1TQ8A

Crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
127
Chain Sequence
SLSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of hypothetical protein Rv1636 from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein Rv1636
total genus 36
structure length 127
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1tq8A00
1IRXA 4DDMA 1OWNA 3MMXA 5DB4A 2VTBB 5DASA 3X1MA 1R6XA 3I05A 1U0BB 3N8HA 3IVGA 1BS2A 1N75A 3A2KA 1JHDA 1COZA 2X0KA 3L92A 5TS2A 2YY5A 1QU3A 2VTBA 3UOWA 1KH2A 4OJMX 4EG3A 1JEEA 1IQ0A 1TYDE 1O96A 2QTRA 3SZ3A 4PY2A 2CYBA 2E0IA 3N9IA 1O5TA 2V0CA 5EKDA 1EFPA 3LOQA 3CVWA 3G6KA 4MQ6A 3CLRC 1GAXA 1OWOA 1O0CA 3HMQA 1I2DA 5FO0A 1MC1A 5HG0A 1XNGA 4MUEA 2PZAA 4I6GA 1J21A 1CT9A 1EFVB 3ZXSA 1QNFA 3CLSD 4JXXA 4DNXA 4Q93A 3KT6A 3P52A 3IH5A 4R2MA 3IVXA 4MW4A 3VGJA 1QTQA 5H7XA 3IMGA 1EFPB 5LM3A 4MULA 3FDXA 5TEWA 3AL0C 4UZFA 2TS1A 1F7UA 4H3SA 1O97D 4NX2A 3PXUA 2WB2A 1EXDA 1JZSA 4KR6A 3FWKA 2ZUEA 3HFJA 2O5RA 5K0TA 2A84A 2IJGX 4EG8A 5IJXA 1I6LA 4HPWA 2CYCA 4TS1A 4EGAA 1N2GA 3A04A 4HK4A 4NAUA 2CV0A 4ARIA 1WXFA 1KQNA 3FH0A 2GM3A 3HV0A 4PBTA 1O95D 3SP1A 3QTBA 1GPMA 1OWPA 4MAFA 1D2RA 1M8PA 1R6UA 3FG9A 1H3EA 4G5FA 1KORA 1WZ2A 2JANA 2X1MA 4MW2A 1KR2A 3NV7A 2VXOA 1N2IA 3N05A 1TQ8A 2EL7A 4U7JA 3MUEA 1Q77A 2DEUA 1WKBA 4QRDA 1T6ZA 2HMAA 3KT8A 1TEZA 1WXGA 2IP1A 5FNZA 3Q12A 4JYZA 3NBKA 3IDFA 3KT0A 1QU2A 2X1LA 3UMVA 2C5SA 3F3MA 4ZCTA 4UZEA 4ZCRA 2GKSA 5IHXA 3FHJA 1O6BA 1O94D 2QUHA 4RPIA 2J5BA 3UC5A 1JEDA 1P7PA 1M8KA 1K4KA 3P0HA 4U8HA 3ZUGA 2E89A 5HUHA 3MXTA 1UFVA 4MVCA 4XFJA 1N2EA 3G59A 3FI0A 4F4HA 3COYA 1T9GR 5LLTA 2NSYA 3RK0A 3ZGZA 1Y42X 3L93A 3QTTA 3ZJTA 3C8ZA 2J08A 3LCJA 4HJXA 4RUKA 4DDKA 3RFFA 4EG1A 3PRHA 1U3CA 3D6UA 1WQ4A 3UY4A 1G59A 1KP3A 5TEVA 4EG5A 3RHSA 5K0SA 1SURA 1IVSA 1LI7A 2RD2A 4MW7A 2A7XA 1WXEA 4XFDA 1XJQA 4MW1A 4CDNA 1EJ2A 1TYAE 4DE5A 3UK2A 1KH3A 2BYTA 1FFYA 3INNA 2A1TR 3ZXIA 1O94C 1YUNA 4WNYA 5HUJA 4ZCSA 4YP7A 1ZH6A 2NZ2A 1N78A 1IQUA 4MVWA 3CVVA 1IH8A 1V47A 3D6VA 1YIAA 3IOEA 4R2LA 4ZT7A 3K9WA 2CT8A 1YULA 3FNRA 1GTRA 4GRIA 4MUKA 4I6JA 4DLPA 3NBAA 4R0NA 2GOYA 1J70A 2OV4A 1XNHA 3IMEA 5KWVA 2A88A 4CDMA 1V8FA 1N2OA 5BNZA 4MW0A 4XSVA 2IELA 4ZT3A 5DK4A 4MWBA 1J09A 1VBNA 3IODA 3RBAA 2QUKA 3TQOA 2EJCA 2QJTA 2QJOA 2Z3VA 4L2IB 5F23A 1RQGA 3COZA 3TZEA 2PXHA 3RK1A 4MUJA 3SZGA 2AZXA 1GTSA 2A1UA 2DXIA 1OBCA 3IUEA 1GN8A 3A4IA 3SDBA 1TYCA 3ELBA 3MLAA 4JXZA 1KAQA 4MUGA 1MBZA 1T6XA 4PBRA 2PFSA 2PZBA 2AG6A 4PBSA 2V0GA 1A8HA 1N2HA 1NP7A 1PFWA 2YWCA 4CT0A 3U1VA 5J58A 2DR2A 1EE1A 1JZQA 3H05A 3M5WA 3P0IA 1NYLA 2QUJA 1KKUA 2A86A 3ND6A 2B7LA 3X1JA 1ILEA 2HZ7A 4YP5A 1NI5A 4KKVA 2D13A 2PG3A 3A05A 1TFUA 2BTEA 1O0BA 4G5YA 4I6EA 4MWEA 1I6KA 3ZIUA 4ARCA 1O97C 2WSIA 3ISJA 1JMVA 3CVUA 3OP1A 4MWCA 2X3FA 4KPUA 4EFKA 2CSXA 1NUUA 1OBHA 2CV2A 3CLTC 3DPIA 1VBKA 4E1AA 3CLUD 4ZT2A 4ZT5A 2WQ6A 2YXNA 1X8XA 4MUNA 1PFYA 3CLTD 1F7VA 2CFOA 4K0RA 1T9GS 1X6VA 3PNBA 4MW5A 4ND6A 1N2JA 4WSOA 1WXHA 3DV2A 4EG7A 1VLHA 2QTNA 4AQ7A 4YMIA 4MUHA 4KPUB 2CV1A 3ILVA 1H3NA 4EG4A 1MAUA 3MLBA 3AFHA 1PG2A 1YUMA 1G8HA 4J76A 4NAHA 4ND7A 3GUZA 2DUMA 3G5AA 2QTMA 4MVYA 1ZH0A 1LW7A 1J1UA 3Q4GA 3SEZA 2J4DA 3LE8A 1OWMA 3P0JA 1GLNA 3PNYA 5DEOA 3X1KA 1VL2A 4U63A 1WOYA 1LI5A 1H1TA 3CLSC 2J07A 3FETA 4DJAA 3ZJUA 4MW6A 1KAMA 3IOBA 2Z09A 1FYDA 2OQ2A 2A1UB 2DETA 1H3FA 1JIJA 1HYBA 3QE4A 4FZJA 3TZLA 3VRHA 1QRTA 4A91A 1J1ZA 2G36A 4ZT6A 4CQNA 1WJGA 5KHAA 3AIIA 1NZJA 1EFVA 1KH1A 2H2AA 1ULHA 1IQRA 1PG0A 2D54A 4EF6A 1M8JA 1JILA 2PZ8A 2O8VA 3TNJA 3K32A 1JGTA 2ZUFA 1K92A 3BL5A 1IFXA 4KR9A 3CA8A 3SEQA 2E21A 1ZJWA 4EG6A 4HJRA 1Q19A 4J75A 1Q15A 3FIUA 4X0EA 5TGTA 1O96B 1F4LA 3GMIA 1MB2A 2I1LA 1KQOA 4G6ZA 3AG6A 4ZCPA 3H9CA 1MOPA 1KQPA 1MB9A 5AHWA 2XRZA 3RJZA 1GZUA 1WXIA 3TS1A 1F9AA 5H16A 3COWA 3HGMA 1M83A 1K4MA 1G8FA 3Q10A 2R5WA 4BWVA 2WQ7A 3VU8A 2AKEA 3H97A 3N2YA 1YI8A 1WY5A 2D5BA 4F3RA 1NUTA 1QJCA 3AG5A 3COVA 2JA2A 4JZYA 3DO8A 3E27A 3KFLA 2DERA 3IVCA 3ND5A 4MUIA 1K97A 1ZUNA 2ZP1A 2XRYA 2RE8A 4KR7A 4P2BA 3FY4A 1QRSA 1PFVA 5FO1A 1N2BA 3JXEA 2E18A 4DDHA 4YP6A 1NURA 3CLUC 3TQIA 1M8GA 1MRZA 1O95C 2HGZA 1MAWA 3AKZA 1N1DA 1S4MA 2A1TS 1PFUA 2CYAA 1EUQA 3H99A 4ZT4A 3SYTA 1OWLA 1N3LA 2CUZA 4AS1A 1VBMA 3ND7A 4MUFA 4QREA 1U3DA 4OUDB 1J20A 5J5AA 1M8FA 5KCMA 4K03A 1WQ3A 4NATA 4ZCQA 1N77A 1TYBE 5J59A 1B6TA 4MLPA 4JFAA 1NSYA 3OTWA 1R6TA 1NUPA 2QUIA 3CVYA 5JBNA 3PNVA 1KP2A 1NUSA 1Q11A 2JAXA 1XNJA 3GLVA 3HZRA 2DLCX 5LFAA 3DLAA 1U7DA 2YWBA 3IMCA 3CVXA 3KT3A 1JECA 4MWDA 4NZPA 4OUDA 2J09A 1I6MA 4S1OA 1EUYA 3IOCA 3IUBA 4L2IA 3S3TA 1G8GA 4NDAA 4QBTA 1QRUA 4GU5A 3CR8A 2DPLA 1DNPA 1JIKA 2Z08A 2PIDA 2QJFA 1NUQA 1IHOA 3CLRD 1YIDA 1T6YA 2A4MA 1M1ZA 1QQTA 4MVXA 1JIIA 3HL4A 4MW9A 4YBRA 3ZJVA 3FOCA 4Q16A 2H29A 3H9BA 1OD6A 1U7XA 1MJHA
chains in the Genus database with same CATH superfamily
