1TQ8A

Crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
147
structure length
127
Chain Sequence
b'SLSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Rv1636
molecule tags Structural genomics, unknown function
source organism Mycobacterium tuberculosis
publication title Crystal Structure of hypothetical protein Rv1636 from Mycobacterium tuberculosis H37Rv
rcsb
total genus 36
structure length 127
sequence length 147
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1tq8A00
5HG0A 2NZ2A 4DDHA 2QJTA 4A91A 4ZT5A 4HK4A 3CVUA 4MWCA 3SZ3A 1F7VA 4BWVA 1D2RA 3CVWA 1EFPA 4MW2A 1PFUA 2VTBA 3IH5A 1TFUA 1KH1A 1ILEA 4ARIA 1IRXA 2CYBA 1KORA 4ARCA 1O5TA 3MLAA 4ZCTA 3TS1A 5K0TA 3IVXA 1PG0A 4PBSA 1EFVA 4MVCA 3UY4A 1YULA 1G8HA 3QTTA 4MW0A 3IVCA 2PZAA 1K92A 2DXIA 2J08A 1OWLA 1MBZA 3ZXSA 2CYAA 4MAFA 3P0IA 2O8VA 1V47A 1I6KA 4HJXA 3PXUA 5TGTA 2PXHA 1NUSA 2HZ7A 1JIIA 3BL5A 3D6UA 1CT9A 4L2IB 3MUEA 2DETA 1XNHA 1IQUA 1O96B 3MMXA 2PZ8A 4EF6A 1WXHA 3PNVA 2D13A 4MUIA 3ZUGA 4EG3A 4F3RA 4AQ7A 1T6ZA 3H9BA 5LFAA 4P2BA 4XFJA 1GPMA 3G5AA 1IVSA 1MC1A 4I6EA 4NAUA 2CV0A 2QTNA 3Q10A 1YI8A 3L93A 1XNGA 3ILVA 4EGAA 3CA8A 1WOYA 2QTMA 1WJGA 3IOBA 1PG2A 3PNBA 4FZJA 3IMEA 3CLTD 3K32A 4MUNA 4JXXA 3ISJA 2VTBB 1B6TA 4U63A 1F7UA 3H97A 1JGTA 3COYA 2DLCX 2QUHA 3P0HA 1I6MA 1N2HA 1N2OA 4DNXA 1ZH6A 2Z08A 1SURA 3X1JA 2JAXA 3IUBA 1IFXA 1K4KA 2ZUFA 4RUKA 4TS1A 1QTQA 4MWDA 3VGJA 1NI5A 1VLHA 1WZ2A 1ULHA 1EE1A 2DERA 1U3DA 2XRYA 3N2YA 1NUPA 5FO1A 1LI7A 3CLRD 3CVYA 1HYBA 1GLNA 1J20A 1ZH0A 1VL2A 4OUDA 4CDNA 3KT8A 2I1LA 1N2IA 1N77A 1N75A 1WXGA 2C5SA 4PBTA 4HPWA 3RHSA 1O0CA 3FG9A 1ZJWA 2B7LA 2NSYA 3HL4A 2A7XA 2IJGX 2ZP1A 3K9WA 5DK4A 4ZT4A 1ZUNA 3SEQA 1WQ3A 1YUMA 4MW7A 1QQTA 3UK2A 3KFLA 1NYLA 4I6JA 1PFVA 4NAHA 1JECA 3LOQA 2YY5A 1OWNA 2VXOA 2WQ6A 1JZSA 1WXIA 3NBKA 3LCJA 3OTWA 2HMAA 3N8HA 4PBRA 1WXFA 2J5BA 1N2BA 2V0CA 3C8ZA 3E27A 4NX2A 5K0SA 1Q15A 2A1TS 2Z09A 1TYBE 4HJRA 1JIKA 3FH0A 1J70A 1KH3A 1KQPA 4UZEA 2RD2A 1NZJA 2GOYA 1M8FA 1QRTA 4MLPA 3CLTC 3COWA 2CUZA 2X3FA 3H05A 1X6VA 1NUTA 1WKBA 3COZA 1J1UA 1N3LA 3GMIA 4G6ZA 4G5FA 1EFPB 1H3NA 4ZT2A 1QJCA 1U7XA 4AS1A 3MLBA 4ND7A 3IODA 4EG6A 3SP1A 3CVXA 3LE8A 3PRHA 4KPUB 1QRUA 5BNZA 2Z3VA 1A8HA 3TQOA 2PZBA 1R6XA 1KAQA 4MW6A 3ELBA 5KHAA 1QRSA 1P7PA 3RK0A 1VBNA 5H7XA 3X1KA 3FI0A 3FWKA 3ZGZA 1KQOA 1MJHA 3HV0A 3S3TA 3ZJUA 1X8XA 3ND6A 1NUQA 4ZT7A 4E1AA 2QUKA 1MAWA 1O95C 3PNYA 1IH8A 4L2IA 1O95D 2J4DA 3KT6A 5FO0A 2RE8A 1T6XA 4JZYA 1GTRA 4YP5A 4R0NA 2WSIA 1JILA 1FYDA 3H99A 1EUYA 1G59A 5DASA 4DJAA 3HMQA 3A05A 3H9CA 3Q12A 1K4MA 4NDAA 4MW9A 4MUJA 1F4LA 2R5WA 1KP3A 3CLUC 1GAXA 1T9GR 2A1UB 3DO8A 1KKUA 4WNYA 3NV7A 4DLPA 4F4HA 1IHOA 2GM3A 4OJMX 1EUQA 2WB2A 5HUHA 1JEDA 3KT0A 4ZCRA 4X0EA 1QU3A 4MULA 1PFYA 2G36A 2JANA 1Q77A 3HFJA 3FHJA 2HGZA 4KPUA 5TS2A 3IOEA 1TEZA 1O94C 3G6KA 4YMIA 2OV4A 3TQIA 1G8GA 4YP7A 1JEEA 2E0IA 1YIAA 2BTEA 1NURA 1KQNA 1M83A 2YWBA 3X1MA 3CLSC 2CV1A 3U1VA 3P52A 4PY2A 5DB4A 4ZT6A 4DE5A 3AFHA 3ND7A 3IDFA 4ZT3A 4MWBA 3IOCA 1TYAE 4J76A 1M8PA 4MVXA 3L92A 3CLSD 3RBAA 1FFYA 5EKDA 2DUMA 3AIIA 5IHXA 1IQ0A 2AZXA 1GTSA 2IP1A 1Q11A 4MVYA 2CT8A 3RJZA 1R6TA 4JXZA 1OD6A 3QTBA 5DEOA 5KCMA 2DEUA 3JXEA 2AKEA 2PG3A 3A2KA 3N05A 3RFFA 4DDKA 3ZXIA 2A1UA 4U7JA 2H2AA 4NATA 1OWMA 2CFOA 4MUHA 3COVA 3SYTA 1KH2A 2QUJA 1JMVA 3RK1A 2X0KA 3CLUD 1TYDE 3CVVA 3QE4A 1NP7A 2YXNA 3UOWA 2DR2A 1O6BA 2O5RA 4GRIA 1J21A 1COZA 1O97D 3FIUA 4MVWA 5F23A 1F9AA 2QJFA 1M1ZA 5TEVA 1N78A 2J09A 1XJQA 1GN8A 3DLAA 4K0RA 1MB9A 2WQ7A 1DNPA 1OWOA 3IVGA 2YWCA 1EJ2A 1BS2A 4YBRA 5J5AA 4K03A 4CDMA 1EXDA 2A84A 1GZUA 1LI5A 3AKZA 2D54A 1TYCA 3ZJTA 1V8FA 2H29A 1MOPA 4QBTA 4EG8A 3A04A 3Q4GA 4S1OA 3UC5A 3TZEA 4MW1A 1YIDA 3INNA 1QU2A 1WY5A 3DV2A 3P0JA 2A4MA 3SEZA 3M5WA 3FY4A 1O94D 1T9GS 4Q93A 5LLTA 2E89A 5AHWA 4ZCPA 2PIDA 4NZPA 2EL7A 3UMVA 1EFVB 5KWVA 3AG6A 4R2LA 1YUNA 4JYZA 1VBKA 2QUIA 4ZCSA 3ZJVA 1N2JA 3MXTA 4QREA 3A4IA 2EJCA 2A88A 3SZGA 1O96A 4JFAA 3N9IA 1U7DA 2E21A 3D6VA 2CV2A 5FNZA 4KR6A 1RQGA 4RPIA 4ND6A 4XFDA 4EG1A 4MUFA 5JBNA 5IJXA 3VU8A 4QRDA 4H3SA 2X1MA 4R2MA 1I6LA 1NUUA 1N1DA 2JA2A 2PFSA 1LW7A 3FOCA 2GKSA 3IMGA 2BYTA 5J59A 5J58A 4CQNA 1T6YA 1OBCA 2QJOA 2X1LA 3IUEA 4MW4A 4EG4A 2OQ2A 2E18A 1O97C 3VRHA 1MRZA 3I05A 4MQ6A 2J07A 1H3FA 4KR7A 1PFWA 1WQ4A 2A86A 4Q16A 1KR2A 1KP2A 1U0BB 3GLVA 3HZRA 1UFVA 2XRZA 1N2GA 3F3MA 1N2EA 3AG5A 3GUZA 1KAMA 1S4MA 3ND5A 4MWEA 3CLRC 3AL0C 2V0GA 4MUGA 3OP1A 1H3EA 1VBMA 4CT0A 1QNFA 1IQRA 1OBHA 4GU5A 3TNJA 1J09A 1R6UA 1Q19A 1WXEA 4EG5A 5LM3A 3HGMA 4OUDB 1O0BA 4MUEA 1MB2A 4WSOA 2CYCA 5TEWA 3CR8A 2TS1A 1JIJA 1K97A 1M8GA 4UZFA 2ZUEA 2DPLA 3KT3A 4J75A 2A1TR 1NSYA 4KKVA 4XSVA 1JHDA 5H16A 1JZQA 1I2DA 1J1ZA 4YP6A 1Y42X 1TQ8A 3ZIUA 1OWPA 1U3CA 2D5BA 4G5YA 3NBAA 3FETA 2QTRA 1G8FA 3SDBA 3DPIA 4I6GA 3TZLA 1M8KA 1MAUA 3FNRA 4ZCQA 2CSXA 4EG7A 5HUJA 2AG6A 4MW5A 1XNJA 1H1TA 4MUKA 3IMCA 3FDXA 2IELA 4EFKA 4U8HA 1M8JA 3G59A 4KR9A 4DDMA
chains in the Genus database with same CATH superfamily
