QHFH 4KVNH 3EOAB 1D3CA 3RBGA 1A6TB 2X10A 2R4SL 4XI5C 3SDDA 1SEBA 1QSVA 1KIPA 4K9EL 3BESR 2DQHH 1D5MB 2VLRB 3TYGH 2FEEL 3JWDH 5HHNB 2LU7A 4M62L 1R0AL 4DVRL 2DIBA 4LAJH 2X4UA 3ARDA 3BZ4B 1OQOA 3HC4H 4ZUTA 3ARFB 1XF5A 5K9QG 1IAKA 1I75A 2J12B 1B0RB 1FVCB 2AEQH 5IV2A 5LBSH 4KK9C 2HG5B 4TULH 1ACYH 4F57L 3HR6A 2IAMA 3MLSH 43C9B 4NM4H 1N2RB 1DQML 1IJ9A 2VNCA 5D6DA 5FK9B 1WCQA 3RWGA 4XXCA 3MA9H 1ZSDA 4ZD3H 4OM0L 3UCRA 1A4JB 3QRGL 3GMQA 1I3UA 5HHOE 4ODVL 1CD1B 1RK0B 3IDUA 3G6JE 1HN1A 5KVFH 3GHBH 2YPLB 4EIGB 5EZLA 2C3VB 3KPSA 3D25B 1QLEL 2YK1H 4M43L 1S9XA 1P1ZB 3BAEL 4KAQL 4KDTA 4NJ9H 5CP7B 3T0AA 1HNFA 4GXVL 2A6JA 3IU3A 5INCA 1AO7B 2PTVA 3S37H 5T3XL 4U1GC 4BELD 4G8EA 1INQA 1AXTH 3RUGB 2VAAB 4XZUB 4Y8AA 1Q72L 1X5GA 2X2YA 1D5XB 4MQXC 5T1DL 2Q87A 2PW2A 1OAKL 3P9MA 2Q7YB 9CGTA 1IC4L 1KPVA 1CXFA 4LCWB 5EO9A 4FFYL 3DVFA 1LE9A 4EDWL 1D9KB 1FO0A 1TQBB 1BAFL 3DVGB 3GMOB 3I6GA 2H6PA 4DKDC 5J8OA 1CG9B 4I48A 3IF1A 4E42B 5E7BA 3O3BA 3VFPB 5D1ZC 3RY6C 4XBPB 2QKIB 4FQIH 5FYJD 5FM5M 3M17B 5JXED 4OCSL 4RFNC 1P6AB 1SJEB 5C0BB 3P30L 4JANB 4LNRB 5KZCD 1JHKL 1IKNA 2H45A 4I3SH 4XWOD 1ZLSH 1JZ5A 4NN5B 2V2TB 3G6DL 4PJ8C 5ILTH 3UTSD 1QACA 1A1MB 2EDRA 3LOWA 2YUXA 1ITCA 4APQC 3WV0A 3ULUC 2CK0H 1TVDA 2GJ6A 5C0NC 1KIQB 3NCBB 4F57H 5JPMA 3C5ZD 2SEBB 4Y16D 4HQQL 4OF6A 3ARBB 1HQ4B 4ODUB 2AJSL 4JY4B 5BVPL 1C5DB 1NC2D 3QRGH 4QRQA 3OR6A 4QHUB 4JY5H 3IFLH 3W11C 1I3VA 1FJ1B 4QRUB 1RZKH 5B39G 3NPSC 4YH6A 1PG7X 3BIBX 4HFWB 5DC0A 1QHOA 4KTDL 4XPBL 4MAUL 1ZHLA 2XPGB 2AGJL 3ILPB 5CD3A 5L2KA 2A38A 4GRWH 3GIZH 4LGRB 2DJUA 3DYPA 1SYSA 3CU7A 2QSVA 4JRXE 3V5DB 5B38G 3G9AB 1C12B 2NX5B 5J13C 4UNUA 4P46B 5I17B 1QSFA 3V8CA 1G7JB 4HXAL 3DV4B 4YHPA 3HS0B 5B4MC 1MJ7L 1DLFH 3VXMD 3GSQA 3VGAB 3VRIA 3O6FD 2H2PC 3RGVA 3O2WL 1J5OL 2V5MA 4POYA 4BZ2L 1TIUA 3NBNA 1QLRB 2QQNL 1UJ3C 4LP4A 2HLFC 2PW1B 2HTKD 1K8DA 4YWGL 3CFJB 5GRXG 4OLUH 4K3EL 4LSQL 3P4MA 4PJGF 3X12A 1SBSL 4EI5B 1V5JA 2FECI 2XQYG 4X8JB 4NQEE 1KXVC 3PABB 4OCSH 3EYFB 4M7LH 4BH7B 3CSBA 5IB2A 3HI1B 2ITCA 2NXYD 2VLJE 5I1CH 5JORA 4L1HA 1Z6JT 4PTTA 1HKLL 3TPKA 3ULSB 1GGCH 4E41D 5BVJB 3F7VA 3ZDZE 3OWEA 5GS1C 3RL1B 3N06B 1KCRH 3MLRL 4U6HB 5D2NC 3RVVD 4LIQE 3VU2A 5DFVC 4OFVA 1G7IB 5D7SL 4R7NB 5J89A 5IB1B 1U92B 2ZUXA 3E0GA 2YN5A 1UQSA 3AU1B 1PZ5B 5IF0A 1DVFB 4LCYB 2JB5L 3NN8B 4D0CB 4KJQC 4G8GA 4NOBA 4P2QD 1D7FA 3GUTB 3D85B 3ARXA 1OD7A 5JIHA 3B2UC 2X42A 2W9LA 3EDDA 5EOTB 5IESH 4QXTB 2Z91A 1F4WH 4JO4H 3OV6A 4XPBH 3I3EA 4RA3A 3GKZA 3QXTA 2FEEI 4DOHB 1CLZH 1P7QA 3S34L 1CXEA 1VGKB 1ZGLP 1S3KL 1T0PB 3W2DH 3DO3A 1U93B 2PO6A 4PJ5D 1CS6A 3WUWG 4KK8D 4OD2A 1LK3L 4POUB 4HPOH 2P5EE 4UINL 3E2HC 3MUY1 2JELL 4L4TD 4CL7A 3P9LA 1XFPA 3MQIA 4AEFA 4PFEA 3V5HA 1NGWB 3OJ2C 1YY8B 4HC1A 4F33A 2Z0BA 3GMLB 4Y7MA 3H9HB 2EXYC 3CFIC 2QQQA 5GJTH 4W6YB 3UPRA 3BH8B 3VFOB 5IFAL 1DEDA 1DBAL 3EKCA 5IHBA 2X7LA 2UZIL 5DD0H 1G7QB 5JA9A 4RGMB 3QUXA 3OXSA 4K3EH 3CVHL 1EHLL 2AKRB 3QRFM 4PRIA 1IQDA 2BSSA 3D9AH 4XCEA 3MLWL 1MAKA 4X9HA 3MRGA 2R0KH 4OLEA 4YHLL 5MENB 4K3JH 4DW2L 3SDXB 1BOGB 1HCVA 1KBGL 3QEGL 5IB4A 3T0EB 5IQ7L 3RDTD 5I6XB 4PJXE 3HI6H 2BX5A 1TZIA 4OLVL 5E4EC 1HYRC 5TFSL 4JFYA 5JOPD 3MRQA 1KB5B 1QEWA 2IFFH 2OR8A 2PYFA 3NFSL 2IAND 3G5ZB 2OL3L 4H20L 1MCEA 1NMCB 5A16B 2ZCKL 2NY4C 2R9HD 2AXHA 3THMH 4DGYL 1QFHA 1T89A 1INDH 1FVEB 2ZSWA 3WIIL 2ENYA 4RQQA 2A6DA 1MCWW 1MCQA 3QXWA 3K2UH 5KS9B 4M02A 2VLKD 3WIHL 3IJHA 5BMFL 5CJBA 2H32B 1J86A 1WZ1L 3P77B 4YIQA 5D2LF 4HJJH 1V05A 3TWCH 3PNWB 1YY9D 1I1FA 1YDPA 2V5YA 1DUYA 5KN5B 4YHKL 4DZBB 4JPKH 2APBA 4KWUA 3VXRB 2B2XL 2RAMA 2DQJL 3O81A 1AP2A 4JO3L 5CJXA 1BREA 4DWHA 1BM3L 4KPHL 3LQMA 3CFBA 5E8DH 5SWQA 1YMMA 1KLUA 4ZYKB 1GC1H 1KPUB 5BZDB 5BW7C 5L8LB 4JFQA 5GS3A 3WLWD 3GBMH 3DHJA 4PJ7A 4P5TB 2HYMA 4QKXB 3JVGA 