4ALKA 3HFSA 1JQBA 1XB2A 1CBUA 1CZUA 2ZWMA 3EA5A 4M54A 3BB3A 5E9QA 1OWNA 2PX6A 3AYXB 4BKOA 3G1TA 4MV6A 1A95A 1EM8B 1GQ2A 1WOMA 2IUFA 5COQA 5EWMB 3FOEC 2A0WA 3FMVA 2IYTA 2DBQA 3EFBA 2X0KA 1NE7A 2ZTSA 2ZULA 1UXHA 4TZKA 3T5CA 2IPLA 1DDOA 3L1VA 2A30A 5E7QA 4DHWA 5FBHA 4EHIA 2PL1A 3LWBA 3TZHA 3UJNA 5IKMA 1BX1A 3K53A 1F0PA 4QELA 4FGKA 4FDLA 3CX3A 3TTYA 1OFVA 3VSDA 5JD6A 2FXVA 4TOIA 2E2WA 3BWEA 5C7LO 1M1YE 4AZVA 4WZAE 1W9MA 2ZIVB 2WD9A 1HDRA 1GT91 2ZVDA 4RBNA 3GLQA 4Q4AA 1KVUA 3H2BA 1NF3A 5E6RB 3SQNA 4N7JA 1G8JA 2GHQA 1YVEI 4UHHA 4KR3A 2X5JO 2REQB 4NOKA 4A0GA 1KZGB 2WKWA 5CVUA 4R1PA 1UJNA 2CXTA 2BEJA 1G8PA 5A3SA 5SZJA 4Z53A 3AR9A 4HLCA 3RRJA 2JEOA 1XP8A 3I09A 1CZOA 2LD4A 4NK5A 3HWX1 1EGVB 3IULA 1NW9B 3DBLA 4UASA 4W5TA 3HYRA 4NVRA 4KFCA 3AI2A 3OD1A 3FYUA 4Y1FA 4YO8A 1TEVA 5DCWA 5GAJA 1E5LA 2YIJA 4RESA 2LGJA 4HNUA 1D0SA 3MWGA 3GAFA 2QY9A 2BDEA 2COUA 4U02A 1MQ8B 3LFTA 3FCYA 4WXYB 5H7XA 3VMFA 4EH1A 4LPSA 4EYSA 4ERXA 2Z2YA 1FQJA 5KS2A 1DBWA 5BV8A 3V8QA 1QGDA 1Q2XA 1U3FA 4GOND 3RVNA 1AKQA 5GY7A 3VH4A 3GBSA 3AF3A 2TS1A 1P45A 1H66A 4JJEA 5J47A 3KWLA 1EK5A 4ZOAA 2XA2A 4B6PA 5EPEA 3QU9A 1YJ5A 5AVJA 2XH8A 3RF7A 4DMFA 4ITUA 3TFWA 4CN8A 4NTZA 1FP1D 1J99A 1FNBA 1QIEA 2CCKA 2HREA 2B69A 3MB8A 4RGQA 2XBUA 2Q3JA 5GONB 1UJ4A 1RCUA 1LPMA 4LDZA 4B4KA 5KZMB 2R60A 1RTKA 3NWJA 2QLMA 3ZJ4A 1H2XA 4WXRA 2C83A 3ED5A 1P1CA 2JCGA 3FH0A 2VZ0A 5CNKA 1C7EA 1FYWA 1MENA 1E2DA 1U7UA 3D3WB 4JKYA 1GPMA 4CKXA 3TNYA 1M8PA 1PX2A 2RK4A 3AV3A 3GJRA 1SC3A 4MQUA 4UVDA 4V0OA 1BMDA 4X60A 3VO8A 1VP3A 5JASA 3RNLA 1XCPA 4MRPA 5JLJA 1H69A 2PUEA 1FRNA 1RRVA 2DBVO 1K7SN 4I4IA 5HF9A 3RM3A 4FEEA 1MEEA 2FW0A 2FUCA 1EZZA 2E49A 4KPEC 3PU6A 3M4XA 4PVDA 1IVNA 3PEWA 1ZK1A 1MPXA 1OXMA 1NXVA 3GXOA 2HJGA 3AKDA 1MZVA 3R41A 3QF7A 4UUNA 5FULA 4F7DA 2E9SA 4JI6B 5FNZA 2IYUA 5ARDA 4ZC1A 4QKQA 2XDQA 1O9GA 2JLWA 4C03A 1M74A 1HYHA 1NT2A 3K20A 3RI3A 1J22A 2QNRA 5B4TA 1GXSB 2C4WA 3FM9A 1FTSA 4L5YA 4EHKA 5IAOA 1JKJA 1CZRA 4B3GA 1XZDA 2B8WA 3HO6A 4ER3A 2I62A 1QG4A 5CVVA 1IJEA 1LK7A 2C2GA 1UBNA 2FX5A 1DKNA 1JBKA 2H4WA 2AE1A 1DUVG 2ZWOA 4JCOA 4EDHA 2ECKA 1GGKA 2I65A 2J33A 1Z82A 4OQZA 1OBFO 2ZDGA 1L7NA 4BLOA 5C8YF 2YINC 2IU0A 2VPYA 2B25A 1T36A 4RQUA 4RHUA 2XCRB 4WEQA 1KMHA 1M0TA 1XVUA 5AW1A 2P6PA 3LBIA 2O8DA 3IP5A 2C8VA 4FDAA 4U8HA 4W5QA 1IXRC 4DLRA 2R6R1 5CFQA 4YO7A 3NGMA 4E32A 4TN1A 3LS2A 2XKJE 2I4RA 4HRXA 1FYEA 3WIOA 3C4JA 1H0RA 2KPOA 1Q22A 1T9GR 5HHTA 1C1DA 3HJRA 2XECA 4K0KB 4HXGA 3L6RA 4EFMA 1E4YA 4EGQA 4U2GA 1Z7YA 4LMAA 5JH7A 1B0ZA 5IMBA 2CCGA 1X8LA 3SEAA 4QYIB 3RFFA 4J0DA 1QP7A 3P9RA 1JAYA 3O1HB 5C8VA 3ESRA 4AWAA 3UXMA 2QTVA 1QB7A 3D6UA 3ZU3A 3T94A 5FUVA 5K5EA 1G59A 1VYHA 2ATXA 2QRNA 3PLAE 4NFYA 3SMVA 4TYWA 3AEZA 4IM7A 1GNVA 3OPYI 4K9DA 3TLGA 1LI7A 2ZUVA 4GBJA 4GHWA 4X85A 2A9KA 4Y3UA 2RD2A 5F4BA 2IDZA 4WOKA 2O8BB 1FU7A 3N1UA 5FTKA 1KGSA 3UYLA 2V55B 2HJVA 1RW4A 3KTOA 4UTPA 3Q7RA 4KBFA 2VQ3A 2PKQO 3WKDA 2QR5A 2IKSA 3ENNA 2X7HA 2XADA 3QU2A 5K05A 2V3VA 4GRAA 3FPJA 1GUBA 2D06A 3EARA 3QUTA 2QL6A 4D8UA 4NFLA 3DE4X 2CLEB 3AW8A 4ZQBA 4D6XA 2P9TA 1C3OA 4PGHA 4WBNB 3JQ9C 1K6MA 2GZSA 4EVRA 4UOZA 3LQFA 3BRQA 3PT9A 4X7PA 2WOOA 4DRYA 3MJ4A 3QM1A 1GG9A 3LLMA 2R65A 4FOPA 1EFUA 4K6MA 4HL6A 5LXTF 5JCJD 2AFHA 4UNIA 2CVQA 4KXFB 2IEZA 3IMEA 2X0EA 1QVZA 3RANA 4HBZA 2VDUE 4E0BA 4Y6LA 3W6UA 2F43B 1W8DA 4WBSA 2ZRNA 2PGLA 1J0EA 3LY9A 4JZKA 4MGZR 4RKQA 1G20A 5LUBA 4LVCA 4CTMA 2CLLB 3N07A 2JARA 2Q1YA 4IWYA 4EENA 1JKXA 3EASA 1J8QA 1HDGO 3C7AA 3GCWA 3FSRA 3VR1A 3TDNA 2QN3A 4MWBA 4JIGA 4DA8A 3VJRA 1JAHA 1P7WA 5KQRA 3P2MA 4ZV4A 2W11A 2RGBA 3GFOA 5IAJA 3TL2A 2Q2WA 4TMZA 1G20B 2B4TO 3TRKA 4F3KA 3STTA 1OC2A 3COZA 4OLBA 4QASA 4GP9A 4BX8A 1XLTA 3AVWA 1Y34E 1NF2A 2EDAA 2OFWA 1T8SA 5FOXA 3NU1A 1A8SA 3KS9A 2IXDA 3W3AH 2PQ6A 4U2EA 3UYKA 1XCMA 4CCSA 2Q27A 5IFKA 2NV2B 2VF5X 1VYVA 1YDMA 3U4IA 5EZ5A 5EJ5A 2P9ZA 1LBQA 2P4UA 1JWBB 4FLMA 4LHVA 4C76A 1N5OX 4D4JA 3I42A 3QGMA 1PFWA 2QM8A 2UZ1B 4CT0A 3L0OA 4EUEA 4DWJA 1DRVA 4YAKA 1E4VA 5KTMA 2ORWA 3AVTA 3ZZ1A 1N8TA 1MTOA 1QV6A 3QVKA 2AXEA 1DWOA 1J9ZA 3NORA 5D86A 3UEOA 3ENVA 3U7HB 1V25A 1B0UA 4EUHA 2I2CA 3QA9A 1XJCA 4ZVVA 3PSAA 5CXSA 2CLIB 3LY5A 4B83A 3GRAA 2OK7A 3DA8A 2CBGA 2OA0A 1JKMA 5ITWA 5KNCD 5B7PA 2AZTA 1CYDA 1M0WA 3ZZ0A 2BFFB 4FDVA 2J67A 4HUQA 5D6NA 1Z0UA 1STOA 1B26A 3SHWA 4LGMA 4BTEA 3B9QA 3JQ7B 1Y0BA 4K7JA 1PTKA 4AG3A 5CVTA 3GGPA 1XZEA 3V3TA 1Y6QA 1U5CA 2TMKA 1YE3A 2L19A 4FMPA 4E4TA 1UBKS 3OLYA 2YJ3A 2ONYA 1HOXA 1W35A 1EUZA 3SICE 2BHLA 3M6MD 1A72A 2C31A 2OV3A 2GUGA 1NFQA 3VKWA 3JR3A 3SHTA 4KG7A 5DWQA 1ISSA 1RLOA 4QBFA 3F6RA 1J5EB 2VYCA 3FGOA 1ESMA 3HN2A 1XIVA 3OPYA 4RA6B 5JAOA 4PYLA 3FJ1A 3F1KA 4Y0NA 1RI2A 2DECA 2Z5GA 4H7HA 5JS1A 1WABA 4V2UA 3FLEA 2AOXA 1X6VA 4LPKA 4F9FA 1TYEB 4Q5IA 3U5ZB 2NU6B 4RDCA 1ZK4A 3DZHA 5CLGA 3PTLA 3WL5A 1B0AA 4N5DA 1O77A 3GDOA 4XWGA 3KJGA 3SE0A 4BWFB 3KELA 4K6KA 3QIVA 1W36C 2NVUB 4MIOA 3N5CA 3F73A 1U2GA 2ZBQA 2OESA 1WZIA 1MAUA 3ILVA 5D3QA 2JC3A 1XCGB 2MYUA 3I04A 2ZB3A 3PSHA 4IJWA 4IQGA 3KWJA 1Y3HA 3CGGA 2XR1A 4YRBA 5LD2B 4UHCA 3EJ6A 3C85A 1MW9X 3PCTA 4DMLA 4DKJA 4JBNA 2LKDA 4LV8B 2G83A 2PT7A 4N12A 4YRLA 4DG9A 1CC1S 4KMOA 3JAWB 1I7QB 2IGTA 3KXLA 5KDDA 4D9KA 3JQRA 2HMTA 3MJRA 4S05A 4GX0A 4EW1A 2FN3A 3IELA 1W4BA 4NEHB 4JDUA 4HZGA 4B9EA 2UVQA 1GARA 4RH3A 4M55A 2A0KA 1XTJA 4RL4A 3RF6A 