2H4XA 2WICA 3GRVA 2I0FA 4HB0A 2NZ2A 2QJTA 4M1KA 2VT7A 1P2DA 5I4BA 3H04A 2FW6A 4WEOA 1YQXA 2AI2A 3EISA 3RVDA 1P45A 1NMSA 2CXXA 5ESRA 4FHFA 4J3NA 1EXVA 2ZRHA 1PFUA 3QKUA 3DHYA 2FOLA 4KLCA 4UTNA 3VA7A 3O47A 1GV0A 3C3KA 4JJGA 3E35A 3FWZA 5D3MA 2QE6A 3QBDA 4GQBA 3ZS9A 1UIRA 2WJHA 5HKBA 1BJRE 5KSZA 2PIAA 2KPOA 3NOOA 2MR5A 1R27A 2XUDA 2Y92A 4M0KA 3M4YA 4JL5A 4OPMA 1ETUA 3AU8A 4U7WA 2AC4A 3A2MA 2RK3A 4UC0A 3LY8A 4Z9XA 4HAZA 1J5EB 1OIVA 4Y2QA 5HMLA 4ZHSA 1I36A 3QY0A 4B4DA 2ZI9A 3PYMA 3M3DA 3HNPA 1GU7A 3IVCA 5IN4A 3TIGA 2ZWIA 5ALEA 2JCXA 4BDTA 4CMIB 4CKCA 4AY6A 2QG4A 3F74A 1TF5A 3O1JC 1TMGE 5AYVA 5AW6A 1TQHA 5IAGA 5AO9A 1QIKA 3CF0A 1E1NA 1DKRA 4OIMA 1NPYA 2I2BA 5TJ9A 4DW8A 4CM4B 2CE7A 3A11A 1A2BA 3P9NA 4RDCA 1DINA 5ALLA 3PIRA 4X3PA 4Z4QA 3PNVA 4IOMA 5CVJA 2ZETA 4MKZA 3V80A 4C29A 1PJSA 1UPTA 2BKLA 1H4QA 4DLKA 3PGA1 3DBLB 2FWMX 2X0IA 2YWFA 3SC2B 5EIHA 3HL0A 3H0EA 3G5AA 1AXEA 2TECE 3ZGOA 1MC1A 4D7AA 2GPYA 4WZBB 1WL8A 2ZANA 4H6WA 1RYHA 4YLYA 2JAHA 3ICVA 1RI3A 4K6OA 5CXXA 3IP6A 3OUZA 4YRJA 4XYLA 3AY6A 1EDZA 4KAJA 2DM6A 3IS3A 3ILVA 4V2UA 5CIWA 4KIFA 5K0CA 2C4KA 3O7WA 1UDXA 5E6UA 2YWXA 1K2WA 1X1TA 1HDZA 1XTSA 2ZYUX 3MRVA 3IMEA 4JBWA 4CG2A 2Z43A 4EW6A 1C9YA 2RHJA 4F3YA 1QQAA 4JXXA 1L4LA 3X1WA 4LYEA 2MSNA 3STWA 2OFFA 4KK3A 4C76A 5CXQA 2QZJA 1UWCA 4JB0A 3V1UA 2BEVB 5DX1A 3CX7A 4OQXA 1QGOA 3DVRX 5E2IA 5BQPA 2W42A 1I6MA 3ROKA 1KVTA 4C2BA 2L0XA 4NZNA 3DE6X 3DDUA 4PE5B 1QFYA 1M67A 4XUEA 5K2OA 1KYQA 2WJ4A 5EE9A 2JJ1A 4K81B 3B5EA 2FWAA 3ESZA 2E5FA 1JDBB 4Q21A 4PLYA 3DCIA 2O8BB 3DE7X 2H5LA 1Y0BA 2J46A 2XCUA 4HGQA 4HL6A 3RS4A 3U3RA 2ZPTX 4N1AA 5KYYB 1VSUA 1G41A 4CCWA 4S1NA 5E2BA 4P31A 3G5LA 3KT8A 1FU4A 3T9EA 4CDNA 5G40A 4CM8A 1UM8A 3P9RA 3ZCTA 3LXRA 4FXOA 1E1DA 1FLVA 1YR2A 3LKDA 1PYOA 2CVFA 4HSGA 3B1KA 1VZ3A 1Z8DA 3CXRA 3H4MA 3FTCA 3MM4A 5DX8A 5IJAA 2H1VA 2R79A 2M2IA 2HIHA 1L6IA 2RI1A 4PTZA 2JCVA 4OBWA 3CLVA 1QWOA 3IKMB 2FX2A 3DTYA 3HBJA 1E1KA 3OY7A 1XJCA 3RC1A 3V7YA 1ZH2A 5BORA 5IX8A 5KYTA 2FF7A 1VLLA 1SUIA 4LIPD 4L74A 4TL7A 5T67A 3GDGA 3SJAA 3W5CA 4PNPA 2FFAA 1PP4A 3PPWA 4B1FA 5I45A 2H2HA 3EG9A 1Z0JA 4H9GA 5TVKA 1Q7TA 4L1KA 2Z57A 1R4MB 4D41A 2QG9A 2X0DA 2H2FA 1EGQA 1HT0A 3QPBA 2OK7A 2D8MA 2V0CA 1LNZA 4BZQA 1K4YA 1GA4A 5E6SA 1Q15A 5K0SA 3VR2A 2IS2A 2WNIA 3CF4G 4IWYA 1X2BA 4FZRA 1ULBA 1AGYA 2IHYA 3BMQB 5F78A 4WXYB 1J70A 4AQDA 3L1JA 1JPJA 3KKPA 1OROA 4UEJA 4UZEA 4N7JA 1E4EB 3HV2A 1YOVA 2VA8A 5AM4A 2YYZA 1PTJA 4PLFA 3D1LA 1UMCB 4UPEA 1T13A 1LWOA 3DTTA 2QPOA 1HG0A 2BJHA 3ITNA 3OT1B 3ZXXA 4F4UA 1MGPA 5IXJA 1P8JA 3Q3IA 4HPJB 2Z3ZA 1YGYA 5CFMA 1BVRA 2IPXA 3KZMA 4G0PA 4QBFA 1TZKA 1YRAA 4HNVA 1ODSA 1OAAA 2AYZA 2WF9A 3A9SA 2NQ8A 4BVFA 2DB3A 3LX8A 4BNYA 4NZYA 4WMLA 3FPKA 5LQKA 4PFKA 3KPJA 1F8FA 4AS1A 5CA0A 2PQMA 4AKIA 2R7MA 2UYYA 4BKMA 2HFKA 4Q39A 4YA6A 1DO8A 2GZDA 1KRXA 3A3YA 4AG6A 3M89A 5IT9A 1VMDA 4EUSA 1UC9A 2DBYA 2NO6A 1U3VA 4PNEA 5AJYA 3HCRA 1PR0A 3WVNA 1R10A 1YRYE 1V5GA 2JDIA 3L04A 5G0WA 3SSAA 4AWBA 3ZCPA 3B82A 1ESZA 3TSYA 4YRBA 5CFOA 1HDXA 2YX1A 1UL1X 2IEBA 1S8NA 4NG4A 1Z6AA 4OHVA 4YT8A 3T7DA 4ARAA 1JEYA 4PYQA 3OQPA 2RBGA 4R8KA 5GIPE 1H5QA 1EE9A 1MJHA 3PWSA 5TPWB 3UK0A 3VTZA 2R86A 5EAIA 3EG5A 4ZOBA 4IS3A 2IE8A 3LWDA 2FGJA 4XQGA 4J0GA 5ICSA 4HDSB 2BVNA 3A4LA 2B83A 3KYDB 4BVHA 4RFSA 3ANMA 2BGMA 2F3SA 1SELA 2TYSB 4ZOAA 2PYDA 4DJFC 1WCIB 2HQBA 4DCOA 1JTVA 1OBVA 4QHTA 1T6XA 4Y6PA 4C7KA 1AA6A 5HDBB 4WBNA 5BXYA 1FTQA 4CM9A 4NH4A 4GI1A 2JIZA 4LK2A 3UUGA 4PZYA 3W78A 3WR5A 5KMGA 1F8XA 3E70C 4Y2GA 1FCJA 2P2LA 2G8LA 1RPTA 4YDHB 3FFTA 5ADVA 3WMGA 2LIVA 1ZNYA 4RH1A 2XOKA 2DR3A 5JADA 1U1IA 1I0ZA 4UTOA 3D8BA 2WTMA 2AFRA 1KKUA 8MHTA 3LY7A 3FDZA 3KUUA 1H42A 3CZRA 2CL6X 1A72A 3IQXA 5EZYB 3BEDA 1I4TD 1IN7A 2A9OA 1L7VC 4G1FA 1PQWA 4EFNA 4J0JA 4YV7A 1YDGA 1R15A 2Q7XA 2TMDA 4M1MA 2UZ0A 4MS1B 4DAEA 1UR5A 1IATA 4YXFA 3KUDA 5BQ3A 2X5JO 4YRCA 1OXSC 1YRWA 3AKYA 1E9RA 2HWYA 1XWIA 3G6KA 3SM3A 4O1MA 1YFLA 3ZZTA 4R8VA 1FDUA 2FTKE 2NUAA 4DSNA 4TS4A 4XWKA 1R8SA 3LUPA 4E51A 2R6JA 2NO4A 2WUVA 4GPD1 5DB4A 4FHDA 4UREA 1CULC 1WKVA 3U4CA 3HR7A 5T3YA 1TW3A 2YV3A 5C5IA 1KBQA 2V97A 1ZD2P 1FQKA 5HKKA 2GCOA 1ISRA 1BD3A 1GZSA 1K6EA 2YN4A 5DNWA 3L92A 2C8VA 2XYGA 1JBQA 4WZAB 1NG1A 1IHPA 3HY3A 3IUYA 2B9EA 3CNOA 3UV3A 2IW1A 4YWJA 4FHCA 1PBNA 2GAIA 1JSLA 2RGNC 3BH6A 3DE1X 4YB8A 3JS5A 3W5BA 5B6JA 5DWDA 2BELA 2EBUA 1X80B 2JFVA 4D5GA 4MICA 4LTMA 1QONA 4WW0A 2FKNA 3PWZA 5BSKA 3QPCA 5EP2A 5F64A 5KNCA 5BSRA 1M0EA 2FI1A 4XDZA 3N05A 1EM8B 3DONA 3HXMA 1CSEE 3OWOA 5FR1A 3GFTA 2DHQA 3DUFB 4R5MA 1X7HA 3AV3A 3COVA 1RE0A 1UC8A 2GI4A 4DPMA 1KH2A 1KSFX 2ZR0A 2ESRA 3ADOA 3V8MA 1RXIA 3JYOA 1JQ3A 1TLLA 2OFOA 2XTNA 3CM0A 4MIKA 1P9WA 1ADYA 2RB5A 4IIDA 2BBSA 5CDFA 3T9BA 4NYJQ 5GJBA 3IXQA 3QG5A 1OXVA 1YJXA 1XZGA 4XYEA 2XHEA 1LUAA 2IX3A 3EDYA 1GWNA 5JLAA 3B36A 3PITA 2CLCX 4XWGA 1EFRA 4WZ6A 3NTVA 1CIJA 3UQZA 3I64A 4EPVA 1WU7A 1A98A 4NLLA 4OKSA 3EIEA 3RD5A 2HIMA 4CMEC 2OHGA 3GAFA 1DNPA 1WZUA 4Q3KA 4KXYA 4R1UA 2C9ZA 1SUWA 1X39A 2ZIXB 3CC8A 3BJMA 3MWJA 5A6SB 5IN5A 2OHFA 3AUYA 4DCPA 1Q3KA 1RXYA 1SMKA 2DH6A 3ANLA 4JU8A 4CHTA 4JH0A 2J6BA 5KNBH 1EFCA 1U31A 1W48A 2AMLA 1EXDA 1X92A 3DMHA 3RRYA 1TW2A 3PXBA 1IZYA 3H6GA 2Q28A 3CE9A 