1TQCB

Ovine recombinant prp(114-234), arr variant in complex with the vrq14 fab fragment (igg2a)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNLVKQAPGKGFEWMGWINTFTGEPTYADDFKGRFVFSLDTSASTAYLQINNLKNEDTATYFFTRGTDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords prion protein
publication title Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function/immune system
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcB02
4LNVA 1JPGA 1JTOA 3SDXF 4RWYH 3EFFB 5HHOA 3SCMC 3V0VA 2Q20A 4DKFH 4R96A 4JAMB 5FUZL 2VLRE 3PL6C 2OS7A 4XBGB 3I75A 4RGNB 3UMTA 3H42L 5MEND 4NQSB 3THMH 2CDFB 4J4PD 5FECB 2F19H 4R7DA 1T1ZA 3E3QC 1HI6A 5JNYA 5I1DB 1YN7B 2ZOKA 1JPTL 4AL8L 4N0YH 2HKHL 3O3BB 4L3AA 4J3VA 4X7TA 3TJEH 3JV4A 1HQ4B 5J6HA 3VFOA 5B39G 3TBSB 4QXWA 4YHNA 5EUOE 1NSNL 1AD0B 2RFXA 3CK0H 3T0EB 5L88H 4I48A 3AY4C 3MJ8B 4U1GB 5FGBA 4F7PA 4OZGA 1CD1B 1QLRA 2KH2B 5C0EA 1PAMA 3R8QA 5FYLH 3K2MC 2HVKB 4RMTA 1S7RB 4QOKA 5F72S 3BZEB 3RWCB 4NT6B 5E4IA 4LKCB 5B38A 4I0PA 5JZ7C 2YXFA 5DD5H 1JK8A 4G80B 2BSRB 2H8PA 3D85B 1HXYB 3MLSH 2XOTA 5D93B 2JKXA 4OBRA 1G7HA 3OZ9L 2JB5L 1JFQH 4RISH 3RL2A 3LQMA 4W6YB 5A3ID 4NJ9H 4F7TB 3G9AB 4LPXA 2VLKD 1MFBH 1TCRA 2BSSB 1YC7A 2JTDA 1MF2L 5HVGB 4M1DH 3U4EB 2CLRB 1ND0A 3IJSB 3BZFA 4FFWD 3I3EA 3GSUB 4GKSB 1PSKL 3MRPA 5L0QC 3L3IB 1B0WA 1ZSDA 3UX9B 5KG9B 5FYJU 4EI5B 3UBXA 2IANA 3HE7D 5IKCB 3NAAH 3SE9H 3MLWL 5F70A 1J0HA 1EAPA 4LSRL 4WDIA 4U33A 1A6PA 3WO4C 1RSFA 3VG0L 5HHPA 1LO3H 4PJ8B 1Q0YL 2PR4H 1S7UB 1CBVH 4MAYB 1JPSL 5FKAB 4AMKL 3SE8H 5DURB 5KANI 4ISVA 4LLMB 2XXMB 4HKZA 2X4TA 2F19L 3H9SA 3DSFL 1PX4A 5H35A 4OIBA 1FNFA 5DUML 4U6YA 3RGVA 2X9XA 3SDAC 4KFZC 4DZ8B 5JORA 5IMOA 2XTJC 3RU8H 2A0LD 1JN6B 4XMKH 4MA8H 2MFNA 4WHCA 1CE6A 4N0YL 2GY5A 4G7VH 3OPZH 4P59L 1UJ3B 5D2LF 