4JEMA 1RWXA 4V0SA 1FUUA 4ZI7B 1DTWB 2J3DA 3KKPA 3VZRA 3T4PA 2C1XA 5C1PA 1EH5A 2QROA 5K0BA 1A88A 3ANLA 1T5HX 2FLVA 4D82A 4BS9A 3IOBA 3KOMA 4Y2VA 3TAHA 4JV5B 2WPDA 2XMCA 2NV0A 1JHYA 1TFRA 2A1UB 3F97A 3M0EA 2Z6AA 3GGJA 4MS4B 4EKYA 3MS4A 3PUWA 3UHOA 4DV4B 5AQEA 3L9WA 3W4KA 4FT4A 1J1ZA 1D07A 3IEPA 4NECA 3JATA 3GFFA 1I6WA 2QV0A 3CVOA 1QHNA 3LVFO 4P82A 2CVPA 4EF6A 4B74A 1A9XB 1L7EA 1KIAA 3L4BA 3K5PA 4J1SA 1K92A 5SZIA 3UCEA 3ZBUA 1SHJA 4HAUA 5IVHA 1A9PA 1HT3A 5FP0A 4P4GA 4L15A 1MFZA 1YDHA 2C29D 4EG6A 2MSCB 3H9UA 5EQDA 1P5ZB 1RU3A 2V4UA 4XD7A 3TXAA 2JVKA 5TMPA 1FRZA 3C5WP 4EVIA 3RG8A 1KQOA 2CJXA 4J3JA 4Y2GA 3SNKA 2ACEA 2JIRA 3U7EB 3UT5B 1P2UA 2Q3DA 4FC7A 4I55B 3FJOA 1F8XA 1Q1NA 3H8VA 1NDQA 2V7TA 4PQYA 1CUGA 2C9ZA 2XUHA 5DXAA 5E4JA 4EO4A 3J81k 3RS2A 4NYIR 3C3DA 4MNTA 2QENA 5AK0A 4C4PA 2UZAA 3IYLW 4EWLA 5F33A 1SOUA 5JCXA 1NULA 1IPHA 4K3VA 1RP7A 4R6XA 5BR8B 2B1JA 4GMKA 2OE2A 3I6ZA 4IVQA 5I4CA 1XLWA 3KXIA 1UZLA 4X41A 1CRPA 4PGGA 4IDPA 2O1XA 1QJCA 3AG5A 3COVA 3K1AB 3U7IA 4EB0A 1YS2X 2RJOA 2NU9B 5KNBH 3QNWA 2C0PA 5MFPA 4B3FX 2RE8A 1K97A 4GZ5A 1H1LA 3V5NA 4KITB 4NCJA 3LPAA 5K3CA 1CB7A 2RHWA 3PC8A 3AL3A 1TGVA 2E18A 2YBEA 4YFVA 3UF0A 2Q5LA 4CMKA 1K89A 2EQBA 3FPSA 5EXXA 3DPUA 5HZMA 1Z5WA 3V1UA 3BMQA 3HTXA 4A8JA 3GRUA 4JY7A 2R48A 3FSGA 5HF6A 1E3DA 1XRSB 2E1PA 1PD1A 4O33A 4J29A 1I14A 2YIVX 4DFDA 1JB9A 2GB4A 3GJ3A 2CUZA 4DS3A 1S6YA 4TL9A 1D1PA 4H7JA 4RJKA 2ZXUA 2XB8A 1SMKA 2Q8NA 2XNCA 4IXDA 3VR5D 3OPXA 4Q7KA 3EF0A 4PTLA 4QGFA 1OYYA 4R84A 2TMGA 4I4TB 1P31A 5DV9A 1EZ4A 1XYGA 4AKIA 2CNWA 4HB2A 1APBA 1NOIA 1KA9H 1UXJA 3PDHA 1DAMA 4HPXB 1SHUX 1A7KA 2ENUA 3MTAA 2VNJA 3GT4A 1WDMA 3GVHA 5K7SA 4N0DA 3NOQA 3FSJX 2DPGA 4QGSA 1ORDA 3UPDA 4QOSA 4CKWB 2JFNA 1N9KA 1NUSA 5DX0A 1XNJA 4XGNA 2OZLA 3F9IA 2IPAB 5CIYA 1I2AA 3EGIA 4R5MA 4XW2A 2H2WA 4EL0A 2FN8A 3EY4A 2JGAA 3GGOA 3O8OB 3QXHA 1D6MA 2YWBA 1LBEA 5GV7A 4TTSA 1Y48E 2FG6C 1ECCA 4Y2JA 1EP1B 1ZD9A 4A10A 1QVAA 4DNPA 5KYGA 2ZEJA 2VK1A 3UJBA 4AJPA 3I62A 3NBMA 3QUQA 3QKRA 2P4QA 3W77A 3IUBA 5HSGA 3EGVA 1CR0A 4A23A 1YIOA 3PHLA 2PJUA 2WWWA 4OQQA 4XPZA 4JP5A 4NDAA 5GWXA 3I61A 3R23A 5C4IA 1NU6A 4M36A 2NTVA 3GYGA 5CAEB 2WE8A 4ND5A 5BR4A 2BISA 3S7ZA 5KSOA 1MC4A 3EDRA 2VPIA 1IXKA 1NLZA 1TX4B 4HDKB 4O4LB 5CX1B 1HTBA 4QOJA 3NXSA 4CKBB 5IWAB 1IHYA 5CBPB 1V45E 2F17A 2J3LA 2W90A 3K9GA 5DXJA 3FOBA 4IW3B 1JXMA 2CXQA 5EE1A 5BYJA 3EXAA 2PR2A 4ZOBA 3S28A 4OX9Y 1PLJA 3MMXA 4BP3A 4DA6A 2HRQA 1KI6A 4LZLA 4B40A 5JDIA 2NX2A 3MMZA 2XV1A 1Z5ZA 3KLPX 1QIJA 5K2OA 3KPYA 1FX1A 2JAWA 3TW6A 4LF4B 3I6IA 4QHTA 3N3BC 1E7SA 1QE0A 1E77A 1XQ9A 3I1YA 2XXBA 3A1UA 4RF4A 5D1HA 5E4TA 5AVWA 4HB3A 3T9CA 1QU3A 4LSWA 3WGJA 1KPGA 2WD7B 3CLVA 3LSYA 2UZIR 3ER9A 4W7HA 5AOVA 1Z2EA 4PPGA 1W4RA 4N3CA 3PTZA 3VZCA 1FJHA 1WUKS 2J6IA 2ZDQA 4JC8A 5H68A 4BMYA 1AZLA 1O96A 1AK2A 1ABFA 1IWBB 1HEUA 4KDEA 4LUCA 4M9CA 5A9TA 3S27A 1AUPA 4C43A 5CA0B 3KTAB 2PA0A 1EHYA 3FWPA 2R8ZA 3H5LA 3LF1A 1VCMA 1ZZGA 4B44A 3WGUA 3OO0A 4B6EA 1U6IA 3NKVA 3Q1KA 4URHA 3KJZA 4CMJA 4ZZ0A 4HVAA 3DFZA 2I34A 3UATA 3C6KA 1XMXA 1RHRA 1C1XA 3D3WA 5I01A 1J21A 4QJ4A 1PQWA 2GRAA 5I9IA 5B1YA 2VSQA 1GTG1 3CLSD 3PRYA 4N7RA 1BCSB 5F3DA 3REOA 3I30X 1YJQA 1RVDA 4KIJA 4LDQA 2J0VA 3IVXA 3R3UA 3FMPB 3OPNA 3Q5EA 4YCLA 1Q74A 3WL8A 4A82A 3HYTA 3FMGA 1EZ1A 1YONA 3OX4A 1AKVA 1O1YA 3O4HA 4NBRA 3T06B 2I2AA 4ZDJA 3K0BA 5TJ9A 1B74A 2VRNA 2BZ1A 2W6QA 4R9SA 5HQ3A 3ACBA 2VIIA 4OU4A 3DE7X 3G8DA 5KOHA 4KXNA 3URKA 1MOSA 3OURA 1RACA 1OBVA 1ZK2A 3BCUA 5EA2A 4EO7A 4ACAA 1CY0A 3K0HA 4N5IX 5K3FA 2ZJBA 2A84A 3RWMB 1IBKB 5G1NA 2YCBA 4Y2UA 3T5TA 4CN9A 2H1OA 2I99A 2VF8A 5BSVA 1QHEA 1SXPA 4MUMA 1GZ5A 2C2YA 1QLJA 4Q01A 4TWRA 5CCEA 5LQNA 5J9FA 2NYUA 3EGWA 4RANA 1KHTA 5FB3A 3RTBA 2RG1A 2Q1SA 2W6NA 4H31A 4HK4A 4QQRA 2V7QA 2OBXA 4LZZA 3IVMA 2PX3A 4GSYA 3RE1A 2VUHB 3G8YA 1EDOA 1PT9A 1UADA 2OOSA 4Q48A 3SM3A 5TQ2B 1OX4A 3UAZA 4BMCA 1Z0JA 2ATCA 2AKYA 4DZRA 3WL6A 4P32A 3FZYA 2REQA 4CDGA 1ULBA 2XGGA 4G5FA 1MA3A 5LIPA 1VFPA 4Y1GA 1T4CB 5E6RA 1UANA 4LC9A 2HHCA 2P2GA 1L7OA 3KETA 2R44A 2BEWB 4J94A 3BJZA 3IP8A 1XPUA 1ONPA 5CA0A 2OSBA 3ABQB 5KBYA 1Q1QA 1UCFA 3NWOA 1XWWA 5IZCC 1MB3A 3L7IA 2F6RA 3VYVA 4ER0A 4BAZA 1SOWA 1DLJA 4J2TA 3GD5A 4GX2A 1UBGA 4UOEA 4JYZA 1ZNQO 3BD8A 3QPBA 1LLFA 4GPD1 5ALOA 2C99A 1NLMA 2RGNA 1N0HA 2HIMA 2ZSHA 4OCZA 1SUPA 2WMDA 2J9ZB 4L3VA 5F7JA 4B6JA 2C42A 3KQMA 2ZSIA 2W2LA 4ZI7F 5TDHA 1XWFA 2OFOA 4RGVA 3K9QO 2UYOA 1P0PA 4MWZA 2DPXA 2HY7A 3K1TA 5GJCA 1BJKA 3NP7A 2JF0A 3O7MA 5AW8A 3FPCA 3L4EA 1EA5A 1IN5A 4G24A 4JB2A 1IVYA 2ISSD 4OQNA 1T3ZA 4OYLA 1ZD5A 4I2VA 3C97A 1JXAA 3VU9B 4PO8A 1A4IA 1N6KA 1RQXA 4BO9A 3U16A 4JBLA 4RENA 4CM1A 3H5VA 1LD3A 1BMFA 2UZ1A 3L6UA 3E5MA 4JK3A 1LKZA 1FU4A 1CRQA 2FHSA 3DXYA 4MICA 4CCWA 1PWZA 1U7ZA 1N5KA 2R79A 2ZQZA 1BH2A 3LPCA 1C8KA 4JQSA 5IBQA 3A3OA 2MJLA 4DMGA 2Z4RA 3DAPA 3Q2IA 3BS4A 1IJFA 3ZKWB 3F5QA 4F5YA 4L76A 4TMVA 1XDDA 1E3LA 1KK3A 5U9CA 4L27A 1J9EA 2IODA 1EWKA 621PA 2ZI4A 1UKEA 2WBLC 3C6XA 5AT1A 1OLXA 1WQ4A 1CDOA 2Q6OA 1XD2B 2RH4A 2WAAA 2XUIA 4D4IA 1L7PA 3JQ7A 2V45A 1QYDA 3TKYA 4ZICA 2GH1A 