1E2PA 1XDSA 3KOMA 3LVFO 5BW6B 3G8AA 1WB4A 1GCAA 1JB9A 4QBTA 4S1OA 1C41A 3PTAA 2GA8A 3NEYA 2X76A 4IW3B 3INNA 1ZNXA 2PXAA 3HRIA 3K9GA 3S2SA 2B4AA 1KMCA 1FOEB 3IP8A 1SA0B 2Y76A 1Z7BA 4AB1A 1IK6A 2W6CX 1VMIA 2ZOSA 4PNZA 1R8JA 2HA6A 1AO3A 2R6HA 2X86A 4MAMA 4R9NA 4XRRA 4CU2A 2IYNA 3CX8A 1LDYA 2D1TA 2R8YA 3ZOKA 1M7GA 3KOYA 1PJ8A 2OCXA 4AJJA 5KWVA 1GDHA 1OIXA 2HPHA 3N6XA 4PCUA 4CR8A 2IEIA 3N8GA 3VV3A 5B58T 4OFZA 3UC9A 1GAQA 1T3HA 2XZDA 4GL4A 4DMLA 4UTRA 5LMUB 2PJUA 1FXSA 2WWTA 1NMEA 1YKGA 3QOFA 5HM8A 1OLXA 2ZRPA 4V0NA 3T99A 3WISA 4IYJA 4JLMA 2AEJA 4R68A 2BFEA 3T41A 1RZUA 3JALA 1HXHA 3IHTA 4PSAA 5E7JA 3GJRA 4AKHA 5C81A 2RGCA 2IYZA 4QPZA 4GWLA 4NBTA 3B2EA 1VGQA 3SK0A 1JDJA 3VR0A 1NG9A 3UICA 3CE6A 5BUZA 5IDXA 4Y18A 2OBLA 5JBNA 1XEWY 3ZJ4A 1ORDA 1RABA 2Z0MA 4CCYA 1CY2A 2QD3A 3KKKA 2PFSA 1U98A 4H59A 1ZLXA 1SZPA 1ZGGA 3TBHA 4C6TA 2AQIA 4QTYA 2BYTA 3HR4A 1PKEA 2BF4A 1XYYA 1Y8RA 2CXUA 2XUGA 4K86A 2WD8A 4E03A 2KWIA 3P9KA 1SBQA 2OVBA 4ZCMA 1XMPA 3IUEA 5K3EA 3HG7A 5I3ZA 2VF4X 2O4UX 5KHOC 1Y7HA 3WIEA 2WVJA 3E7PA 4CYMA 4G0MA 5DYTA 5ERXA 3I05A 4B75A 1PNVA 3CNBA 5CEEA 1C3VA 1R6VA 4FCTA 3DMPA 3ET5A 1ES9A 4J91A 4JYAB 2JBHA 4FJ0A 4GXNA 1FLNA 4TWZA 2YWEA 4S05A 1VJ1A 3NNSA 3HZRA 3O84A 4V0MA 3ZYZA 3LX6A 3FLMA 3Q6MA 1ZCAA 2CB9A 4REQA 2XB8A 3O4JA 1VMKA 3HKDA 4G97A 1Q12A 2CFSA 2FEOA 5HKKD 2Z6VA 3MJHA 1Q0HA 4UMFA 4LZNA 2GWRA 3PRYA 4ZRNA 5IJ0A 1QQBA 2GTIA 3JTMA 5BQ5A 3V33A 1CE8A 2FSVC 4UDYX 3IQZA 2C5AA 3B3QA 3OHMA 2X7XA 5A03A 2G28A 2PH5A 4N7BA 4Q3NA 4AUMA 4NNJA 3I73A 4AJPA 3BREA 5ICMA 3SVZA 3W2GA 5D1NA 3ROFA 521PA 3CRW1 3NHMA 5LU9A 1VSBA 1P91A 4B3BA 2CYCA 1N8NA 2C0CA 5I8ZA 3T1NA 3BD7A 4P92A 4QEKA 3HJCA 4QXOA 4UNPA 4BVJA 2DBZA 3QPWA 1ZMXA 1NHWA 2FSPA 4UTVA 1YXMA 2BKXA 3B52X 4IF6A 4B71A 3MSCA 2PGLA 4PZDA 3DPUA 2F48A 3GJSA 4OBXA 1HSZA 2QX4A 1UZAA 1BE6A 3K6RA 3Q6IA 1U7TA 2B82A 5ALJA 4OHMA 4UAGA 1RI2A 2Q3EA 2VTDA 2WFAA 2Q5CA 2NTYC 1LSUA 1JYFA 2QG6A 3EX7C 2JBWA 2WHXA 4JI3B 1QYVA 4DR6B 3LQRA 3VR4D 3TZLA 4R1NA 3OKPA 3DD5A 3OIWA 4O4JF 3X1ZA 3AR4A 5HUJA 4LWZA 2AG6A 3E2PA 3I2HA 1BMQA 4EW1A 4U8HA 4S12A 1QLWA 4H35A 3D3JA 4LV8B 4O6VA 2O2JA 2AK3A 2OBYA 4I1UA 4YMGA 3U3JA 3PLNA 4W9MC 2DUNA 3N87A 1C9NA 3UFXB 1CUAA 5KAMA 4OBEA 4CEJB 4X92A 1M75A 2QX7A 4NQZA 4DPLA 1CIVA 4JLJA 3N2LA 3QSGA 2J7KA 2RDMA 2QTVA 1XMIA 2XQKA 1KJQA 3H83A 4ZQEA 3UWSA 1HMYA 1MAAA 2AOUA 3QZUA 1HO3A 3IE0A 3G5TA 3O2QB 3GNLA 1NM5A 1DTSA 1Z39A 2YBDA 3MGKA 3S8YA 2DQYA 1OW3B 3R5XA 1P39A 2GBFA 4HWGA 1ZOSA 2CYBA 3QFSA 4Z6KA 4PPNA 5BMVA 4OGWA 2ODWA 5ADWA 1Q20A 4R51A 1KNXA 1X1EA 1DKUA 1TKAA 2FG5A 5JRDS 1ABBA 1ORTA 5DP1A 5DLPA 1TCCA 3QUBA 2NMVA 2VJMA 2E6KA 4II7A 2J08A 1OWLA 1SY7A 5HCIA 5LOVA 4F6RB 3OZWA 3RT9A 2HEIA 4ZIRB 1YB4A 4JEHA 3BWXA 4RJJA 4EEKA 2QVLA 3PXUA 1XAJA 3NUGA 4M60A 2C7GA 4Z7JA 3R3VA 5L4SA 3QNWA 4UNSA 4GP9A 1X7ZA 3D5TA 3F6CA 2DETA 4D82A 4Z3KA 4CKWA 1E3WB 1O96B 1PJBA 4YUAA 3RC8A 4EKGA 1MX9A 3RQSA 5TMBA 2UU9B 1CVRA 4F3RA 5ARDA 3RVPA 3TLXA 4EJ0A 1OTXA 3OZ7A 3ZV5A 2J31A 5G02A 3NTXA 1XQWA 1BKYA 3LT0A 4I6EA 1KIMA 1QGDA 3ZQJA 4K6MA 4A0GA 1YI8A 4G5QA 5LC1A 4TYYA 1SQGA 4MVJP 3SNKA 2JVIA 3ER8A 1HH4A 3P8ZA 1V6AA 3WYEA 2LNDA 4D9FA 2GPTA 2PUDA 2GCIA 1VJ5A 2N9UA 3AIMA 3WGLA 4NENB 2OBBA 2X8JA 2GUWA 3MILA 4KXFB 5DTEA 4YN3A 1JFLA 1CQZA 5ECYA 3WKCA 3C98A 4MQFB 3SBXA 1R0LA 3ZLBA 5FWNA 1FVHA 2IPAB 4MA4A 4O2AB 1I4OA 5JAUA 1KIAA 3QVOA 4I8IA 1ZH6A 5AKKA 3TVYA 1AQIA 1XCBA 4IGKA 3IUBA 4MGEA 3HCBA 1ESEA 2G07A 3SBEA 4BUJA 5JZOA 1YZYA 1FP7A 1TJPB 1LZKA 1HWYA 3A26A 3CUEF 3PFKA 3KJNA 4RDIA 4DARA 4HNRA 5DYYA 1XA3A 2KHZA 1NI5A 5ARCA 4URHA 3U7QB 3I61A 3LPCA 1GNTA 4X41A 4D5EA 1ULHA 2PGOA 3LH5A 1H8HA 1UAAA 1L8XA 3PF9A 3KYCA 1XCOA 4XI9A 4QDKA 3K0FA 3REFA 3UMBA 2XDWA 2XGOA 3UAOA 4CF5A 4RF3A 5BYKA 1AQYA 4E5DA 4F97A 3PQ3A 1G7SA 2FEPA 2I4OA 2IPMA 2IUEA 2RHOA 4KH1A 3G82C 1DDOA 2QVGA 4FOLA 4L07A 1AKWA 3P2EA 3W8DA 3Q8LA 2YY6A 1ZR2A 3AOEA 4HGOA 3IRVA 2B1RA 3BMOB 3TQTA 4PLHA 4EO4A 5JARA 5COBA 3HU5A 4X63A 2EX4A 4O2BB 4A15A 1Z16A 1J00A 2PA0A 4MOWA 4PYIA 5H80A 3LHIA 4N40A 2M6LA 5DT2A 3BDVA 4J43A 4Y9RA 1SQSA 4D99A 2D3TA 1P2FA 1YUMA 4YJGB 4IILA 3U7IA 2AE2A 2F17A 1KZHA 2XT9A 3P9IA 4PTYA 2C00A 3ZE2B 3LZCA 3ND8A 1CJCA 3OZCA 4N5LA 5I9BA 1LPBB 3ZIAD 5F1PA 4LGCA 4YT2A 1ULSA 3CRMA 4PM4A 5EHNA 1JHAA 3U7FB 3AOEC 4WKGA 5KC8A 4GX5A 1IUKA 3SKVA 2ZRQA 2LD4A 4YJ3B 5E6UB 3HK2A 3EPRA 4IIJA 1SC4A 4HG2A 4NBSA 5AK0A 1V95A 4LBYA 5K8TA 3ERCA 1JG3A 4M1WA 3W6PA 1GRRA 2PX8A 1SG0A 2JGKA 3AEKB 2UVPA 3I3SR 1K3UB 3T7AA 4URVR 3OZEA 2J9GA 3HB7A 4FW8A 1E58A 1IVYA 1W2GA 1NN0A 4IKOA 1Q95A 2XMPA 4MR7B 1J49A 5A9TA 4WD3A 2BJWA 2QRLA 3AF0A 5AHKA 3PGKA 2I80A 1NZJA 3ROXA 5KX5A 2R2AA 2Q5JA 2WP8J 3BSYA 1YRQA 2X3FA 3CURA 3HCDA 4JYBA 4YFYA 5HE8A 4ND8A 5F73A 5FWAA 2DSNA 3CEAA 4J0FA 1LLCA 2ZVJA 3AEYA 2PT7A 5AKLA 3UK7A 3USCS 3HSYA 3UXMA 1EWTA 5J23A 4QM6A 1J9EA 1BEEA 1JR3A 2XMZA 1U99A 5LXTB 1MC8A 2FQXA 1W96A 2ZSAA 3H5TA 4DSOA 3NP9A 1RDFA 1RXEA 5KC9A 3ZNOA 1ZSYA 5DTQA 1E59A 3ZZ0A 2AD5A 2ODEA 4Q4LA 3CG4A 4DGSA 5AVOA 3R7WB 1WCYA 4J4TA 4HUQB 3F5QA 1BGWA 5ECDA 3T94A 2A0XA 4OUKX 2JVJA 2A7QA 4YAOA 3H5OA 3MGAA 