1TQ6A

Crystal structure of iigp1: a paradigm for interferon inducible p47 resistance gtpases
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
402
structure length
402
Chain Sequence
ENNDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPDTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISAMKKEFYFVRTKVDSDITNEADGEPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords interferon-inducible GTPase
total genus 144
structure length 402
sequence length 402
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tq6A02
1HTWA 3CWQA 1L7VC 4YONB 1LB1B 2QL6A 3EIEA 2DFLA 2CL0X 3LLMA 1GP2A 4DZZA 3CX8A 1W48A 4RVCA 1RPZA 2GEDA 5J4KA 1X1RA 3QKSB 2FX3A 4G5SA 1WRBA 2KB0A 2OBLA 2JLSA 3FHOA 3QKRA 5FOWA 1P9RA 4Q4JA 4MUAA 3W8NA 4R9UC 2XNSA 4LHXA 2GDJA 1KDTA 3DL0A 4KLZA 1CS4C 5E3HA 3C5HA 4LBYA 2QNRA 4US0R 1OIWA 4Q9KA 5HZKA 2BCGY 5L3QA 3QEJA 4XD7A 1IN5A 1H8ED 3KJIA 2FNAA 3KQHA 3VX4A 1ZU5A 4DDUA 2CMKA 3LQRA 2IYLD 1S0UA 4YLGA 5H1YA 3BE4A 3GJ7A 2ZRHA 4LJ9A 2J7KA 3BH6A 2JLZA 4Q21A 1AQYA 1QHHB 3PXGA 1JXMA 1WMSA 2DFTA 1P9WA 3LRPA 3LWNA 2O8BA 4KI0A 2KSQA 1SXJC 3HR8A 2VIIA 5BN5A 2NZJA 4Q47A 2BHRA 1W4BA 4TLAA 3OEHA 3H1TA 4RD6A 1OFTA 4PPFA 4DEXA 4EUNA 1XB2A 4MA4A 1E9RA 4MRSA 2HYDA 4F91B 1R7RA 3LW8A 2YZ2A 1E9CA 1Z6GA 2EWWA 2NO1A 2OUKA 4E22A 3AVWA 3NVAA 4IDQA 1MRSA 2QT0A 1H8HA 1E1QA 2B8WA 1GKYA 4IOKA 3ZGXA 4P3YA 1KI7A 2ANCA 3GFTA 2ANBA 4QXAA 1N6HA 3FMFA 5E95A 3BB1A 4GZMA 2OCBA 1AQUA 4JL6A 2F1IA 5HZHA 3AM1A 3K9HA 3PUYA 4W5WA 1HQYE 1DAHA 1CJKC 3GP8A 5DSZA 4B73A 1G8HA 2HT6A 4FD2A 4LJYA 2OG2A 5J47A 2GVDC 5HCIA 4DLXA 1GIAA 4JZKA 2NPIA 4QRHA 1GNPA 2CJWA 3D31A 3TQFA 1KNQA 3AKDA 4JS0A 2BBSA 2WJHA 1G17A 4POAA 1ONBA 1JBKA 1OLOA 1J70A 2ZJ5A 1W5TA 4AK9A 2OXCA 3BD9A 2ZVQX 1JQLB 5SZJA 2PLFA 1D2EA 5EZ6B 2ZJBA 4IOJA 4DCUA 3EPLA 3KKNA 4NCIA 2I3BA 3WNCA 3Q9LA 4F4CA 1E9BA 1AJEA 2HCJB 3TAUA 4C2UA 3X1YA 4C0AC 5JJLA 3AV0B 1Q57A 4FXPA 2F43A 2UZIR 2VHJA 5IT5A 1NG9A 1F2UB 4YDSA 3MG9A 4LUCA 3AEZA 1VG1A 2REXB 1FMJA 4A92A 3ZQJA 1Z07A 1YVDA 1OW3B 3R7WB 4P31A 3X2SA 1UBGA 4PPNA 2EW1A 1F60A 3FKQA 3CUEF 5CJ2A 1BMFA 4LV8B 3K0FA 2CJWB 4JBXA 1UDXA 4MDFA 4C30A 3RDPA 1U0LA 4C2TA 3R9WA 2XZOA 3EIHA 4LV6A 1M8PA 5GJBA 3FPAA 3QXHA 3CM0A 2VEDA 1RFLA 3HU1A 2FPKA 2KJQA 3BERA 4FMDF 1HEIA 4GPTA 4TL8A 5DI9A 5FOXA 1C1YA 1UKZA 4A2PA 4A1FA 4EJSC 2F55A 3PFIA 2MSEB 5C4GB 4EDHA 4BZQA 3I72A 2ODWA 1JR6A 1R10A 2P6NA 4LJ8A 3AH8A 1WA5A 1KI4A 2W58A 4D0LB 3R9IA 1RYHA 2HV8A 1LS1A 3A6PC 4HLDA 1M6NA 4BWYA 1PVOA 2AD5A 3A36A 3N2IA 1E3MA 4RKEA 1Z28A 1N0VC 1RKBA 1UEJA 4C0SA 5F9HA 1L8QA 3DDCA 2ERYA 3QKSA 3CX6A 3EWSA 5JRJA 3HPRA 4XJXA 3MWJA 4ZO4A 4P4TA 3OESA 2ZYWX 1Z5ZA 1G16A 3MFYA 4JLDA 4PC6A 2PJZA 3OHMA 2OBNA 3CO5A 3ZVLA 3KQNA 4KBFA 1EWQA 2F7SA 3DKPA 3DOEA 3NH6A 4B3FX 2OCPA 3MMPA 3SYKA 2NO9A 3AVVA 1XMSA 3DO6A 3GLIB 4ZIRA 2GXQA 1CBUA 3GD7A 1RE0A 1FMLA 1N6LA 4V0MA 3WBKA 4WW0A 1VYTA 1TMKA 4OL0A 3GLHE 1HT2E 1VCOA 1XTKA 4A6PA 4WAUA 4W7SA 2HDNB 2QPAA 2X8AA 3K70B 5FTKA 3IHWA 5GJCA 1MABB 4OI1A 2IA5A 1KTVA 3GQBA 1VCIA 4F7WA 2HUPA 4NCKA 3ZVNA 4OQFA 2Q3HA 3VR1A 3QPVA 2QRZA 4PQFA 2UZ3A 3FB4A 2GCOA 3KUDA 1KSGA 4C0KA 1ZCBA 4EPTA 1P5ZB 2TMKA 3ADKA 2GEUA 3T5DA 3CIOA 5FPSA 1UKVY 2DR3A 2QE7D 3EC2A 4DLSA 2FDCA 1CEEA 1MR3F 3OEHD 2ZSEA 2JLVA 4ZKDA 1SKYB 1KY2A 2XTZA 3MSXA 3HU2A 1G8GA 1VPLA 2R44A 1D2NA 1FP6A 1KZ7B 2MMCA 3GJ0A 4DLVA 3TSOA 3SFVA 4QBGB 4EIWA 4B3CA 1G3UA 3ZLJA 2LWIA 5JHGB 5LDDC 2HLDA 4IVPA 2GJ8A 3F8TA 2ZIAA 2ZRDA 5IK2A 4Z1MA 4B48A 2CHQA 3O8RA 2IXFA 2P6RA 3QIAA 1X8KA 5B64A 1NMYA 1IXZA 2WJYA 4IEEA 2FSFA 1OF1A 2ZUBA 1A2BA 5C1BA 721PA 1GFIA 5JWRA 5F9FA 1OH7A 2Z4RA 2ZUCA 1N3BA 2QPOA 4JVNA 4CZ2A 1VECA 3U44A 4HEJA 2ZU6A 2FZ4A 5FL7A 4BEJA 1ZD9A 4HZIA 4ESVA 3B5JA 4WXRA 3THYA 4JJKA 1N6IA 2PEZA 1GTVA 1ZYUA 4Q7JB 4X8OA 2C77A 2GCOB 1YR7A 5EP3A 5CB8A 1AS0A 4B34A 2JLWA 1ZIPA 4TYWA 4UQOA 1E0KA 4TZ0A 3HJNA 2NO7A 4C4PA 5IRCD 5GJWC 4UXIA 2OXRA 1Z0IA 2VSXA 4F93B 2BDTA 2XZPA 3PEVA 3TJZA 2FMXA 4JSYA 4JYBA 4B47A 3REGA 2Y8EA 2V8OA 1G20E 1JR3A 4C0JA 2G1JA 1R8QA 2YVUA 2ZRFA 1KK2A 3AVYA 1FOEB 4I81A 1XMJA 1RRCA 1GVNB 4PC1A 2P5SA 3P1JA 1I4TD 3RHFA 3TVTA 1M7BA 1KY3A 2WWXA 4HLQB 3EPHA 3VU9B 2KE5A 1T0HB 4HSEA 1QZXA 2A2ZA 1I2MA 5EP2A 1G5RA 2GHIA 3OE7A 5EP1A 3WMGA 3QXJA 5FTMA 5TMPA 1EFCA 4TLBA 1HT1E 4KODA 3M1IA 3AGQA 4TL7A 5D3MA 4NCNA 3NBFA 1FTSA 1S9HA 4D2IA 2VA8A 1XBTA 3KB2A 2AXPA 2ZI3A 2H7VA 1VDZA 3E1SA 5JHHB 1KNXA 4OHWA 4AI6A 4JIMA 3KDSE 2ZAOA 4II7A 4V0NA 1N6PA 2GAAA 5EQTA 3GEIA 3RABA 4JLAA 2Q3MA 1QVAA 1XCGB 4KVAA 4BE7B 3B82A 1NG1A 3CH4B 1IJFA 4CT5A 3LBIA 1OE0A 4HUQB 5H68A 3PCRB 2WPDD 1YR8A 3DPUA 1TQ6A 3AKEA 3ZD6A 4AIIA 4L8GA 4NTZA 3FHCB 1YRAA 3REFA 3CRQA 3B1WA 4US2R 1JECA 4QHSA 1IN6A 1UADA 2A5GA 2OAP1 1N25A 1W0KA 2YINC 3QBVA 3GLFE 3KZ1E 4C0BA 1OXTA 1BIFA 4XIGS 2D74A 1KO8A 2P2LA 1ODFA 3TE6A 4DSNA 3RS5A 3GLGB 1OFUX 3BFXA 1Z2CA 1KSJA 1E99A 3GLHB 1KK0A 5TV2A 4QFMA 1P72A 2R65A 4HB0A 1XXHA 3U6BA 2RGNA 3W3ZB 4UNRA 5KNBA 1SQ5A 4PANA 1KIMA 1WB9A 4DT1B 2IYTA 3KL4A 4LHWA 2IT1A 1HUQA 5DGXA 4OHXA 3TR5A 5LBIA 4M0LA 4EPRA 4BFSA 2WOJA 3ICQB 5BXQC 1RJ9A 4YC7A 3GPLA 1Z0FA 