2PXYB 4LLWA 1TTUA 1YYML 2R2EA 3L5WA 4LLMB 2BY1A 5GJSL 1F8TH 1EHLH 5F7UA 2J8UB 5MERB 2GSIB 4X83A 3MLWH 5CCKH 4G43B 4PLKC 2YS4A 1BMGA 2XNAA 1P5VA 1PVHA 2ZWLT 3DIFA 1J0JA 5DGRA 1A3LL 5HYIA 5LAXA 2E9IA 5BS0B 1AY1H 4OGXL 4PRHB 2ADIB 2BVPB 4JN1H 3WSQL 5E6IA 2NPLX 3E1F1 5KSBF 1PKOA 3M45A 4GRWE 1RZJH 3HZYA 4LCUB 2ZUVA 5TPWH 3EOYG 5B3JE 4KJWD 4DTGL 3JTSB 4LSVL 5FO7B 4Q6IC 2IBZX 3AS2A 1GSMA 1I7UB 2ICWI 3I6LD 5CIPH 3PQYD 1S9YA 4XCNB 5FHAH 4HIJB 3DMMA 1I9JL 3RTQB 5MEOB 3GSNA 3M1BA 2Z93A 5LWYL 5D96C 5B3NA 4Y5VC 4HUNB 4AL8L 4TVSa 2FO4A 2BVQA 1AKJD 1F42A 5KSAD 3SCMA 2V9QA 2Q8AH 1HNGA 2H2SD 1YC7A 1CD0A 1B90A 1UZ8B 1YECL 4KTEL 3ZKND 1XR9A 1NAMA 5J6HA 1JYVA 1ZS8B 2ED9A 1BVKA 2WBJD 3OMZA 1QFOA 4PJDE 3KLSA 3NZHL 4IDJL 2AEPL 4LLDB 4X7SH 5D7JC 1BM3H 3OL2A 1BD2E 1FC2D 4Z7WA 4YQXH 4N1EA 1YMHB 5E5MB 3W0WE 5I71B 3GMRB 4JDVA 3ZKXB 4PRNB 1N4XH 1RZGA 5GRUH 3QDJE 3QG6B 4OZHE 1CDBA 1KJMA 1XGQB 1VDGA 4X98A 5C0FA 3T2QA 3BKJL 5IROC 4WFHD 3CGTA 5DRXB 1XIWD 4ZAKD 5ACLA 1IEBA 3MJ9L 2WANA 4WENB 5E8NB 4U0RC 3U0TB 4KKBC 4QT5A 3CVIL 1IAOA 4XPFH 5IM7A 3V79C 1J8HD 1KB5L 4JKKA 4NNXB 3V0AC 3DROB 2HKFL 1QZ1A 3RHWK 3FB6B 4JFFE 3RWCB 2D9QB 3O8XB 3ALXA 4EI6A 2CRMA 5GS0L 4RAVB 1MLBA 4LPCA 5I8CA 3WN5C 3WSQH 4Y88A 2R0ZH 1CTOA 5GQBA 1R3LB 1YPZB 5F21B 3S3SA 2A6KB 2IALA 2AJVL 3I02A 2P49B 4DUXA 3GEWB 2FJFA 2K1MA 4Y1AD 1GH7A 4HCRA 3D39D 1N64H 2BMKA 3GK8H 3JTTA 4WV1B 5C09D 3T3PE 4RWYH 2C3GA 4HJ0D 3EDKA 3IDJB 5HHME 4DAGL 4G9FE 1UM6H 3MJ8A 3MSPA 3WNOA 1MHCA 4CN1A 3FO1B 5T3ZL 4L8CA 3QIUD 1QFWL 4Y5YB 3TO4D 4UNTA 1UKSA 4OSUL 4AL8H 3RY6A 3TZVB 1R3IL 3DVNB 4LLUB 5CGYD 1CF8L 4PJFF 2QADC 1JN6A 2XZQH 4ZXBB 4NQDB 3BYYA 2YMXH 3SE3C 3FQRB 1A7OH 4OLWH 4XVUC 5T1KD 3AAZB 4NOFA 3RFZC 5EUKB 3TIDB 1RFDL 5F7HA 3QUZA 3RAJL 5H2BA 5LKNA 5ITBH 2NY5C 1I3GH 1CLOL 2FBOJ 1U8NA 3NGBC 1CLCA 4K94C 2YPKB 3KR3H 4IRZL 3IS1X 3I6KB 5JZ7D 4M5YL 3FO9A 5JTWA 3S35H 4HK3J 3HR5A 3DPBA 5MHSE 5D7IE 35C8L 4M6MH 4P5KA 1IMHC 1IFHL 3LEYL 1YQVL 2NYYC 4OT1H 3QI9C 3DTXB 3BSZL 1JZ2A 2A83B 3PF2A 1WCBB 3BZFA 4HIIB 5BV7H 3LQZB 3TH4T 1T5XA 3GB7B 4PRBB 2BC4B 4FN0A 3RVUD 2BXYA 2J3SA 2OMBA 2VWEE 1FP5A 1RZ7H 1FLRH 1S7TB 5F7LB 3U7WL 4X6FA 3LQAC 5EZIL 1J1OL 1SY6L 1Q9KA 2OP4H 1IGMH 5JHLL 4JRYD 1DVFD 5F1SA 3SGEH 4F37K 3OKNB 4G6ML 3AFLA 4X4MA 1N6VA 3WL9B 2DTMH 5J6GA 2VDRL 3D85D 3U9UA 3UO1L 1HXMB 43CAA 1LMKA 2A2QT 1ZMYA 5DJ2A 5E9DA 5HHQA 3WFHA 4LBEA 3SPVA 3K81A 3MA7A 2JCCF 3EHBD 3OTTA 3QEQB 2EZ0C 2ADGA 4X9FA 1KLGA 1AGBA 4GQPH 3FKUS 3MRHB 4V1DD 4Q9RH 4K7PH 1AE6H 3MRBA 3UJTH 1CGWA 4U1LA 1I8KA 2MOVA 1BEYH 3MOBL 4LQ1A 3HB3C 1KF9B 4HFUL 4IRJC 5K93A 1JGLH 5GS1A 2F8OA 4XCYA 1FH5L 5I1DB 5EPMB 5J56B 1YYLH 2DDQL 2OXHA 1C5CH 5IVXB 3HE6B 3GHEH 4ORZC 4NO3B 2LFGA 3DNKA 3VXTB 4BQCA 1GJIA 5FYKD 2MCPL 3BPCB 3REWA 2BFVH 1M71B 2EIDA 3DX9B 4DKEL 4KJYB 1KLFA 5JLZB 4N5UA 4LSDA 25C8L 4P9MH 4HUMB 1UH3A 2NY0C 4IRSA 2G5BA 3FO0L 4UAOC 2E6QA 2EDOA 4KRPC 4M7ZC 1MCLA 1VKXA 3LEYH 4HD9A 2NW3B 4WNQA 4NQUA 3T4AB 1A0QH 3WFDH 3PE9A 1P5UA 2R2CA 4JM2B 5H37G 3LS4L 1F4XH 2IMMA 5DXWA 3T2PA 4P9HL 2ID5A 1CCZA 1ZA3A 2AXFB 1SY6H 5F7EH 2HRLA 3REVB 3BH9A 5DJ6B 2JK5A 3QAZC 4XVJH 2W38A 4JO2H 3I50H 2YD4A 5J4MA 2C1OA 4KKCC 3IB4A 1KNOB 3PV7A 4EUPG 3CC5A 4Z9KB 3TJEL 4UZGA 1RZKC 2NXZD 4PGEA 2LE9A 4S0TD 3ARDD 4F2MA 4H1LA 5T3ZD 5CJQL 3X3GH 3FRPG 4KHXL 3A67H 1IEAA 1HCFX 5TQ2L 1ORSB 3CK0L 4PY7B 3VXRD 4OLZL 3CX5K 1X3DA 1JGVL 4BKLA 3ZT6A 4XNUL 5F88A 4FP8H 3F7RA 1RIVL 1XAUA 4KVCH 2CLZB 4P57B 5DQ9B 2IAMD 1KN4H 1RJZA 4O2EB 4JPIA 3MLTB 5E2TL 3GGWA 2DLTA 1NUNB 2W60B 2K9UA 3L1OL 5ADPH 1QBML 3VFRA 3TA3A 3UTPD 4YPGB 4X6DA 2A9MH 1I9RH 3EZ8A 3DUUA 1AGFA 1KEML 3CDGA 5DS8A 5HYSG 5IW6B 5JDSB 4QHMB 3QT2A 4JFOA 2HMIC 4PRPA 1JPTH 4EN3C 1V7ML 5DVLA 3FRUB 1INEL 4HGMA 4Z0BL 5JOFA 5KVEH 1QFWI 