5LOVF 3T38A 4B3RB 4H7JA 4R6XA 1FK8A 1NF8A 3PE4A 4EMBA 2PZBA 1JFTA 4ZTZB 2J87A 3ORYA 2X0JA 1E2KA 4MW6A 5E8JA 1PK7A 3OFKA 4A9AA 1D07A 3EOZA 3R1IA 3TLBA 4FR2A 4RZ2A 4A8TA 1OZHA 5HUQA 1LBHA 221PA 4KHPB 4LZLA 1NRWA 4KJXA 2YIJA 4LXYA 3FMPB 2JW5A 4IMRA 1VJ0A 4JIMA 1FMLA 5EJEA 4JZKA 1L7NA 1P3JA 1W85B 2VZ0A 4E2XA 4RCYA 2PKXA 4HVCA 2C92A 4B6JA 3HHEA 1K7CA 1EJ6A 4PGMA 3VYVA 4XB2A 3WLPA 1J07A 1H2XA 3DZJA 3WGTA 3V7WA 4HEA1 4HFNA 1UMCA 1MEOA 3ZWAA 4L8FA 1VYTA 2X7JA 4RF5A 1VPVA 3GJ4A 4U2EA 2AXPA 3W79A 4M99A 1C3EA 4PEVA 4QASA 2CMDA 1OYVA 3TFOA 4GX2A 2PAAA 2FMHA 4HNAB 2A0WA 2FYTA 2J3JA 2Q6IA 4NI5A 3C8MA 4F4HA 1ZN2A 4F91B 4UUNA 5KTNA 4E22A 2SKCA 2IEGA 4HMQA 1M2KA 1SBNE 3DOCA 5CLIA 4J9VA 4DQKA 4DSUA 4I5EA 4GI5A 1Y98A 2QJRA 3EJ6A 3OWHA 3CRQA 3R6DA 4CE6A 3DKVA 4HLUA 3DHNA 1JFFB 1QGUA 4JJKA 3VPGA 1MB4A 4RE6A 5BYJA 2Z2ZA 3JVIA 4KH0A 4UCFA 3RRFA 3COPA 3OLQA 1G8GA 5G2OA 4BFZA 3JZAA 3QEMA 5FJIA 3QVSA 3K09A 1EB9A 1EQ2A 2OD2A 2NVOA 3GB9A 5DHPA 4KPGA 1IBSA 4GZMA 1SCUB 4QC2A 3U81A 3JQ7A 1F06A 4UPVA 2W4QA 3GEGA 1JEYB 5KYYA 3K8ZA 3L0SA 4I9NA 4TLDA 4RSGA 4AG3A 2H6EA 3SOPA 1AQUA 5D87A 4CQLB 3P19A 1XUOA 4FFWA 1NW3A 2UZ3A 2VUUA 3D0OA 3Q7TA 3ZPXA 3GCZA 4DQDA 4MDFA 3IOCA 2VP0A 3KAQA 1POXA 4C5AA 1KJYA 4XJSA 4YRNA 5E9QA 5ITVA 1CR6A 2P5UA 3ZJ5A 5KNLA 4UTXA 1VJDA 5BOVA 3GGOA 2ZRJA 1O57A 1R0CA 2HA5A 3SXJA 3OIUA 3ZHZA 2CHQA 1WW2A 4BIMA 3V2GA 3GLIE 2LCQA 1IDOA 2GRAA 2F1IA 3QY9A 4UUBA 1N0WA 1LTKA 3SQNA 2GYUA 1IQ0A 1Q11A 3OIVA 3RJZA 1MAVA 2W83A 3JY6A 3ZH2A 1XE3A 4I4NA 3QK7A 4A8PA 2J8ZA 4TUYA 1MJFA 2Q4BA 4CQJA 2XWJI 4M9ZA 4UVGA 5HK8A 4BJ3A 2XKAA 4ENTA 1R88A 2NOAA 4NRDA 3T5PA 4N0DA 2Q3JA 4UBKA 4M21A 2OQIA 3T3HA 4CM9D 4JK3A 3AHDA 1TAQA 3PUXA 4KO2S 1N5JA 2IKQA 2KBFA 1ND5A 3A9UA 3B2NA 4IR7A 4D4HA 3ICQB 2MT9A 5FHQA 4YCDA 3K73O 3UJPA 1TYDE 4BIIA 3ND9A 5DNYB 3CVVA 5EUCA 4B2YA 1CRPA 2IZ5A 1ZGJA 3WGZA 3HB1A 2YV1A 3OC6A 4MVWA 4ARZA 1Y9AA 4ZVLA 4KWTA 2CXPA 5REQA 3JWPA 4XVCA 3STHA 5C53B 3BIFA 3NHPA 2J9FA 4L72A 5COQA 1E7YA 4NOKA 3VBCA 3GJ7A 1Q17A 2O2DA 4HXYA 4MRAA 3UCFA 2B9VA 5K20A 1ODJA 1KK3A 1XVVA 3DT6A 3PDUA 2AFIA 3NUZA 3R5HA 2HMYB 4JUFA 2NXCA 4D8TA 3D7SA 4QSHA 3BAZA 3KUKA 2EGUA 4ZVRA 2OHVA 3CGWA 3SYKA 2L18A 4ETMA 3NTUA 4EJMA 1NYTA 1C2TA 1P3Y1 1W8DA 4X3OA 3VJMA 1CG6A 2D54A 2H9YA 3D8HA 4CIBA 3FGOA 3JCZA 3E6AA 1U5CA 1MOPA 2Z9BA 2ZPAA 5HF9A 3ZQ4A 3K70B 1AQLA 3T5BA 3DF7A 1Y6QA 4Q9LA 3GEPA 3OPYB 4DA7A 3L4SO 3LVBA 3UWMA 5IDQA 1C8KA 1X80A 3ZWWA 1WVIA 4P4GA 1QVVA 2EJUA 1WUKS 3VU0A 3BPSA 5LLTA 3U1TA 2WT9A 4KXWA 2PS3A 1RRKA 2F3TA 3I9JA 4L3OA 2NZYA 4FFBB 4D3FA 4OHUA 5CB4B 2HRDA 3G17A 4HXFB 2WZQA 5JD4A 2XODA 1GGMA 1EVQA 3QEAZ 2WINI 4LXGA 5M7EA 2VDWB 4BKRA 3HNOA 3NKLA 5JH7F 2LPMA 1FYFA 1HLPA 1LBQA 2F3QA 3OUTA 2W6OA 3Q11A 4NOJA 5FTNA 2FJ0A 1X8LA 3ZTWA 4ZCSA 1BG6A 2NV0A 1DC5A 1L4FA 1U7ZA 5KMGB 1LU9A 1XDZA 1GFWA 2CHUA 2JVKA 2RGDA 4NMHA 3ZCXA 3MOGA 1LX6A 2DPGA 3O8OB 5FL7A 3WOVA 2J3MA 4U6SA 1N57A 1XEWX 2GZAA 4GT1A 2DKNA 5CJPA 5SY9A 5JXWA 2KX7A 2V4ZA 2E21A 1RLTA 3BH7A 3D6VA 4ZO8A 3HA3A 3PPIA 1NV8A 3P2IA 4IF4A 1MOQA 1PEKE 1QLJA 1P9LA 2ECFA 4MUFA 1TM4E 3V46A 4FMPA 2NYUA 4TSFA 2QBYB 2GR9A 3WIDA 2IU6A 4IP0A 2YFKA 2IT1A 4IWNA 4Y1GA 3SF8B 4D56A 4HWSA 2GX6A 3CKLA 4HSEA 2XEXA 3KCQA 5DXFA 4LHZA 3OQ6A 4O4IF 4PHGA 3GLGA 4JKIA 4DA4A 4F0JA 1ZCJA 3U37A 2CJFA 1M74A 1ULUA 5KOHA 1CJUC 4W6QA 3WYNA 5B4TA 1U3TA 5BQOA 1YB5A 1J56A 5HS4A 4N03A 1K89A 3WB0A 4CG0A 4J03A 2MOKA 3MHPA 3OJOA 4YNBA 4LISA 2HAEA 5BR8B 3PHBE 3U56A 2F3UA 4JUDX 4E21A 1WU8A 1KJWA 1PJTA 3KSDO 3NP7A 4PVDA 2A86A 1OX4B 1V1RA 5EEHA 5IW8A 3HZZA 1U81A 3HP7A 1XTQA 1LLFA 2AV6A 2C0QA 4EGFA 1T5SA 1ZAKA 2DT8A 3RNLA 1ZAYA 4M36A 4OV6B 2I33A 2OILA 3ZGYA 2BRUC 3ZW9A 5JPCA 1KZ1A 2YWJA 3AL0C 1XWFA 2OXTA 1EIWA 4QAJA 4LMBA 1H3EA 4AO6A 1SO8A 3CINA 3GXOA 1G2QA 2O20A 5DOVA 3QVLA 3DOFA 5KUTA 1Q19A 4XASA 2JGEA 2H2GA 3IELA 4OHCA 4NZMA 1T3SA 2O3RA 3PT9A 2O1SA 5JXIA 2CKMA 2C03A 5TQJA 5L8VA 2RKOA 2QLNA 4TTSA 3QIAA 4RZUA 1G20B 5DIZA 1JBKA 1ECFA 3KJQA 2XCSB 4BFWA 2ZWAA 3OQMA 2G9QA 1JL3A 4FQ5A 2A1TR 1G3RA 4DR5B 2WEKA 1HC7A 4R83A 2FXIA 3FZYA 3Q3JB 4MKIA 2IITA 1ATZA 1EJ0A 2E4YA 3RF6A 2GCPA 5IKPA 2GJ4A 2H00A 1KKMA 4RY9A 5LP1A 3A1DA 1ZZGA 2JAWA 2D5AA 1UK7A 3N6RA 4AY3A 1I1OA 4KEAA 1D1SA 3C8HA 3IT0A 1B8UA 3RIEA 1UBRS 2F1OA 3IQIX 1E2BA 3ST7A 2OOKA 3KXIA 3OJCA 2ZBPA 1KFEB 4Q24A 4B4VA 4DFDA 1QF6A 3H9JA 3AIOA 4GPBA 1AXRA 2NSJA 3RJMA 5AI8A 1D5WA 2W4IA 1TAGA 4ALJA 3WAGA 1XCLA 2B37A 2V7VA 4F2DA 3WYCA 2R2GA 1LTQA 1TMYA 3B1XA 3RO7A 5FX2A 2FSFA 3GROA 3CISA 3DAPA 4U7DA 1NR1A 3G59A 2PX3A 2PUFA 4RHYA 4BXOA 1PIWA 2PQ6A 4F4JA 4YCMA 4EHDA 1GN9A 5E95A 1ZBDA 3D1VA 5JVDA 1HPLA 3IOYA 2C7VA 2QVXX 5HKLA 2ANCA 3DO6A 4O4JB 2GDZA 2ZR9A 3DEAA 1C9EA 1H2EA 3SZ3A 2VXCA 3I76A 5FNVA 1YWGO 3WQBA 3SSOA 2HNAA 3T6KA 1E3QA 2NU9A 3K4HA 2VRBA 1XTZA 3CCBA 4N3CA 3CU5A 2ERYA 1AKMA 4N0QA 1BU5A 1PJAA 1WHTA 1KH1A 4ICIA 3UJCA 3TI7A 3TUJC 2HMSA 2I6FA 2WIFA 4ZDWA 4KTTE 4L73A 4V0QA 1Y1PA 2RHMA 4NV3A 4RIIA 1O5TA 2BP7A 5BSUA 4NYMR 4ENQA 5K0TA 1KOFA 3BKXA 1XNQB 1DIOB 4CCSA 1F0PA 3JZFA 2PCJA 1OZFA 4H0CA 5DGXA 1YJ8A 1XMXA 4DC9A 1CY0A 4IHJA 