1E9FA 4QOSA 4OQNA 2BMFA 3B9PA 4QNMA 1N2CE 3ZJYA 3U3OA 4BRWA 3W6PA 2XXAA 4LJ4A 5CITA 4UNQA 2XNDD 4URXR 4UKDA 3ASZA 2ZR7A 2GA8A 2JASA 3U4QB 4TMVA 3MWKA 2WSMA 3MGCA 4Q03A 5C4MA 2QQ0A 1AK2A 1MABA 1G4UR 2P0EA 4Q1FA 5J40A 2VP4A 1GKUB 3FMIA 4X8MA 2XOKA 4C9BA 2FFBA 3OFND 3VR2A 2VPPA 2VP9A 3AUXA 4A0GA 1JI0A 2EVWX 2O0JA 2XAUA 2HJVA 1E2EA 1ZUHA 3BAFA 4A8JC 1DAMA 4B3BA 4JLJA 2ZRLA 4ERNA 4DUGA 3B6EA 4XOIA 3BRWD 3T1OA 1XF9A 2ZROA 4GP7A 1NKSA 3AF1A 4RD2A 5L3SB 1TQ2A 4TSFA 4L4UA 4IOLA 2C98A 1JAIA 3N2EA 3NC0C 5GVSA 1C4OA 3P26A 1TX4B 2PLRA 3BWDD 5AUOB 1ETUA 2OFWA 3IDQA 5BWMA 1W1WA 3QXSA 2C2HA 4BLQA 1W7AA 4O25A 2ZRGA 3RC3A 4U7DA 1FQKA 3QF7A 5IF9A 2XZLA 1OYWA 5EXXA 3R7WA 1F2TA 3MD0A 1IM2A 3QNUA 2FV8A 4LHVA 3SBDA 2C8VA 3CRRA 3RAPR 1D2MA 1II8A 1ZNYA 1G3IA 4PFSA 2OAQ1 3CNNA 2JLRA 1SVKA 1HA3A 2Q9BA 2RKOA 3PJRA 4ZCMA 4HAYA 1XPRA 2C9OA 2DHRA 4KFTA 2FGKA 3ECCA 2CNWD 1D5CA 3CNLA 1XNJA 4TQUS 2J9RA 3LLUA 1DO2A 3ZS9A 4RD1A 4AYXA 3QBTA 3K0CC 1I4LD 4CT4B 4J0QA 4N0DA 3ND9A 3NTUA 2J45A 5BQ5A 4NH0A 4FMDB 1E79A 1NF3A 1NN3A 2R62A 2ZYVX 2J1LA 1UKYA 1YR6A 1S9DA 4MRNA 3VR5A 1RRFA 5FOVA 5KOYA 5FI0B 3CPHA 4Q7MB 3SC3A 4AURA 3PUVA 1U9IA 1CRPA 4GFDA 2FE4A 4V0LA 3T5GA 5SZHB 3CR7A 3QXCA 4Q4JB 3R9XA 3CW2A 3HYTA 4PO8A 4US1R 1CF4A 4D4LA 1DG3A 1FX0A 4BLSA 2YOFA 5JFGA 2D06A 2GCPA 1R0WA 2JGNA 2OZEA 2VP5A 1Z0JA 3JZMA 3ZYCA 1Y3AA 2QQEA 3MWYW 1W4RA 1XD8A 3R8FA 1JPJA 4URVR 4Q7LA 3B1YA 2CHGA 3F5FA 4HDOB 1S2MA 2A30A 4TMKA 2RCNA 4LOAA 2ZRBA 3H84A 4TT3D 2MSCB 4QJ3A 3QPUA 3F0TA 5CB6A 2OILA 1RRGA 4NZYA 3U3KA 5JECA 1QHXA 2BMJA 4Q66C 3K70C 4D26A 2ZJAA 1BH2A 1GKIA 1ZC3A 2GEVA 5UKDA 5AUNB 1VG8A 1W0KD 1KSHA 2J46A 4CRWB 5HPYB 4EQ6A 3NEYA 5AJXA 3A1TA 4I1SA 2G0NA 2YWEA 1KI3A 4ZCLA 2C03A 3CZPA 1TTTA 1CR0A 1KKMA 2FPLA 4CDGA 4QGFA 3V4FA 2WJGA 4BPBA 5AJYA 2YWHA 1JB1A 3RNLA 1AS3A 2BVNA 4L15A 2QSZA 3R8CA 1UBEA 3SJBA 3PG5A 4MYTA 3LY5A 3QI2A 4YXWA 1R0YA 1DEKA 1II9A 3DMDA 2WJIA 2RGEA 1X8LA 3JZAA 4PHTA 1C9KA 1U8AA 3DZDA 2IEZA 2XJ9A 1XTRA 3C41J 2FSIA 4HAUA 1YZNA 2BC9A 3L82B 4GRAA 1QRAA 3MJHA 2FFQA 4R71A 1CJMA 4D4KA 1N6KA 5M04A 2XXAB 4OBEA 4KFSA 1E2HA 4B74A 2Z4SA 2P3SA 4BZXA 4Q1CA 3RS0A 1GZSA 4IFBA 2IHBA 2W00A 4BLRA 3TH5A 3W6OA 1KK3A 5KTYA 1KK1A 3HR7A 3WP0A 3VR6A 1K8RA 1ZW6A 3I8XA 2NTYC 2D7CA 3B7GA 1N5JA 1SXJB 4HLUC 4NKRA 3BIFA 3OIYA 2BCJQ 2O8CA 4ASUA 2A5JA 3T15A 3VX3A 1WBDA 3KKOA 4RJLA 4GDFA 2GXUA 4G5RA 3RRYA 2Z6VA 4ON9A 4YDHB 1JR3D 1SKYE 1XWIA 5K8TA 1ZNZA 1G21E 5SZKB 3B1VA 1W2HA 1FZQA 4M8NE 1YE8A 1VG9B 2EYUA 5EXTA 4FINA 2ZJZA 2FA9A 5EXPA 1E2NA 5BW8A 2PH1A 1Q20A 2IS6A 3KKMA 1EFTA 1YJ5A 5KSPA 5FOTA 2IXEA 2ZSAA 5LB2A 3Q5DA 4EFNA 1S1MA 3C14C 3U3JA 3LFUA 1J8MF 5FOSA 1DVRA 2QBYA 4YMTA 2X2EA 2D4HA 3GEEA 1P4SA 1VHTA 1W2GA 1NJGA 2DYKA 2WWIA 4C0QC 4KXFB 1D9ZA 1NMXA 3UWOA 4AKEA 2AWNA 1CR1A 4DB4A 1AZSC 1HYQA 3OIWA 1IQPA 1XTJA 2VH5R 1TF7A 4DUGD 1B23P 2O8EB 3TGPA 1FQJA 1RRPA 2ZJ2A 2ONJA 2FSGA 2K5UA 4MKHA 4MKIA 2P6UA 1UAAA 3M6AA 4XTCS 4OYHA 3CF0A 2BWJA 3AVTA 2WIBA 3T12A 3AKCA 1YZQA 4UJ5A 4RFSB 2GWHA 2V1UA 3FOZA 2WICA 2MMGA 3M4YA 3OFNA 1KAOA 2KBFA 4OJKA 3AF2A 1Z29A 4R98A 4Q4HB 2DWQA 2ZUDA 2ZRPA 3VFDA 3T1TA 4WZ6A 3UXMA 1EFRD 5KDDA 3I1FA 4QGAA 2QBYB 2VBCA 1Z22A 3KKPA 5C2JB 2VP0A 3GJ8A 3L0PA 4MGYR 1AKEA 2V7QD 4EJSB 2RGAA 3GFPA 2JJ8A 4HAVA 3LH5A 2VO1A 4KCGA 4QNRA 3VR3A 5HCNA 2VSFA 1V5WA 1E4YA 2IF0A 1FUUA 1GG2A 1CJUC 3PR1A 4DLTA 2DWOA 2AKAB 3K1JA 4X8LA 5EE1A 3EA0A 2ECKA 4M1YA 4Q48A 1TU4A 4TTRA 3QG1A 1DAEA 4BFUA 1CULC 4IXMA 4PAOA 1EGAA 1KI6A 3OZXA 1O3YA 1G8FA 5B2ZA 3UATA 1P61B 2WZQA 4GMDA 4KVGA 5DI3A 1XEFA 3QY0A 3WYGA 1G19A 1J7KA 3BORA 4LZZA 2OEPA 4M1OA 4NDZA 4A0FA 2ATXA 1XXHB 1US8A 3FE2A 3SHWA 3NEJA 3WYFA 4F38A 4P33A 5FR1A 2B7CA 3SHFA 1VYUA 3ZZ0A 4MGIR 1G7RA 2FWRA 3T1VA 2A3RA 1XXHE 4LRWA 2F1HA 1OB5A 2DPXA 4MDEA 5CM8B 3EW9A 1KI9A 1LFDB 2N1BA 2CK3D 3TKLA 1MO5A 2PX0A 1LS6A 2HF8A 4ZI3A 5F98A 3ADDA 3C7KA 2YC2C 3K0SA 3UPUA 3A58B 1OXUA 1Q3TA 1KDOA 1QHSA 1XD2A 3QSYA 1ZD1A 3THXB 1CP2A 1LF0A 3M0EA 4MYCA 4TN1A 2P65A 2GZAA 3C16C 3IIKA 2CBZA 1KMQA 3MAAC 3W8RA 1E2GA 2HF9A 4TLCA 1KO7A 4LC1A 3AVUA 4RY2A 2FG5A 4NE2A 2VTKA 3TR0A 3NWJA 1V43A 1II0A 1AKYA 2JLQA 821PA 2HT1A 2ODEA 4DLYA 4ZKEA 3HP1A 1N6RA 4PHHA 1CXZA 1JJ7A 1JJVA 1UBFA 1QHYA 2VF8A 4D80A 4LDJA 4DHEA 2GBLA 1G4AE 4HLUA 1DS6A 1KI1A 2J5XA 3RWOA 4M1TA 4Q4LA 1N5LA 4ITRC 3SDZA 3KQKA 1P6XA 4DSUA 2OFOA 2DFNA 4Q1EA 3CH5A 3N5CA 2DB3A 2Q3FA 4JLNA 4FI3C 3QKRB 5FR2A 4A82A 3IQWA 2QAGA 5L3RA 2IWHA 1MKYA 1J8YF 1OXSC 4B3DA 1R2QA 3O8DA 3FGNA 5CIQA 1IY2A 3A1UA 5D3QA 4O3MA 4JLVA 4M9XA 4TYQA 3QJYA 4G01B 4MGKR 2A78A 3BB3A 4BFXA 1Z6TA 2WV9A 5FL7D 5JI2E 4HAWA 1CJVC 2ZJ8A 2XX3A 1W47A 2ZTSA 4PTLA 1W4AA 3CPEA 4HATA 3QVUA 2CL7X 4UXHA 5DNYB 4HB4A 2OBMA 4DSTA 1DBSA 3LXRA 4TMWA 4OQLA 3TW4A 2GF9A 5KPJA 1NI3A 3ETLA 3PEUA 1ZJ6A 3QF4A 1KMHA 3LBHA 1N5IA 4P4SA 2EU8A 2FEMA 2H92A 1VMAA 4FMBB 1TEVA 4EPYA 1E2KA 3ZQ6A 2WSSA 5AJVB 1E2IA 1M74A 3LDAA 2WIAA 3U3MA 5JI3E 2W6JA 2Q9AA 5EP4A 2CLCX 4O2LA 2OFXA 3KXIA 1W46A 4AY2A 4BFTA 1UF9A 2D3WA 4QGGA 1W36D 2ASEA 4UNNA 1E1QD 3IHLA 2NO0A 4LI0A 4WZBE 4IJMA 2H18A 4B75A 1JAHA 2R6AA 2VQSA 1LW7A 