3BKCL 3MUZ1 1T03L 4GAGL 2AJZB 4OGZA 1AGDA 2D7TL 4L4VB 1G7PA 3K4DA 2WNGA 4JFDB 4PJGE 4YHNA 2BNRE 4OIIL 4LVNB 2X44D 2D4FA 4V2CB 2GCYB 5F3BB 5DJXB 3RL2B 1JPGB 3WNPA 4YUEH 2HLAB 4GAJL 4OZGB 4R0LA 4XCCL 4LGSB 1HHHA 5E94A 3P0YH 1CFNB 3VRLF 4TRPH 1WIUA 4OZ4B 5CSBA 2DBLL 4MXWL 5D93B 5K59F 5FCUL 4O00A 4ZO8A 2AQ2A 2NY3C 1NUGA 5BW7A 3G6JA 4NQCB 3S8WA 3QUMA 1KCVH 3QWRA 1Y18A 3W5NA 2XWBB 4H8WL 1F45A 3KPPA 1T20A 1PYWB 5I66A 5CJQH 5FYLL 4KHXH 1VFBB 3FL7A 1U8KB 2VQ1A 1EEZB 5CBAA 5E8OA 1JFQL 4D9RD 4MCZA 5MP6H 3VH8A 3MV9A 4Z18A 4OFYA 1FPTH 2GJ6D 5CILL 5F71A 1WBYB 3H42L 3MBXL 5BRZA 1VFAA 1TVHA 2XFXB 4HX1B 3SKOB 1RIUL 4U6XB 2VDLH 3CZJA 4FQXB 3KYAA 1J18A 4Y2DA 1WSST 4M6OH 1UCTA 3T1WA 2C1PA 4JLRA 3VFGL 1LEGA 2KQNA 4C83A 3VWJA 1MCHA 1HK6A 1BBDL 1FDLH 5JIPA 4HS8H 5L2KD 1IM3B 1VFOA 4RMWA 3O3EA 4JKPL 4ZFZB 3UJIL 2OI9C 1NFDF 1WBZA 2N56A 4O5LH 2ZKHL 3QPQD 4U3CA 1G7HB 4PJCB 5INDA 5DEGB 5FKPB 2YUVA 1QSFD 4WU7A 3L3GB 5EO1B 2EC9U 5I73B 3TO2A 5H35B 5IB3A 5IMMA 2R2HB 3I75A 2Z8RA 4NCDA 1A7BA 3RGVD 2HT2D 4NRXB 2Z9TA 4OM1H 3JXAA 3QA3A 3D3VB 4R4NC 1NPUA 5CHNB 4KKNA 3H9YA 5D7JA 4ETYA 1LK2B 4D2NA 1A9EA 3MRFB 1T4KA 3U30C 3ABZA 3FZUD 4WDIA 5C0CB 4JKWA 3FONA 4B0MM 5L2JA 3O4LB 4KMTL 1A4KA 2DIAA 3K80A 4QOKB 4I4WA 4UIMA 5AAWA 3NFPB 1LO3L 4XTRC 1BX2B 5DRWB 1AFVH 4NHCL 1X5XA 1Z5LB 1GIGH 1MJ8L 4PD4J 1IGYA 3NTCH 5IROA 1CR9H 4PYHA 4OFKA 2AAVA 3H8NA 1YEIL 2VABB 5KVGL 4P48A 2VWEC 4I2XE 3QO1A 1VB9A 3DUHA 4BJLA 3D1MC 4RMUA 1S78C 3S36H 5D2LE 4G6KL 3TT3H 3U48A 1KXQE 2AXGA 3IFOA 2BJMH 3QQ9D 1BPVA 3H9ZA 4GBXC 5LQBH 3MNZA 4O58L 3GSWB 3IDMA 4G42B 3IKKA 3GSNL 4O2CA 3Q48A 1G0XA 1OARH 2CDFA 1GC1C 5DK0A 1P4IL 3WN5A 4NNPL 2VDOL 3BRGC 3LDBB 1FFQA 5F6HJ 4PR5B 4ZUWA 1IZKA 5ETUB 4NZRH 4G6JL 2VH5L 5EZOL 2PYEB 1NAML 1T1XB 1MQKH 3WIFB 4JAMA 2VLJA 2DM7A 5DZLA 3S37X 1FNGA 2PO6D 3LKQA 1MCOH 1U3HC 4Y19E 2F8XC 3V0VA 1YEEL 4NO2B 4HZLB 5EU4A 3GJFA 1I4FB 4TTDD 5SX4H 1NBVL 2E6JA 3F62A 4NWUL 3SE3A 1ZE3C 1FZJA 3VE0A 1YEJH 1DFBL 1U8PB 2OZ4H 3Q2CA 4LSUH 4EOWH 2G9HA 2E27H 3MV01 2N7BA 1V3LA 4JJHA 2OCFD 3A6CH 3VXNB 3L7EA 4GMTH 3U9PL 3IDYC 5KSBE 3QUXD 5DJDB 4YXHL 1DQDH 2JLLA 2P8MA 2VDMH 4FS0A 4KK6C 5C2UB 5SX5K 3LMJL 1I1YB 3QEQD 5I8KH 1A1NB 1IGCL 4UDTA 1VGEH 3Q3GA 1TZHB 1FORL 3FOMB 5HY9B 3S9DB 4M61A 5I76B 4ENEC 5FYLD 1LO4H 4XP1H 2FATH 1PX4A 3C5JA 2R56H 4WHYG 2XYCA 2IH3A 3O9WB 4DCQA 3UPAA 1HYSC 3C6LC 1BZ9A 1XF2B 2DLGA 4AG4L 4ETQA 5JR1H 1CFTA 1P9MC 4X6CB 5L0QC 4Y4HB 3SDAD 3IFPB 3VXUA 4QRSB 4F9PC 4N8CH 1TJHL 4TSAL 4ZS7L 4N0UB 2JJWA 5K9OB 4WWKA 5I8EB 2HFFB 4U6YA 4JFEE 1MNUL 2CRYA 2DWEB 2NY6B 4QHLA 3U2SB 5FHBH 5D9SB 1X44A 4NFDA 2KL6A 3QFDA 1I1AA 3GBLA 3BMWA 3VFMB 1EVUA 3V7AG 4PV9B 1QRNE 1X5LA 4HKBA 1N8ZB 5JO5A 2X4NB 1FL3B 1CFBA 1S9VA 4M3KB 2AV7A 1OAYL 3FFCA 4GMSL 1TNMA 1FL6B 1C16B 3RUGF 4AENB 1OTSC 4ONOA 4YXLH 2AK4A 1HHIA 2DLHA 1MWAB 4ZTPL 4IOSD 1RUKH 1YN7A 2F53E 3JV4A 1NBVH 1YMMD 3P0GB 5C6WH 1IC1A 3KJ4C 1DQJA 2FYYA 3LZFL 4RNRB 3DVIA 2EE6A 5CUSH 4O51B 5L8KB 3EJYC 5IR1A 1ZTXL 4HT1H 4Z7UB 3PWUA 2FB4H 3ORJA 1NGYB 3QFJE 5T33H 1IT9H 1S7XB 3G6AB 4H0GA 1FE8H 2YA2A 2XXCB 4HIXH 4YK4B 3MOAH 5IUSA 3D0LB 3QIBB 1SBBA 3ARRA 4YDKH 1F00I 1MF2L 4RGOL 5HYQA 3MNVA 4PB0L 4CU7A 1XCQA 3BX7C 5A2FA 1U8IA 1NBYA 4J3TA 1MI5B 3VXPA 1SJXA 5E6ID 1WC7B 3ROLA 3WLBA 1EERB 2EEDA 1B0GB 2VDNL 3ALPA 4HH9B 3SJVB 2ARJA 5IEKA 1DBBH 4PJFE 3VGHA 3NCFB 1YEKL 4MDIB 4NKMA 1AH1A 5E5UB 1HSAB 4OF5A 4PGDA 5DEFA 4WUUA 3UXFA 3DMMD 4LF3A 5H94B 2IG2H 4DGVL 3L7FB 4XNMA 5C6TL 1MCPH 5IMKB 2G2RB 2J7LA 1ZVSB 2P24A 3FFDA 2DI7A 3T2NH 5IFHH 3LEVL 5TDPA 2F19H 2BVOB 3OXRB 4W6WB 3SCMD 2E7LC 5I75C 4X9BA 5E8PB 3DSFH 1NCBL 3BKYH 1RJCA 1F11A 5F1IA 3SQOL 1UZ6F 3O41B 1ES0B 4L4VD 4LKXB 3IDIA 5T1MB 1CGYA 1EGJH 3KDMA 2ADFH 2I26N 2W9EL 3MO1B 5J0BA 2YWZA 3VWKB 