1BN6A 4WK6A 4BFLA 1V71A 3MAJA 5DYTA 4RPKA 1TQHA 2QL7A 2QDXA 3EQ9A 1FC0A 3ZHBA 5KOIA 2JRCA 2XMZA 4Q3NA 4CDNA 1X80B 4DE5A 3JD4A 3SQDA 5FI0B 4KVAA 1N9GA 2NUAB 5JZVA 3SCZA 4LSMA 4NBKA 5IDVA 1HSOA 3PJFA 1Y9EA 5BSFA 4QG7A 4A26A 4E30A 3BD9A 4PAOA 1ADCA 2EL9A 4Q1VA 5HKKA 2IP4A 3U62A 3WLOA 1JBQA 1K8QA 1KPIA 1QFSA 4MVJA 1F2UA 3CY6A 1CJKC 4YI3A 5JFTA 3HBMA 3C2QA 2HWUA 3FNRA 3WKBA 1CJUC 3KYCB 1ZSVA 4KTVE 4PLGA 4PYQA 1RHMA 4CF6A 4I6JA 4E4RA 3FCAA 1KSFX 4AN4A 1CEYA 1FP4B 4RZ2A 4P36A 2GOYA 2Q5FA 5T8KA 2J7PA 3RDPA 5JQGB 3QU7A 2GLXA 1S2MA 2K4MA 4ILKA 1FP7A 1R27A 2PQMA 2ZI5A 3BAFA 1FNCA 3MM4A 4J9VA 1S3GA 4MV4A 5ENDA 3TI9A 1JNYA 2V9ZA 1AS3A 5E0OA 4DMCA 1V8FA 5FH9A 5LQRA 3S2SA 3PKIA 2RHLA 3V4PB 4D56A 2PNFA 3B2EA 3A4MA 3P9CA 1SVWA 1ZYUA 3R5SA 1WTCA 1TPZA 2IELA 2GRJA 1HORA 2VJMB 2YR0A 5KNCA 1VQ1A 5CJJA 3PFWO 5D6OA 1ORHA 3X1DA 4PGMA 1CZHA 4C30A 2QUKA 2GBPA 2R1ZA 1IL0A 3D6MA 4GXNA 5BWNA 4F8EA 4Q3DA 3SDZA 1JDUA 4FEAA 4X6UA 1AS2A 3ID6C 4I5DA 2V7UA 1KI3A 3ZWNA 2QX7A 1O54A 3L6BA 4H7IA 3TW4A 2AZXA 3BCHA 4DLWA 5T4BA 2Q50A 4LHWA 3GEGA 4ZEWA 1HNZB 3N5KA 2QAGC 4HLQB 1RHKA 2V4ZA 3O9MA 1XRPA 1CERA 2I4MA 2PZBA 2YW2A 2VPXA 4PBSA 4ZRNA 3VVMA 2O4UX 1DE0A 5A3VA 3DVRX 2J9FB 2VSOA 3DZCA 4L1KA 1E6EA 2VG8A 3H05A 4KVFA 1WW3A 4QPNA 1RYZA 1SUBA 3PUXA 4WY2A 1DG1G 2IU6A 1VLMA 1Z2NX 2B0JA 3EVDA 3F78A 1SHLA 3ND6A 1F5SA 4RM3A 5CDTA 1NN0A 2QZSA 1Y1KE 5LMUB 5EWJA 5E3HA 3TINA 4KKVA 3OX3A 1CUUA 3AOGA 3TEMA 1FFSA 2YJ4A 3ZY4A 4CMIA 1ELOA 1SG0A 3V1TC 2PANA 3UXEA 5JXGA 2BZGA 4UUPA 4Z0HO 2JBAB 5M5BA 3DTYA 2Q3HA 3B2QA 4YN3A 2VSFA 2ZS7A 4D43A 3OKCA 2D5LA 2VLBA 1PR6A 1NUUA 2D7JA 2N75A 2ZJFA 4JR1A 4K1XA 4R41A 3DPIA 4YLEA 3AUFA 5K3AA 3GFRA 4QXMA 2VOJA 3H5NA 3OQMA 1ACLA 2HA0A 3BXGA 2FN9A 3M4YA 2WQ6A 3DAGA 5JAHA 5B1IA 1A2BA 1JR2A 3A9VA 4DV2B 2Q4BA 2UYYA 4J0KA 5CG2A 3STXA 4ZCIA 3QBTA 1C0PA 2WPDD 4XE5A 4G07A 5I3ZA 1WZEA 1E3TA 1FNMA 3DVSX 5CP8A 2AE2A 2YNMD 3CEAA 3D1VA 5SY9A 3K0AA 4ND6A 2P2NA 5AM1A 3UA4A 4F5DA 4QULA 4AU1A 2KQUA 2QQ0A 1UC5B 1MC5A 3G79A 3P4YA 3COPA 2JLVA 1UEJA 2CLHB 4AQ7A 1S5PA 4ATNA 3C3YA 1G2IA 2CDAA 2DQSA 1DQRA 1PR4A 3ZHTA 3BIXA 3NAMA 1W49A 4HWOA 4L6IA 1BA2A 1B2LA 3T4UA 4DQVA 3VV3A 3RIXA 1K66A 2QMYA 2YMQA 3H87A 3M89A 5K8TA 2X3UA 3IIKA 2I8AA 3SZOA 3X0DA 1BMFD 3WE7A 5KX5A 1TUBA 4OXXA 5CH3A 2BI8A 4LZJA 2QA5A 1HMPA 5CGQB 3T35A 4AD8A 2JCVA 1DRUA 3NUZA 4FDMA 5B2FA 1LXCA 1UM9A 3M2PA 5HP4A 3PWTA 4CQLA 3P2IA 3E82A 5E1BA 4D44A 1J1UA 1SO8A 2XTJA 5FI3A 3EIOA 3TCKA 3PNYA 4D8TA 1KWKA 3RB8A 4F4IA 1P1IA 3NTOA 1SC6A 3OLXA 4IQ4A 3KG2A 4Y9TA 3OZFA 4JIMA 2AZDA 5LZ8A 3EH1A 5D00A 4EG0A 1KIMA 2FU5C 4YFYA 1H4VB 3ETJA 3ETGA 3NT2A 3UANA 2OFXA 3HC7A 3USES 1NJGA 1AURA 1SXHA 2PTGA 1B1CA 2YV4A 3OQ6A 4KUEA 4ZXPA 4KPFC 3VRHA 4CW7A 3KB2A 1NYRA 1SCDA 1A7UA 3EQ6A 3F5DA 1F20A 2X5XA 3L6DA 4D9EA 5B6PA 3TLYA 1GYPA 1N2CA 5H0IA 1IQRA 1ZCJA 3QV1A 3U9SA 5CCBA 2BM1A 1YR9A 2V7XA 4F4FA 4MCHA 2R1VA 4N7MA 2EJVA 5BOSB 2ON6A 5P21A 3TQTA 2WYOA 1BHO1 2R1UA 3K4QA 1RI1A 4M9ZA 5HFNA 3WGMA 2I7VA 4KEAA 4WNCA 4FXPA 5DHQA 5AM3A 4O8CA 4G67A 3QWHA 1UQRA 2PO7A 4ONEA 3WFJA 2F43A 1A5SB 1AGYA 5JAUA 4OGKA 2O1SA 3PVSA 3VKGA 2XLCA 4Y0AA 5FBWB 4XPIB 5DNVA 3U3JA 5BP7A 5AVUA 5DM2A 4EAQA 3DDNA 5LKRA 2O2IA 4TMYA 2RK6A 5CLIA 3TLGB 4RXTA 5HQTA 3C7DB 1MHTA 2IS4A 2NV6A 1BHJA 3RSGA 1N2CB 4L4UA 5KNDA 5F2NA 4LVOA 4DUYB 2HSDA 1U4NA 1LY1A 1N25A 3DFUA 2JIQA 3M81A 1S8OA 4GOMD 4MI6A 3RSFA 4ALJA 4TYPA 3G2QA 4BLQA 1TU0A 3VYTB 2OFFA 3EUAA 4UD2A 3D6HA 3U3KA 3K9HA 1KHHA 1KU6A 3HBLA 2H7XA 3V1NA 1Z33A 2AOUB 1R8YA 5IT5A 1E3WA 1U1EA 1HKHA 1X7XA 3BTSA 3GUCA 2OM2A 4EZEA 1AQJA 2ENWA 5F7XA 4WLNA 2FE1A 4U7GA 3SQWA 4TVKA 3OKFA 4HG2A 5HIIA 1DV2A 3S8MA 3TTSA 4BNHA 1KOLA 1IY0A 2XHEA 2GPWA 2ZSEA 3CPEA 4P33A 4N0MA 4ON9A 3NH9A 1Z62A 1C7RA 4BIMA 1OWLA 4IOMA 2OZPA 7YASA 3AJAA 3WL7A 1LS6A 1BX0A 3EXIA 4LJAA 3F96A 2XWSA 2W2QA 4D74A 4MUFA 1VJTA 3W34A 2IQIA 4KE6A 1M1YB 4UHJA 5JCJA 2OD9A 1J2JA 4UU7A 4O2LA 3O4IA 3FLAA 1NBWB 1L1EA 1PJQA 3DL2A 4NJMB 5LP6B 3CNLA 3KHTA 3L84A 5DT9A 4HXYA 2VHJA 5C4MA 4AZSA 1LRJA 3EVFA 3U60B 1DKPA 2WZBA 5ANRB 2G8LA 4QUIA 3HCPA 3OTWA 4U5QA 4JVSB 2LCIA 1T5IA 4RAOA 4Q12A 4ZDWA 4YMLA 5HYVA 2VNHA 1RWKA 3GLVA 2Q99A 2A92A 1N0UA 2FETA 1MORA 2ZJ4A 3ZK8A 3BWDD 1ODIA 3LPDA 1V43A 2CLCX 5ULLA 3H2JA 3ZBPA 1DRWA 4OOEA 3AX6A 3I6BA 5CITA 4L5JA 2GJAA 4LVNA 1BD4A 1HRKA 2GA9A 1JVSA 4LBYA 4PNHA 3ROZA 2UYGA 2ZI6A 1NC1A 1I6MA 2QRHA 4NBNA 4FS3A 2CBZA 3KJEA 1Z2PX 2I66A 5JOQA 3TLEA 1J49A 2XW6A 3HXOA 2JJMA 1G0NA 2ZZMA 4KWHA 3Q7PA 2YV5A 4H3HB 1V2GA 3SN6A 3UFXA 1YE5A 1QHSA 4ENRA 2J45A 5I9LA 1Y4SA 1UMKA 1XZPA 4QE3A 3A4LA 3O47A 1NUQA 2B8TA 1HYQA 3OHMA 4GR5A 4LI3X 4Q7QA 4ZJUA 5MF6A 2CEKA 1E79A 5KTKA 2PRYA 3I5YA 2AYXA 1QQTA 1YS6A 5LBIA 4ZQGA 1JIIA 4AN1A 3O75A 2GBLC 4C7XA 3EZ2A 3GFGA 3H2ZA 3K09C 4NZMA 4UU0A 3PR1A 2VWPA 2H29A 1ECBA 5EFZA 1U7PA 2UVPA 1YFLA 1FS5A 4J1TC 5ER9A 1U2GC 1ADGA 1Q6YA 3G2LA 4DB2A 3AR7A 2C4KA 1H6DA 2C4TA 3F7TA 3DMPA 1Z4KA 5BSTA 1XZJA 1E2LA 3K0FA 4KXXA 1NRJB 3ZHVA 3H2IA 1BQ3A 4R01A 4XGKA 4ETNA 5I7OA 1JEYB 5T41A 1TLFA 4PFSA 4RMGA 5JYCA 5TPZD 2G67A 1GN9A 3L92A 