5FPHA 1OJLA 1EESA 3C15C 1WP9A 1GL9B 3VR4A 5ELXA 5JS8A 4JLPA 1G8PA 3UMSA 2H5EA 2A5FA 1GOTA 1PUJA 1TPZA 3AUYA 4LJ6A 1W36C 1W4CA 3ZS8A 1N0WA 1U0HC 1KI2A 3OF5A 2EWVA 2WMNB 4N0EA 2WBLC 5DN6A 4D4JA 2V1XA 1G64A 4QM6A 2REOA 2QMEA 4RD4A 3TW8B 2IYQA 2A7QA 1E98A 4OHVA 5TXGA 4M1KA 4V0KA 3DHWC 2RHMA 1M34E 2WJVA 5KU1A 1IJEA 1VHLA 4O2RA 4RCZA 1A4RA 2AXNA 2F43B 2OT3B 1FP7A 3QOFA 1P2TA 1SXJE 4C7OA 2V9PA 1KDRA 3PENA 4RD0A 4LY6A 3UMFA 1L4YA 2YC4C 1Z47A 3VKHA 1G1MA 5BYJA 2FFHA 2R8RA 3SJAA 4TMZA 1P73A 1DE0A 4RFSA 1EX6A 4AG6A 3GLIA 4XWKA 3HWSA 2YJTD 2EFGA 2BKEA 2R6FA 1JEEA 4NU0A 2WAXA 4QBHA 1YQTA 5CYOA 2CVHA 3QPWA 4V0ME 1HE8B 2IYVA 3EXAA 4KO8A 2O8FB 2PZEA 1MO3A 3EZ6A 2F3TA 1ZP6A 2P67A 1OHHA 1XCMA 3CF6R 1MT0A 4ACAA 4ZDKA 1RC8A 1FNNA 1E2JA 4U00A 2IC5A 4R2IA 3OIUA 1R5NA 1KJYA 2QRNA 2ZRCA 3RS2A 3LNCA 4NYIR 2BMEA 3TNFA 1RZ3A 4TMXA 2IYYA 4PQRA 3CRMA 2RHDA 3GEHA 4RZXA 2GAOA 3THOA 2BEJA 1E9AA 2GKSA 5JCZA 2GETA 4TYNA 4XVRA 1BOFA 1F48A 5B58C 4QKQA 1K6MA 2QA5A 4LPSA 1UDWA 4M21A 3NBYC 4NYJQ 4AKGA 1E94E 1NP6A 2G77B 4ZCIA 2ZEJA 2XSZD 4G5GA 3CZQA 1U98A 3PV0A 1I2DA 2V54A 2XJ4A 2PJRA 1IONA 2C95A 2GXSA 2BBOA 3IIJA 3K9GA 4PX9A 2EFDB 5JJKA 1J99A 4FW9A 2J7PD 2OCYC 2PBRA 2ERXA 2DBYA 2W83A 3I92A 1X8JA 2ZANA 4FCVA 5CM9C 4JL5A 2IEYA 4F4IA 1VCMA 3ZH9B 1EFRA 2NMVA 5CK5A 2CE2X 3QVVA 1CKEA 4Q01A 5F2EA 5CDFE 3P20A 1IOZA 4C0HA 3CF2A 3UG7A 4MUBA 4TYPA 1T9HA 3W34A 4DLWA 1XU4A 5JWOA 1KGDA 2CVFA 2I1VB 5AR1A 4Q9JA 2N42A 1E2LA 4RD3A 4MRRA 1NY6A 2WTUA 3ZZUA 1DAGA 2C9YA 2QMOA 3H0KA 5H70A 4OI4A 3I4LA 5TB5A 4B43A 4Q1AA 4FIDA 4TWZA 4UNSA 2G88A 1PLJA 2GJSA 3K9NA 2ZR0A 4URUR 1NKTA 4W5HA 1CR2A 2BBTA 1VCNA 4LC0A 1UBCA 2RGXA 2ZI4A 3IQXA 3PUXA 3CONA 2E1RA 4URWR 1K5DA 2AL7A 4ZDIA 4B3XA 1H8HD 2RGBA 3HU3A 4DEYA 1R0XA 1AM4D 2FJUA 4K81B 3L0OA 2V6JA 5FBRB 3QKTA 4EPVA 5J4LA 1PV4A 4CGZA 3B8HA 4LCBA 1RJ9B 4E09A 4OK6A 1EX7A 1SVWA 3GJ4A 5E4FA 3KKQA 3VNVA 3SN6A 3ZVRA 4ABYA 5JCPA 4A9AA 1AZTA 4PXAA 4A8JB 4A15A 1KDPA 2GILA 3VKGA 4LYJA 3LX5A 2ORWA 3RC8A 1YZKA 1TF2A 1PJRA 1XRJA 5K8LA 4B2IA 3X1ZA 3NBZC 1BO6A 3KUCA 1YRBA 4ASUD 3NXSA 3QG5A 3ONWA 4EFMA 1OH5A 2G9NA 3NKVA 2AK2A 4QC2A 4BEBA 4C3ZA 2ONKA 2GZDA 1TUEA 3AF3A 5DLQC 2ZI7A 2IX3A 3E5HA 4TTPA 5K8UA 4LV5B 1JXOA 4LJAA 2N46A 3GLGE 3CPJB 2NO6A 3MUFA 4HDCA 4Y0VA 5K8IA 2DWPA 3EG5A 4DSOA 2QU8A 2HEIA 4AG5A 3W9YA 3FDIA 2RAPA 2A9KA 2YWFA 2JJ2D 2HXSA 2CEAA 4TSFD 1XEXA 1N5KA 2BEKA 1HH4A 1KJZA 1Q22A 2O52A 3A1VA 3QENA 3QUSA 2JDID 1Z63A 1M7GA 1XJQA 2R6CA 3C5CA 4YXWD 2GESA 2G3YA 3Q8XB 3VNUA 4L9WA 2DCUA 4Q00A 2CXXA 2YHSA 3AVXA 2MSDB 5P21A 1U94A 1YZLA 4P4SB 4DJTA 3V4RA 1LY1A 2LKCA 4B71A 3DMNA 3X1XA 4TL9A 3UANA 4KYUA 2WWFA 5EZ5A 4IDOA 2KI5A 2IS1A 1P3JA 2BOVA 2JEOA 2QP4A 2CHVA 5L3QB 1KI6B 3ZIAA 2X2FA 4XTRA 2Q0HA 1AGPA 1ZU4A 2ZR9A 1PUIA 2WWGA 3IILA 5EE0A 3DM9B 2XGJA 4A0HA 2ZE6A 5KUTA 1SGWA 1N6NA 1COWD 3GLFB 2IYZA 3EAQA 1AS2A 1QDEA 2FZLA 3KQLA 2WHXA 2JJ1D 3IO3A 1AIPA 2AX4A 1Y63A 2IYRA 1FPMA 5G3YA 1Q12A 4BRUA 1WXQA 2ZRKA 2ODBA 2PX3A 3L8ZA 4Z51A 1QHHA 4EPXA 3CKLA 3PITA 2X19A 4S2EA 2W2XA 4I1OA 4HB2A 4NCJA 1AN0A 1YHNA 2G83A 4PZLA 4TMTA 1XCPA 3B9QA 3SOPA 1IN7A 5DH9A 5A0FA 4QGHA 4TQ9A 3VQTA 5TY0A 4XVQA 4K8OA 5EUMA 5BN4A 4CEIB 3HDTA 5KPDA 2O8EA 4IRUB 2ZS8A 2ORIA 5AJWA 3B78A 1Q3HA 3J81k 1E79D 4G5OA 4JMPA 2OSBA 1KI8A 3C4JA 4QG7A 5CJPA 5DHFA 1G7SA 4AWXA 1J2JA 1IY1A 1ZM4A 2CDNA 5EE9A 1Z6AA 1SZPA 2XITA 3BBPA 4WA7A 4AC9A 1NVVQ 4HUTA 3D6TB 3EC1A 3LO5A 2AN9A 3ZZTA 1TAGA 2QMHA 3D8BA 4OQXA 3VHXA 1Z0KA 2WKPA 1OFIA 2FSHA 2RGGA 4BFWA 1FX0B 4TL6A 3TLXA 2GNOA 3EIQA 5EJEA 2HYIC 4JLBA 3K8YA 4YMSA 2QM8A 2C96A 3BC1A 4M1MA 4LYAA 2G6BA 4KJZA 2GTPA 4RFVA 3EPJA 3LBNA 1GNRA 1GSIA 1E2DA 4Q4AB 1X1SA 1XTQA 1W49A 3CLVA 1N0UA 2OE2A 2JLXA 5JJIA 3QEOA 3UWKA 6Q21A 4A4DA 1OPXA 1W0JD 1XEXB 3CRW1 2ZSBA 3AKYA 1U99A 2CNWA 2D2FA 3KTAA 1DAIA 4BFVA 1E4VA 3B60A 3EZ9A 1QG2A 4LWZA 3TIFA 3TK1A 1Z6XA 2ZVPX 2F9LA 1NLFA 5G40A 1R5BA 4D0NA 3U7EB 3ADCA 3MJRA 3SFZA 1YZGA 1ZM9A 2ZPTX 1E96A 2QGNA 3EX7C 3GJ5A 1G3MA 2FU5C 3O8CA 3WXMA 2WVJA 4PAQA 1OV4A 2Z0MA 4EAQA 4K46A 3Q85A 2ODNA 1G7CA 4R7ZA 4AKIA 1JPNA 3ND8A 5FUYA 1NIJA 1P7CA 3FKSA 3GJ6A 4GOKA 5JS7A 1LV7A 4NL4H 2OV2A 4H1VA 4CEJA 3VMFA 3GMTA 3BK7A 5EE5B 3A4NA 2CLSA 4NYIQ 3D7MA 3SI7A 2AR7A 4WZAE 3I5YA 2E9SA 4A8JA 4QM7A 2NPFA 3LW7A 3W6NA 1HE1C 2W0SA 4LBZA 5FOUA 2IYSA 4GNKA 2QTVB 1F6BA 3LXXA 4NYJR 1W5SA 1Z3IX 1Z8FA 3PIRA 1EFUA 3VU9A 5HR5A 4KU4A 3R20A 2EFEB 4PC3A 3EA5A 4LSGA 1CIPA 3IKJA 4AD8A 2G1KA 1IHUA 1M7HA 5IK2D 1LF5A 4FWIB 4XH9B 1GRQA 4M9SA 2H57A 2EQBA 4DDWA 1NSFA 2Z5FA 2R9VA 1SVLA 3A4MA 5DO9A 1ZBDA 2AFHE 2VHCA 2ZRJA 2WM9B 4HZUB 1NY5A 1R8SA 2WOOA 4LJ7A 4QBFA 1J90A 2XB2A 1FNMA 1XMVA 4LBWA 1S4QA 1NLYA 4XVUA 2WKQA 1L4UA 421PA 1XPUA 3K09C 2J7PA 1XPOA 1KO5A 5FPKA 1ZVQA 2OHFA 4U5XA 4QBIA 3MLEA 3IO5A 1US8B 4LYHA 5EXSA 2XTMA 2QN6A 4QL3A 3RS4A 1E2QA 5J5CA 5HKKA 3CR8A 2J0VA 4BZPA 3I3SR 1MO6A 2XSZA 4PZYA 2WPDA 1E32A 2B6HA 1KZGB 2PT5A 1KOFA 5CLQA 5G53C 2ATVA 1NJFA 3OEED 2CCJA 5KNCA 2Q9CA 3VAAA 2JIZD 1A1VA 1IY0A 4JLOA 1CTQA 4Q9LA 3SYNA 1MO4A 2RGCA 1ESMA 4DLUA 4D6PA 2J87A 2F1JA 4TYYA 2YOHA 2IS4A 1F2UA 2IUSA 