5BV7C 4PRAB 3MV7A 4UQ3B 2EDJA 4BFIA 1HSBB 2FX9L 1JHLL 1EBPA 3CSYB 2XWTB 3BUTA 2YPVH 5HGDB 2DQGH 3TN0C 4GG6E 3O45A 3PP3H 4YGAB 4F7PB 5ADOH 5I18H 1CZ8L 2EKSB 4D0DB 1AXSB 3KLAB 4OJFH 4TQEH 4P2CG 4MD4A 5IQ9B 1SYVB 5A43C 3PWVB 2HJKB 1GGBL 1DBKL 4KROC 1OGAA 1NCCL 2CJUL 1MCRA 1DL7H 1D5IH 3T0WA 1AD9A 5I1JH 4GAYB 1CE6A 3P4NB 1G0DA 4HPYH 4CU8A 4Q9QH 5C08A 1A6VL 1X5HA 4PB0H 3AS0A 1J10A 1JK8A 4FQ1H 1IC5H 2EDBA 2NZ9C 3PDDA 2R29H 4JQXC 1YC8A 2BXZA 5AWNH 4PJDA 4HV8A 2JCCE 3FCTB 1UB6B 5F7DA 2V7HA 2EDDA 5JW5A 1IM9A 4NO5A 3PUCA 3UP1A 3TFKD 4YFLI 3GI9H 2DQFA 5GGUA 4JM4L 2CR3A 4OUUA 4JKLA 5IHZA 2FSEA 4FQXD 3L3HA 4OZHA 1Y0LB 4MNHA 3HA0A 4U1JA 4POZD 1LP9A 1S5IL 5FKAB 4XPAH 5HYJA 5L9DL 1X5AA 3LEVH 3MBEA 1QYGH 2Z92B 2EYRB 1CU4H 4PGJA 4WFGD 4R7DB 4WI8A 4GKNA 1YN6B 5ENWA 1MWAL 3B5GA 2P45B 1KCSL 1BJ8A 1KJ3H 5EU5A 1MQ8A 3HKFA 1FFRA 3N1QC 3BDXA 4NPYB 5IHUH 5DVOA 3QUZD 3FOLA 3O3AB 4XBGA 3BFOA 1N0XH 3MRNA 3BPOC 5I1HL 3HPLB 3PP4H 5I15L 5GIRA 1CXIA 1OTUD 5H37H 3MODL 3QXAA 2PCPB 3FB8A 3IKCB 3E6FB 3Q6GL 4G9FA 4CVZB 3RWDB 1RD6A 2WUBL 3O4LD 4TUKL 2E6PA 4MNQB 2G75B 1ZLWK 1K4CB 5E1AB 2Z31A 2HFEB 3U1SH 3FB7B 3TNNA 4NN7C 4O02H 1W72A 5GS2D 1P4LB 3KVQA 4M9OA 3UYRH 2XQBL 4PGBA 4WUKH 2ATPA 3DHMA 2VZOA 5D5MF 1F2XK 1I7ZA 5FYJE 1ZANL 4H88H 5DRZB 1A6PA 5IBTH 3HE7C 3QQ4B 4JHWH 4WHTA 3QNXB 4PJBA 1L7TH 4QHNA 4I5BB 4KY1H 3TP4A 3AXLA 4I18A 1K3IA 1NANH 4XNYL 1NGXB 4UV4L 3BIKA 3QIWC 1NSNH 1WT5C 2Q76A 4JHAH 3KNBA 1QTYT 4OCYL 5CD5C 12E8H 3MCKA 3UAJD 4ODSL 3UTSE 5CZVL 3WHXB 3RX5A 3ZDYF 4UQ2A 1I3RA 4N9GB 1FZKA 2NY2C 3LH2L 4N8VB 3BP6B 5D7LD 5DD3H 1FGVL 4O4YH 1ED3B 5E9DD 4ZSOE 2VSCA 1JVKA 3AREC 3MR9B 1OM3H 1NFIB 2EDKA 4WJ5B 2BDNL 2Y36L 2ORBH 5KSUB 5FFLA 3H3PH 3V9FA 3W39B 2CLVB 4IJ3B 5EBLA 2X1WL 3N85H 5GGSA 5C0DA 3ZSSA 2VB5A 4ALAL 4BSWA 1KCSH 1A6ZB 3E3QE 4A6YB 3OGCA 4JR9H 3AGVA 5TF1L 3AB0B 1DBJL 1YJDH 5I19H 3MRCB 4AIOA 2CKBA 1U3YA 4CADB 4RFEB 1FCGA 3V4VL 1JTOA 4UNVA 1NFKA 5EN2A 1T1ZB 1L0QA 4LLYB 2OLDA 3HMXL 1XR8A 5ALBH 3BPNB 1A3QA 3BEVB 5EA0H 4OZFH 3VXME 1ZA6B 3VDBA 1F58L 4MA3A 3RVWD 3VRLE 2GSGB 5EH1A 4R2GB 3SDDB 2J2ZA 1T7ZA 4IRSD 3B9KD 5K59E 4EVNA 1IGFH 1WIPA 4WEUD 2MNUA 1S7SB 3DGGA 2EC9T 1ZLWH 2WWMD 1U8JA 2X70B 4X7CC 4ZNEA 3HZMB 3VG0L 2F54B 1SHMA 3H7LA 3VA6A 1ONQB 1E4KA 4QXGH 2ADJA 2FL5B 4Y4FC 4PJHB 3ZZ1A 1KTRL 1FZMB 4JG0L 3T0XA 2D0HA 5IGXH 1LO2L 3CIQA 3DYMA 3OJVC 2Q86A 3O3UN 1CK0H 3WXWL 4E41E 4P23B 1XH3A 3TESA 4LVEA 2EDEA 4F15B 2VXSL 4HEME 4HEPG 2X1OA 4X99B 3O11A 3CUPA 2F8VA 2F15A 1CDCA 1XGTB 4XRCA 1T0MB 1BIIB 1S5HA 4M48L 1M7XA 1PSKH 4KKLC 4HUWA 1W0VB 1IQWH 4HWZA 1EJ6A 2VL5A 2BHYA 4DN3L 1AD0B 3KPSB 2IADB 4P2QE 5LXGL 1CT8A 1TZGH 5I2IA 5CAYB 5DJ0A 1UEYA 4F7MA 1IAMA 3W81A 1CICB 3BISA 4MAYC 1NGPH 3KYNA 2JIXB 2MKLC 3B6SA 4LCIL 1GAFL 4UUJA 1JJUA 1MRDH 5GZOD 1NFDE 1IILE 5JHDB 3PWNA 3Q5YA 4PG2A 4PJ5E 3Q0HA 2JTDA 3TA3D 4PS4H 3W9EA 3KJ6H 2AJ3B 4L4TE 1QA9A 1U8HA 2QSCL 1I7RB 3WUZA 1M4KA 4PRPD 1J1XH 4N0CC 5B22A 4PYGA 2R1WB 3PL6C 1RUPL 4E0RA 4XHQA 2VSDA 3R8QA 4I0PA 4GRLB 1WEJL 4YDVA 2I9LA 2VE6A 2J5LB 2X4OB 5DQDL 3RNKB 3SN6N 4CVUA 2EDWA 2Y5TB 4QWWC 5I1IH 4V2BA 2AW2A 3FT2A 5DDHA 2BRRH 4HMDA 4WO4A 1T3FB 4YHML 4LLQB 4AM0A 4K55A 3C60C 5LCVH 5AYUL 3QXDB 4U1SA 2OQJA 5FOBA 1N6UA 4KUCD 5FUOL 5JW3H 3QULB 4D9LL 5D72L 4BFEA 3V7MA 1CE1L 5DTFB 4BQBA 4AEHH 5I1LB 3NIGF 3SOBL 2Y6SD 3VFUB 3E6HA 1DQLH 1MFDL 5JOPE 5MEQA 2WV3A 3PHOB 4NT6A 3TF7C 2JF1A 4L3CB 3SKNA 5T5NG 4JHZA 1F6AA 2IANE 3QWRD 4NDMA 4F3FA 5CBEA 4ZS6C 3SKMA 4DVBA 3H9SA 2GTZA 3MROA 5DD6B 1R6VA 2OMNA 4K7PX 5I30L 1S7QA 3DJ9A 5C3TA 3FQUA 3WD5L 4A6YL 1T83C 4ZOEA 2VLKE 5EU3A 3NAAL 4PLKD 4UU9A 2BNRA 5CD3B 1K2DB 3O2DH 1SYSB 4JGMA 4L9LB 4KUZH 5F3HB 1RZ8B 3MV9D 3ULVL 4Q2ZB 3IDXH 4OFYD 4YLQT 1JBJA 1N3NA 1EIBA 5BRZD 5JPNA 2DQTH 