4UUMA 5I6DA 4DOMA 1HTTA 2CWWA 1G8HA 1LLUA 1TT5B 3HR8A 4MW0A 1F3LA 3ONDA 3EIXA 3QBTA 1Z62A 4KXUA 4TMZA 4QODA 5DO9A 3RVOA 1EVEA 4GOMD 1P18A 1HDRA 1TK9A 1UWKA 2CYAA 5B30A 5EMLA 4UM7A 1X38A 3D59A 2BGWA 1MRSA 3L8CA 4U00A 1YBHA 2CXRA 3EEBA 3RREA 1W88A 5I7EA 2BUBA 5GOZA 5L6LB 4AUKA 3DZBA 2I66A 5EA2A 4LDNA 4NCAA 4JP1A 1USKA 4FW9A 4P5EA 5AWFC 2XECA 3HM9A 5H3HA 4CEHA 1FRFS 3TL3A 1WV1A 1C29B 1OASA 3PXGA 4EF6A 2D4HA 3F73A 4PO8A 3GEBA 1HDEA 2F9LA 1YKSA 3TINA 3K70D 3WV5A 4F5WA 1NJSA 1X7WA 1PV1A 4NCXA 4OJNA 3DE4X 4JJAA 2ZBEA 3LRPA 5G0SA 5AW4A 4B44A 2VHYA 3W8EA 3IILA 4Y6GB 3K0AB 1RJDA 4UDNA 4J1SA 1I4DD 4QLAA 5G1PA 1MX3A 2RCNA 4G8CA 4ONEA 2X0FA 3L7NA 5CEFA 3EUAA 4FI3F 4Q05A 3PQ4A 5JSZB 1Z6QA 3A28A 4D3XA 4FU0A 3EY9A 3IOBA 2C20A 3NNNA 4UQLA 3RUFA 1SCKA 1KERA 3CLTD 5F3DA 4EVRA 5KVCA 3A1FA 3M1LA 3HCEA 4LTDA 3FFBA 2QU7A 2B99A 1F7UA 3AWDA 1IN6A 3PGMA 2HF8A 3HP1A 4A6PA 4R0MA 3NHAA 2P4EA 1PVOA 3DL0A 4MQ4A 1AD2A 2B2XA 3T3NA 1BA3A 1FS6A 2Z08A 4G67A 4PU0A 4DC1A 5ALSA 3Q9LA 5J2UB 4YJ2B 5IEBA 4R1QA 1S6YA 1AKEA 1HDYA 1Y1TA 4MRMB 4YRPA 4URUR 2P9GA 4Q4JB 1XQVA 1CUWA 1O4WA 3RH0A 3LO5A 4OL9A 3KFXA 3RFCA 2QP9X 1R16A 3PV0A 1DARA 1NUPA 1B7GO 1KVSA 4HFJA 3S81A 3TZ6A 1U0EA 3UXYA 3ZWOA 1T5DX 2Q1WA 3K9CA 4EH1A 4UE3S 1A9XA 1PQYA 1ZH0A 4V03A 1QJ4A 1T4MA 1ZG3A 2DULA 5IVDA 4PG8A 4BMDA 2GZ1A 3U17A 2QZZA 4QJBA 3ZHUA 3ELWA 1D2CA 4LRTB 3ZLTA 2HW8A 1X9GA 5K8JB 1U9ZA 1GTG1 4JWKA 2NSYA 4JJEA 2A7XA 4TYQA 4DS3A 1Z25A 3CUWA 1L8LA 2H7YA 3PD0A 3I23A 1FW6A 5A3RA 1AKNA 1U8UA 3DULA 1EP3B 3PXDA 3B12A 3KDPA 2WIGA 3L43A 3NT2A 1MV8A 1UK8A 2AFVA 2PBZA 1QYDA 4X8MA 3SSMA 4K8OA 3WHPA 3BCRA 1XELA 1KRHA 1ZK2A 1ZMRA 3C7KA 4TRRA 4WUTA 3EFOB 3GFVA 3OZAA 4KQIA 3UANA 2ZRLA 3IPCA 2C98A 1C3OB 3HKEB 3U3KA 1F3OA 2GHTA 3KR1A 3K1AB 3PNQA 4W1PA 4DQUA 1MHPA 1U8YA 3AJ8A 3ABZA 2WMNB 1JSRA 3WC4A 3V8EA 4DTIA 1E9CA 4HAVA 4PAGA 4N39A 1DKQA 2QP4A 3GLHE 4ZVOA 3LIIA 3FNIA 3F2IA 5HRCA 3O82A 1QXSA 1JH8A 3T9AA 2BBOA 4ZP1A 2RD2A 1Q7GA 3A32A 3ZK7A 5BR4A 3CB4A 1EP2B 4TMFA 3J80A 4MIEA 4F4FA 1EXNA 1FZTA 2GM5A 1AUOA 5FUVA 4YMVA 3PVCA 2FWIA 2RHGB 3WZLA 4Q48A 2V54A 2DFDA 4MZXA 2PR7A 1N2SA 2F2TA 3I8OA 3CY6A 3KSAC 4FTWA 1REQA 1MVOA 1P4AA 3G9TA 2RAFA 5AK4A 2F4NA 5I7VA 5DE3A 2GBIA 3ZKAA 2O8CA 1ODIA 2I8AA 2B1GA 2ADFA 4PAOA 4QPJC 2FRVA 4PRLA 4N5MA 1YQUA 2FW7A 3F8SA 4OH7A 4QU5A 3WGJA 1QPZA 3QNUA 3WLKX 4R69A 4DR3B 4QOHA 4CKYA 1N5MA 1Y4AE 2AJLI 2YN2A 3CT4A 4A7PA 4B7CA 4QPNA 2BY4A 5FOTA 2YFYA 2UUPA 3GPCA 4JYMA 4FNOA 4F6RA 1G21B 1VBNA 2NUPA 3CW8X 4OQPA 5E0OA 3ULKA 5KQMA 2JARA 4DMMA 5DLEA 1FUIA 1U0NA 3AJRA 5JRJA 2G77B 3FCEA 4TXMA 4IFBA 2OMKA 1YSCA 1IH8A 5TR9A 3AFNA 2Z9DA 1F0NA 4I4TA 5CFZA 1KOGA 3HDQA 4GUAA 4KE8A 5AOBA 2G9VA 1CIPA 1UPFA 2D5IA 2PX2A 3T7TA 4YPFA 3UGJA 3F67A 3R41A 1CQWA 1E79A 1QKIA 2Y4OA 3ECSA 3ABOB 3BCHA 3H99A 3SLRA 1SN7A 4C08A 1C7ZA 3RE1A 2VK2A 1SG6A 5GONF 2F8SA 4E09A 1EU1A 1I10A 2IP4A 1G8JA 3DPSA 1H94A 1M2NA 4HDNA 5HR5A 5HZGA 1SWWA 1Y7IA 2VEOA 2HDWA 2AL7A 2RMKA 2YJ5A 1AKTA 3PDIA 2VYND 4NNOA 4PINA 3E1GA 2WJYA 3TR6A 1Q92A 3SDSA 1BW9B 5B7PA 5HP4A 3KQHA 4ROTA 5LVAA 3EEOA 3I01A 1QIGA 1JAXA 2WW8A 2ZQ5A 1N6IA 3C6YA 1WUYA 2QXTA 2DRIA 5KDLA 1XXHB 5DCLA 3UAVA 3WB9A 4QOIA 3U4MA 4R8LA 3N75A 3MIIA 5AXBA 1A95A 1UKAA 3HYCA 5I7SA 3HFJA 4RK1A 3ZU6A 4BMSA 1Y5NA 2Y8EA 4NBUA 4RSRA 4YJHB 1QP7A 2DFKB 3KBBA 4WK6A 2ZZMA 3R9XA 3WYBA 4GZ6A 2QRPA 2B36A 4QDZA 1SIWA 2D7JA 2QLMA 1I33A 2O0KA 4G26A 4PONA 1JMYA 1NDQA 2CLMB 2XA1A 5DXAA 4W5QA 4Q1VA 3HI4A 2A58A 4QELA 4YQYA 4KVFA 3NM4A 1HURA 1YQEA 2J48A 1TB4A 3ZU4A 6REQB 4DE5A 2QYTA 3A1TA 1EUDA 1QO0A 2DT5A 3L6CA 5JTUA 2ZJ2A 2XB9A 2OUKA 4IHJF 3QHPA 5EQTA 1RRVA 2OV2A 2RJNA 1E3LA 3FPAA 2YOHA 5JNTA 2RH9B 4WBNF 2Q0HA 3P9ZA 1PWZA 2V5VA 3TK1A 2WT8A 5B3AA 4C04A 5IJ9A 4AKGA 1JYSA 5D01A 4L6CA 2ASVA 3S44A 4EAQA 1IC6A 1IWBB 1ICIA 3VO2A 2DUMA 1FJGB 1DUVG 4K3VA 1QR2A 5JV5A 1RYNA 4QQFA 3V3TA 3IO3A 4FDLA 3RAFC 4HB3A 1Q1GA 5BN3B 1RIFA 1ZWKA 1PT5A 1T9CA 3HKCB 3ZHYA 3VZDA 4WJKB 4BY9E 3X0DA 3OZDA 3A2NA 4K9KA 1T2VA 4E5PA 1LWNA 4IIJB 2AKAB 2BFWA 3LQQA 5CYFA 3CX6A 3MWEA 1EAMA 3C6BA 1HLGA 1PW5A 3B1ZA 3CZAA 4JNKA 1C50A 1JDZA 2CZQA 2VYQA 3C1AA 4Y2VA 4LZZA 5IF9A 2B3TA 2CFOA 2J3KA 4MUHA 1ENOA 3ZVLA 5DYGA 4YHHB 2LKCA 3LK6A 3KELA 3FCOA 1UBTS 3ILXA 1NJ2A 4HLNA 2H3HA 3CLUD 4E08A 3JD4A 1NRXA 1XF1A 3GJQA 4M9CA 4S0XA 4UULA 2ZT7A 1JFSA 1AF7A 4PPYA 4IPTA 2DR2A 1AJEA 1HM5A 3R8FA 2HU7A 3CKKA 3TPCA 3I9NA 1DOAA 4DBLC 1A1VA 1KS2A 1T4CB 1HA3A 2NQ2C 4M0EA 1MHTA 1ZC3A 3V5NA 3SNHA 3PXCX 3AHIA 1E9BA 4INZA 3A1UA 1MIHA 4CG1A 3ZI0A 1N1EA 2MHCA 3OJWA 2C61A 4HDRB 4RVSA 3OG9A 4V39A 2AUTA 3BJIC 4AY4A 1VP9A 4L85A 4PVCA 1D9ZA 1NXPA 1UMBA 4JVNA 1OB5A 3LHFA 4RMIA 4OK5A 2A84A 1Y4SA 1AVTA 1LI5A 4NFHA 5ETJA 1G6KA 2WOOA 5ELLA 5BW5A 1ZVKA 3GJZA 1VIDA 3EXG1 1BHSA 3AX6A 3OPMA 1PWHA 1WSBA 2JFHA 3SC4A 1V35A 2B0JA 3G2KA 1G16A 3A4YA 2GYYA 2DSTA 3NIFB 4TKLA 5E4YA 4BFTA 2EHDA 4B79A 2W6PA 4MWOA 5CDYA 1E5XA 3U5ZB 1R7RA 3QWBA 4PZPA 3CHYA 4OGKA 4R01A 4INAA 2XYVA 1WTAA 2GCGA 2E89A 4TQGA 1BQ4A 4TUYB 3ON5A 3M1YA 3UA4A 4DCJA 3QU9A 2BCEA 4A0RA 4BNLA 2OLKA 1I01A 3EHEA 1KMMA 1ODCA 1P29A 