5E7IA 3HPQA 4KHZA 4DC9A 1SVIA 1U9IC 3GLHA 3AGPA 4JLMA 4FN5A 1BS1A 4EJSA 2Q21A 1G5TA 2A5DA 1TEXA 4N1AA 4NPHA 5FH9A 2J0UA 2RH5A 2O5VA 1LNZA 4BFYA 2ZJOA 1WE2A 1DOAA 4UXJA 3OIVA 1E6CA 3KFVA 3O8BA 4HZUA 4UNPA 1U8ZA 3FTQA 1OSNA 1FW6A 1ZIOA 4OQMA 3L43A 3K70D 4LHZA 2WAYA 1D9XA 3KJEA 4OKSA 4CVNA 3EZFA 3IPXA 2PZFA 2FPMA 3SR0A 5TVKA 5C18A 3V00A 3T35A 1E9SA 3PQCA 2AD1A 4DLRA 5FBQB 4I1VA 2BJWA 5LD2C 3L0SA 3Q3JB 5CYPA 4EQ6B 2X1VA 3K0AB 5AWFC 1OYYA 2JA1A 2IYXA 1ZM2A 4KBGA 4JJZA 3U2QA 3NC1C 2OM2A 1E0SA 4QHYA 4KFRA 2ZSDA 3U7HB 4XWAA 4MYUA 3I62A 1RIFA 3I61A 2QAGB 1OIXA 1HV8A 1U90A 2UVQA 2WKRA 3EWAA 4TLDA 4LPKA 4JSTA 1G6OA 4ACBA 2QENA 3AB3A 1G41A 4M2LA 3TVDA 4Q02A 1M1YE 4Q5IA 5JEDA 5AK0A 1FL9A 1U8YA 2P5TB 4GL2A 4URZR 1HY3A 1KHTA 2RMKA 1NNEA 4ARZB 3SS8A 3SZRA 4C7OB 2ZM5A 1QVRA 2GRJA 3PEYA 1SHZA 3FMOB 3SEAA 4DIEA 3THYB 2GZHA 3CB4A 1DPFA 1OXXK 3RRZA 3TUIC 2NOAA 4PPGA 1OHHD 4NBSA 4V03A 2AWOA 3FVQA 1SXJA 3L0IB 1Z06A 1RYFA 4Q18A 1N6OA 3KB1A 4Q4AA 4BUJA 3NDBB 1E0AA 2ZE8A 4MRVA 4DT1A 5EUQB 3RANA 4Q9HA 4U02A 3WP1B 3EZ2A 4DCVA 5FPTA 4L9SA 4M22A 3WBJA 4ZDJA 5FTLA 1X6VA 2IXGA 3FFAA 2IL1A 3WMEA 5FPYA 1NSTA 2PL3A 1E2PA 2GXAA 3PUWA 4E03A 4XWOA 4A0RA 2QAGC 2GVZC 4CEHB 5B57C 2W6JD 2YOGA 2YWGA 2J59A 2WSSD 5JEEA 2ZI9A 2BV3A 3W5JA 3BXZA 2FN4A 2W6ID 3FYHA 4B76A 3IEUA 3CRVA 4ZDWA 3SBEA 4IEIA 4B44A 4MITA 3QXXA 3ZVMA 3WYAA 1D6JA 3BGWA 4Z1MD 1UPTA 5DE3A 5DN6D 2AK3A 2HLDD 3AF4A 1S1CA 4N3NA 4P0TA 2JAQA 1G9XA 2O0HA 1TF5A 4E07A 3THWB 3VKWA 3UIEA 3JVUA 1Q0UA 5HE9A 4OK5A 1DTSA 1EK0A 3U7FB 2ZQ5A 5B30A 1E69A 1R0ZA 2H8KA 4GZLA 2J0QA 1E9EA 1YU9A 4FMCB 4B2LA 2QE7A 3Q5EA 5IHPA 2E87A 2QORA 521PA 3TMKA 1OH6A 1GL7A 1UKEA 2W6IA 4BLTA 5JWHA 4LJ5A 1FTNA 2IYWA 5JLJA 1U81A 2B21A 5LD2B 3QKUA 2GJ9A 2B8TA 1ZNWA 2ZITA 1ZM3A 2AKYA 1XJ0A 4WIAA 3ASYA 4NYMQ 2R6DA 3GLFA 1E9DA 4DXAA 1XX6A 5J4YA 3U3RA 1DO0A 2V6IA 3P4XA 1GWNA 1XTSA 3RLFA 1OT3A 2Z83A 1YZTA 3FMPB 2J0SA 2IW3A 2O8DA 1SKQA 2BMDA 3TBKA 3EARA 2ZRAA 1DG1G 5KDOA 3T06B 3WMFA 5CIWA 3SU8A 4JLKA 1UJ2A 1IAQA 4QJ4A 4RCYA 2YYZA 4URYR 1S8FA 2LKDA 3IPYA 1OH8A 1H8EA 1T3LA 1XMIA 4XD7D 4DDVA 2O8FA 3TAHA 1TADA 4Q19A 5J4HA 4MRPA 2Z43A 2ZU0C 4V02A 1GILA 4TTQA 1R6BX 2RB4A 3KXLA 1NVVR 4PHFA 3WY9A 2VLIA 1GM5A 1VG0B 4PAMA 5ANRB 1IN4A 4B6FA 4LX0A 3Q7QA 5G3ZA 5AUPB 3L8YA 1EXMA 4Q1DA 2WWWA 4RZUA 4IKEA 1RW4A 2NGRA 4W5JA 5AJZA 1NLZA 1KO4A 5JSZB 2B92A 2L0XA 2XB4A 5GVRA 3VTKA 2C5LA 4NCHA 3SQXA 4E5UA 5BYKA 2VP6A 4X8HA 1VYVA 4GT1A 4JYCA 3P32A 4PR0A 4PPQA 4MGZR 2CK3A 2ZREA 3Q72A 3LA6A 4XSHA 1TL7C 5L8VA 3W90A 3H2YA 1ZM7A 2F1RA 3ADBA 3G5UA 1P2UA 3U44B 5A4JA 3KFXA 2IF2A 4HI0E 4M9QA 4IDNA 1UEIA 2D2EA 4NHOA 1NN1A 4P4UA 1IN8A 2PEYA 2VRWA 3CX7A 2RGNC 5KDLA 2W2TA 1FUKA 1BMFD 3AVPA 4GI7A 3F3YA 1P9NA 3WNBA 1KKLA 1F2TB 3K0FB 3NIBA 1JNYA 3QE0A 1YZUA 4M9ZA 2GJKA 2ZS7A 3G0HA 2F3RA 2OESA 3V9PA 4OHYA 4DCNA 1G8YA 4AYTA 3BS4A 3GJXC 3SYLA 3KXKA 1OIVA 4GOXA 4M53A 4HB3A 1T4GA 1T91A 1LVGA 2EYQA 5J4VA 5HTKA 4IW3B 5LB4A 2IYUA 3WHLA 1CR4A 1NBMA 1P60A 2V3CC 4HAXA 1WDTA 1WQ1R 2W2VA 3BH7A 2VSOA 3K0EA 4MQBA 5JBQA 4G5QA 2BM0A 4RKFA 3HYRA 4FCWA 5DI3B 3SJCA 1Z6YA 4DIDA 1QHNA 2V7QA 5KYKA 1XZPA 2F9MA 4ARZA 2R6GA 2GJAA 1P62B 3BB4A 5TARA 4B35A 5A5GA 2GBLC 2OCAA 3U61B 2CE7A 4A2WA 4H9GA 4G1UC 4ILEA 5LPNA 4TLEA 5CLLA 3EASA 4JL8A 3U4QA 4GP6A 3I73A 2IHYA 2QTHA 2VHUA 5FL3A 5HKKD 2SHKA 3A1WA 2RGDA 2W0MA 3DKVA 2OLKA 2VHQA 2BBWA 4KYIB 2NZ8A 1BYIA 2ZETA 1G291 1XEWY 1NVXQ 1UFQA 2QSYA 1DADA 1B0UA 4TQAA 2ZRMA 1QF9A 1T3HA 4Q4HA 2V55B 5E7JA 2IK8A 2NG1A 3NHAA 4CW7A 1QBKC 2PT7A 3IUYA 2VF7A 1CU1A 2OLJA 3KX2A 2YNMA 4MKFA 2CLDX 2JIZA 1Z2AA 4M1WA 3DVLA 5L3SA 1T6NA 1T8TA 3OEEA 3TSZA 3GLIE 4YMVA 1YKSA 2R2AA 1O87A 2I1QA 3Q7PA 4EKDA 3LVRE 3B2EA 1TU3A 2IUTA 1ZAKA 4B2PA 4JBWA 4IXNA 4LYFA 1U2RA 4NONA 3AVOA 1JR3E 1EG7A 5DISB 4YMUA 1Q1BA 2J3EA 3QF4B 1PLKA 2QAJA 1CRQA 2KBEA 2PZGA 2D62A 1NMZA 1LTQA 4DCSA 2WWYA 3IEVA 4EPWA 4HDQB 8OHMA 1DAKA 1DAFA 1SHKA 1EWRA 5FTJA 5KO2A 3RRMA 1SVOA 4KFUA 3DOFA 1XP8A 3X1DA 3VHLB 1NVUQ 4GSYA 4PZZA 1MV5A 3C8UA 2QGZA 4KAXA 1HURA 3B13B 2ZAMA 3K0CA 4PSAA 4G3XA 1SVSA 4GOJA 1HQCA 3H4MA 4B32A 2O8DB 2A5YB 4WOPA 1G5PA 2QROA 1A82A 2ORVA 3QQ5A 1NVWQ 221PA 5CK4A 4CEHA 1CLUA 1ZUNB 1SXJD 3P27A 2AFIE 5E7MA 4HAZA 4M1SA 4R2HA 5JMTA 1TNDA 4FCTA 3U7GA 3P4YA 2IWRA 4RSGA 3S1AB 2ZS9A 4HYYA 3ICEA 2O8BB 5KSOA 1T5LA 1DELA 4NMMA 5F3WB 2AHOA 3RS3A 2FFAA 3W3AA 2HCBA 1MOZA 1ELOA 4D4MA 1H65A 2D7DA 4FWTA 1W0JA 1BYUA 2IBMA 2JATA 4W9MC 3TSWA 3TRFA 4TZ6A 2H16A 1UM8A 4UJ3A 4IHQA 3TQCA 4PO1A 3BOSA 1IBRA 3FKSD 2PMDA 4PC2A 3BFKA 3RSOA 4OJQA 1G3QA 2C9CA 2IS2A 5CDFA 3TUJC 1ZCAA 5DYGA 3SQWA 1Q21A 3LX8A 1Z0DA 1GL6A 4MH0R 3AQ4A 4YMWA 4BLPA 2JLUA 1E0JA 1A5TA 3AP1A 4IVRA 3SNHA 4L16A 3FFBA 4IDPA 3GLGA 3T34A 1YR9A 1NRJB 4PSKA 4WVFA 4Q9IA 3U60B 3K53A 4JVLA 1GUAA 1Z83A 4IFEA 1VIYA 3ZD7A 4Z54A 3GCGA 1P2SA 4TT3A 3RYTC 1TQ4A 3RWMB 2ZI6A 1GITA 3T61A 4CEJB 1BKDR 5KSZA 4MKGA 4Q7KA 2IUUA 2QI9C 1QHIA 3I32A 3TUZC 3T1QA 2QP3A 1NN0A 5FBVB 3EPKA 1T8UA 1K5GA 3W5IA 3DZ8A 4RZ3A 4ZI2A 1XDBA 3B1XA 1E1RD 4LBVA 1JALA 4ZPXA 1G7TA 2BJVA 1XD9A 1AGRA 3WRYC 3OAAA 1P2VA 2DFKB 1OXVA 