4G5ZH 1T80A 4FQQB 3HLAA 3VRIB 1K4DB 1AI1H 4Y2DD 1RUQH 4Q7DA 5E8EA 2FIKB 5DSCA 3WDIA 4B53A 1T04A 1S7RA 3U4EA 4RDQG 1MCBA 4NWTL 3VWJD 4IHOA 3RWHA 4XPHL 3NA4A 1ORQB 3GMPA 1UWGH 4HULB 2EEAA 2KH2B 4UT6H 4QGYA 5FA4A 2Q3AA 1ZLVH 1NC4B 3ZE0F 1P2CB 2DLIA 5EU6B 5C0AB 2EYTA 1T66D 1A2YA 2V5TA 5B8CC 5EUOB 3SGJA 1S8DA 4L8BB 4PTTB 1AQKH 1BZ7B 1H3XA 4C55A 2EDYA 4CJ1A 4U1KA 2V2WA 4S11A 4AZ8A 1UACL 3OKLA 3BWAB 1KJ2B 2M26A 4MXVF 1LO5B 1J0HA 1KG0B 5D72H 1ZLUH 1RJYA 4L3EA 4K3DH 3MRMA 4HAFA 5DI8B 2ATKA 5IIEB 5GGTH 5IF0B 1E4WL 1ZEAL 4KZEH 3TN0A 3UMTA 3UTQA 1U95B 4FFZL 2BY2A 4PV8A 5FYKH 3ZTJG 4IEFB 5DC9B 3ZHKA 3LKPB 4RX4A 5DYOA 1N0LA 1MH5B 3I6LE 5JXEC 2NNAA 3PQYE 3EYUL 3WD5H 2WLYA 1P7QB 4MA7H 4BFBD 5KTEL 4JFXB 4XWOC 2V7NA 3NAAH 2VITA 1MIEL 3V4PL 3MRIB 1WAAA 5E2VL 5I1EL 4FFVD 3CLEH 4AIZB 3CFCH 4ZQKB 1DN2A 4F58L 5F1KC 3RUGE 3T1FA 1TQCB 3WDHA 3S5LB 3UDWA 4G8IB 4NJAH 5F89A 5HPMA 1R3JB 3BUYA 3C5ZC 2MPAL 5E1HB 1QR4A 4Y16C 1YEFL 4LCCA 5J9PA 2C3HA 3GSOA 2B4CH 3NZ8A 1G9MC 3CAFA 4MLSA 1J1PL 5DD5H 3HNTL 4ELMB 4PRIB 5HVHB 3CPLA 1LEKA 3E3QC 3GSVA 4MWFA 4ONGH 3MRGB 1Q9OA 4HKXA 3STZA 4X4YB 1OB1A 3OKKA 2IGFL 5GRJH 2J1KA 3DX7B 1X5IA 4WFHE 1II4E 4PJAA 1NGZA 1HXYB 1RURH 5AZEH 2VR9A 3OKMA 2LVEA 5EZJB 3SGKC 1YNLH 2Y7QB 1YEHH 1IGIL 1J8HE 3PWLB 4I13B 5C8JB 3QNZA 2YUWA 1EEYB 3O6FC 1A8JH 3VD9A 4QHKJ 3RX7A 1KEGH 1MUJB 1U8LA 2ZSWB 3KWWB 4XP9L 1ZEAH 1M1SA 1OHQA 4RQQB 2NY1D 4LARL 1FCCA 1A02N 2HTKC 3VG9B 1JWSB 2DIJA 5E08L 2K7PA 4Y1AE 1HWGB 5C9JA 2HRPH 4J3OC 3D39E 4M5ZL 4LSTH 1K8IB 3MGAA 3X11B 3HC3L 5KVMC 5TH2A 5C09E 3U79A 4K9EC 2E9BA 2NXYC 1HIMH 1DUYB 3TCLB 1H0DB 1G1YA 1GXEA 5D70L 1N5YH 4OUOA 1ETZB 4QTIH 3TBYB 3RU8L 3HE7A 1UZ6E 3ULVD 2R8SH 4UTBL 3RVVC 5B39A 3BJ91 4XNQB 2DB8A 1FO0H 3D2UB 2W1NA 4P4KB 1G7MA 3CMOL 4J4PA 5F9AC 3VXUD 4YDIL 1FVDA 2YBRA 3FB5A 1SEQL 2R4RL 2GK0A 4WU5B 2MQCA 4PJ7B 4WWKD 3VFTA 4MNGB 3QCTH 1MFEL 3U4BL 1IC7H 1J88A 1UA6H 4AT6A 1I1AD 1U6AH 4YBLB 2RCSH 5C7XL 3L5WB 4FMFA 5T1LA 4YZFF 3TT1L 5F44A 2ZCHL 3FFCD 1JTTA 2EZ0D 3AREA 4MHHG 2AK4D 5DUBA 1YEDA 2HFGL 3T8XB 2F54D 4ZMAT 4JB9L 1U58B 5LAXB 1C8PA 3ARGB 4KK8C 3KPOB 3P0VH 3JZ7A 2X1QA 1RI8A 2FEDD 4K07A 4Z7WF 4P2RA 2R0WH 3OJDA 1B2WH 4K8RL 4NP4L 4ZPTA 1PKQE 4NZTL 4L8SB 5I8OL 1CDYA 1I9EA 1U91A 3WJLA 1LEIA 1CLYH 2G60H 4NKDA 1MHPH 5L7XH 4WY7L 4H1LG 1D5BA 2R1YA 4YGVA 2CIKB 5T5FL 3P4LA 2BNQB 2MTPA 5LGJA 1HQRA 1JRHL 4XXDA 4KGLA 1JMZA 4JRYE 3C8KB 4RDQF 1MFBL 5D1QA 2ZJSH 2DQCH 5EC2B 3OG4B 3KPLB 1K6QH 4G6FD 1AHWC 3JUYA 2RIKA 3BXNB 4LSRH 1P7HL 4QY8A 3X14A 2CKNA 5TDNA 1RVFH 3RDTC 4IS6A 1ZT7A 3JBG7 1BVKB 2A74A 2B1AL 8CGTA 3L5IA 2CDGB 2QR0A 1ZGLB 3UTZB 4V1DE 1HDMB 4UTBH 3BVNA 4I3GA 4DFHA 4WUUD 3TPUA 4Y4FA 2EH8H 5IMOA 2KKQA 3B9VA 2P43B 2YA1A 3CMOH 1OAZH 2R9HC 4JDVB 4MZ2A 1OWRM 1CBVL 1RUMH 1TVBB 5CINL 1OOAA 2ARWA 2F58H 4LSSH 1TJIL 4CU6A 4D8PA 1MRCL 5DLML 5I16B 1LVEA 3IXTA 2V17L 4JREB 2ED8A 4QRPA 4PJCF 2QQKL 1YY9C 4R4BB 5FYKE 2VXQH 4U7MA 2Z8WC 3VXSA 1VACA 1QO3A 3KXFA 4N0YH 4Z5RA 5IM7B 4JZNA 4J1UA 4MDJA 2CKBL 3MV7D 1FL5A 1WTGT 2F5AL 5ANMA 1KJ2H 4HBCH 5JQ6L 2D7NA 3SO3C 5ESAA 4OGYL 4LMQE 1HZHH 5D5ME 4MAYA 3PV6B 1X5JA 3I9GL 4JE4B 3Q6FB 1ND0A 1BHGA 1ZT4B 2JJVA 1JGDB 1WZLA 2Z8VC 2DYPB 4LDEB 4TSBL 1L9MA 1LWRA 3V7AE 3BEWB 2AERT 2HVJA 1RSFA 3QDGB 3WLWC 4JCLA 1OGAD 5F9JA 4PJIB 2A1WH 2ZUTA 4PJEA 3DX8A 3RWIA 3ZDYE 2EIEA 4LKCB 4LSPH 4HHAB 5C08D 4GKZB 4KXZH 3IVKB 2HN7B 4NZUL 5D1ZB 4LQFH 4Q9BA 3HN3A 2CLRB 2ITDB 5DMIH 4LU5L 4NO0A 3OKDB 4RFNB 3ARSA 3HUJA 1T21A 2CRZA 2KQMA 3BDYL 4HXBH 2X4PA 3DX6B 5E0QA 4HK0B 4HC1H 3WBDA 1OY3B 5T3ZE 3HCVA 4NKOA 4PJ8B 3H3KA 3HZVA 4J7RA 3C60A 4GG6A 1XF3A 5JXAL 1NCDL 3VXRE 4FQLL 1H3PH 4HUVA 4PGZA 5CP3A 4QRRB 4APQB 4KJWC 4BZ1L 2OK0L 1GPOL 3U36A 2O5YL 4LHQB 1B0WA 5DWUL 5HYJD 3DRQA 3WJJA 1QVOA 