4R98A 1HF3A 2VJKA 3THRA 4IJQA 2J0EA 3NC4A 1SVLA 5KQLA 4RVCA 5COAA 4UEKA 3L9WA 1W0CA 1E2DA 1UBFA 1N33B 5K51A 4RFLA 1SGWA 1USUA 5LP6A 2XTZA 3S1AB 1NR7A 2EERA 4ZDJA 1Y82A 3PUWA 2OO3A 2PD6A 2H65A 4XDYA 4FWBA 2I3GA 1UDWA 3QFTA 2J0QA 2F8TA 1VI6A 1HEYA 3FZQA 1U7DA 3DXZA 1ZITA 5C52B 3I9LA 3OX3A 4HNGA 4BFCA 1K08A 4F92B 4UBMA 5E6RB 3SIXA 4KITB 4G1EB 1UXIA 1T4BA 4CM7A 4EQ6A 5IXSA 3VU8A 2BKAA 3IJPA 1ISSA 4GEGA 2IYSA 3P4UA 2VYCA 1NUUA 2JIDA 2V5UA 1E7MA 2XMBA 4MZDA 5FFFA 4G36A 2JA2A 3D7RA 3O8BA 1LW7A 1XZQA 2H4WA 1N32B 3MMNA 4PPFA 3T1TA 4CEIA 2ERXA 4F8JA 3OCZA 1YNOA 5CX4A 3HEMA 1X7DA 1W73A 3BTOA 3UGTA 1B42A 1E3TA 3DT9A 1BVUA 3OOJA 5EINA 4G5RA 2VAXA 3RTEA 1YZLA 1UQRA 3C6ZA 4P7GA 2F64A 1NVGA 2J9RA 3N76A 3ONWA 1B43A 1KETA 1V9CA 1DMRA 1WZCA 4HQRA 1OR8A 2YOFA 3ONVA 4URWR 4NXMB 3P7MA 2FVXA 1JQAA 4DGQA 2Q07A 3SDZA 4Z1MD 4KR7A 1VG0B 4BZPA 5YASA 5F98A 4GKJB 2I9PA 1BX1A 2O2YA 5FTLA 2CUKA 5B3KA 2JIPA 1S9HA 4X91A 5GZ1A 5EJ9A 5GQSA 3DE2X 3MGBA 1U2DC 4G09A 3GA5A 3GUZA 3ND5A 4EQZA 3O3MB 2ZI6A 2RHHA 2AOWA 2B2CA 5C80A 3WE7A 4UAUA 3BFPA 3RNOA 2FRXA 5K6AC 1JH9A 4F5YA 2UZAA 3CH5A 2IU4A 4CT0A 2XDAA 1OX6A 3L4BA 5LMCA 1JHUA 5DGTA 4ZU6X 2CNBA 3CJRA 3M1IA 2Q7OE 5IJWA 5IZCC 3QFCA 3T95A 3GQBA 3NPAA 2HO5A 3UMSA 1JKMA 8ABPA 1M1NB 3DOIA 2H2IA 2QDKA 5JNWA 1I7NA 2WWFA 3WL7A 4LK3A 5TEWA 1QP0A 4RD1A 4IQFA 3E9RA 1WO8A 1O9BA 4MTCA 6LDHA 5EYPA 1SWVA 3KT3A 1NJGA 4BMZA 1I80A 3PNOA 4EZBA 3EXIA 3PJEA 3R77A 4PX3A 3WI7A 2V4UA 4AZTA 1U0RA 2Y0EA 3QLVA 3PUIA 2LCFA 4PC1A 1Y34E 3R44A 4R40A 5BQFA 4YRIA 1HZZA 3BD6A 4PRZA 5A71A 2XQFA 2YMMA 1DIGA 1DB3A 1ZUWA 5H16A 1JZQA 5EJMA 5IZ4A 3QSYA 3D81A 4XW2A 2ZSJA 5IDVA 5BV2P 2NT3A 3A6DA 3AH8A 2JAQA 5FOSA 3PIDA 3EG9B 3QELB 3NBAA 3NHJA 4GOND 1VJTA 5IC4A 3IXMA 2ODPA 4BE9A 2IU3A 5C5EA 2ZPUA 1SQ6A 3G2LA 3M81A 3BHIA 3O9ZA 4MLCA 1E6WA 1RYBA 1CVIA 5ENZA 3MUFA 3B6IA 3ZEAA 1HZZC 2YIMA 4OM8A 1C4KA 3JR3A 2A9VA 4LYFA 1YZUA 3FOAA 4GLJA 1XQ9A 2FPPA 4RETA 1KEVA 3I9V6 3WWPA 1DBWA 3C6KA 4WN9B 5DGCA 4ON9A 4NCNA 1NRIA 1H2AS 2DEUA 4FOPA 5J47A 3KHSA 4ND2A 4QXPA 4NE2A 1CUZA 1JVBA 1GILA 1WW8A 4RXTA 4HK4A 2Q6VA 4G81A 1NX6A 3E7XA 5CT6A 1RQ2A 3MTDA 1VDMA 2CXQA 2W2QA 2C9BA 1KAGA 4AMYA 3KQNA 4J3JA 1DJLA 1G63A 3PL1A 1C7QA 4C20A 2IY7A 4IXTA 3GLFB 3I34X 1W36C 1T8PA 2Y93A 5CM9C 3M0EA 3M6MD 1S7CA 4UU8A 4LAFA 4Y6QA 5FPKA 3QBEA 3EVTA 4ZZ1A 1F38A 1N2ZA 3N8NA 2Q6LA 4X95A 1H6BA 4JD5A 3RLIA 4I1RA 4EYQA 5FORA 4MV6A 1IHYA 3IVXA 4FD2A 5FTWA 5JD6A 3VZRA 1OGIA 4PBSA 4MP8A 3F7OA 3NCHA 2DYKA 1L9XA 5EHZA 1EZ1A 2HRCA 1UFKA 2ZTMA 2P6UA 3BXEA 2FP3A 2V5AA 3E3LA 4LMPA 4DLVA 1XHEA 2V6BA 5B53A 5DHFA 2YJTD 5LLSA 3KLPX 4BGEA 4BB9A 1ND6A 1LRLA 4E46A 4Z7OB 3L7CA 4D9NA 4HYYA 2Y2VA 1W29A 3QNMA 1UMDB 4YX9A 1MC5A 1CZNA 1LPSA 3DQPA 4LOLA 2FMIA 3ZE9A 5BN5A 1DFGA 4GS5A 4M7WA 2GXUA 3B9RA 2Z8YA 3QEOA 1L3CA 4G9GA 5EZ6B 3T4EA 3ZCRA 1Q84A 2Z95A 3DBHB 3MCTA 1KDVA 4D9MA 3T3GA 5MGBA 4GHWA 1UADA 4JGGA 5I01A 1E5VA 1AQNA 1BJTA 4RIEA 1WDKA 3PE6A 2R1TB 1K8RA 4GH5A 1Y8ZA 3JD2A 1JQLB 2YNMC 3JARA 1RQ7A 1G1AA 5AXAA 4HATA 4GYJA 4JX9A 1NAHA 1EX9A 3B7GA 4FMDF 3D8SA 4PC3A 1FP1D 5JVDB 2FZLA 1RC1A 3GLGB 3DEZA 5C51B 1WOYA 5E7MA 1L5OA 2XDQA 4GI7A 2RI6A 3FZEA 1RFLA 1A82A 1KXJA 2JAPA 2HF7A 3IULA 4H3HB 3BWMA 2D3WA 3BRWA 3DL7A 4P98A 1TI7A 3TM5A 4C3VA 4G1BA 2Q2WA 1FBTA 3TMKA 3U9TA 4IVRA 1B6TA 5EZYA 1U6JA 3CSUA 1VECA 4W7IA 2BMDA 2FEXA 3BB4A 2C3PA 1CC1S 4JLNA 2C94A 4QATA 3TQQA 3AWIA 5C37A 1PJZA 1GR1A 4UXHA 4DNXA 4UHBA 4ZXPA 4GXQA 4LWQA 2C78A 5TT1A 3IKVA 4MQMA 1X1AA 3C16C 2G9ZA 2PO7A 4JC8A 5IKEA 1KSGA 1SBTA 2YYSA 1CJBA 1DJNA 4GE3A 1T2EA 4CF7A 4BO3A 1W4AA 4MYTA 2NXEA 4X1YB 1P9NA 1Z37A 5FUQA 3EK2A 2Y05A 3AETA 2IK8A 3KHKA 2IEZA 1YHYA 4LJKA 5JMPA 3A6ZA 3QLTA 4F45A 4OKIA 4NYIR 2VATA 5TMEA 1X8KA 1KI7A 4GI2A 4F85A 3LPAA 4OMFG 4BZZA 3CCCA 2WTBA 1T2AA 4CL8A 1PQUA 1L4MA 1NIPA 1R2QA 1XK6A 4PBTA 5CW1A 2SKDA 5CFLA 1Y1KE 1O0CA 2VG8A 5F9HA 4MQBA 1SU8A 3VVCA 2IJGX 4YCAA 4CMGA 3EIWA 2D2EA 1O5IA 2C9YA 3BIWA 3ETLA 4CW7A 3OKFA 2GEVA 4KFRA 1BNCA 4JC4A 2C4WA 4PPGA 2O1XA 5TSDA 2VA9A 2PZFA 2MYTA 2R47A 1T5BA 2ACVA 1YR6A 1PL7A 3HWX1 2G7ZA 3V8RA 2CJWA 1GKKA 1H5NA 1LLQA 4CLOA 5DNCA 1J2EA 5DYIA 3M5DA 5FQOA 2QRQA 3ZGNA 4BLSA 5BV0A 1USVA 2P27A 4B35A 1H4VB 4PBRA 4BU0A 1J2JA 3FUTA 1L5RA 1P2VA 4IO0A 4OLJA 5KU7A 2FPGB 4NU6A 4AIIA 1RKXA 2VEDA 4B4KA 4QVIA 4TTQA 1JIKA 4J4BA 2J0VA 3T34A 3BULA 1DQPA 3BGWA 4Q9DA 2MMCA 4D4KA 3LUCA 4C0WA 1OI3A 4QYIA 2IU0A 4CR7A 5HVNA 5JLJA 1SVSA 1FZQA 3IQDB 3NDRA 1TPYA 5F1YA 5K0FA 1UBMS 3LOUA 1L5LA 3NFRA 3AILA 4HEQA 1HR0B 2YJNA 5IZCA 3ORSA 4GMXA 1E2EA 1LXCA 3W6ZA 4G89A 5CTJA 1XYGA 1MABA 1O6FA 3K5PA 2NU9B 3JVEA 3B85A 3VVLA 5CLQA 1ZISA 3GZJA 4JB3A 4RO0A 4ZGWA 5CNIA 4DIUA 2A94A 1H0HA 1R4AA 1E0KA 2O8FB 4PC7A 3D8RA 3IUQA 4R2IA 3IEPA 4RXMA 1R00A 3ONEA 3PRHA 3HUFA 1OH8A 5BNTA 5ILOA 4FDMA 2JATA 3QM1A 9ABPA 1C7JA 2V4MA 4GD3Q 2ZW9A 1A8HA 4PC2A 4XM2A 1N9GB 4B73A 3OQHA 2BTQA 2BFFA 4HOYA 1T29A 1TT5A 2Q5IA 5F52A 1HK7A 2ZBUA 1BWRA 4NBKA 1ZK3A 5AKGA 4D4LA 3S7TA 2FN4A 1XZ8A 4B09A 4EEXA 1C1XB 4IZOA 3RK0A 4V0LA 2AX4A 4BNMA 3U4QA 3W06A 3JQRA 1E4YA 4NE7A 4DR1B 3DC7A 3ZJUA 