621PA 3E2IA 4XSGA 2JLYA 1ZMXA 3IIMA 4KSBA 3FHTA 3OAAD 4G0NA 3LVQE 3WNDA 2VHTA 5TDHA 3AVQA 4DVGA 3DM5A 3O47A 1P75A 2QZ4A 2WJJA 3A4LA 1OKKA 1Q1EA 1D8TA 1S96A 4KLNA 2JCSA 4DB2A 2C04A 1ESNA 2BM1A 1IXSB 4B33A 2VP2A 2ZE7A 1OB2A 3AP2A 3CBQA 4PSVA 4DBLC 4BASA 2JJ1A 3FWYA 3NBXX 2Q6TA 1G3RA 3BJIC 5DIFA 3KQUA 3ZDQA 2CL6X 3UG6A 3RRNA 1U0JA 4JKIA 1XD2B 2UKDA 1TQDA 1GRNA 3B1ZA 2B7BA 3LAWA 5FUXA 1R4AA 4OHZA 3KJGA 2NIPA 1WCV1 4IOMA 3GFOA 2WWHA 1QG4A 4Q1BA 4O0MA 5DHAA 121PA 2NQ2C 2YV5A 5KSYA 4FMCF 4ZV4A 4KSCA 3PUZA 1XJCA 4IVQA 4DDTA 1KJWA 3S1AA 3NDPA 2ZRIA 4HLCA 1WBBA 2QTFA 4D25A 3IBGA 3K9LA 4CYMA 4CIDA 4MYHA 1F5NA 4A6XA 1E2FA 3LQQA 5DYIA 2QY9A 4GBMA 1II8B 2FH5B 5JRZA 3X1WA 2JJ2A 3RSLA 4Y0AA 1XZQA 4DRZA 4F4JA 3ZIAD 2FEOA 3MRSA 2QM7A 4LHYA 2VL7A 4BLOA 4I99A 1W44A 3NH9A 1Q44A 1JQJC 3A37A 1T5IA 1F3OA 1XEWX 2PMKA 3K0AA 2QG6A 4A36A 2KWIA 2DY1A 1L2TA 1ZINA 2J41A 3PEWA 4I4LA 5KNDA 1KO1A 4PC7A 4QHTA 4OK3A 4OI0A 4DCTA 1WF3A 4YQFA 3NG1A 2O0KA 4Z8XA 1X86B 4DWJA 4BGDA 1VTKA 5L3VA 2EFHB 2JDIA 3CWZA 4JKYA 4WXPA 4L5BA 3WHKA 4P32A 3D3QA 3THXA 1ANKA 4HUQA 2XNDA 2VYFA 4RZ2A 1JEDA 1SULA 2G0TA 5HE8A 1EFHA 1GDDA 5FBLB 1QHGA 2BKUA 5BN3A 3BFVA 2V4ZA 5JSZA 1G18A 1PZNA 4V0OA 4JVMA 1A2KC 1GAJA 4Z8YA 1KYIA 5GADl 3U5ZB 2ZRNA 1A7JA 3DEFA 4JT2A 3PVSA 5FTNA 3UKDA 1KMHB 2H17A 4LK2A 3U6KA 2O8CB 3IBYA 4D81A 1IXRC 2BIFA 2GK7A 3AF0A 4JT4A 2QEQA 5AUQA 3JVVA 1G6HA 5FUWA 1Z08A 5IDVA 2EFCB 3AP3A 4H1UA 4C0LA 3H86A 5D3MB 3GJ3A 4I1UA 4KITB 3WRXC 2C99A 1NIPA 5FBWB 3LV8A 4D82A 2ZYUX 2LCFA 1S3SA 4BECA 3L2OB 4M4SA 2HJGA 1ZD8A 2WMOB 1SVMA 4PQYA 2XEXA 2ZI5A 3EZ7A 2XTNA 1DARA 5FFMA 5FUVA 1T0JB 4LGMA 1VIAA 5EE3A 4F92B 2ZYTX 2C78A 1R5OA 3SE0A 2QT1A 4OI2A 1T3SA 1X3SA 2CCKA 1GRRA 2F6RA 5C46F 2H1LA 2XOKD 3A1SA 4JBYA 3LD9A 1KSFX 3BH0A 4A2QA 2HXYA 1NL3A 1OFHA 1KAGA 2GCNA 3MWLA 2QUZA 2I4IA 1OKKD 3K09A 1W36B 1RVDA 1ZUIA 3G82C 4D0GA 4ZIRB 1NBME 4NYMR 2ZSFA 5H8WA 3IGFA 3UMRA 1Z0AA 4QJ5A 3KJHA 5G41A 1E2MA 1Q1ZA 1ZNXA 1ZC4A 5KHOC 4PHGA 1NBMD 3NHBA 1E1RA 2FF7A 2CCGA 1ZRHA 3RVBA 4BFZA 2YKGA 1GNQA 4CF7A 4IDHA 2PCJA 2GK6A 2QPTA 2ZE5A 4BQSA 2REBA 3N70A 4KV9A 4B6EA 3THWA 3OE7D 3MCAA 2QMUA 4JVSB 3KTAB 5JZVA 2ZXUA 2QP9X 1VKJA 4PO9A 3I8SA 1COWA 2FGJA 4CEIA 5FI1B 2FOLA 2GF0A 2X77A 1MRNA 4GMXA 4S35A 3E70C 4AKHA 4ESHA 3UK6A 3B85A 1XTIA 4NP6A 1PLLA 3SJZA 1S3GA 1AA9A 3A8TA 1M2OB 2OO7A 4AYWA 3CNOA 4EFLA 1XFAA 1CJTC 2ZJYA 1NN5A 2J0UB 5GJVC 4DKXA 4DLZA 3RS7A 3I5XA 1Q1QA 1TUIA 4WBSA 4B3GA 5SZIA 1I4DD 1MH1A 1FFHA 2PCLA
chains in the Genus database with same CATH superfamily
1HTWA 1V16B 4NAHA 3COZA 1O57A 3EULA 4R3NA 4NPCA 9ABPA 1JDPA 1XO1A 3FPCA 2QL6A 4WLVA 1TMGE 2DFLA 3OC6A 1H66A 2EKBA 1L5RA 1Y6RA 3CX8A 2PWAA 3EG9B 5EZQA 2GEDA 1RXUA 2X3YA 1FVXA 3DULA 4G5SA 1FDVA 3FSRA 4M83A 2W6ZA 3QKRA 1P9RA 3BIOA 1YCGA 2XB6A 2P4HX 1FSGA 2RHLA 3E3AA 3HFRA 1RTTA 1MUUA 3KC2A 2X58A 5E3HA 1HKHA 4LBYA 5I9BA 1N9ZA 1B8PA 4US0R 3EFBA 1OIWA 1VHWA 2O2DA 5KSWB 1ORDA 4LRTB 1XRPA 3QEJA 2JIQA 5B1IA 1ZN7A 2FNAA 4N76A 4RK6A 4Y2JA 2B4TO 2CL5A 2IITA 1A77A 2P3OA 2ZUUA 3CPSA 3ETJA 3LQRA 5HIMA 3ZLBA 1I9CA 4UFPA 5DP1A 1ZWLA 3PB3A 1DWPA 3MUNA 2HA6A 3ZU6A 2BKLA 3PXGA 4IDAA 1JXMA 1WMSA 4RY0A 4KR6A 3LRPA 4FHCA 4QD3A 4UTOA 1A8SA 1J1ZA 2KSQA 2QDKA 4UUOA 3ZJVA 4XDGA 1BCSB 1USUA 2ZKLA 3UICA 2M9MA 1Z17A 2J8ZA 2OHVA 3ACDA 4UU0A 1Y3FE 3KYIB 2BMVA 2EAUA 5D1NA 4PPFA 5EN4A 5ALNA 2EQ5A 3FIJA 2I2XB 3ONDA 1XLUA 1T10A 2CFSA 2HYDA 3PDUA 4HX2A 4BZWA 2VT3A 4F91B 1AF7A 4E22A 2EWWA 5JY6A 1D4ZA 1MPTA 3G9QA 3LQ2A 3MRTA 2DPYA 3DR3A 3MRVA 3NVAA 4IDQA 4RE5A 5DYYA 5ABPA 4I4CA 4X64B 3VSAA 1QKIA 2B8WA 4KDFA 1A0OA 3T41A 2VDWA 3GFTA 3A9WA 4QXAA 2F1IA 3J81A 3DLHA 4TUYF 2Q07A 2Y9PB 4AQDA 3PUYA 4W5WA 2KM1A 1Q74A 1OFGA 2M98A 3ZDZB 1O5TA 2D4AA 1LSUA 1WX1A 1I2BA 3N59A 1WDKA 1EVKA 3DYIA 1G8HA 2HT6A 2VYND 4LJYA 4AUEA 3FAZA 3LRXA 4DLXA 3TS1A 3CO0S 2NPIA 3K5PA 2GN6A 3NOXA 1MO2A 2FN3A 4JZKA 4MPJA 1JDTA 5FQNA 3T9EA 2CJWA 4XIIA 4W9RA 2HFKA 4JS0A 2BTQB 4CR7A 2GPWA 1OLOA 3RODA 1OU4A 1FNBA 1WSWA 1V16A 5MFZA 2ZJ5A 3N2GA 4PNHA 2V6MA 4CG3A 3I9V1 3OX1A 1Z62A 2C7BA 2VT7A 3V2HA 1WVMA 2XYGA 4IUBS 3QMMA 4DYHA 5BV2P 5IXJA 2ZUSA 5KSYA 2EIHA 5DKFA 5SZJA 1DAOA 2ZJBA 3FJOA 1QGZA 3NHPA 3KKNA 4IOJA 3CC8A 2ZT7A 3OTHA 1EBUA 5KTRA 1AJEA 3KB6A 4JELA 4M99A 1XKTA 4RMIA 5LBTA 4C2UA 1XTTA 1SWVA 2YRWA 5JJLA 1PR2A 4AS3A 3KT3A 4DMFA 2CJFA 3ABSB 2F43A 4G89A 6REQA 3K6JA 5D8DA 3GEMA 2WD8A 2QPLA 4OM7A 2Q5JA 3AEZA 1HL3A 1QTNA 1YS2X 5CT5A 5E1MA 4XB1A 4HN4B 4AJLA 5BVGA 1ULTA 1JEYA 4Y1GA 3LDGA 1FMJA 2WTXA 2PL5A 4FYJA 3TMYA 3WRYA 4A92A 5KQPA 1MLDA 3R7WB 3E0QA 1P8AA 3DT6A 5ARBA 3QPCA 2XE8A 3X2SA 3N9IA 1L3CA 1REQB 1UBGA 2RG7A 3A6DA 3GZTB 1O6FA 4HTAA 3TB6A 4BEWA 1R6VA 2Q1UA 1HR0B 2NXEA 1JQBA 4LV8B 3K0FA 4J0IA 1CY6A 1ZJ5A 2IQIA 5FWAA 4MDFA 3RDPA 1U0LA 2NUBA 4R2MA 4QYIA 2XZOA 5GJBA 4NCAA 2XUKA 4B8ZA 3HJAA 2ASVA 2Q1XA 2AG8A 4F4UA 2D2IA 2A1TR 2KJQA 4X44A 3BERA 5HZHA 3UJNA 1IHOA 1H0KA 3BXGA 4A1FA 4GPBA 1B14A 1HPLA 1K3TA 2Y0PA 1NXOA 1SHTX 5AJHA 4CDMA 4D4IA 4EDHA 4HGQA 2A9PA 3I72A 1JU4A 1JR6A 3JQEA 1R10A 6PFKA 5BQFA 4DLKA 3Q0EA 4YCNA 4ER3A 2P6NA 3LSTA 4GHWA 