4RFOL 2NW2A 2O61A 1KLUB 1MJUL 3WXWL 5I75C 4YAQB 1DUYA 1R3LB 3AXLB 4NZJA 1S7SB 4ZXBB 2R0KL 4G8GB 5IEKA 4U6XA 1U2HA 4OTXH 1MCQA 4PJAE 4CNIB 2R4RH 4YXLH 1CFVL 4ELMA 4PRHE 1MHEB 4JO1L 3U6RB 2DQIL 4OZHA 3F6LA 3L95B 4Z0BH 5FYKU 4ONHB 2FHFA 1MREL 2N7AA 4OQTA 1A7PL 1AIFB 4GKNA 1PG7L 3UJJL 5DJXA 1EUUA 5CZVH 4PJ7F 1N64L 3KR3H 4GAFB 4PRPE 3AAZA 4X6DA 4KZDH 3CU7A 4JN2B 5KS9B 1QO3A 4RISL 4JFFE 4OF3A 1RI8A 4PP1C 1JZ5A 4NJ9L 5FGSA 3IJHB 5K9OA 2J2ZA 3BKYH 4FTVB 1FO0H 5EC1B 2MHAB 1MIEL 5J12C 3SO3C 3VXQB 4P3CL 3ZZ1A 4TUJA 5E5UB 1X5AA 1FVDB 3RWJB 2FZ3B 1J12A 1REIA 2XA3A 1L0YA 4XP1H 3BVNB 5JXAL 2BDNL 5CJ8A 3WKML 1CTOA 1Z5LA 4N8PA 4NQDB 1CQYA 1RZ8B 3EJJX 5JOFB 1IT9L 2CQVA 1FH5H 4RMSA 3ZKND 4TSCH 4JQIH 2CR3A 2VNCA 4ZUTB 1FZKA 3OKMA 1RURL 1OAQH 3B83A 3SE8L 1RUQL 1FPTL 1NMBL 3G5ZB 4HMDA 3ECBA 4AEEA 3QWOB 2PKDA 3WE6A 1INEH 2XZQH 1VFUA 4PJIB 4PJGF 2A77L 1UH3A 1U41A 3O4OC 2Z4QB 2EYTA 4YC2C 4R97B 2NZIA 1BZ7A 4F58H 5EC2A 1KCVH 2EYSB 3U0TB 4Q0XH 3F7PC 3TYFA 1IC1A 3DI3B 4LARL 2DLTA 4JY5L 1NUDA 1S9YB 1F02I 4FG6D 4PJFB 4Y7MA 1KN2H 5C07E 2DYPA 4YHZL 4YZFE 3LS4H 2ADFL 2V2TB 3GMPB 1XIWA 1F2QA 1OF2A 1IKNC 3SN6N 5BMFL 4MHHG 2OJEB 4JHAH 4R90L 1BVKA 4EIGB 1SJEA 1QEWA 3W2DH 3V7AG 4NNPL 5KSAA 2IPKA 5I30L 4XP9H 4TPRH 5DEZA 1OLZA 3DX9A 1RK1B 4OZIB 1Q9KA 4HPOL 5CZVL 1N7ML 1A14H 1KPVB 5BO1L 3KHOA 3VWJD 3OKYA 2AABH 3VFRA 5IMKB 5JHDD 2YD6A 3QJHB 5EO0A 2J8UE 2R23A 3EIFA 3SPVA 2GUOB 2XZCH 1EIBA 4P4RB 1HXMA 3MRJB 3C60B 5IMMA 5FCSH 4ACPA 2NLJA 2ESVB 1E28A 1T0PB 3WSQL 1A7QH 4HULB 4KDWA 4Y5XB 2VLME 1V3KA 1QRKA 1YC8A 5SX4I 2E27H 2UWEF 3EYOA 1VEMA 4Z9KB 4RGNE 1MQKH 5J9PB 3CXHJ 2IEPA 4LHUB 5JDSB 4XNQA 2DQJL 4D9RE 4GW1A 4L3CB 2CRIA 3QDAA 3MUJA 5K9QG 5D2NA 4HWEL 3V0AC 4RGMB 2BY2A 4X5WA 3WV0A 3KGRA 4L9DA 4X8XA 2APTA 1CICC 3MNZA 4XPFL 3VW3L 