4X61A 3R24A 2BM1A 4AN4A 4MO9A 1ZI9A 4I81A 4ZALA 5DFAA 4HYEA 3NTRA 1GYPA 4HMPA 5SZIA 3TSCA 2DFTA 2PO5A 3WQHA 3K1AA 4JCCA 2ID4A 4ENWA 3R8CA 3KEQA 2R8OA 1RADA 2DUJA 4GP7A 3I5UA 3NI2A 4L0CA 3K5HA 3L1VA 4X6UA 3W7VA 4Z4HA 1ACLA 3M6IA 1MQSA 1WABA 2LRHA 2QN8A 1DOZA 2OHXA 2COEA 2P7IA 3KQWA 3QJGA 1FPQA 1FYDA 4N3NA 5CHYA 3GXBA 2WVAA 1DO2A 1NXTA 1XCPA 3V55A 4MVJD 2XOXA 2OAQ1 4B3FX 5GINE 3WLMA 1KP3A 3H3JA 1MLDA 4M7OA 1RRPA 2A1UB 1BSVA 1HRDA 3U31A 1H1LB 4JQOA 3RU2A 3OE7A 2P7HA 1QC5A 3ML1A 3W8FA 4B4OA 1CZRA 4N0MA 1DKMA 3ESCA 3MERA 3WNCA 3QE9Y 1YL5A 1BXZA 2I3AA 2A8YA 1MOSA 4I8DA 4JP2A 4MO2A 5JAPA 3BERA 3HDJA 3E9YA 4X0EA 1B0PA 3K1YA 4X1KA 4YUVA 4F3TA 3E61A 4BC0A 3FMIA 1LGYA 2CF6A 4JX8A 3EWIA 4JI0B 2P91A 3ZVKA 4N0EA 2GF0A 3IEIA 1E60A 3TQIA 3RRMA 5HWSA 2E0IA 4R9SA 3MYYA 1YIAA 4MRMA 4HT3B 2GN6A 3PJRA 3DDOA 5KTMA 3EDMA 1Q0LA 4JVLA 4KLAA 1W1IA 2YKGA 3LWBA 2ZQYA 3UMMA 1WB9A 1TK2A 1YZVA 3KKNA 2P78A 1NX9A 3P52A 4Y6OA 1W36B 2B4RO 3KX2A 4R1LA 4LOKA 1A8IA 4MV3A 2YJ4A 3GAMA 1IMJA 1XKLA 2MDTA 1A9XB 3FPBA 5K45A 1WF6A 2IEAA 3CRZA 1ONOA 2JJQA 2HQRA 1NVEA 1U0OC 1PQ4A 2W2KA 3DYIA 3OSUA 5H0IA 4AG5A 4CN9A 1TYAE 5A4FS 3C3CA 1D2GA 3LDAA 2D0DA 2PUVA 4IUYA 1W44A 4REQB 2GN2A 4I2VA 1KDRA 1II8B 3DAOA 1ISIA 2VO1A 3IAFA 1KY5A 5CVVA 4QULA 2OZKA 1GYQA 5CA1A 1GY8A 2XT6A 2FCRA 2GPBA 4WV3A 5EHIA 1Q0PA 4YJDA 5EKDA 4D3DA 4ZYLA 2ZRNA 4Q1AA 3NYRA 4EJ2A 3N58A 4RMJA 3QKSA 4AQYB 1LQ2A 1V0JA 3GMTA 2MYUA 1U1DA 3QYAA 3ORFA 2R8XA 1FVXA 1ML4A 4H6VA 3S70A 3EZ9A 1EKXA 4RWEA 3VR2D 2BFOA 3BGVA 4X66B 2E4VA 1M7HA 4GKVA 5FFNA 5TGDA 4CR6A 4ZYWA 1KHTA 5EPEA 5C7IO 1KFCB 1TVCA 1AZLA 4FBGA 3NETA 3ANNA 2QWXA 4MV1A 5JXGA 3W05A 4KQJA 4QYTA 3BSSA 2QRVA 4CLEA 3NIGB 1TEXA 3PKJA 3KPVA 1QRDA 1XXHA 1B6SA 2G82A 4MYUA 3UKJA 2XD4A 4DMKA 4RK0A 1SXJE 4NSNA 1LEHA 4BUCA 4YCSA 5TY0A 4US2R 1PR5A 4I1YA 4NABA 1M34B 1MIOA 2VP9A 2WZCA 3W0LB 5A3SA 1JAIA 4HFRA 4Z86A 3UAYA 5F23A 2WBLC 2QJFA 2I91A 3Q0TA 4D0LB 3W5UA 3P45A 2VI5A 4BLOA 3EXEB 3PUZA 3DQZA 2WQ7A 2OESA 1TF2A 4TVKA 3K2IA 3WRYC 1G3IA 1JEJA 1Z7WA 2YFQA 3PICA 2MYPA 4NOLA 2IFTA 3RU7A 4AJ1A 1N8SA 5HGJA 3GNQA 3BS4A 2EZUA 2X22A 4W1RA 4DY6A 2G08A 5MDHA 2FSGA 2ATVA 3HO1A 5BP7A 4LBWA 2BFNA 3I3OA 4E88A 2VP2A 5JC8A 4EYSA 1EIZA 1NFQA 2H5IA 3VC1A 1E3MA 1MO2A 2OXRA 4AECA 1NLZA 4QOSA 2V7BA 2O3QA 4TZKA 4J6FA 2YW2A 2G40A 1FFWA 5IKXA 2SCUA 1T2NA 4X71A 1YVRA 1DC7A 2CZGA 1WPRA 3JAWA 3A0RB 3AR2A 3MD0A 3UJ6A 3SS7X 4B34A 3IHLA 3Q85A 1OC2A 1YS7A 1ZD4A 1MO5A 3OFJA 4MS4B 4V02A 3ZOZA 2JEZA 3GFRA 1DXQA 3B3JA 1XN4A 1IHUA 3A6LA 1NYQA 3V2UA 5J4VA 3FY4A 1FS4A 2XXJA 4OHZA 4IKPA 4MEJA 1NHGA 4I66A 1O08A 2SHKA 3O8LA 2W2LD 5EMMA 4CJXA 3H9QA 1A4XA 2C8KA 1SIUA 4W8OA 1LFDB 3IV9A 4IIFA 4ESVA 3R40A 4FNMA 3VZBA 2F4VB 1GR0A 2XYRA 1G5HA 2RH8A 3DAGA 4MYRA 4TLMB 3DDZX 3RUIA 4NCHA 3HFGA 5CR9A 1P80A 4MGZR 2IGBA 3DOUA 5DLYA 4D8YA 2G5PA 2BC9A 1MEJA 1XP8A 2H11A 2GWHA 1G8SA 2PSHA 2XB4A 3F5SA 1FL9A 1SEPA 1NJFA 2YIVX 3L0PA 4YDSA 1V2HE 1IOZA 3MXTA 2C5LA 1NOKA 1U63A 1J42A 2NWQA 4R7TA 3IEKA 2X8AA 2P9TA 2H16A 2F43A 2HO4A 1O96A 3ONFA 3I28A 4YRDA 4BJ6A 2QMOA 3DVAA 1N7GA 3GH1A 3VQTA 1SOWA 1LH0A 2DTDA 1MGOA 4A82A 3A4NA 1BW9A 4MMZB 3R74A 4OXXA 3RYCB 2X1MA 3H9EO 4R2MA 3GI1A 1DQZA 1NVBA 4J16C 4ACBA 1VL5A 2GAJA 3ZHQA 2V59A 5IDYA 4C7MA 2ZVPX 3GRPA 3HCAA 2VAMA 4RX1A 5AM3A 1LBEA 3FPLA 4TXNA 3OF2A 1U0LA 3O74A 5HUHA 3FWHA 4K2HA 4QTZA 3LQ4A 4LPSA 5JI2E 3KSBC 3UH1A 2X8JB 3M9LA 2AD1A 3BFVA 1ZX1A 2ZUWA 3DEIA 3ID6C 3D6NB 1T9ZA 3ZW8A 3THWA 2WPDD 1MQ8B 2J07A 1H3FA 4L4UA 4K6GA 6REQA 3GD7A 2R8RA 2BGLA 1OH7A 3FNEA 1IM8A 1TVEA 2NTNA 1Z5PA 3OETA 2ZZNA 4RWZA 1LJ8A 1PT9A 3EUEA 4EENA 4PR3A 3ZK8A 1NVXQ 3MS7A 1PCXA 4O63O 3OZIA 3RHZA 3H1PA 1GTZA 1FRNA 1GPBA 2ORWA 3DZ8A 1MFZA 4MWEA 3RSFA 3UH0A 1I8TA 1VL8A 1OXTA 2PU7A 4FONA 5I5GA 3FVTA 4EVIA 4S04A 4L5IA 1GZ6A 1Z33A 3LLSA 5G0VA 1L5HA 4IICA 1OBHA 2JDID 3H87A 3HJRA 3K0CC 3MTJA 1KL7A 1FDRA 2QT1A 2HHJA 5IKOA 2JZNA 4EUHA 5L53A 5MF6A 2PJDA 2VYVA 4BJHB 4HDMA 4NYJR 4OUDB 4BX2A 1RPZA 1A0OA 1FNMA 5E3JA 4BNVA 1AM4D 3PXAA 1O0BA 2Q5LA 2XNKA 1A5AB 4P82A 3V8VA 1TTHA 1OI4A 1P5HA 2QW8A 3Q3CA 1AY0A 2TS1A 4HQFA 4IUDS 1ESNA 2CNWA 5EZYF 3AKCA 3A9VA 3VGPA 5CB6A 2ZUEA 3OQJA 5BSEA 4HEHA 4RJKA 4YJGA 3F4KA 3O5AA 3RWOA 3LOPA 3G0GA 3UMJA 2DHRA 1W76A 4RZQA 1N0UA 3CQ9A 3IP1A 1P1KA 4EVSA 1Q74A 4IHAA 421PA 4DV3B 2NXJA 3PFFA 1I3CA 2QSUA 2ZREA 5D7NA 3K70C 3UMFA 2P2NA 5M3BA 4QT4A 5JS1A 1KGSA 4Y9TA 2WMDA 3ENWA 1CXZA 1P5JA 2XX3A 1JEQB 2FR0A 4N41A 2HMVA 4LYGA 4UD6A 1YBVA 1Q91A 5IT0A 1G2OA 5K8IA 4UMVA 3ROQA 1NNUA 3S28A 4KQ1A 1UXJA 3OM9A 3AKZA 1N3BA 3LQFA 1PZMA 5ER6A 2GM4A 3GPBA 4DCMA 3JQ9A 3NKFA 5F12A 3M9WA 1NXVA 1NFFA 1I7LA 2I4LA 4JWTA 3Q9NA 5C9ZA 4P38A 3SFZA 1US8A 4WRRA 2G1PA 3KZOA 4ALKA 3L07A 4N3GA 1ZXBA 2B6HA 1F7VA 1QS0B 3BOSA 4RKWA 3MTGA 4X6LA 3V97A 1O5OA 3RC3A 5EJ6A 2DKOA 4IMJB 1KEWA 2RG7A 5D3QA 1G8KA 2Y0BA 1R50A 1YCFA 1IHDA 1QANA 2LWIA 3EH2A 5A0FA 1B3RA 1YA4A 3IH5A 4E2ZA 4F93B 4KBFA 3F7TA 4NCKA 1THZA 3ZWMA 1T8RA 4R1MA 2UZIR 4H77A 1QHEA 1R6AA 5JY1A 1E9SA 1GTVA 1DRVA 4WE3A 1V45E 1A8QA 1FX0A 2CVZA 1SOVA 1ZL2A 3AM1A 4RPGA 1ZVQA 3UY4A 2H4HA 3EXIB 