4NQXA 1RUAH 4TPRH 3MBED 4QGTA 4M1GL 3SEPA 2Y07H 1DANU 1M7IB 1TJIH 1VEMA 1NC4D 2R23B 3QDMB 4JDZA 4KJPD 3TGXA 4K2UL 3VRJB 3LS5L 1G9NH 3UTPE 5C0AD 4LPYA 3EFFA 5DD1L 3B5TA 4U3XA 4H26A 1GL4B 5KSAC 1AIFB 2GT9B 4FXGB 3T4YA 3NPSB 1AJ7L 1HHGB 3B3IB 4WTWA 2H2SC 5BOPA 3UTOA 1RK1A 3OKYA 1KIUA 4GT7A 2VTFA 1T83A 5F1NB 3HAEG 4Y0GA 3E8UH 5CSZA 5SWZB 3WHE0 4JO1H 3RA7L 3BGFC 1Q0YH 2WBJC 1VA9A 4F9LC 5J13B 4OGYH 5K9JL 5IWLC 2Z4QB 3SBWC 3BKMH 4PY8J 4K8RD 4YO0B 2QSTA 4JFZH 1OAXH 4YHZH 5DHVB 1OLLA 1UENA 2X41A 3OB0K 1CD8A 3VFVA 1OSZB 3H0TB 2BY0A 1Z3GL 2VXVL 2XKNB 2Z31D 3EOBB 4UI2A 4M1DL 5IB5A 1UJ3B 4I0KA 4NCC2 4UMGA 1XZ0A 3TEUA 5IG7A 2UWEF 4LLAA 1XIWC 4ZAKC 4RGNB 3G5YA 4LU5H 2FHCA 5KSVB 3LKRB 5ECJE 1JV5A 3R0NA 2E8YA 1GHFH 1D6VL 4R6UA 5C0EB 1KELH 2XXMB 5GS1B 3OAYK 5ICZA 1VADA 4NKIL 3OZ9H 1QG3A 4X80L 5D2NB 4MQ7B 1OAUL 1A7PH 3H3BC 4D9RE 2C5DC 3BP5B 1HH6B 2P5WA 3PWJB 4Z7VB 4ODXA 1Y6NR 2GJ6E 4W68A 4LEXL 4NBYB 2I5YL 3NFNB 1KENL 3VXOA 5HVWA 5D71H 3EFDL 4HJ0C 5F96H 1L9NA 1JRHI 2X89A 3VFSB 1HI6B 4K2UH 3QIUC 3TO4C 3F58L 1MCWM 2G5BB 3D87B 4KXZI 1PY4A 2YD2A 4M8VA 4M7KH 1JE6A 2AJXL 1X5ZA 5FF6A 1ZHKA 4C59B 4LLVA 3NABH 2PR4L 1VFUA 4YXKH 3EZJB 5L2KE 5D1XD 2QHRL 4S1DD 1B4JH 5EOCJ 4ZUSB 1QNZL 3C09B 3OHXA 3CLFH 2KZ1B 3PIQB 5E56A 5EIIA 2IH1A 3E2HB 5KJRL 2LAAA 1QSFE 4MJ6B 4X6DF 1UM4H 3KPRA 5IHLB 1ZV5A 5K9JH 2VC2H 2FX8H 3HG1B 2GY7B 2NLJA 3NOIA 1NCWL 3PWPA 2DD8L 4HF5L 2DQDL 5GGQH 5C9KA 1Q1JL 1Q94A 5CEZL 1B6UA 3MTRA 3EO1A 3MLUH 5E70A 5JZ7C 3MXWH 4NGHH 1FIEA 2C1OB 4IOIA 3OB0H 4MJ5A 3WS6C 3MGTA 3NIGE 4WEMB 3SDCA 3MV8B 2OTWB 4ZUVA 4Y4KA 4J3XA 1IGTA 1UCBL 4PGEB 4KMQA 2CGRH 1H5BA 3ET9F 4ONFL 1FBIL 2R0LL 2ESVB 3WHE1 4Z0XA 3HRZA 2XRAL 4KUCF 5F7WC 4ZFGH 4TSCL 3TBVA 4MSWB 3RVUC 5E4EB 1R5IB 3BN9D 3RY5A 5LVEA 3SE9L 4LRNL 1FYTA 5E7FA 2XZCH 3T09A 3IU4H 3G6JF 4OZIA 3EO0A 2W9DH 2BHZA 4JGUA 2H8PA 1PAMA 3OAYH 1DVFC 1JNLH 3QUYA 3HNSL 2NY4B 3C08H 3C8HA 3O6FA 5ESQA 3R1GL 1VEOA 4LPVA 3CH8A 4FZEL 4DGIL 5HDBF 1TPXC 4Z78B 4FTVA 5F70A 4P2OA 1OSPH 4ZFOB 3U46A 4HKZB 2CD0A 3EHBC 4LHUB 1SM3H 4HIEA 4WI7A 5C70A 3N9GH 2GUOA 3S4SB 3TNMA 4JG1L 4LDLB 4YHOH 2BSED 1G7PB 2G5RA 1OL0A 3FMGL 3VFNB 1NEZA 3ZE0E 4Z7QF 4L8DB 4JQVC 2XG4A 2XTJD 3Q1SL 5IBUG 4XP5L 2P8LB 3EO9L 3QJHA 4FHBD 5EG6C 4TOYH 1PLGL 4HCRH 1HILA 4AMKH 4F7TB 5HYEA 3UBXB 1FRGH 2DD8H 2DQDH 5HHOB 4MXVE 1MFAH 2XA8L 3KYMA 4G3YL 2AJUL 5TE4L 3QUMB 5E2WL 3RNQA 3RVXD 4Y5XA 1NEUA 2UUDK 4I0PD 5GGVL 5ITFA 2AV1B 5IKCA 1F3DH 3GIVA 4P2QA 5FUZH 1J87A 3QB7C 2VAJA 4PP1D 3TV3H 1T20B 3GO1L 3D6GA 4WO4D 4TUOA 5ICXB 4I3RH 3QG7H 3SE4C 1CQKA 1YUHA 3QEQE 3L9RA 1T1WB 2HWZH 1FLTX 3VH8B 5TDOB 3TH2T 3P3YA 4MVBC 3ULUH 1AGEA 5FYLE 4R8WL 4FG6D 4L29B 1T22A 5CMAA 5BOZG 5DRNB 1KTLB 1LNUA 2YRLA 4ODTL 3H9SD 4N90D 3MFGB 1NCAL 4Q6IB 3MREB 3MLZH 5GGSY 3OR7A 5DC4B 2B4CC 4R4FL 2ERJC 3A6BL 5IK3A 5GSVA 2AI0H 5FGCE 3QSKB 5D96B 1QFUL 5GS2H 4Y5VB 1ZOXA 4MJIA 1A7RH 2NXZC 1EMTL 2FGWL 3ARDC 4XP4H 3TVMA 5IMLB 3LHPL 2OJEA 4FMKA 4N9OB 1MCCA 1UM5L 1G6RB 5ICYA 1WUNT 5CS7A 1JWUB 1AHWA 2IPKA 1KIRA 1ADQH 4D9QD 5DJ8B 1UVQB 3F8UB 3F7YB 1IBGL 4QF1A 4R3SA 4XC1H 1D5ZA 5IEHA 1EXUB 2HH0H 2IAMC 4WHCA 5ISZA 1IGJB 3X3FL 5D6DC 4XXCC 4XCFH 4CJ0A 2IANA 1YMME 3T65B 5JIIA 1Z0MA 4WW2A 1XGUB 5C2BL 3U7YH 2PXYC 5DURD 3UJJL 1C08B 3EDFA 4WDIB 5CEZD 4PRDA 2AQ3A 4QHKI 3FN3A 5EU7E 2X4SA 3L3DA 1JIBA 3ES6A 4AH2A 1FG2B 4UT7L 1ZWIB 3LIZL 1R3KB 1R24B 1U9KA 4JRXB 4OD1L 2YEZA 2QQLL 2XY1A 5DFTA 4Q97A 2BVEA 4KQ4H 2E7BA 1MVUA 4OLYL 4U0RB 1DR9A 3W82A 3WKMH 2A73A 4L3ED 5GGRA 2E8ZA 4BQ8A 5BXFB 4S1SL 5IVZA 4OQTH 4HKJB 2JE8A 4OB5H 1DUZB 3TN0D 1BQLL 1DLHA 5HHXH 1YEGH 1W0WA 3MRKA 5DJYB 1J0ZA 4OAWA 5CJ5A 3VCLA 4RX4D 1IE5A 3IGAA 4ZFOL 3U0PB 2EDHA 2DICA 3LN5A 2ICWA 4NQEB 5SWSD 5JUEH 3DXAB 3EOAA 4YNYB 5FGSA 6FABL 1A6TA 