4L8SB 4HT1L 4FZEL 3DVFA 1N59B 1FNSH 4LGPB 2ARWA 4G8EA 4ZYKA 1U3HD 2H3NA 5K9KB 4HJGA 3KPPA 3JBG7 4ZAKC 2YK1L 5HHXH 5J1AB 2E9BA 1R0AH 3HC3H 5C09A 3VXRB 3OGCA 3O6ML 4LIQE 5IEHA 5T3ZD 1V3LA 1VEOA 1GGCH 2DI9A 3FT2B 4Z7WA 1QBBA 4E41E 5DEFA 3BISA 3WIFB 4NO0A 3L3DB 5EOCJ 4XCEB 3RVVD 1UACH 4BFIA 4Q9RL 3BOVA 5L9DH 1WZ1H 2JJSC 3TO2B 1I8MA 3TFKD 5I8KH 5CMAB 2AJZB 4X7SL 2EXYC 3MV9B 4HH9B 4ETQA 5IHUH 3RNKA 4U6HB 2VTFA 4GXVL 1YEIH 4M5ZL 2LTQC 1EO8L 3P0YH 2O93L 4MQSB 4FQHB 3D0LB 1E6OH 5AG8A 5L2KB 2DLFL 3EYVA 4MXVE 5IK3B 5KN5B 1NAKH 2V7HA 2DMBA 4S0TD 4D0BA 3WHE1 1AGDA 3GSNL 4H1LH 1DUZB 3QO0B 2XWTB 3V6FA 3NCBB 1X5XA 2CK0L 5F44A 4OFIA 4EN3A 1AI1H 5LVEA 2IPTL 5E9DA 2HT3D 4Y16D 5JPNB 1NLDH 1FL3A 3TJHC 1B0RB 2YD8A 4LPUA 4ZS7H 1XR8A 2CDEA 3FOMB 2V5YA 3FFCE 3B9KC 1RU9L 4PLOB 4KWUA 2D31A 4WV1A 5E00A 4ODWB 4X4MA 4UDTB 5EOQL 4PV9B 3QDJA 3HI6H 5EH1A 1YEFL 1WF5A 4I18A 4ODSL 1NKRA 3QUYB 4HWBL 1VFOA 3NFSH 4KRPC 1KB9J 2FEDC 2FYYB 1JWSB 3T2NH 1P84J 1II4E 3MZGB 1DANT 1UXSA 2W0FA 4R2GB 2AJYL 1I4FA 3KYOA 4MDIB 5FV2A 4P2QA 3D2UD 3MUY1 5L7XL 4P46A 2XRAH 3IDXH 5BS0B 5FYJE 1DBMH 3FAXA 1GIGL 5ICZB 5E6IA 5JOPD 1FE8L 4I77H 2NY3C 4QY8B 1KXVC 2AJUL 3JVGA 5BVPH 1D5ZB 3M1BA 4QRTB 3SGJA 3ILPA 2VZ3A 1KN4L 2NY6B 1P7QB 1U8QB 5KS9E 3PHOA 1E4XI 1U8KA 1CDIA 3K7UA 1ZGLM 3DNKA 5IBUG 5MHSD 2WWMD 4HMEA 4DQOL 4FTVE 1MI5D 1ZT1B 4DOHE 3D6GA 3ULVF 1W0VB 1GGBH 3VGBA 4GW4B 4EQ2A 5FOBA 4GAYA 5IHUL 2WLZA 4YR6A 1FFQA 1ZANH 5IBTL 1DLHA 1E6OL 1F6AA 2WAHA 4OUUA 4UILH 3F58L 4OIIH 2FGZA 4IDLA 2CSPA 4DWHA 3SDDC 4LOUC 3QXDB 3N9GL 2NZ9D 2HMID 5GJSL 4W4OA 4NKIL 5E1AA 3TBTB 3DMMA 3RY6A 2C1PA 3WFDL 3KWWB 1OY3B 3L9RA 4G9FE 4LNRA 4MNQA 5L2JB 1A6UL 2AV7A 4TUKL 1ORQB 1RVFH 1MCFA 3X12A 5KW9L 3A0OA 4PJIE 3DO3A 4N0FA 8FABA 3TH4T 3DWTA 4XPBH 3O3UN 4LVHB 5INDA 