4DADA 1JQLB 3SI7A 4CMBA 5C8XA 1T4GA 5DN6D 4YLYA 3HRKA 4LZWA 4BL5A 3JQ8A 2I3BA 1NZFA 3FWZA 4CKZA 1H2BA 1L5MA 3ZV5A 4FZVA 4DRXA 4EIWA 1G2QA 2FW9A 3CR7A 3NBQA 3PQ3A 4RSRA 5DFAA 3AHFA 3BGDA 1EWVA 3ZVKA 1PJLA 4RVCA 1E9RA 4A8PA 4XWOA 4QJ5A 3N9IA 1O5TA 2YV3A 1M34B 2XMQA 1GHTA 1KF0A 2BFAA 4TZ0A 1UQTA 5CX1A 3TUZC 2G9QA 1DO2A 1QH8A 5AI9A 5IM5A 1W5EA 4CEJA 2EOAA 5FLKA 2PX5A 4MR9B 4FGJA 3UAWA 4K9OA 1FJ2A 4DEYA 4ED9A 3WO0A 4JYPA 3GK3A 3TNDA 5HR5A 4H08A 4DVGA 4BCDA 3L05A 5DX8A 1YB7A 5MN6A 2FVYA 4DC0A 4RZUA 5BQ5A 4TXLA 3A9CA 4C7OA 2PDAA 5HBGA 3AXTA 2YYZA 1LWNA 2FFAA 2WJ4A 2AUMA 3Q8WA 1DCTA 1QCZA 5EGNA 4WASA 2C9CA 1DQPA 5LQSA 3SBDA 4TTQA 1RPTA 1TF5A 4DNFA 2OCGA 1FFCA 1WPXA 3I04M 4GGPA 3O8NA 2PKYX 1KTVA 2Q5HA 2CLKB 4R8KA 2ZLBA 1Y4UA 5M3BA 1LBHA 4EBBA 1BO6A 1PJZA 4J6FA 4MRRA 1P7ZA 1ZMBA 1P77A 1PS8A 2GVZC 2J6CA 1WEHA 2Z2XA 4UHFA 1IJBA 1R4NB 3ZGVA 2VLIA 3IBTA 1Z8FA 5LP1A 1P9RA 5CBPA 2ZUEA 2YFHA 2Q7OE 1D0VA 1UPTA 1XJWA 2R6JA 3E15A 4KNWA 1Z15A 4RDIA 1TIPA 2H11A 4C6TA 4E2ZA 4ENVA 1XHFA 2J3EA 5BW4A 2GKGA 4EKGA 4IG4A 1GCOA 3DEHA 1UOPA 1WSWA 3A37A 5DBOA 1E60A 3LQRA 2LPMA 3HM9A 3LUJA 2M6SA 3VUFA 3PX7A 3G8CA 4NNPA 3EXHA 5JMPA 1NI3A 2H4YA 4AXBA 3A04A 3BBLA 4TLMB 1M75A 4H17A 2QM3A 3KB6A 4UAUA 1NJ5A 4LKRA 3BGVA 4ND8B 1KQNA 1BW9A 2GM3A 4WA7A 3N86A 3SVLA 1IB6A 5ICGA 4P3YA 5K0GA 3W5AA 1OAOA 1CJCA 1Y4ZA 1YBMA 2AOVA 2ZRCA 3AF0A 3FUWA 3NEAA 4L16A 2J8ZA 4FFRA 5BV7A 5IDWA 5KU7A 1O6CA 5ITSA 4WL0A 3NMUF 2XGSA 4DG8A 2ACWA 3ORFA 2ES4A 2F7SA 1TJ3A 2CJFA 4U7JA 1IY2A 3MUEA 2NU9A 5JJ5A 3A06A 3MNFA 1FBTA 3NW9A 4D4KA 1BFUA 4U8GA 3IPYA 1FZQA 1E6WA 2ZU0C 4WACA 2IYQA 3EMDA 3EVGA 5DWVA 4IEIA 3IDFA 1EBBA 3QOWA 4RSHA 1G5TA 3T3GA 2FPGA 4MVJG 4K86A 3ETLA 2CXHA 1FSFA 1ZHHA 3I01A 1GCAA 3KVRA 4TKUB 5JZOA 1MG5A 1VDMA 2H7VA 3CRRA 4TXHA 2H9YA 3QW4B 4OL9A 1L5KA 2A9QA 2REOA 1QS0A 2P4HX 3OICA 4DQUA 1PDWA 1PT8A 2ZPAA 1QANA 3BF7A 3QUSA 4JWKA 3CW2A 1GAWA 5J4KA 3TZQA 5JNLA 5K8UA 2AN9A 2MYNA 3AWDA 3DTTA 1XV5A 2RK3A 3IBSA 2JDID 4OY3A 2V6BA 5C7YA 3H1PA 4KQFA 4L73A 1P33A 2V03A 3QX8A 1X86B 1OXUA 1GU0A 3D5QA 1Z06A 5CEFA 2CFIA 3PUJA 1F6WA 2HI0A 3TIXB 2E89A 1KO4A 4BLTA 2RBKA 2HF8A 3PWZA 2QOEA 3T0GA 4BNTA 3RABA 4P9NA 3U13A 1K27A 3DOHA 5CFPA 1XRJA 3NDJA 1VCOA 2FQXA 2I4IA 2JZNA 2P7HA 1Y3FE 2WJIA 3EW9A 3U7GA 4JDPA 1ADJA 4M8LA 5B3KA 3SJBA 3OWOA 2QRKA 1YKSA 3B48A 1UOEA 3IAM1 4HJXA 1LDYA 4IIJA 3HB1A 3QVTA 2FPIB 2PS3A 2ZUUA 4XB6B 4D4GA 1F0KA 1XJ5A 4QAJA 4WN9B 1TXGA 1V7CA 2QTHA 4HNAA 4F6RB 1GRRA 2FW1A 1JJAA 4EKIA 3K0SA 1REQA 2O8CA 2I3DA 5AI6A 2HFJA 2ZYIA 4HQ0A 1XELA 2DY0A 2CHQA 4KLNA 1C4WA 1CY7A 3BOSA 2BE9A 4OF4A 4EF5A 3AERA 1FFYA 1F2TB 4M6WB 3INNA 3ZXIA 1E32A 1YUNA 1NVEA 2Z1DA 3LCRA 1P9NA 1RYDA 2JGFA 2XWPA 1V8OA 4UMDA 5F2OA 4RVFA 4ESOA 3UMMA 1RP1A 4CLRB 2QIOA 2C7QA 4I1OA 2HA6A 1NM5C 1PD0A 4G81A 3R0IA 1AUXA 2XJ4A 3FRHA 2UZ4A 4H1VA 5EJGA 3UJAA 2HHLA 1ZIDA 1G8SA 1JLLA 2EFCB 4TROA 2ZIGA 1R16A 1CRWG 1XVLA 4XVQA 3EIHA 3F1LA 4CEHA 2WE7A 1FPQA 4MUKA 2FRXA 1Z7WA 5ALJA 1WNTA 2W7TA 3HA5A 1W5SA 4F97A 3DEIA 1GZHB 4NHEA 5E6UA 4EYKA 1XZCA 1YU6A 3LX5A 3F7OA 1XNHA 3IGFA 4TRNA 4YP0A 1YXMA 2A5GA 1Z7EA 4E2WA 2XE6A 4UREA 5FOWA 1EG2A 6YASA 4I14A 1L5NA 4IWXA 4N3GA 1FLAA 2JCYA 3TVYA 3O9VA 2XT0A 1A04A 4NENB 4B34A 5C5CA 4C08A 3L1HA 4RJJA 4C5AA 1SKYB 4YRTA 3CXUA 5FCDA 1SXIA 1T25A 1LFDB 5LP6F 3RV3A 5A9RA 3PUIA 4IBOA 1Z63A 1TQ4A 3OEHA 4CLDA 2FPLA 3T5AA 4FYIA 5IBRA 3SZGA 3BUSA 3QMVA 4EHDA 1G66A 2GNAA 3THWA 3DWEX 4DCVA 4GFDA 1VLLA 2I8LA 3O03A 1OBCA 3S2IA 2SKDA 2XNDA 3IIEA 3IUEA 3H2GA 3PUVA 4EARA 1TYCA 4B4VA 2AG0A 3KR1A 4FYHA 4JXZA 1FNNA 1BVYF 2BI4A 2O57A 4JEIA 1Y1TA 2B94A 3SXUA 2R66A 1I2BA 1VJ0A 3NI2A 1ZGZA 1DXHA 2J3JA 1DDGA 4ZXFA 2E1RA 5BMVB 4Q1FA 5F1PA 3G49A 5LZ5A 3B6JA 1DXQA 5TARA 1ZSYA 3DE6X 4QPDA 4EQZA 1PYOA 3P0IA 3EWNA 1Z2AA 1M1NB 3PIDA 3F4LA 2FWIA 4RK0A 2NYRA 5TXGA 1JF8A 3GZTB 2P5UA 2CJWB 1OI2A 1WCIA 2XTNA 1OX6A 2Y0EA 3A9TA 3MYYA 1DQZA 4HDKA 3BORA 4O4LA 2JIMA 3CW9A 1VE3A 2QRVB 2DFKB 3BTOA 2H0AA 3DJYA 2AI2A 1G8MA 2D5CA 2QN9A 2Q3MA 2YJNA 3DKRA 4MA0A 4UBKA 4DT1A 1Z56C 5J2TB 2WKPA 4AJLA 2XUKA 1CUHA 3O8BA 4H77A 2WIFA 2WMOB 3DFMA 2D3WA 4H6WA 4M4SA 4N9QA 3S99A 1HLGA 4B8ZA 4DW8A 4EPRA 4HT3B 1YMVA 4ER7A 4PPNA 3KSRA 1W9HA 2HA4A 2IL1A 5H4HA 4EHJA 2WSBA 3MG9A 4E1AA 3X1YA 3D4OA 1ZBQA 4QDTA 4ZT2A 1RYMA 1U8YA 1BZYA 2H8KA 3PUKA 3U56A 3DW3X 5CDYA 3WV4A 4MVJH 2EERA 2CFOA 1KDPA 1FFGA 3A3PA 4ZP1A 1Y8RB 1Z45A 1IIRA 3D6NB 2EIXA 5TMBA 2BFCB 1QNLA 4I8DA 5A06A 3REQA 1KJJA 5KTSA 4DQKA 3GV0A 4O25A 3O74A 3DS8A 1ZRNA 4BNNA 4DXAA 1ZO8A 3GR6A 4KRYA 1I2MA 4YDRA 2LDXA 2QTNA 1L5LA 2HO5A 2C2HA 3OZBA 4U39A 8GPBA 5HJ5A 4HZUB 3K09A 3GRFA 2JRLA 2JLYA 4Q19A 4BPBA 2ZATA 3E7FA 4MUHA 1LNSA 2P27A 3LCCA 4KPUB 5HM8A 1AKEA 1OFGA 3SYKA 3LBFA 4GWLA 1MX1A 1H3NA 1USKA 4IUDS 3WZMA 2NACA 1IPFA 2JAOA 2WHPA 3GDFA 4ZKDA 3G2IA 4BNJA 2G7ZA 2OORC 1WB5A 3KZVA 1XCLA 2AVDA 4I4LA 2O52A 3QI7A 3K5HA 1MX3A 1QE5A 1JG4A 2I6GA 2PMBA 3AH8A 2F8MA 3SKVA 3RQIA 5IDYA 4ZI3A 3W2TA 4H6VA 1Z37A 4GH5A 4WDQA 4ZU1X 3RVRA 3TZCA 2D0OB 5SYMA 1WO8A 1VCIA 7AT1A 2GO1A 3HH8A 4UMVA 2GK7A 6PFKA 2XRMA 