3AH8A 1ZPDA 1U6IA 1KI4A 4D0LB 1UXOA 3HUFA 1JEQB 1LS1A 4UE3S 2F3PA 3ZXSA 4BWYA 4Q4DA 3QLUC 3ORSA 1JHAA 3ZK7A 1Z28A 2YX1A 4JP3A 2NZ2A 5ICCA 4EL5A 2DHDA 1W75A 1JL3A 1L8QA 4AP5A 1XDWA 4FU0A 4NAVA 4RVOA 4XJXA 3MWJA 4ZO4A 3W7AA 3OESA 4G0MA 4I1YA 4JLDA 4P35A 1AGYA 1H6CA 1QIEA 2YS7A 1DL5A 1TW2A 3G0IA 3QPAA 1W35A 4KO4S 4LCEA 3ZJTA 4MA0A 2XLBA 4DJAA 1XYYA 5G0VA 3H16A 1TZJA 1LCIA 3DOEA 3FCSB 4IXTA 4UTXA 5B58C 3NH6A 2XWSA 5NLLA 2F59A 1YMVA 1ZFNA 3OJXA 2OCPA 3MMPA 5T5QA 1RPAA 3FGPA 4Y30A 1U8CB 3WJ7A 1YJ8A 4HDNB 4EG1A 4JJ8A 1BFKA 1UH5A 4C29A 3SVLA 1P1BA 3EIWA 2BFPA 3I6QA 3ZWXA 3ZU2A 1UOQA 3IT1A 1A95A 3G17A 4UAUA 4UUMA 1RHUA 1VCOA 1K5HA 3H0EA 4UZSA 1ENYA 3JQFC 5H02A 3FROA 5DRTA 2Y1FA 2X8AA 2P0YA 5GJCA 4LCJA 2C83A 1MABB 4OI1A 4PAWA 3ILSA 4KGXA 5K0JA 1NWHA 1OILA 1TTHA 1KTVA 4JUDX 2Z6AA 4H3HB 3VO9A 2IOYA 1XL1A 2FHPA 4B7UA 4NCKA 3SZOA 3H2GA 3ZVNA 1N57A 1W30A 3W2FA 2DBRA 3KUDA 1O54A 2GCOA 2NM0A 1LBQA 2D3TA 3CXUA 3W8DA 1OZFA 3R6DA 4M36A 2IY7A 4L85A 4HRAA 3TQHA 1QX4A 5FPSA 4X6YA 1WB6A 2FEXA 2H7CA 4G36A 2FDCA 3ZDBA 1VL6A 1PVVA 1MR3F 4MZXA 2AH5A 2ZSEA 4QOJA 4WZBB 4WKGA 4ZKDA 4G0YA 2GJ4A 2XTZA 5A5FA 1QONA 1VL0A 3HFGA 1VL8A 3OOHA 4PC3A 1L7DA 1KZ7B 2DG2A 1QOZA 4DLVA 3SFVA 4LDAA 1G3UA 3A9CA 2BUAA 3GVCA 2V5UA 2ZIAA 1ADGA 2ZRDA 3E53A 5FORA 4B48A 3PPYA 4IO1A 5C7YA 4CKEB 1IOWA 2E4UA 1WKCA 5BSKA 1EX9A 3JD3A 3O95A 2W4IA 4E33A 4F9EA 3U4MA 2M1ZA 1NMYA 4BKPA 5B64A 1QO0A 2FSFA 721PA 1M6VB 4YHBA 1GFIA 1MX5A 1V3TA 3RBZA 5JVDF 3AUAA 4QXQA 4LFCB 2WR8A 1BE6A 1N3BA 2QPOA 4JVNA 4N6NA 5JAOA 1P0FA 2PBZA 2UDPA 5AOCA 3BMOA 4HEJA 2H1WA 2FZ4A 3BJZA 3KJNA 4UEQA 3AW8A 4KR0A 1Z3CA 1ZD9A 1YB4A 4HZIA 1V8ZA 4ESVA 1LRLA 2YV1A 1GDHA 2Y0BA 1ZYUA 4ETMA 1RJFA 2XCLA 3WZLA 5CNIA 1D2RA 1AS0A 5HIJA 3W1EA 2IQ5A 5C8VA 1GVHA 1XYVA 2H7XA 2ACKA 5BRJA 4Y6LA 4TZ0A 4GOLD 1MXFA 4UHEA 5FTNA 4R6XA 2X4LA 3GYBA 2JFXA 1DX9A 3NCTA 4UASA 2VJAA 3ZCRA 4W5OA 2XZPA 1E92A 4DPKA 3S27A 2XMZA 3CF4G 2NU6A 3HUTA 1MOSA 1H0HA 5FAXA 2F4VB 4MCAA 1ZGGA 3AY0A 3PZRA 1G20E 1L4GA 2GBIA 3QW2A 4LFBB 2ZRFA 2JAWA 3ZE1B 2PG3A 1RQRA 2ENWA 2Q5FA 4I81A 4KQ6A 1YL6A 2WMYA 4DTIA 2YZNA 1OZGA 1TVMA 2AA3A 5COQA 4BWFB 5LZ2A 4PC1A 1RRCA 1KQNA 3P1JA 3SM9A 3OP4A 1J07A 5EVCA 1CYDA 1M7BA 4HLQB 4YGYA 2XE7A 4KN8A 3D3JA 2BEUB 2RK3A 3R5KA 5ULLA 1K9SA 1QZXA 2A2ZA 3T4PA 5EP2A 9ATCA 4GNRA 5EIAA 1V48A 3BTOA 5CBPA 4JROA 4YJKA 3CT4A 5BMVF 3DUFA 3KOUA 3O3NB 2EDCA 3GDFA 5ERYA 1NV9A 2HH9A 4TLBA 3M1IA 2Z2IA 4AN0A 5D3MA 1KU6A 4NXMB 4FFVA 2GFHA 4HX5A 4G09A 4BNHA 4D2IA 1QCDA 1XBTA 1YS1X 2GCEA 3PGLA 1P4RA 1ZLYA 3D59A 2VJOA 4M0PA 2AXPA 4N4AA 3FPFA 3NNNA 1KE2A 5JHHB 1Z4QA 4G81A 4KVFA 3STYA 1JA1A 1W85A 4JIMA 4TWIA 4RF3A 4YUZA 4UCXA 4F8YA 2YIJA 4MUHA 4PZ9A 3DDHA 3S40A 3GEIA 3RABA 2ISCA 1IJBA 1ZA2A 2PGJA 3FI9A 3NBQA 1XCGB 4NXNB 1QUEA 2HL6A 4NDAA 3C6ZA 4BE7B 2IOFA 2WD7A 3CH4B 4LKOA 4U1RA 2FZGA 1RC0A 3CSUA 5H68A 2RE8A 3PCRB 2CXQA 2WPDD 3HLTA 2ZUTA 3LX6A 2ID8A 2KX7A 3CRQA 3RC2A 4L7VA 1VBMA 1BDBA 3FSEA 2OAP1 2Y92A 2YINC 3L92A 3JQGB 4H3KB 4RA6B 5DXAA 1JSZA 3KZ1E 4AJJA 4I6GA 3GLFE 4REQA 1JZQA 3JATB 3R3SA 4MCIA 4FBMA 4JI7B 5IXSA 2PGDA 2QN2A 2QMZA 2YHAA 3RS5A 3WI7A 1IJKA 1OFUX 4Y2HA 2JBWA 2TYSB 2XCIA 3BFXA 3VDRA 1RBQA 1R27A 1Z2CA 3U4IA 5LMUB 5G0UA 4QFMA 4HB0A 4WFJA 5IEJA 4QIHA 5THXA 2C2ZA 3S8MA 3DBLB 2WFLA 5KNBA 1T6XA 3AYZB 4Z86A 2XYHA 4PANA 4AQYB 1TKBA 4EX6A 3B6ZA 2I22A 3AI2A 3VSCA 5F3RA 2IT1A 2JS7A 4FGUA 4XW2A 4OHXA 3UXEA 4BNFA 4DR6B 3UPTA 4JQYA 1YRLA 1FX1A 2QL5A 5BXQC 1FNSA 1XF1A 4LJRA 4OQNA 2Z9CA 3KP1A 1KXZA 4QNMA 4L8WB 4E30A 2XXAA 2G0AA 3BGIA 4IWNA 4OU4A 2PUDA 1GSAA 3TINA 3ABZA 4URXR 3ASZA 3RUHA 2ZR7A 3KM0A 1ZNQO 2JASA 1IL0A 4TMVA 1ZONA 2VNAA 5EZYF 2WSMA 4Q03A 1MIOA 1PK9A 4J7CA 2P6PA 2D2VA 2O1SA 2WFLB 1G4UR 3HJHA 4FGZA 4Q1FA 1GD1O 1OXMA 3EQ6A 4X8MA 4TTSA 1OAAA 3VR2A 1UZLA 1K4MA 1ZW1A 2VP9A 1OBCA 4MX8A 1JI0A 3DOOA 5T64A 3SIPA 5C31A 5HJ7A 2PUVA 4AUNA 3N0RA 2HJVA 1E2EA 1K8YB 1S5PA 1IVNA 1ZUHA 3D4BA 1I13A 1UPXA 3KELA 4YRPA 1DAMA 2X0DA 4QTUB 4CIYA 1GUDA 4JLJA 2RJOA 3BCUA 2Z8YM 2C3PA 2G80A 3F5DA 2CYBA 3V97A 4UBOA 2G04A 1XF9A 3BGVA 1VHJA 3L1JA 4EHIA 1C3JA 1B73A 3CUTA 3E7DA 3AF1A 1J23A 3NP7A 4RD2A 3NATA 1TQ2A 3KSMA 4TSFA 4ZYXA 3G5AA 1U0FA 3LCUA 1S8AA 2O2HA 5AW2A 4KMOA 3BM5A 5FRDA 4AY4A 2R96A 3WYDA 2CEKA 1Y0BA 5DPMA 4C43A 1LLCA 4IG4A 1RBMA 2QNIA 2BP7A 1Z34A 2QV0A 1SHJA 3W04A 5K6AC 1HM5A 3RC3A 4JN6B 3OE1A 5LL6P 4UBIA 3QF7A 3JSAA 2XZLA 1OYWA 1O6CA 1JDBB 2FMKA 2OD2A 3QPDA 4KVZA 5EXXA 3R74A 4EGSA 3LUAA 4XFKA 4JLWA 4CKCA 4MVXA 4WNAA 3RAPR 1USKA 4RSHA 2HEGA 3DOIA 5KOJA 2QF7A 5DNUA 4FFBA 4IFIA 3MMXA 3R5TA 3RYIA 1SVKA 3PJRA 2RKOA 3B7PA 4LWOA 2HWWA 4M7WA 3UNXA 2C84A 1NA5A 2PFSA 4L95C 4S3MA 4TQUS 3LLUA 2ZWVA 1JEYB 5DZSA 4HWPA 2C9BA 2FW6A 3IUNA 4RD1A 5DMXA 3F98A 5EEGA 2FR8A 3OH8A 4OU5A 2XMPA 3LOQA 1K7FB 3ZGZA 2FUNB 2F2TA 4NH0A 1I3NA 4FMDB 1P39A 4DRXA 5FOQA 1J4AA 3PNVA 1E79A 4CM4B 5DWVA 1SC9A 2J1LA 2Z56A 2VH1A 1S9DA 4IHJA 3VR5A 4K9SA 2ICAA 1RRFA 2VJQA 3UY4A 1F2VA 1PG2A 3CPHA 5ITZA 1U2TA 4L6AA 4KTTE 4I19A 3GV0A 4NBLA 4MWTA 4AURA 1U9IA 1NJ2A 3DDOA 2R8ZA 1KP9A 4JI2B 3T0IA 2FE4A 3CUUA 5I9IA 3DMYA 