1IKNC 2C3WA 2VLJB 2VO5A 3LKQB 5J11C 4CVWA 1EMTH 1D5MA 2VLRA 5JNYB 5HHNA 5KW9L 3ARPA 2QADB 4YZFE 5DJCB 5HYSA 2APVA 3KPNB 4HLZG 3ULVF 3O6MH 4UILL 5F7YC 2ZOLB 1VESA 2NMSA 3BWUC 4JDTH 1QSZA 1B0RA 4PREB 3ECBA 4F7CB 1FVCA 4GW1B 3O6KH 3ZKXC 2HG5A 3NMEA 4Z7WE 3O2VL 3RPIB 1F6LL 43C9A 5F9OL 1N2RA 2IBBA 3AS3A 3AY4C 1CFVL 4ONHB 1A4JA 3DV6B 1T1YB 3TBTB 4XC3L 1OP5H 2FX7L 1CD1A 1RK0A 2X5PA 4P59L 4QEGA 2CMRL 2YPLA 2H3NA 3QPQC 2C3VA 1PZUB 3D25A 1P1ZA 2P5EB 5CP7A 5ID0B 3QI9B 1WWCA 4OLYH 3WCYA 3O8XC 5IFJB 4EBQL 1AO7A 4D3CL 3RUGA 2VAAA 4XZUA 3RGVC 2C26A 4CNIB 2IH3B 2HT2C 2OTPA 5I1GH 1D5XA 1BZ9B 4QXWA 4ETQB 3QYCA 4NYLA 1F3RB 1JGUH 4LVHB 2Q7YA 2X6MA 3EAKA 1V8HA 3CXHJ 5C0GB 3EYOB 3BZDA 3P9WB 4KRNA 2NW2B 1LO0H 1RZIB 2MFNA 4LCWA 4GKOA 1IAIL 4GLRH 3EDEA 2A77H 2YN3A 1T5WB 3FZUC 3DVGA 3IETA 1BVZA 1O7VA 1CG9A 3PGFL 4PJ9D 3WXVL 3QWOB 2OJZH 4E42A 4OV5B 3VFPA 4XBPA 2QKIA 4KI5D 3UX9B 1CD9B 3M17A 4UBDD 2W0FB 5BO1L 4PJXB 1G84A 1TJGH 1SJEA 5C0BA 4KRLB 4JANA 2BNUB 4LNRA 4LPUA 4WFGE 3MRPB 1NUDA 2V2TA 1F97A 1B88A 3JV4B 2FIRT 4PJCE 1J8HA 3QQ9C 5I1KL 4J4PD 1A1MA 3MLVL 1OAQH 4IRJB 2I60H 3OPZH 2HFTA 5DVKA 1I8IB 2NTFB 2VUYA 3S88H 2FWOB 3QUMH 2D2OA 3D18B 4R96B 4IBLT 1KIQA 2DI9A 4LGPB 1U8MB 1NMAH 2WQ8A 2OL3A 1HEZB 2SEBA 5T1LD 1EO8H 3ARBA 3DRTB 3D39A 1HQ4A 4ODUA 5HI3D 1C5DA 4QHUA 1FJ1A 2H9GB 4QRUA 3H2WA 3HPJA 4HFWA 2PO6C 4ZOBA 3WIHA 2ZG2A 2NY0B 3B9EA 1KCLA 4M93C 4UAOB 3SKJL 4KRPB 2XPGA 4JPVH 4P2RD 1MPAH 2C7UB 5GZND 1TENA 1J8KA 3IJSB 3QDHA 3QH3B 3V5DA 2ARJB 1C12A 2NX5A 4U6VH 1GOGA 4P46A 5I17A 5DHXB 4ISVB 4GW5B 4NKMB 3AROA 1G7JA 2QLVB 2YOCA 3B8YA 5EOCH 1DEEB 1QUNA 3BPLC 3DV4A 3HS0A 5BQ7B 5CJOL 4XPTH 1I9IH 4MQTB 1TMCB 3ZTNH 2AABH 4JJ5B 1EEUA 1IKFL 3WO3B 3FFDB 2P24B 2GTWB 4TVPL 3QAZB 5IT2L 1DBMH 1QLRA 1OF2B 3LPGA 4Q0XH 5D1QD 2P48B 2PW1A 1F6FB 4X4ME 3CFJA 3GMMB 4FQ2L 5EO0B 4ZDHA 3FN0L 3EYVB 3P11H 2E3VA 1V3MA 5D7LE 3WE6B 4EI5A 5HJ3B 3CH1A 1G6RH 5CZXC 5E9DE 4PJDF 3LV3B 4UT9H 4BSJA 2YXFA 2BOCB 3KHQA 3M8OH 1CFSB 3EYFA 1JMXA 3HI1A 5E99H 1TETL 3SDYL 3UC0H 1ZKAA 1UXWB 2V6HA 4XBEH 4ZUUB 4GRWB 3K8LA 3ULSA 5BVJA 4S1RH 4HIHB 3RL1A 5DUPH 4U6HA 2J6EH 2Y25A 1QKZL 1P6FA 2NY5L 3O45B 1LP9F 2ZPKH 3TH3T 1G7IA 1KGCD 4R7NA 2UYLB 5IB1A 1U92A 4XPGL 1E6OL 3AU1A 3QHFL 4KVNL 1PZ5A 3SDAC 3QQNA 3BGAA 1DVFA 4PY8I 3V6ZB 4QRPD 2R15A 3NN8A 3MC0A 4D0CA 3VXSD 3KXFD 2DQHL 3TYGL 4ZODA 5HD8D 3GUTA 2IPTH 3D85A 3JWDL 4EN3B 3P73B 5EOTA 2BY3A 5CZKA 4QXTA 2BP3A 4KMLB 3HC4L 3GNMH 1EUUA 2GW5A 1VGKA 1Z2KA 4OLXH 2YZ1A 1QFWM 2UWEE 1U93A 1LD9B 1BD2B 5JW5B 5LG1A 3ZO0A 1G9EA 1A5FH 3KGRA 4I1NB 2AEQL 4JQVA 5LBSL 3W0WB 3UBXI 3MMEB 1ACYL 3CD4A 1YY8A 3QDJB 3MLSL 4NM4L 4OZHB 4ZPVB 3H9HA 3KAAA 1MLCB 5DUMH 1QBAA 5EU7C 1EZVX 3MA9L 4R9HA 4ZD3L 3BH8A 4LAQH 2AK1H 1IKFH 1TLKA 1HINH 4CMMB 4M6NH 1DP0A 2NY3B 5KVFL 3QZWB 7CGTA 3GHBL 5TQ0H 1MFCH 5K33A 2VDQH 5ID1B 1G7QA 4NO0D 3UTTD 3UYPA 3CFKB 4GKNB 4NJ9L 2YK1L 2AKRA 3GJFH 4NUJB 4PJBF 3S96B 3TC9A 1A6AB 4JFFB 5EU5B 4LIQH 3VI3F 2PN5A 4EDXB 5MENA 3SDXA 1BOGA 1AXTL 3FT3B 3K74B 5E6IC 1PQZB 5IBLD 3T0EA 3GFUA 3CFDA 4J3UA 4PLOB 2AJYH 1KB5A 1FNHA 3G5ZA 5GHWH 3BP7B 3CSGA 4K94H 4HGKC 2GFBA 4OI7A 3DMMC 5A16A 1FG9C 5HHMB 5HBBA 1E6OH 5KBNC 4S0SD 4HG4K 4X6DE 1FVEA 1U8QB 1IAII 1XCTB 5MI0B 3N1GC 4FQIL 3SCMC 5HI5D 5KS9A 4PP2B 1EO7A 1J11A 4PRPE 1NCTA 1FZOB 2H32A 3P77A 4I3SL 1ZLSL 3PNWA 1NLBH 3G04A 1I7ZB 1BZQK 4OCXH 5FAAA 2OI9B 3MV11 4C56B 2HT3C 5ILTL 1NCNA 3QJFB 1K9TA 5KN5A 4YDLB 4DZBA 3ARTA 3VXRA 1RULH 4FQCH 2CK0L 3GRWH 3LQAH 3JV0A 2MWCA 3MCKB 4HSQA 1NGQH 4ZYKA 4PGCB 1U8OA 3IJYB 2FBJH 4PBVC 5J3HD 5C07D 1KPUA 5BZDA 2Q1EA 2P46B 5D7IB 1Z9LA 4JY5L 3DXAD 3IFLL 3U30B 3N1PC 4P5TA 1N59B 3QPXH 4TVPD 1RZKL 2PXYA 4XAWH 1CDGA 4TUJB 3LKNB 4EXKA 5JW4R 2GIYA 1I8MB 3QNYB 4LLMA 2OS7A 1RPQA 2J8UA 