5B55A 4LGVA 3MIIA 3LUDA 2IX3A 4P7BA 3FTNA 1XU7A 4OH7A 5H9WA 1NNLA 2FV8A 4UC0A 3ZJUA 1LVUA 2QSZA 3NR2A 2DETA 2WNHA 4K88A 3H75A 4DQDA 4JP1A 2ZRBA 2WWHA 3RS7A 1QQ5A 3NB0A 2G36A 4BNMA 5JWOA 1R6BX 1G98A 3KKZA 4YRJA 3K15A 1UODA 2C3YA 2J7PD 2L42A 4KV9A 3MK31 2A3RA 1TCUA 1KSGA 3W6PA 1B00A 3DBHB 1K7FB 4HWGA 3UM9A 3VH2A 3OIFA 3PNPA 4RZIA 1B3BA 4B71A 1DCFA 2RARA 2HTFA 1M34E 1VBFA 3JQPA 3KQKA 2SHKA 3FMOB 1TU4A 4EEXA 4KQXA 1A69A 1GL7A 1ZIPA 1CE8B 4Q03A 1L4BA 4LNHA 3FIUA 1X1EA 3L40A 1T36B 1H9AA 4FCTA 4IY1A 4KCGA 2BTQA 5JVDB 3RV4A 3RYFB 4M76B 3ONVA 4TQUS 2ZCJA 3OO1A 5IW8A 3AKCA 3V42A 2F1KA 1JQKA 1HDIA 5AHWA 3RROA 4ZVNA 5IJAA 1AZSC 1P3DA 2I1QA 3UB2A 2R3SA 4FYPA 4KLAA 2XYQA 1JU4A 2SKCA 4PPQA 3T38A 2ZS8A 3EBOA 1ISRA 3P45A 4G5GA 4BUCA 1G8FA 3V9AA 1KS2A 1WHSA 3Q10A 1A71A 3GDWA 4LYYA 3WLNA 2BGWA 1L3BA 3V1LA 5BORA 3H97A 1WY5A 5D3ZA 5IF9A 1Z4NA 2OBLA 3ENQA 5B1HA 4QYTA 4C3VA 3C3JA 1VZ3A 4MS3A 2JIZD 2YDYA 1GPBA 3SSAA 4IFTA 1GPWB 5KYWB 4ZVTA 3RODA 4UDNA 5DGXA 4N18A 2WAYA 2BFWA 3ZD6A 1K0UA 3KVNA 1TKAA 2CL6X 2IOQA 2QTTA 2QTWB 3S1LA 4KYUA 4F6LA 2O7SA 3ZW9A 4NMLA 1UINA 1V1RA 2G77B 3OCUA 4B6OA 5EIOA 3PFBA 4XGRA 4DOMA 5AVSA 5E9AA 1R0BA 4D57A 3F98A 3WA6A 1HDYA 2MSLA 4F93B 3EG9A 4O6VA 5EG5A 1D4FA 1RWMA 3L18A 4CT5A 5EIWA 2GFHA 2YY6A 4NYMQ 5COAA 3KSMA 3M1YA 3MRVA 2RB5A 2WSLA 4KVGA 1GL3A 1E7RA 2R8BA 3X1ZA 4AW9A 3BJRA 1I1OA 1P8JA 2Q45A 2PUTA 5NLLA 4E2XA 3E22B 1DB3A 4K03A 5DBGA 5AW5A 1QO0D 5TQVA 5FTMA 4MPTA 5TC4A 1G1AA 1MVOA 1R10A 2A8YA 2GXUA 2XWBF 3K16A 1X74A 1P5HA 3AHEA 4AKGA 3HSKA 1Y8ZA 3PI7A 1NUPA 4F1KA 1XTRA 2QUIA 3OZXA 1I5RA 2W2PA 3GT7A 5FA8A 1GRNA 5DN9A 5F35A 1Q11A 4EAAA 4IUYA 2DH5A 4L50A 3PGLA 1A7AA 3E23A 3KDSE 1TO6A 4RW0A 4N0EA 2C5GA 1NL3A 1S2OA 1X14A 3PQCA 1ZEJA 1A5TA 3CKMA 2C00A 2DBRA 5DHUA 3BXHA 3I2IA 1ML3A 3AT1A 3LU1A 3VNVA 3WY9A 5IM4F 3E3MA 1KZYC 2Y1KA 3EMVA 3VZBA 4M8NE 4NCHA 4E15A 3CB2A 5LQCA 4L8LA 3TZBA 3AB8A 5CLFA 2IOYA 1N5LA 3H5AA 1UJ5A 1FP6A 3WB0A 1E2PA 2JEZA 1XTBA 1TKCA 3REFA 1C7FA 3MWDA 4V38A 4TKZA 4Z4QA 1DOHA 2YHIB 2VL7A 4DJ5X 4MRNA 1XYYA 2PA3A 2NVWA 2QKYA 4L8WB 4L75A 3TQRA 1PTJC 3H0EA 3OOWA 1TIBA 2MMGA 3Q3GE 4M9UA 1P4AA 2BEVB 2DLDA 2E3JA 2JI6A 3GJ7A 3GRCA 1GCIA 3ZJVA 5KYWA 5WRFA 2QL9A 3RFVA 4F85A 2AX3A 3BWVA 1PNTA 2QVXX 1EFAA 2IHJA 5AM5A 1KDTA 1QF9A 1X7ZA 3EX7C 5DMHA 4NMXB 1N6LA 3QFHA 3A1TA 4AZ0B 1A3CA 2G3YA 1AZTA 1ATZA 3QEMB 4BN4A 4M1MA 4N76A 1GNPA 3QYJA 2XZTA 3EYWA 5DASA 2ADOA 3TO5A 4BO7A 3GF4A 2NZJA 1NBHA 3RTDA 1T8RA 4FHCA 5BOVA 1IBMB 1E6CA 1HT0A 1ZN2A 1E3MA 4JLUA 4F9GA 4AMZA 2PUGA 1UBOS 2SECE 3OG9A 4TYMA 3ENKA 2G9ZA 5DNAA 1AXGA 1UC8A 3RUIA 3UB4A 3UBTA 2JCBA 1DEKA 2WVJA 3ISTA 4JOCA 4X8LA 4ZC8A 1PJ2A 2RH5A 2OV2A 4FR0A 1LBTA 5DNDA 4MKIA 4BU1A 3LT4A 1BWQA 1JRLA 1Z36A 5EYPA 3RYIA 4N8EA 1PR3A 4KQHA 1ISJA 4XQCA 5CT4A 1IQ0A 3Q72A 4QHSA 3TQQA 1T2CA 1NG1A 3FDZA 2C0QA 2CYBA 1P73A 3HFRA 4DR7B 1GLVA 4I5IA 3V7FA 2AC7A 1PLKA 3LOQA 3N76A 3O5AA 3QPDA 5HS6A 1I33A 4GQAA 3PQ6A 4D3FA 1OWOA 4Y2TA 2P69A 2WM9B 6CHYA 1I2DA 1KMIY 2W48A 3FWYA 1LDNA 4BO3A 4RTPA 2EFYA 1NFRA 4OB7A 2A9JA 3HCFA 5F9MA 2DJIA 2QLFA 5IVDA 1VPWA 4R9UC 5E2BA 4C6HA 1YVDA 3LM8A 3QHQA 3TTUA 2ODPA 2P6OA 1D4ZA 2IYRA 3KZ1E 1J9GA 1ZVMA 3QE2A 4A2PA 1I4LD 3KVOA 1RMYA 2PHZA 2JLSA 3W8RA 2PMDA 2QVBA 5HMMA 3OZUA 2B1IA 2QPOA 2A35A 3FYDA 3BCSA 3LV8A 1TCCA 4BAUA 2UUBB 5BV1A 1E4OA 1JHAA 3IMGA 3HJNA 1R0KA 3JD2A 4MRMA 4CQMD 4FWTA 3A6GA 3P9PA 4Q3KA 2W6IA 5AI4A 2V7VA 3ZLTA 1B6SA 3I1JA 3L0CA 3RAEC 1IYZA 3RD5A 4GDMA 3B7GA 4HF7A 5EVJA 4DIOA 1TAUA 2G88A 1KETA 1TRHA 1YAHA 3NC1C 1J6UA 3U7RA 1NT4A 1SOAA 1BFKA 2O5RA 4HFRA 3E1GA 4MB2A 2H3EA 1W19A 4HNSA 3R7FA 1S1MA 1UQUA 2IZ6A 3EIEA 4CCYA 1I6LA 1C8VB 3RFUA 3RNOA 3IVRA 1QO0A 4FXOA 4HQNA 5B7GA 1HNNA 3BWXA 1QCYA 4PS1A 4BHTA 2O19A 1WNFA 3Q8MA 2OG2A 3NIGB 5IJ0A 3A9SA 3B7PA 1SBYA 3D7RA 1YHZA 2P8SA 2FWBA 2OOKA 2Z9BA 4G63A 2OXIA 1DZIA 4JI4B 4DANA 2G80A 3DV0B 4XCVA 4YRFA 4R7GA 1EK1A 3DL4A 1RPNA 3DZKA 1KAEA 4EB6B 3R9KA 1GZ7A 2LBPA 3GEDA 3PG5A 3R5HA 4G0NA 4GVPA 4LXQA 4WKOA 1BIFA 1RQNA 4ZTUB 4RHXA 4RKFA 3EEFA 1PYGA 1YJAA 1R6UA 1WMFA 2O3QA 3EEIA 1HC7A 4P8RA 1KORA 3LO5A 4R8MA 3ZWXA 4DPLA 2VHZA 3QI2A 4L4ZA 4CEJB 1N7GA 1T5BA 4OHKA 2BKVA 3FNQA 4CF3A 3FTDA 2VR1A 4KYTA 1Z17A 4BO4A 1D5CA 5EHQA 1TVKB 3ODGA 3FDZB 2HSZA 3TGLA 2DEUA 2GD1O 3HDHA 5KNBD 4WPGA 4DR3B 3E18A 2ZQYA 3G2OA 2HV8A 2A9PA 1PFQA 3JAKA 3MHPA 5DBHX 3DCJA 3NBKA 1YZLA 1QR2A 1N3IA 2IW1A 2X1LA 1LRKA 1RI3A 4X24A 4IVPA 3DKPA 2AOTB 2E37A 2H4FA 4HUTA 4L85A 3ZCPA 2AJDA 1JIUA 2AFRA 2AFHE 3AP1A 4F3NA 1IMOA 3EBPA 3EGDA 4OQLA 4ADSG 1XG5A 3FPHA 1EFTA 1M2JA 3KU1A 5EERA 2KX7A 5CMLA 4KN8A 1S0UA 3QEJA 4QX6A 5KOHB 2QPLA 4WJZA 1RI4A 1DWUA 4URYR 4CL2A 1O94D 2W0MA 3FPFA 1L6IA 4ZQFA 1I01A 1Z16A 1ISMA 4LG1A 1FK8A 2HK7A 2ZJOA 1M2FA 4YJFB 5ALRA 3VR5H 5C1OA 2EW2A 2I55A 3EEBA 4FUTA 2YVKA 4DMUB 3UJDA 4MROA 2HF2A 3DWIA 5J5CA 5JARA 1WVMA 4KNYA 4QARA 2ROQA 4MWTA 3IVAA 4XEHA 2AQ8A 1P6UA 1SU7A 3R7AA 3WWYA 1TAQA 3FHOA 1UFVA 2QZZA 4YT5A 1A9XA 1OVMA 4OXQA 4XFJA 1P2SA 3X2FA 3DZIA 1PF7E 3QKUA 3TVTA 2Z3WA 1J0BA 5LLTA 3P2KA 2HLHA 3MWDB 2QYOA 4WKCA 