1RE1A 3I01M 3CR7A 2PQ2A 3VDQA 1M5RA 2O4UX 2XT6A 2FWNA 2AN5A 3PHBE 3HYTA 4FK8A 2PL1A 1YI1A 4PO8A 4D4LA 1BJKA 1DG3A 1FX0A 1O03A 2XOXA 3IR5A 4M0KA 4WUTA 3WAJA 4QUJA 1JXQA 1ZWKA 3DTNA 3P2MA 4GDMA 4DEVA 1JMKC 2JH8A 2UYGA 4WOBA 3SM3A 3GU3A 5K09A 4H4DA 1YOBA 2D06A 4RLSA 3OE4A 4C89A 2J3QA 1R0WA 2OZEA 1CG6A 2AIRA 2PYIA 1Z0JA 5B1YA 5I5EA 2B8EA 3OM0A 1Y3AA 4YYZA 3BF7A 1W4RA 1XD8A 3QFCA 3R8FA 1JPJA 1P4GA 2HPVA 3G59A 3KHUA 4NY1A 5F21A 3M8KA 2CF5A 2EZ8A 2O1EA 4TT3D 4LOAA 3R0QA 3H84A 3ZIAA 1M1NA 4GMKA 3ESYA 5K51A 1KPIA 3OQOA 3LCMA 4E5DA 2FOIA 5CEJA 1UAYA 2MSKA 1F7UA 3KYJB 3U3KA 4XUGB 1VMKA 2BF4A 3L6UA 1DHRA 1U4SA 1X9GA 4R8SA 5AUNB 1LPMA 5E3JA 2Q1TA 3A6HA 1W0KD 1KSHA 1Y81A 1QHFA 3HP4A 3NANA 3PEFA 4J0FA 2B82A 1XN4A 2D5IA 3JQPA 5D5HA 3QFHA 3SF8A 3HEMA 4EQ6A 3BL8A 3CVWA 4MUEA 3PC8A 4HNSA 5JS1A 4PRZA 5L95A 2YWEA 4IQ0A 1Q6YA 2FI1A 3EPRA 3H5LA 3NHJA 4F2WA 5JU6A 2AOXA 2J9FB 4W7IA 2FPLA 2DPLA 4KIWA 5H3LA 1FRFS 4BPBA 5AJYA 2XDYA 2D5AA 2ZJ7A 2HY7A 3RNLA 3T7KA 3OJLA 4DA0A 2XQKA 3ODGA 1H3EA 4GAEA 1Z36A 3I2GA 3OU7A 3SJBA 1GTSA 1PFKA 2LR0A 3LY5A 4EG5A 4FLMA 3K8ZA 1HE5A 1I7PA 2EGHA 2H31A 1RPTA 4GPZA 1MD9A 5FNVF 1C9KA 3UIEA 2C9ZA 2XJ9A 4EYQA 4JJ4A 1VKHA 1UMKA 2JZCA 2XLCA 2ZJ4A 1QRAA 3H83A 3U5TA 2FFQA 3O8QB 1CJMA 4G1MB 4D4KA 1KIAA 2I5PO 4LSWA 4AS2A 1E2HA 2YDXA 4QAJA 4QWWA 4HVLA 5I7RA 1GZSA 5FHRA 4IFBA 3HBAA 5M3BA 2F8MA 2W00A 3WGZA 2R7NA 5AOVA 1OTXA 1K63A 3EDRA 3ML1A 2H1SA 2HD4A 3VR6A 3GLIA 2OK7A 3HCPA 1DIHA 2FSUA 2FPWA 1DINA 4OP3A 2GD6A 3IEXA 1VXOA 2JB9A 2BGRA 2ZJ0A 3V8VA 2PD3A 4DM4A 1AURA 1N34B 1DKRA 3AR4A 3RRYA 4INAA 1E4EA 3DVAB 1A5AB 1EIZA 5U4XA 1RYEA 1K7XB 3JQ8B 4LDZA 4X7MA 3GJSA 1XWIA 4B31A 1DCMA 1ZNZA 1G21E 4MPRA 3D0RA 1OZAA 3B1VA 4M9UA 1JLKA 2EZUA 16PKA 4DRYA 4FINA 2ZJZA 4ZA2A 1UM9B 3CUSA 3D54D 2BDEA 2OQIA 3LPLA 2P0AA 2IS6A 2DBQA 1EFTA 5IABA 3SAJA 1A9XA 1DFIA 3OLQA 2CZGA 4WXMA 2JI4A 2B8NA 3C14C 1Z73A 3U3JA 5A7FA 1DVRA 3GVPA 3N2KA 5ECYA 3GEEA 2D4HA 3SZLA 4C0QC 4YMTA 2QYTA 1NJGA 4GPD1 1D9ZA 1GPLA 2F1OA 3MGKA 4FYMA 1CR1A 2OVBA 4ZD6A 3I3OA 1AZSC 1MN6A 3E4CA 3LA8A 3BPSA 4TROA 3DE5X 3RVKA 2BTEA 1IQPA 2VQDA 2VH5R 5TPZD 1R0KA 2V98A 2X9NA 3FR7A 3TWOA 5J1SB 3QV2A 1C2YA 1RRPA 2WD9A 2XY4A 2ZJ2A 4YT5A 2FSGA 4BNGA 2XUPA 3R5FA 3LPDA 1WV0A 3Q9SA 2A9FA 4XTCS 3A1FA 2J3DA 4LVUA 2CC2A 3AKCA 2DKNA 4DA7A 2GWHA 4N03A 3OUZA 3ZU5A 4YDRA 4KNYA 2WICA 2QAIA 5KX5F 3LY8A 2GK3A 4X93A 2KBFA 4OJKA 5DX8A 1U1CA 5C53B 2FWBA 1CFJA 1ZZGA 2BFNA 3IESA 4MRAA 2DWQA 4HWGA 2IPAB 4K9DA 5HK8A 4WZ6A 1FIUA 1SU6A 2VPWA 3OUUA 2G09A 3G2KA 2RJ3A 2GN4A 4QGAA 3K4QA 2P2NA 3H05A 3MW8A 3VOAA 2VP0A 3GJ8A 2CZCA 3O4HA 1BD4A 4GX0A 1LH0A 4MGYR 3L7KA 4YRBA 5KKCA 2Y1CA 5EIWA 3EA4A 4I55B 4M1EA 3TDKA 3GFPA 5FBKA 1MB3A 5GOZA 1TKRA 1XZMA 4JT9A 2YWDA 5HCNA 5JS2A 4A10A 4ENSA 1E4YA 2IF0A 1GG2A 3PR1A 4K88A 1DFHA 1T9ZA 2Q5QA 1UFOA 3IURA 1Z18A 4M9RA 1RWWA 5EE1A 3VPBA 1JLMA 4ENVA 4R1PA 1OLSA 2YZ7A 3L8FA 4R9RA 1J2EA 1DAEA 1S8OA 4IXMA 3GZ4A 4PAOA 4UHBA 1EGAA 4N7JA 1DQNA 3V2IA 4A8HA 2AKEA 4PF1A 1K06A 4BO2A 2FK8A 3DQZA 1MAWA 5F77A 3UAYA 2UU9B 3UATA 4GMDA 5DI3A 1NTOA 1XEFA 3WYGA 2JFNA 4A3SA 5B7NA 2RCYA 5KOHA 3PPWA 4L6CA 3G9XA 5AKKA 2OEPA 2ZCJA 3ND6A 1GPWB 4A0FA 4N12A 2GF2A 5KJ1A 1XXHB 4GI2A 3NEJA 1GYQA 5CDSA 3IE1A 1VYUA 1X0VA 3FDJA 5IX8A 1I51A 3TLEA 3T1VA 5A04A 4ZQHA 1M83A 4PG5A 5EC8A 1XXHE 1A72A 1UQTA 2YJ3A 1GA4A 2DPXA 1RPJA 4MDEA 1KI9A 3BGOS 1VA5A 1L4KA 1LFDB 3QX3A 4MKXA 2PRJA 4M98A 3TKLA 1X7XB 4QGSA 5C32A 1X13A 2HF8A 3E84A 1MP0A 4YAWA 2V4MA 3WQQA 5F98A 3IBFA 3ADDA 1BTOA 3WSVA 4RTNA 3LHSA 3UPUA 3OECA 2HKIA 2QUJA 4XPIA 5ALXA 5K0BA 1HDZA 5TLSA 2WF9A 4RTQA 3X0DA 5JAZA 1Y6JA 4KQGA 4MYCA 4TXLA 4E21A 1CYEA 1I3MA 2B4YA 4M87A 2AMJA 4XYLA 2QNBA 4CIAA 1LBIA 2BD0A 3IP3A 2HF9A 3EF1A 1KO7A 4KDRA 4ES6A 2FG5A 4J03A 4MAFA 3WISA 2VVTA 4TS1A 4W6QA 3OZAA 1II0A 1QM5A 4LRXA 3IA2A 1JIQA 1CZKA 1ILWA 3G2PA 4CKEA 3NNDA 3CE9A 2JFYA 2JIMA 5JIBA 2OXIA 2HT1A 1UK9A 1V9CA 4DLYA 1MIHA 2GM4A 1AQLA 2JL1A 1XZKA 1GU7A 2ZULA 1N6RA 3AHFA 5E38A 4B80A 4DY4A 3AC0A 3ZJUA 2N47A 2B0CA 3F9IA 3EYAA 2IPMA 1FDSA 4MUXA 2AOTB 3ROZA 3LOUA 2FAXA 1U2ZA 4ZWNA 2RIRA 4CHTA 5K3OA 4Q4LA 1N5LA 4JEMA 2FPSA 4IHJF 1NQAO 1JYFA 3SDZA 2VPZA 1RHKA 5ADVA 5K0CA 3KSBC 1ZR4A 1Z5NA 3FPSA 2DFNA 4QO7A 2B34A 3HK2A 3N5CA 3NUGA 1Q7BA 2DB3A 3ZE7A 5LN1A 1EP9A 3NRCA 4IQ8A 3QKRB 5BNIA 4C01A 4Z4QA 3LNTA 5L3RA 4RACA 1SWWA 1NI4B 1J8YF 5FLEX 2DQKA 4EEXA 4YV7A 4KPEC 3AT1A 2C5EA 2I76A 2FR1A 1R8JA 1L8LA 3GP5A 4UAVA 3GT0A 3PQ2A 1IY2A 4JUAA 1ZUNA 4ZO8A 1ZCZA 2CLOB 5D3QA 3A4IA 1E3TA 1NRXA 4J3FA 3R3VA 1TRHA 2Q4EA 2I7CA 4L72A 4QPDA 3USCS 4IJ6A 5CH8A 2PZKA 3MEQA 2ACVA 1U02A 3BWEA 1UUFA 1CUUA 4TV9A 2WV9A 1TFUA 3UJ9A 1R6TA 1HZJA 3K9BA 4HAWA 4ND1A 4F56A 2XX3A 2V7BA 3D4NA 2EZ4A 5K03A 3FUUA 3O2SB 2VZEA 2ZUVA 3JAWB 5LWHA 1W4AA 3EOZA 4L3WA 5DNYB 1N5OX 3QSGA 4HJXA 1B0PA 1VJDA 3A3PA 1V37A 5ENVA 4CLOB 1U28A 4TMWA 5FCDA 5AKJA 3H75A 5J2UA 1EX1A 2HQOA 2Y99A 3N0VA 1YQGA 2HU2A 3BD6A 3QEMB 5BNZA 3ZWOA 4OX9B 1M6VA 3MWDA 3QA9A 4DR5B 4GYWA 2IRWA 3JD1A 4PGMA 5ALDA 3ESAA 1JWLA 2BKXA 3LBAA 4LDPA 2C9DA 4S0ZA 4TKZA 1E2KA 3EVGA 1RWPA 2B2XA 3GGSA 