5C0DB 5MERA 5HDBE 3GIZL 4AEEA 3EYSH 4G43A 5BCAA 3GMNB 5AG8A 3WS3B 2I9TB 4P99A 5CJ8A 5C0JB 3FQWB 1DDHB 4YBHA 1Y6MR 5BS0A 1DLFL 1GZQB 4PRHA 1X4XA 2ADIA 1A14H 1FFOB 2BVPA 3TFKC 2EH7H 2P5WD 2XN9D 2ZNXA 3MV9E 4GBXB 4U1MA 4IIQB 4G6AD 3DBXB 3B83A 3CXHK 5BRZE 4Z7QE 4E5XB 4FQXC 4GRMA 4X4XB 2X9YA 3RWEB 3JTSA 2D31B 1RZFL 5FYKU 2W59A 2X89D 4OLUL 5FO7A 4POZC 1I7UA 3DUSB 3ZYJA 1SY6A 4S10A 4FFWD 4XCNA 4DQOH 4HIJA 2XZAL 3RTQA 3RZWA 5MEOA 2GI7A 3DGGB 3ZHDA 4M7LL 2JJUA 3QEHB 4RRPA 5I1CL 2GHWB 1NKOA 3MNWA 1GGCL 1U3HB 4NHUB 1UZ8A 1WK0A 2DM2A 1KCRL 1KT2B 3PJSA 5SV4A 4FQJL 3KPRD 3QUZC 5DJAB 4K23H 4UTAL 5F9DC 3LN4B 3PWPD 2Q86B 3MYJB 1KYOJ 1OTUC 4ZFFB 3STLB 4LLDA 1CWVA 2B20A 3INUH 3K46A 1CXLA 3SGDI 3GJEB 1YMHA 1QQDB 3SDCD 5E5MA 2VR5A 3V8OA 3GMRA 4Y4KD 4YE4H 4HUWB 3QG6A 5CIPB 4U0QB 2EECA 3IDYB 2Y06H 4HWZB 2XIDA 2VL5B 5GRZA 1O0VA 3ARZA 3AY4A 1XGQA 1U41A 5IESL 3LRSB 4ODWB 3LEXB 1MHHB 4X9IA 1F4WL 4JO4L 3G08B 5HXMA 1CLZL 2HAZA 3W2DL 4KI1A 1ZK9A 2F74B 5E8NA 4U7SA 4RAUB 3U0TA 1MJJB 4HPOL 2Q6WB 4NNXA 1KB9J 3DROA 4UUJB 8FABB 2HVKA 3L3KB 1BQSA 1FYTD 3FB6A 3MLXH 3RWCA 1EFQA 5FCSH 1E4JA 3O8XA 4RAVA 1C1EH 3QUYD 5GJTL 3UAJC 1R3LA 1YPZA 1QA9B 3C6LB 2A6KA 2I07B 4RA0C 4NM8H 5KOVC 3HMWH 5L0QB 4FTVD 3X17A 4P2OD 1RZFH 1S7VA 5DD0L 5GRYA 4WCYH 4WV1A 2BSTB 1UWXK 3IDJA 2XZAH 4J3VA 1EHAA 3D9AL 3WFBH 1KCUH 3PXJA 5FV1L 3FO1A 5A3ID 2R0KL 3P4OA 2VE6B 2W65A 3L95B 4Y5YA 4K3JL 1QHPA 2YXMA 2EE2A 5DJZB 4KV5F 5DDHB 3TZVA 4TYUA 4CVXB 3DVNA 3HI6L 4LLUA 5K9KB 2YD5A 4WGVB 3QBTB 4ZXBA 4NQDA 2CUIA 4FQJH 5AZ2H 2IFFL 4UTAH 3BO8B 3IS0X 3AAZA 2Q20A 5KG9B 5EUKA 4PB9H 3TIDA 3RKPA 4HUXB 3THML 3BDBA 1INDL 4LHUG 3WNMA 3NIDF 4IMKC 5DA4A 4LVOC 4ZO9A 2YPKA 3K2UL 4OV6F 3O6LL 3RVWC 1QP1A 1JPST 3I6KA 5FO8B 4IRSC 4UB0H 3B9KC 2OR9H 4GUPB 4HJJL 4U1NB 3RWJB 3C9NA 4OD3H 3TWCL 1JF1B 3BD4A 4AEIH 4QXUH 1NBQA 4TTGA 2ZG1A 5EU3B 4ORGB 4PJGB 3L3OB 5ELIA 1BQHB 2WWMC 1I85C 2BNRB 3ARUA 2WBKA 1QBLH 2IQ9H 1EFXB 5HHPA 4JPKL 3UBXG 4YEEA 1N3NB 2DQEH 5FDWB 2A83A 3ZKMD 3CJJA 3HI5L 1WCBA 4HIIA 4GKSB 5BJTB 5T3XD 3GB7A 4PRBA 4XMLH 5DZOA 4URTB 4BSVB 1A6UH 5E8DL 1GC1L 1S7TA 4HLZH 2EIBA 3AM8A 1J7VR 3ULVE 4HGWB 3GBML 1JI1A 4RBPK 5AUMB 1FNSH 3OKNA 1U2CA 3IAQA 1W72H 4MJID 3VXUE 3WL9A 1F8TL 1UEMA 3TVMD 4HDIB 3V0WH 1HXMA 1BVLB 3BN3B 5D8JH 2PTTB 1YNKH 4GW4B 5CCKL 5I75B 4G9DA 3MUGB 2GYSA 3QEQA 1WAAF 1UWXH 1AR2A 1OTTD 2LV4A 3WFCH 3FFCE 1PG7H 4QRTB 5TE6H 4CRPA 1A7QH 1AY1L 2AK4E 4JN1L 5ISZD 4QO1A 2VN4A 5EFIB 5BV7B 5GZOC 1RZJL 2F54E 2IQAA 5TPWL 1JGEB 2DLEA 5I1DA 3TA3C 5EPMA 2IC2A 3KYKH 5IVXA 3HE6A 3QHZH 4MGXA 5EOQH 5FHAL 4P4RB 4NO3A 3VXTA 4FXKB 1P7KB 1ZHNB 3O6LH 3SDAA 3BPCA 4HBQA 2NTSP 2NNAB 1M71A 3DX9A 4KJYA 5JLZA 2Q8AL 4KROB 4JHBA 2GJZA 4C4KT 1L7IL 1CGSH 4PJAF 4LPWA 4X5WB 1H8OA 1TCRB 2NW3A 1MCFA 3TIEB 3T4AA 3LSOB 5IVOA 3NVQA 4DEPC 4LNVA 1JCKA 4R0LC 4YC2C 4JM2A 4JQIH 3HI5H 4X7SL 1KSRA 4S1QH 1WFNA 5DHYB 5EWIH 4YQXL 1T6WA 1MAMH 1MHEA 5F9WB 3U6RB 2Y6SC 2P7TB 3U0WH 4UV7H 1XF4B 1N4XL 5GRUL 2AXFA 1NMBH 4Q9CA 2OZ4A 2EO9A 4WUUE 5DJ6A 3NZ8B 1MCNA 2EIZB 4QCIB 4D94A 1S7WB 4KK5D 4RBPH 1NDMB 2H26B 4WW1B 2VLRD 4KI5F 3ZT5A 2XKSA 3B5HA 3VD5A 1KNOA 1A7NH 3IDGB 4RMTA 3CCHB 4R26H 4I2XB 2HJFA 4XPFL 4C56D 2D7MA 5D2LB 5FECB 4WTZA 2N1KA 3ARFD 1R5WB 2AP2A 1CDHA 2WWKT 1OCWH 1ORSA 4PY7A 2JJTA 2E9JA 3BMVA 2R0ZL 1TNNA 2WIIB 4D0BB 3MV7E 3BRFA 1Q8MA 1JHTB 3LRHA 3BPOB 2DQIH 2CLZA 4M00A 4P57A 5DQ9A 4Y2DC 4O2EA 1N64L 4HUUB 3MLTA 3GK8L 2B1HH 2NR6D 1RU9H 1UB5B 3VWJC 4LP5A 4BH8B 4N5ED 4RWYL 3OF6A 4YPGA 4NQVB 3MFFB 1UM6L 2DWDB 3R06B 1BFOB 3LN9A 2VZ1A 4Z95H 5IW6A 2HTLD 2YPLD 3CX2A 5JDSA 5HGHB 4QHMA 3LKOB 4Y19B 1JUFB 1MEXH 1OGAE 1T66C 4NN7B 3IXAB 1L7IH 3FRUA 3BZEB 2XZQL 4UIKH 1Y6KR 2YMXL 1AO7D 5C08E 3C5SB 2AJZA 1A7OL 3V6FB 4OLWL 5J1TC 4L4VA 2EXWD