4RORA 3AEUB 4R2IA 4YRDA 5EUBA 3PX3A 3RLIA 3MWFA 3HDQA 4QNMA 4MS4A 1XL0A 2IUYA 4R8RA 1ZITA 4GOKA 2JFOA 2X76A 2GCGA 2FEMA 2W4QA 2CVHA 4JC0A 3AM1A 4HO1X 2FMTA 2PXAA 5BY2A 4Q4AB 3W05A 5HK8A 5K0SA 4GS5A 2PTHA 4WK2B 4YXFA 1SA0B 1Z8NA 3P2JA 4GZ6A 4MW7A 2IYWA 2FSIA 2QP3A 3QEAZ 3UPUA 2A0FA 1L7XA 3EHDA 1A7JA 3C3AA 2BL4A 1LU9A 4K8RB 1WP4A 2I3GA 3N2EA 2Q1WA 3HHPA 3T3MB 3TMKA 1Z2DA 4EI2A 4ZOLB 3HI6A 5K6RA 3GNTA 2IY8A 4DN6A 3DLHA 3HR7A 5KVQA 1BEEA 4FJ2A 2MYTA 2NTEA 4TMFA 4V3CA 1MHPA 2I87A 5BSMA 1RMTA 1YFZA 4D4LA 1C1HA 3FRIA 4QUBA 4BNKA 2B37A 3CINA 4MVWA 3CH5A 4MPRA 2EGUA 5JDCC 4PAWA 3W5BA 2WZDA 1I32A 2XB6A 3HZOA 1NBMA 3PLRA 3DVAB 4MGEA 5EFOA 3ZYZA 3PDIA 3ELDA 5B57C 4WXHA 2XT6A 3BJMA 1F8YA 3I9NA 4W6ZA 4WESB 1H8HA 1BKSB 1BSVA 4TSFD 4WXEA 3ZEAA 3BZBA 1DJQA 3ECSA 1C29B 4KAJA 4R05A 4H1WA 4EQ6B 3MT7A 3HU3A 4JP3A 4NLLA 1J70A 1GFSA 3ZQUA 2EBWA 4CDMA 3TQSA 1FDSA 4KVZA 2FCAA 3KJHA 4QL3A 4AIIA 2PKEA 3IJ5A 4Q9NA 3LF2A 1SXJC 4UBMA 5B1SA 3L07A 1Z5VA 1RABA 4MV0A 2WAOA 3TQHA 3UUEA 5BNZA 5IABA 5K0ZA 3OQJA 3WLLA 3CZAA 4XARA 2O5VA 5ICEA 5JXHA 4EA6A 2O20A 2EGHA 3BSFA 1WCV1 1Z83A 3OLVA 1KYQA 1RPZA 4RKEA 3TTWA 3RBAA 3NTUA 4LQCA 4RQTA 2EJCA 1RRMA 1RXCA 4Y98A 3AR5A 3GPBA 3T9AA 3FPEA 4HNAB 1RQGA 4L3OA 4WQMA 1EYZA 3GNSA 1PNOA 1VKRA 2PGDA 3HB4X 4D7AA 1GUAA 3WWCA 5CPBA 1S3SA 5IYZA 5MDHA 2IH2A 2DUWA 2X9GA 1MR3F 3L6CA 4MP8A 4UVHA 4AJ4A 5I5EA 2GPYA 1HDEA 2XSZD 1K9SA 3KUXA 5HX7A 3RADC 1GTSA 4X1KB 3ELBA 3UJPA 4IWNA 4RLSA 3B13B 2EV9A 1ZK0A 2B8JA 1C0EA 4YNBA 4REOA 1USUA 3FZGA 2AG6A 2XDWA 2BMDA 1H0HA 3UCFA 5HRCA 2GAOA 2H00A 2WEKA 5AKHA 5AWFC 4AJ1A 1PVOA 4OATA 3D5TA 4F9TA 2DVMA 1VLZA 4LGYA 1ZWKA 4E2YA 1J39A 3HKDB 1KMQA 3QKTA 2QUJA 4DSTA 4DXHA 1PNVA 1T2DA 4MHOA 1V7ZA 1Z6AA 1G7SA 3I5MA 1UJMA 5F4ZA 4LYFA 3THXB 2A0XA 3LI2A 1MNAA 1W85B 3KAJA 4F91B 1EK6A 3IP1A 3N87A 4NZOA 2VF7A 2CVZA 4G5YA 1Q0HA 1HXHA 3IT2A 2G9NA 3HCCA 1T1GA 1NOKA 3CVUA 1VI2A 2W2TA 3D7LA 4X1KA 4AICA 1XROA 1T1RA 2X3FA 2P75A 3CUUA 1UKBA 3EXFA 4URWR 4L9AA 3U4AA 4PZLA 3S2YA 4HFNA 2IS1A 4DR6B 4C88A 5A2QA 3P9QA 2F59A 4UBJA 3ZGNA 2AR0A 1HFJA 4ZMBA 2WSYB 4FVTA 1P5FA 4OSEA 2CHUA 4DTCA 4XWTA 1GA4A 3ROGA 2HNBA 1U8XX 2Q1XA 3OH8A 2HX1A 3F5SA 3OZRA 3IEXA 5E2AA 3E1KA 1TPYA 1FLVA 3ZE9A 1TZJA 3BILA 3P9ZA 3GNLA 3KKNA 2GGSA 3HWRA 5DHSA 2GCNA 3JRNA 3TUJC 5E1OA 2B8NA 2PS1A 4O5AA 3WL4A 2QVGA 4BJ5A 1XGKA 1N32B 2C4HA 2Q2QA 1VLHA 3IFSA 4B76A 1ETUA 1ESZA 4LTNA 1T0PA 2NN3C 4Q4JB 5IUNC 5B7NA 3PGVA 3G0CA 1W4AA 4OHZA 2B5WA 3WQBA 3P9SA 1FTQA 3THYB 2JLAA 4RF5A 5HOQA 2CV1A 4H7DA 1M6EX 3BXFA 4RQAA 1N2XA 4DT1B 1BVUA 3QUCA 4F2WA 1ZOLA 2Z1NA 3C4VA 1KEEA 3BEDA 4B31A 3HM2A 1L7DA 1SUCA 3DDCA 3I45A 2PX2A 3DCYA 4Z5XA 2NG1A 1E9VA 1QZXA 2XMRA 3FGPA 2PKWA 4V2IA 3GWGA 3E9ZA 3WTBA 4YMTA 5BV0A 2P2ZA 4F2GA 5B2ZA 4RIIA 1C41A 1ZIOA 1CR4A 3CG4A 4INPA 4RPJA 3ULKA 1V7QA 1EHCA 2FEWB 1LB1B 2PZLA 3MMPA 1L4YA 4ZALA 1T9BA 3WRWA 4F7WA 1NIPA 5DPMA 1PRYA 2HRRA 5E1MA 4YV0A 5KDOA 4U63A 1JS1X 2WDPA 2WUFA 2Q0XA 2D74A 2RC6A 3L7CA 4UBLA 1LI5A 4WD3A 3WK6A 1JR4A 3FPLA 4YMSA 5IYZF 3SFTA 5KJ1A 1QM5A 4OMCA 2MR5A 1FQOA 3DNFA 3EA0A 2Y1FA 3CPJB 2Z09A 4IZHA 1E3EA 3P32A 1JIJA 4NYIQ 5BWOA 1WXWA 6AT1A 3P9NA 4BQPA 1I2ZA 1KNXA 5CGZA 1JQEA 1ZL0A 3TDKA 5EWLB 1W2HA 5JFOA 5JRJA 1II8A 2C5EA 2DR3A 5DSZA 2C9MA 3ZDZB 3ILHA 3S29A 3IAXA 2I2FA 1SULA 1WSAA 4MS1A 2F55A 1V8DA 4C29A 4F60A 5F3RA 4TVOA 2YIDA 4D02A 2GJ9A 3LGSA 4FFDA 4JR2A 3PHJA 3AKYA 2CLSA 2OLJA 1YRWA 1X1CA 4MO9A 5FPPA 4PLCA 4W7SA 4AK9A 5ELXA 3EC1A 1ZJWA 3TAUA 2IHTA 3VPBA 1U0EA 5GIPE 4YMHA 4Z3OA 4P7JA 1WAMA 1HNXB 4RLQA 4LAFA 5LDDC 1H9CA 1QH1A 2C92A 1ZG3A 1F4LA 4CXMA 1KAOA 4LCBA 4DCCA 2E48A 2GVNA 2ODAA 4AJEA 3MGBA 3E81A 1MOPA 4PQGA 3SD7A 4RTKA 3QEBZ 2O0KA 4AY2A 3MS7A 4H7PA 3AEQB 1JZTA 1FXWA 3ZK9A 4HAZA 1J8VA 2QJWA 3LDUA 5AUNB 4Q3LA 5AR1A 2H18A 4PHGA 3KQUA 3BFXA 2WU8A 1PL0A 1WU8A 2CMFA 4Q4JA 1EU1A 2RGGA 2BFMA 2B1QA 1YJBA 2QXUA 3GRVA 4L4XA 5AKEA 4HMQA 2RGAA 3EYAA 1EI9A 1E94E 1FEZA 3PHHA 3VKFA 3WBBA 5JD4A 4GMHA 5D7BA 3KFLA 3OU2A 4RHCA 3GCZA 4NU0A 4U9UA 3G5TA 4QHYA 4BZZA 4CE6A 3ZD7A 1QRSA 2UYQA 5K51A 3TJZA 1GL6A 4UFNA 3KD2A 1MOQA 4GZMA 2CKMA 1OAAA 2ZYDA 1BAPA 2WWGA 1K08A 2Z43A 1MAWA 3QENA 5DX1A 4PS0A 4DBLC 2WJVA 2NSLA 4AECA 3SNHA 4IXNA 1F6BA 2GAJA 3FFWA 5EMNA 4HGYA 1N5IA 2R751 1SKMA 1TAHA 3M6FA 4YRGA 1E2FA 2EW8A 1P1RA 3RU7A 2WF8A 4XYBA 1XRQA 1P91A 1US8A 2ACVA 1Z73A 3K2EA 4AY3A 4NBLA 5ESRA 4QXOA 2QRZA 1NBMD 4RLHA 2AMFA 2IE8A 3EDOA 2CUNA 3X44A 4IDNA 2VDRB 4QGGA 3EVTA 1QX3A 2C9BA 4H0FA 1L5GB 3UMFA 3ZHSA 2X4GA 2VWGA 3E0QA 2WYVA 4NATA 5BWMA 1CQXA 4HTFA 2YWJA 1C3XA 5GZ6A 1X0VA 2R6HA 4GC9A 4RD3A 1ZLYA 4WCDA 2ERXA 2QD5A 1Y7IA 1ZDMA 2X8LA 3DF7A 1V3QE 3IERA 3C5HA 4GLJA 2FOLA 3KL4A 5FEUA 4Q82A 2P7IA 1I0LA 3C15C 4GXQA 1YF3A 4JI8B 5CFMA 1G8AA 1BXRA 2REBA 3UWPA 1ZD8A 4KMRA 4OG2A 5LFAA 2OR3A 1ZD4A 1O5OA 3ACDA 3WB1A 4TMWA 3G0OA 2NU7B 1N1MA 3L8CA 4KAFA 1LTHR 4P22A 3M3PA 3I8XA 4XVRA 2PCJA 4JT9A 1NVMB 1JQJC 4MWDA 5ED0A 3PCXA 1YA4A 3ASVA 2VXCA 4IKPA 2YW9A 2HDNB 4IP0A 1W7AA 2IBTA 1NHWA 3IOCA 4G5OA 2R25B 2J9XB 2VRCA 1N8SA 4XIIA 4I1PA 3ABIA 1OV4A 1BOOA 