5AJVB 4E5VA 4UOZA 2EXXA 1M74A 5JI3E 4WDRA 1RXSA 1M1ZA 3AUUA 2W6JA 3QX9A 1BSVA 4J4TA 5AKZA 1YONA 1U0NA 3OA0A 2C54A 3FF4A 5HIKA 5AQ1A 3BXPA 4MYDA 1KETA 5AVXA 3EQ2A 3IVXA 2OFXA 1W46A 2OFPA 1BW9B 2JFPA 2OORA 4Q1VA 3TPFA 3WMXA 3HBJA 2DHEA 2KS6A 3FFWA 5GZ3A 3AILA 3IHLA 1RI3A 4LVOA 4MV9A 4QGBA 2NO0A 2PUGA 4C6RA 2XOEA 5JJ5A 3MCUA 2CFOA 3KSAC 3H5AA 3M34A 5DX0A 4B9EA 3PFCA 3DV9A 1DC7A 2BH9A 1GL9B 3KEFA 4J6EA 3G6WA 1G8PA 5IZCA 1D1TA 3F3KA 4LYGA 4LJ6A 1A76A 3I52A 1W36C 3SX2A 4YJHA 2RHTA 3IERA 1H23A 1E6WA 3H9BA 1RAFA 3OQMA 3LFTA 3C1UA 3T5CA 1JW9B 2B25A 3R7LA 4ZVUA 4PYKA 4QG3A 4Z7JA 4NJMB 1G5HA 4GKKB 4QM6A 2REOA 1YHYA 4H7JA 1TE2A 2Z30A 4WJKB 4RD4A 2CNNA 3TW8B 4BQNA 1NW8A 1AH2A 9GPBA 3RFVA 1NWCA 2P35A 4JY7A 1LNSA 2XODA 3QYPA 5TXGA 1UC8A 1GUBA 4KWHA 5AJTA 3DHWC 3WLSA 3EZNA 3HLYA 3HXPA 5CBPB 5KU1A 5DHSA 4FI3F 4O2RA 2F43B 3U4GA 1T9DA 2MDTA 1OTHA 1AU9A 1FP7A 1NX6A 3QOFA 1SXJE 4QUAA 3L1KA 4YP0A 1EP1B 3QFFA 1KDRA 2C59A 3ONFA 4LY6A 1L4YA 3RG8A 4ARCA 2YC4C 3VKHA 1G1MA 1XZIA 3QELA 4K9QA 1P73A 4G56A 3A7EA 4M3NA 3QOYA 5D6NA 2PTGA 1Y3CE 5IJ9A 4GM1A 4C04A 4MOWA 4NU0A 4J3JA 4QBHA 3IKVA 2UVPA 4JNKA 4CTJA 4ID3A 2CVHA 1Y9JA 2HSJA 3PC8C 4RK4A 1PGQA 4C7KA 1B8OA 4ZCRA 1HE8B 3P9XA 2IYVA 1ID1A 1L3IA 1OAKA 1YAHA 2O1XA 3W5BA 5KNBH 1MO3A 1ZH2A 2JH9A 4RXMA 3U26A 3VR6D 3OZGA 4I4TF 5AP9A 2P67A 1OHHA 3I6IA 4LNUA 3TL2A 4ZDKA 2R6HA 5JYBA 1FNNA 1E2JA 1RC8A 4W8GA 1UMDB 1X7ZB 4LFAB 4R2IA 1GPDG 4M76B 1JT9A 1R5NA 2HC9A 2A4KA 3OJOA 3KSUA 2H5JA 3CU5A 3K32A 5FDFA 2PWYA 3LNCA 4OHBA 4Q6BA 4N8SA 3EISA 3TFWA 4NE9A 5JC8A 2WAAA 2OCKA 3KUKA 4NS4A 1XWFA 3LKDA 4HP8A 1Y6QA 4PX3A 3SZMA 4PQRA 2VKTA 3CRMA 3FW1A 1UIMA 1NNI1 2BEJA 2PH5A 1NFFA 3BSWA 4WOCA 3TRDA 5JCZA 2E82A 3ROGA 3L7CA 4LPSA 3NHMA 1UDWA 5GGYA 3NBYC 4E3WA 1CY7A 2VYVA 3RSCA 1EBBA 1N7HA 3HKEA 1NP6A 5EGNA 2FEWB 4JENA 3FAKA 3E9RA 2HZBA 1FPQA 1TZBA 2Z58A 3IOYA 3UXYA 1PW7A 4CM3A 4JXKA 3CZQA 1EB9A 1WUYA 1IZ7A 2XJ4A 2V54A 2YMMA 2O3RA 3TRIA 3JQAB 1T4MA 2QV7A 3M2TA 2C3OA 2B30A 3BQNB 1BVRA 5EA2A 3ACBA 4RX1A 1JKJA 1UMBB 4RJ2A 5JAIA 2W6PA 4O2BA 4ZOLF 2PBRA 2DBYA 3HA3A 3I92A 1X8JA 4FCVA 4ZT6A 3GEGA 4PV7A 2BDUA 1J56A 2WNIA 3ZBUA 5JAPA 3TLZA 3TOSA 4RXTA 3SLKA 4PGGA 1Z0ZA 5HMLA 4DW8A 1I3LA 5AHXA 4C0HA 3CF2A 4MUBA 3UV7A 2V96A 3W34A 1E2UA 4C06A 2ZAIA 4K9RA 3U1TA 2I1VB 2O06A 4MICA 4GKJB 3EODA 1UFVA 2TS1A 3F96A 3VOBA 2VS1A 3G5TA 4W82A 1IZ0A 4TX1A 4I4IA 7YASA 1VI5A 2Z1NA 1E3QA 1NY6A 3HCCA 2YFKA 1DAGA 5H70A 5EMNA 3UWSA 5TC4A 2V58A 3GXBA 1FRNA 4Y2GA 4Q1AA 4FIDA 4TWZA 5D87A 5CM2Z 4BNDB 3EPPA 4KG7A 1LV8A 1D4OA 1U0EA 4MUFA 1NKTA 3WDKA 2WSYB 5EMJA 1T9KA 1L7PA 2ZJ6A 4O8ZA 1CR2A 2BBTA 4HF7A 2Q6OA 3IRVA 3HO1A 1LI7A 3D1JA 3IQXA 4GLJA 3CONA 2E1RA 3TLYA 4DSZA 1K5DA 4LRQA 2AL7A 2FVXA 3P2IA 4WCFA 3KOOA 3MWEB 1BX1A 3FYTA 4K81B 5FAKA 1KMMA 4O6VA 4RTRA 1ZR2A 1E7MA 4EUSA 1PD1A 1EZ1A 4E09A 3UFXA 4OK6A 1TYCA 3AV3A 5E4FA 4R9VA 4FYVA 4QO8A 3ZZ1A 4CQLA 4RMJA 1GNTA 2XUAA 4OXIA 2BRUC 3CUWA 4EJ2A 1VI2A 1F17A 3M5PA 4RDIA 5EHNA 3ZR4B 1ZRSA 2YWJA 3BXOA 3LX5A 3ZY6A 5KINB 2IH5A 1E1MA 1YZKA 2GA9A 2IPXA 1TF2A 1PJRA 3E8SA 1XRJA 3A1DA 3GJQA 4H31A 5K8LA 1UBOS 5DVZA 3ER9A 1CJSA 4LI3X 1YRBA 4FGJA 2HMUA 3U80A 1AY0A 5LQRA 3RS8A 1HLGA 3S7ZA 4BLUA 4DAOA 2JLUA 3T1YB 1S2DA 2D5LA 2E2WA 3D8HA 1D0IA 1U0SY 2ZT5A 3ONWA 4MTCA 5DTEA 2AK2A 4QC2A 3TEMA 2Y27A 1U5BA 5DLQC 4U2BA 3U1BA 5K8UA 1MENA 1RAIA 3VC1A 1SVUA 2LP4Y 2Y1KA 1HFEL 2DFPA 3PX2A 2LIPA 3HNOA 4JB8A 3TRKA 4FFSA 3U7RA 5EL0A 4DF3A 2HNAA 4DSOA 2QU8A 2R11A 4AG5A 7MHTA 3ZGOA 3RAFC 4FXOA 3UJHA 5K0ZA 1XZCA 1ZN9A 4TSFD 4WY2A 3S2IA 3WWZA 1A71A 1ZSYA 1HH4A 1YCFA 3A1VA 3L41A 3QTLA 2PWBA 4D0RA 3WAGA 3QMWA 2NAPA 3VJLA 2WT9A 3V1KA 5EWMB 5KEIA 2PBLA 4YXWD 4M1ZA 2G3YA 4QULA 2BCEA 3ROQA 5HM6A 4L9WA 2CXXA 2QTGA 2W8BA 4YRMA 5JISA 3Q2OA 2J6IA 1Y8AA 1BXGB 5K20A 4X62B 3SXUA 1GNVA 1U94A 3CURA 4PVDA 4YLEA 4HDSB 5J4YA 3V4RA 4DE5A 1LY1A 2P8JA 3PXBA 4FHGA 3DMNA 3X1XA 3VR2D 3UANA 4KXWA 2IS1A 2WWFA 3HCNA 3RPEA 3LIPA 1P3JA 4QEZA 3KZXA 1WETA 1RMTA 2BOVA 2JEOA 1EKXA 4M7PA 4KUHA 4ZOEA 2H48A 1OREA 2H1IA 3KTFA 3JD2A 5EMMA 2XRFA 3H3XA 3ZN2A 4CKYA 2BGGA 2WAOA 2P40A 1IQ0A 1EWVA 1PUIA 2WWGA 2ZR9A 3E1GA 2ZT6A 4UMEA 2XD9A 4KWIA 1P1HA 4BWVA 5JH7F 2XGJA 5IVDA 4M89A 4A0HA 4D9EA 4X85A 1COWD 3GLFB 4YUVA 2FZLA 1H2FA 2MYNA 1K8XB 4DMUB 2WHXA 2Q1YA 3GRKA 3H42B 3K94A 3VNAA 5TMPA 1RS0A 3GDGA 4I1IA 2FLKA 3DV2A 4UZFA 3PX3A 2AX4A 2I8CA 3Q41A 1M1YB 1Q12A 4NULA 5HJEA 2ZRKA 4HPJB 2G67A 5HFNA 4U2KA 3RTDA 3VU0A 2ODBA 1WLYA 3C7DB 1M75A 4N49A 4Z7NB 3DXXA 4YAOA 4Z51A 4MYSA 1P0QA 4KIGA 4ZEXA 4EPXA 3CEPB 4B6RA 4MIKA 2W2XA 2VRBA 3HXMA 2VXOA 1YBFA 5AW0A 1O1YA 1AUXA 2EZTA 2BJHA 2AMVA 3NONA 4U3JA 3CMCO 1YHNA 1YJBA 3MTBA 1VGRA 1BFUA 2PZLA 5LNK6 2AI2A 2H0RA 2VDNB 5DH9A 5A0FA 3KLBA 4QGHA 1CV2A 2P77A 3KCNA 3VQTA 5ENDA 1TT5A 4XVQA 3F6RA 4ESOA 5KYTA 1EDDA 1LDGA 4ZRDA 5DM70 3DLIA 4PICA 3ZBPA 4POOA 5BN4A 2O8EA 3L8DA 1K4KA 1K4YA 2CNKA 3V2GA 3W5DA 2ORIA 4UHFA 5EGSA 3FRHA 4JMPA 4I9HA 4QG7A 1E63A 5CJPA 3V33A 4GR9A 3WGKA 4AWXA 1CNFA 2XMSA 2CDNA 3QMPA 4CWAA 5COBA 2PJDA 2O1WA 3WG9A 4MS3A 4WI1A 4E5NA 1EWYA 2N3ZA 2X9GA 3MTGA 5TMEA