1ZJ6A 3AY7A 3NBUA 4KNVA 4LQ4A 4D44A 2VWQA 3HJFA 2GK3A 4RGVA 5IK2A 1NT4A 3SIRA 2QTLA 1I2AA 3OM8A 1PSZA 3OQVA 2HBZA 1VL0A 4OJKA 5J4KA 1NBHA 3F6PA 4PR0A 3BAFA 4ND3A 4DR7B 1F6WA 3H3FA 3MINB 1IK4A 4FYIA 1V7QA 4E5UA 2IXTA 3THXB 5IAKA 1DZIA 3O83A 3CW9A 4ZZ3A 2W5UA 3SBDA 3W9UA 3NYIA 2PGIA 4EI8A 3VTKA 5I51A 4YAIA 4CDGA 4ETWA 2FVYA 1U8TA 1DIBA 4ER7A 3H4IA 4RTPA 3L77A 3PVSA 4NEHB 5FBZA 2XY4A 3GHHA 4CTJA 2XIJA 2C42A 2O2SA 3GCXA 2XGMA 4P0TA 4EQ6B 5K8LA 4DDTA 4R16A 1OJ7A 5M34A 1SC1A 3GK3A 3PS9A 3K94A 4JMLA 4U2CA 1Z29A 3VHQA 2GZ2A 1GGHA 1E6MA 2ZSUA 2VUIB 2XJ9A 4WOBA 1CQIB 1XNGA 3GCGA 1L4EA 1VE5A 1ANKA 2B1IA 3QENA 2X40A 2O0LA 4HNAA 5AIAA 3GN2A 2Q21A 1R5BA 2YZNA 3G1TA 1AB6A 2JJ8A 1U0HC 2Y0PA 3EBPA 4RV9A 3LECA 4L6IA 4OSPA 4QFCA 2X42A 1XC7A 4CIDA 3U4DA 3TTYA 5JS6A 2QPAA 4C2UA 1JGTA 2Q2QA 3ANYB 1G8AA 1Y9JA 3BYZA 1DTWA 4MR9A 5KVVA 4PICA 1RQLA 1ONBA 2XUIA 3W5IA 2I6SA 4ZVPA 4TRNA 3RHFA 4QHSA 2X9QA 5B1DA 2ZUVA 3EQZA 1ZI8A 3L8ZA 4L7QA 3ITKA 2O14A 1ZJ5A 3F6BX 1T15A 1S8OA 4GM0A 2WHRA 3BWBA 1DHRA 5GGXA 1AS2A 2V7QA 3AB7A 5A5EA 5HZKA 4BPBA 3ETJA 3JAKA 3VGJA 1FNDA 1YJCA 4QUEA 3OA2A 2H1IA 3EQ2A 3S8MA 2HK8A 2HPVA 4MVJI 3Q7QA 3HDYA 3T5CA 3ZGLA 3QOYA 3N2YA 5IK2D 3WGMA 3VR5A 3ZN2A 1ZH8A 1UJNA 1GU1A 3GA0A 5FBKA 1AV7A 5KYGA 4E12A 3R3YA 2G9NA 5CFRA 4V1CI 4S24A 4K9MA 3ZWPA 1EVLA 3DJFA 3SFTA 1GQQA 1L5ZA 4PWZA 3KQMA 3SR0A 3TQRA 5JJIA 2YWDA 1DQYA 1PVDA 3Q3HA 3VX3A 1P2BA 2PKEA 4OTZA 3C6QA 3GCWA 5FLKA 1CEEA 1F48A 4LBVA 5E38A 2GBGA 1ZUNA 1ZKDA 10MHA 3HI6A 3FVRA 4LXXA 1NNSA 1USWA 4Z5XA 5B3JC 3H42B 4D57A 1JEAA 1KZ9A 2EAUA 3LA8A 5I7RA 1NOIA 2ORVA 1T1GA 5AM5A 3MAJA 4L50A 4WBXC 1W19A 3LCJA 3OTGA 1QVRA 2WIJA 3LL7A 1Z18A 5IBPA 4D79A 4OX9Y 1CW2B 3WTCA 4OOFA 2VIIA 2VTEA 5CP8A 3K6SB 1HE1C 1RFGE 2NN3C 2PS1A 3DMGA 2H63A 4B3JA 1NI3A 4KI7A 2IYOA 5JNRA 1N3YA 2G9RA 3W1EA 5KNDH 1NMXA 3TMYA 3MELA 2VDRB 3IHWA 1PW7A 4WN9A 1J0CA 1TRKA 1YAHA 4KIUA 4XTCS 5IABA 3FMGA 1KSJA 1M8FA 2Q8PA 4ARZB 2V9PA 4F72A 3IUSA 4U2GA 2JFUA 3AYXB 1SUBA 3VO9A 5K1ZA 4UTZA 1XTKA 5DTRA 3ZVRA 1QG0A 2VHCA 3N0WA 3W04A 1TA4A 2BI7A 2H2DA 3GMIA 4Q6WA 3TD6A 1EFPB 3HBFA 1XA0A 5B1IA 3GP3A 4U2DA 5LBUA 4F4DA 4Q9HA 5FPTA 1U7XA 3MC1A 3SHTA 4EITA 1AQ6A 3TAUA 4RVOA 4QGBA 5F7JA 1WXWA 2CLIB 1W6UA 1ZUHA 4X00A 2E1RA 2I71A 1B8PA 3D5EA 1GFSA 2QGZA 2FOIA 4P7KA 2YJGA 3C45A 4ZEMA 2XBUA 3SIWA 1Y5RA 3HLYA 4KGZA 2C96A 3AFMA 3WLTA 4B80A 3PX2A 4K28A 5FLEX 2F00A 1V1MB 3U62A 3DM9B 4JL6A 1HQCA 3SJUA 4QAQA 3PQCA 3BBPA 1E0DA 3M9XA 1OAOA 2FV8A 2O2GA 3AYZB 1JDVA 3R6WA 1P5RA 4HMOA 4RNCA 2QE7D 4NZ9A 3T7JA 5GP1A 4JA0A 5EOVA 3C1UA 1IY2A 1EQAA 1FF9A 2AQHA 2XAUA 3ZWBA 3DBOB 3S3TA 4AZ3B 3K09C 2JFZA 6YASA 1BU8A 1NUQA 1HFEL 1BYUA 4DN6A 4IOJA 4J7XA 1RRGA 4JYPA 5DM4A 5JQWA 5HTOA 5A02A 3E3NA 2APJA 1Y3CE 4FDTA 4MQ5A 1WMDA 4Y0AA 5JG7A 5AD1A 5BMVF 5JQGF 2ZSDA 4RLFA 4ZA2A 3F78A 1YVDA 2RGGA 5FTJA 2AR7A 5FNVF 1E96A 4YP5A 4ZGBA 3RGWS 3AK4A 1JNYA 5BNWA 1IY8A 3MPOA 1C80A 2WMYA 5EE3A 1JHOA 3EULA 3OSZA 3A05A 4G8BA 1SVOA 2CE2X 4IXWA 2EG9A 4CGZA 2AVNA 2R1ZA 4KO3S 3ZC3A 1OV6A 1C7EA 3CF4A 1XDUA 2J9XB 4LF7B 2R5WA 1HT2E 2H06A 3VNBA 2RONA 2XDQB 3CLUC 1PJCA 3I6MA 3Q1LA 1CUYA 3OOHA 3U3MA 3VFDA 2P68A 4F46A 5J43A 1DAKA 1RAEA 3VISA 4AMBA 1T1EA 3V00A 4GPZA 3KDSE 1F4VA 4QJ3A 2WC1A 3E15A 3E7FA 1F20A 3GGPA 3AVPA 4HUJA 5J5VA 1JG4A 5DVZA 3VHLB 3SHWA 4ZYXA 1EHIA 2AE1A 2NLOA 1X7XA 4P3PA 2BHSA 3NVDA 5CJJA 4OB6A 1RWVA 1SOAA 5DTMA 4M8NE 5BPFA 2PUGA 3K0KA 1L8AA 2AG0A 4BTLA 2FQYA 1V4BA 3HO6A 4I5GA 5L6MB 4AMZA 1VLJA 2QB5A 4FE7A 2CB0A 1A9QA 3QFRA 3VHRA 1GTL1 4GC9A 4RYLA 1BZYA 3FTDA 3X1DA 1AB5A 2YZ7A 5NULA 4C0KA 3ICWA 2N0SA 4EB3A 1MV5A 1NC3A 3PUVA 1C4WA 2C2ZA 3U09A 3JQGA 5B2ZA 1Y5MA 4I0WB 3FKJA 2XGGA 4N49A 5HBRA 5H83A 2GD2A 1D03A 1MA0A 2P2ZA 3EY4A 3H2GA 1V1RB 1W5EA 3NB0A 2IHUA 4JLBA 4L22A 3LXMA 1Y8QB 4PSVA 3VJKA 2RKBA 3V1LA 2F59A 3LBNA 4LSZA 1PL0A 3GRAA 3ZZMA 1WBDA 4J76A 4MQEB 2AF3C 4XH9B 5HBGA 1NMQA 1V8ZA 2ZUDA 3RS8A 1DMSA 4J2OA 1JHQA 2V65A 3ZWYA 4U3JB 2GUGA 2HLDD 3ANTA 4KLNA 5BSMA 5BW8A 3TF5A 4K26A 1DTEA 3CH4B 3Q3VA 3S2ZA 3UATA 3T9FA 3U0VA 1MQ9A 1R4NA 2IP2A 2K87A 1VG9B 5FBLB 3RSGA 3RANA 1LW6E 2H07A 2J5QA 5FYDA 3I37X 4TXJA 3WL4A 1AHNA 2CT8A 1U02A 3KOOA 1QHFA 1V8BA 3T3PB 4DMUB 5DEOA 4P2GA 2WB4A 2BE9A 2Z1DA 3L18A 1Q2UA 1QP8A 2JCBA 2PG3A 3A2KA 2WJVA 2AX3A 5FADA 3RFUA 4PRYA 1BFDA 4MX8A 4OK3A 3Q1KA 1ZM3A 2O5VA 3DWGA 2I87A 5AVSA 3E8SA 4MLDA 1FUYB 1P1JA 1QC5B 3Q6NA 4I19A 1IBMB 2QTZA 3ROZA 4EM6A 2ZBDA 1WP4A 4EZEA 5LL6P 3FYTA 5ESDA 5B3LA 2FZKA 4U5QA 2WFMA 4F2WA 4GRDA 1PN3A 2WYHA 1NR5A 4FFNA 5THXA 3HA2A 4RENA 3JATA 2OHHA 2A92A 1O97D 2FOXA 3QUCA 1G4AE 1N9ZA 1T5TA 3IPXA 3ZS8A 1BH6A 1M1ZA 3MRSA 1O54A 2YFHA 2WHYA 2J09A 3VKWA 2W58A 1FRQA 4F9GA 5I5EA 3ZKWA 3SYLA 1S3SA 4IQGA 4RQTA 2NU7A 3DTVA 4L8VA 3H2SA 3H8SA 4JOBA 5JNLA 2XYQA 4AFNA 1RHMA 4YUXA 3IB6A 5EMNA 5FH9A 4JELA 4H2DA 3OAAD 2OOSA 2RJ3A 4Y2HA 3UJDA 4DQVA 4BEVA 3TVDA 3DFKA 2ZJ7A 3KU4A 1I24A 2O2XA 4KDFA 3OECA 3ZWDA 3CUSA 1JIQA 1H23A 2O3SA 3EGOA 1V8FA 4WESB 2JRCA 1DT5A 2IXAA 2YL2A 1U9JA 1SM4A 3O26A 3GVHA 4FNGA 3QUSA 4U7GA 4EG8A 1K86A 2ZB3A 3BCSA 5CDGA 2GCNA 3LKVA