3MREB 3A6OA 5ILTL 4LASL 4JO2H 4POZD 5B3JE 1DQJB 4CN6A 2E7BA 4YBQD 3DXAD 1P4IL 1G7LA 5DSCA 1TTUA 4KXZH 4BSWA 4PJFE 1CDJA 4H8WC 4B41A 4HG4J 4JVPA 4NUJA 3QXWA 1JZ6A 3QI9C 1IEBA 2CXGA 2WLYA 2QSVA 4PBXA 2OK0L 1OAZH 3ARXA 1C1EH 4HS3B 2BOBA 1DBML 3VXUB 3BO8A 3D87B 5E8PB 4HK3J 1RUAH 2ZCLH 3RJQB 5LJYH 1A4KB 5C08B 2VLRD 4GBXD 3EYQD 1RK0A 4Q6IA 2VITB 2ITDA 4RBPH 3SJVB 5CIPA 4TSAL 1HKLH 3U4BL 1G9NH 3GIVB 5E56A 1SYSB 3FB6B 4LLQA 2OI9C 4IOFD 1OD7A 2YD5A 1WT5A 1FIEA 5LGKA 1I7ZB 5EOCH 2J8UF 1NGYA 4OIIL 1M7XA 1D9KA 2GQHA 3HA0A 5IMLA 2A6JA 4X4YA 5GS1B 2NY1C 3N1MC 5F9WC 4XAWH 3MODH 3IXTB 3L6FA 4XI5D 4AJ0A 4XPGH 2WINB 5I1JH 1IEHA 1PBYA 4HKBB 5IG7B 3VFNB 3GSXB 4I4WB 3CAFA 3TA3C 4F37K 2V5SA 4AEIL 2G5RA 1YEHH 3KPLA 1X5FA 1RVFL 1RHHA 4QO1A 4XRCA 2X10A 3BEWA 3MJ9H 1ZEAH 3CJJA 4O4YH 4A6YH 4XPBL 5HYJD 1X4XA 2ZJSL 4M1GH 3S35L 3C6LD 3VXRE 2YC1A 1MJJA 3BZ4B 4NBYB 3NH7L 4FFZH 1QSFB 3U1SH 5CSZA 5AEAA 2AXGB 5CGYD 3WCYA 2VISB 1HN1A 3FT4B 4UDUA 3ZL4H 1DBKH 4NCDA 5IHZB 2EDDA 1TQCB 1AGEB 4Y4FA 2YUWA 2WNGA 2PO6D 4HLJA 2FIRT 3JWOH 5D7JA 5DA4A 1J18A 3I3DA 5IB4B 1FNEA 1NMCC 1U9KA 3ULSB 2PXYA 3ARWA 4BA8A 4TVSa 43C9B 1F4WL 4YE4H 1RUAL 3CC5A 2B4CH 4I5BB 1QFWH 1I3VA 5L2KE 5DT1H 5LBSH 5D6CB 4G7YH 3L3KB 3WN5B 1PLGL 1YEKL 3D9AH 4KJQC 5GZOD 3HZMA 5IIEA 1PY4A 3S5LA 4OB5H 4EOWL 1N8ZA 1W2KT 4R4FH 4HUUB 4AIXA 3OKLA 1ZT4B 3ZDZE 2IAMB 2P5WB 3QIBC 3P0GB 5HD8C 4JREB 1GGYA 1EJOH 2DBLL 1RMFH 1G9NC 2EC8A 4ZPVA 5KSBA 1T1XA 1AO7D 3FO9B 5GS0H 1RFDL 2OL3H 4Y19E 3T1FA 5ID0B 1K4CB 3ZTNL 2Z91A 4IJ3B 3ZTJG 3GI9L 4X9BA 3EOBA 2CPCA 3LPFA 3D25A 1H3PH 4XMLL 3BKJL 1VFAB 4M93B 2E3VA 1U42A 1BZQK 1FBIL 4GKZA 4L4VA 4P0DA 3TWCH 3WUZA 3ULVD 5IJVB 3X11B 4UBDD 4PYGA 3VXSB 3STLB 5FUOL 2VLLB 1ZEAL 5E70A 1B4JH 4GG6F 5C0BD 3ZMRA 3DUUA 3SKOA 5DMGC 3RTQA 3MFGB 