2ID9A 3KD3A 4X3OA 5EINA 1PSDA 5HIMA 3UMSA 4YPVA 2E4ZA 1U63A 2VUUA 4JLMA 1E6MA 4LX0A 1JIKA 1UDCA 4Q4LA 3T6KA 1XTPA 2PIDA 4B2IA 1YIDA 2WIJA 3RKUA 4YH1A 1AA9A 2Z6VA 3INGA 4PSVA 3WRVA 2GWHA 5CB4F 1E6LA 2NZWA 1RWOA 3OECA 4YBRA 4HAWA 5BSRA 4AVYA 1AKWA 3DBRB 2HW8A 1M2VB 4UE2A 3B8HA 5T5QA 2VQDA 3QV2A 4OJQA 1K06A 3ZU2A 1Q6ZA 3NIFB 4YJ2B 4PIMA 5AKZA 3I9FA 1Q2UA 2D5IA 5I5GA 4GQBA 1TMKA 3PD7A 2DHRA 3ANYB 4D99A 4IR7A 4BQFA 4XRGA 4XQ0A 5JCZA 1VHWA 3VMMA 1C3OB 3QFSA 4Q3OA 1L5HA 2IY7A 3BXZA 2ORIA 1VL0A 3EVEA 4X92A 1BS2A 2PCLA 4ZAXA 5TS2A 1K7EB 1KI4A 2YY7A 4JGGA 4LRWA 5DTQA 4B7AA 1C3LA 5BWBA 2VTBA 1J8FA 1RE0A 4B87A 4HYQA 4EZBA 5C81A 3O0TA 1CY8A 1M6WA 2XVZA 3C39A 3R40A 3KJNA 4XPIA 2FFJA 3P4XA 1SU8A 3PPVA 1U9YA 1DJMA 2I2DA 1NGSA 2XE4A 1TU3A 1PJCA 5E7IA 1HFKA 1KYZA 1Z4IA 2I6QA 2LV8A 1OAOC 1ZC3A 2WPNA 4XIGS 1EFRA 4XEUA 3UKJA 1DX4A 3H5IA 3I34X 3ANXA 3OZAA 1WQ1R 1QZUA 1WUYA 4DVJA 4LDNA 2GEUA 2NSDA 2WU4A 3L41A 4TLCA 3RYCB 2EF1A 4F45A 1J5XA 2XOKD 5AW9A 4DDVA 4QZVA 5BR1A 3BMNB 2PZAA 3Q3HA 4DMHA 2DM6A 3WWEA 2G70A 2VDOB 1QXSA 2QN2A 2VJYA 4JOQA 4RGBA 3W8DA 5ELLA 3GHYA 4DJFC 4HADA 5T6BA 3LIIA 2X7JA 4QUHA 1QE3A 2ZE6A 4P4NA 2ZR8A 5BO5A 4F2DA 1EJBA 3IR6A 4INOA 3ZIAA 1QQBA 4V0KA 2OBFA 1QTQA 3SSNA 1UZAA 2I6TA 4JLDA 2OHJA 3QVGB 3LXUX 5JPDA 3LLVA 2CNOA 1MJGA 5T57A 3QEMA 5TEWA 4QPCA 1QGYA 1B8UA 1E58A 4J2OA 3VYWA 1S7CA 2Q46A 4GOXA 1O6FA 1A5BB 1ENPA 1WUJS 4AJOA 4NU6A 2BKXA 2AI1A 1SA0A 3ZNNA 4EABA 3EGDB 3JARB 3QVVA 2H1VA 2B78A 3VR5A 2ZJ1A 2LXNA 5I4KA 1JPJA 5EZYB 1VLQA 2VNAA 5AW7A 2IF2A 4OKSA 4F2PA 2ZVPX 2AG8A 1KK2A 2C2MA 3GC6A 4IIUA 4KODA 1G3RA 3LP8A 4EA8A 4US1R 2D3TA 1HK7A 5EEGA 4HDRB 4NZNA 2JFQA 2P9QA 1MF7A 3MSXA 3CH6A 4N0PA 4NAUA 4EUNA 5KEIA 3HU2A 5L9AA 2R4TA 4L9SA 1Q3KA 2PT9A 3WLFA 2UXCB 4TQAA 2NUPB 1SHZA 2VHYA 3KUCA 3AFMA 2VPPA 3ZE8A 4B45A 5IDXA 4OAQA 3BGIA 2VAMA 2X1MA 4WI1A 5EE0A 3L4SO 3SQLA 1VG8A 3TGWA 2YWRA 1U90A 3ZWVA 3U3DA 4JN6B 2XF8A 5BWLA 2B4YA 1NMEA 1ZUIA 2ZAYA 5LL6P 2FE4A 1HI9A 5KNLA 2BR5A 2EKPA 4AJKA 2O0HA 4RMJA 3VI3B 3BE6A 2EX1A 1JXOA 1JHRA 1SKUA 3GEHA 1AB5A 2SBTA 2SKEA 3PE3A 3CUEF 4HDRA 4P7GA 4UEQA 4CQLB 821PA 3KKKA 4L9WA 5KTPA 4KXLA 4YB8A 3VA7A 1JW9B 1BDJA 2C54A 3ZVMA 1NF9A 3LCMA 1EP3B 2PV0A 3B1YA 3GU3A 4UTXA 5FQNA 3X1XA 4Z4EA 4RABA 3WZ2A 2P0YA 3KJXA 4IEEA 3ROFA 1AHHA 1QGUB 4B3IA 3ZWKA 1EDZA 1SC9A 1DOZA 3QUBA 3FF4A 3LUFA 4P35A 2VZEA 5JANA 3NUGA 1IMJA 5TNXA 2O2EA 4AF7A 1AQLA 5B6JA 3WSTA 4NNOA 5H82A 3FSEA 5KINB 1L7AA 6ADHA 2ODTX 3ESYA 1Y8CA 5EHNA 1ND6A 2QG6A 3QKIA 4EI8A 5KJ6A 3IALA 1VJCA 2AB0A 3GAAA 3CKLA 4FMCF 5DYGA 1O08A 4DPKA 4BB9A 1QG0A 5DCLA 5F51A 3DYBA 2IEIA 4RY8A 5D7NA 3CJRA 2WICA 5H70A 2ODEA 1GITA 2YOFA 1HG1A 2DYKA 5L3RA 3QXSA 4DLSA 4LRYA 3DEJA 3EG5A 1RC8A 3UFBA 4U2KA 4J0JA 3B82A 5DTJA 3ZJTA 1U11A 3PLNA 2WJ3A 1PGJA 3I37X 4IO0A 2J6HA 3BG5A 5F1OA 4DDKA 1Z5GA 3EPPA 4AM8A 3FTFA 3PRHA 1IK6A 2HUPA 2XY4A 4I66A 2C59A 2JJ2A 2WJWA 4I08A 3WYEA 3D9QX 3UY4A 4EW6A 3VHQA 3KEFA 1N0IA 4M1YA 3AK4A 1G5FA 5ALDA 5DXFA 3HCEA 3DE3X 1ZI8A 2IZ1A 3N0WA 2R8YA 1E0JA 3FVRA 5FUXA 2Q6VA 3DAFA 1MDBA 2GETA 2NO1A 3ICVA 2Z8ZA 4FC6A 1IHUA 3EOBI 2OO5C 2QW1A 4I9UA 3VPGA 2GERA 1QIMA 2EJWA 4Q4HA 4R8VA 5KAPA 3RYIB 3VPAA 5JDIC 1ORRA 1NZDA 4IH9A 1Z4QA 1T3GA 4DREA 2IV7A 4ZCSA 4JJ7A 2P68A 1R8QA 3HXLA 1DPFA 4R1UA 1AD2A 4TTPA 4ZZ1A 2FSPA 2XMSA 1MVLA 5T4FA 4KTTE 3SIXA 3F71A 4C0WA 5KYUA 2QSUA 1WVIA 5IBCA 2PZGA 1GTRA 4UNNA 1DFIA 3U44A 3ICQB 5EJEA 3H4IA 4ID3A 1X7ZB 1N3BA 4HH0A 1VG9B 2EZ9A 4RNCA 2OV4A 2B98A 3IIJA 4BC0A 2KJQA 1V6CA 4NAVA 4Z4IA 2VJOA 5C7OO 2ZWPA 2EC5A 3VOTA 2HAEA 3HR4A 1NY5A 4XIFA 1QH8B 3DNPA 1JQ3A 2VYND 4G1UC 3WQHA 4D9CA 4FM9A 2VXBA 4DZTA 2PZFA 4U5XA 3VVBA 3ZHCA 4K05A 4ROSA 4XWYA 2ZIEA 3VR6D 4IUBS 1Z35A 1COWA 2BAGA 4E5MA 4LEIA 3HWWA 3HK2A 5DP2A 5ESWA 4M7WA 3ZX5A 1KYVA 5I9NA 4RTOA 2FX2A 3PXDA 1DG9A 1NV9A 1QF6A 3H8SA 3KQOA 2A5YB 2ZJ6A 4OFXA 2J0EA 3ON5A 2DCUA 4IZIA 3A4IA 2YZMA 3MLAA 3FBWA 2IOFA 2ABWA 4U9HS 4ZRMA 2FRVA 2WHQA 4JLJA 4DDTA 3IIMA 1ONSA 3TG8A 1GSOA 3N8KA 3H3JA 4Y2HA 4ARSA 2RCYA 4P86A 3OAAD 1N4AA 1EE1A 1H5UA 3E9NA 5IU6A 5ICMA 1L3IA 5EMJA 3ZXYA 4KQJA 3I2FA 3UC9A 3OEYA 1ILEA 6Q21A 1MJFA 4Q1DA 1GNLA 1OY1A 1I5EA 4J1NA 3BE4A 1RZ3A 1DUIA 3B1VA 4CFZA 1DJLA 3OTIA 3GCXA 3MB5A 5JATA 1H2ZA 2GSWA 4DIEA 4N01A 1QS0B 1HQYE 4MWEA 3IP6A 1JUDA 3C74A 1ZM4A 1O97C 2HU5A 3D4IA 3KRTA 3QUAA 5A9SA 5BR7A 3BHJA 5JMTA 4KXVA 1G9XA 3ICCA 1JFSA 4EMSA 3BMXA 2L17A 1VIVA 4TS9A 2QTVB 3UXYA 2C9DA 1T5SA 2GEKA 4X93A 1BRTA 1I1QB 3CRZA 5CIQA 5ALZA 5EOVA 1VHLA 4DLBA 3JQEA 3OX1A 4HUJA 3AJ9A 3C3EA 3KJFA 4YUWA 1RPAA 1GO2A 1HO3A 4HDAA 1QHHB 4Y0VA 2O0LA 5I4IA 4E7PA 3ENZA 1GPUA 3CLTD 2BHTA 2A33A 3CT4A 1PR5A 3R3ZA 1Z3CA 4EB3A 1JPNA 4BBZA 2FRDA 3D0KA 4MVJP 5AKXA 3W9UA 1G38A 1LLUA 2IYPA 3NYRA 3I23A 3U4DA 1AF7A 2DQKA 3E2IA 4WLOA 2W2MA 3V4LA 1ZOOA 3SF0A 3GLHB 5JH7F 2CFTA 4YXWA 4KQGA 4E51A 4EG7A 2C04A 2IHUA 3OM1A 4M7PA 1NDUA 1SIWA 3MT9A 2DX7A 1I4EB 1NTRA 1AY0A 2YXPX 3NYWA 4R7ZA 4WW0A 5FDFA 2YVLA 4YT4A 4Q05A 3O83A 3UTCA 2ZWIA 3NPAA 4ZJYA 5HUQA 3T34A 1B73A 2C5FA 2Z0MA 1GOTA 1R18A 1CZKA 3P19A 1KFEB 2BELA