3CMGA 5MP6L 2VDQH 4FFZL 4WI2A 4OZ4A 3CH8A 3OMZA 3U1SL 3NN8A 3UTQA 3ULUH 4KHXL 4OJFH 2YA1A 5C0NC 1JRHI 1L0XA 1S78C 4FQLL 5EZJA 3ZL4L 1DBKL 5HHQB 3TN0B 5F3BB 4NN6B 4JO3H 5DVLA 3L5HA 3EZ8A 1WBYA 5CLWA 4E0RB 3EDJA 3DYMA 2M8XA 3JWOC 5CP3A 1SVCP 3RPKA 2Z8WC 1NANI 2X9YA 2R2HB 3E2HB 2YPVL 4AT6B 3Q5TA 5SWSD 5IJKC 3FQNA 2B4CC 2IH1B 5DT1L 4P2OD 2IBZY 4WHTA 3V6OA 2R1WA 2FIKB 5HGAB 1HH9A 2VZSA 4U4BA 3MRRB 1IAKB 2C4FU 3JV6A 2FD6L 3TPUB 4YK4B 3G6JF 4R8WL 1LD9A 2R0LH 2GK2A 2FO4A 4NRXB 3OKNA 3MBED 3T3ME 3VRLE 4PGEA 1EFXA 3FO0L 3QUZC 4WUKL 4OLVH 4YHKL 3S36H 5GS0C 3KG5A 5F7YC 4L8DB 4M7KH 5LCVL 4JJ5B 1EGJH 3O6FB 4JY4A 4O58H 1GAFH 3VFWA 4YDVB 1CYGA 1UXWB 2H2SC 4CVZB 5C07D 1T2QH 2IFFL 1VEPA 3W9EB 1A1OA 3BW9B 5CEZH 5FHAL 3MYJA 3BUYB 1IFHH 1JMZA 3RJDA 1CG9B 2EE2A 4OD1H 1JF5A 3MLPA 4H26B 2GY7B 1F6LL 1YQVH 3OAUL 4MS8C 1FRGH 4ZFZA 4AEFA 4EUPH 1JHKL 1JWMA 4WFGE 4KKNA 1NFDE 1EEUA 1AGBB 3CFJB 4PD4J 5B3JF 1S9WA 1AHWA 1VA9A 4X9HA 2VDQL 2R0ZH 5EU4B 2XWBB 2VLMD 4J3XA 1NL0L 5C08E 4HIEA 3ULUC 3ZKQD 4IHOB 3WUWG 2C1OB 3DIFA 3PP3K 3BWAB 1V7ML 5ICXB 1XCTA 3SJVE 4X6EA 4D9RD 5DMKA 1R5VB 4LIQL 1FG2A 2ZG1A 4UQ3A 5IT2L 4P9HH 1GOHA 3OR6A 4ODVH 3H0TB 4OI9A 3NZ8A 4HQQH 5EZOH 3REWA 1A0QH 1H3UA 4FZ8H 1ZGLP 4OLUL 4YNYB 1T0MB 3ARFA 3IS0X 1TCMA 1LE5A 3UTSD 5IHBA 2EKJA 1DBJL 2H6PA 1KJ2B 5D72L 2VSDA 2FR4A 2QBWA 4TSBL 4IRSD 3QB7C 3TBWA 5JXED 4ZQKA 4BUHA 2IADB 3HAEG 4ZPTA 2D03H 1H15B 3QQ9D 4MA1C 3VD4A 1MCNA 4KZEL 4OLVL 1FAKT 5HYQB 1D5MA 1J87A 1DANU 3HNTL 5AAMA 1ORSA 1I8LC 4N0CC 1S7VB 1MRCH 4OCRH 4Y4HA 4KQ3L 5J56B 4E41D 3PWVB 4I3SH 5CBEA 5DJ8B 2BVPB 3LRHA 4G6FB 1KB5H 1BBJA 4XHJC 2XWJB 4TVPE 4TNVF 2ITCB 4NN7B 4L8CA 3RWDA 1QSFE 2XQBL 5FYKH 3VDAA 5ESVB 1J0JA 5EU6A 5C9JB 3C5JB 5CFHA 3GHBH 4OD1L 3U36B 1NMAH 3HPLB 1JHTA 1SBSL 2YEZA 3L5WA 5F1IB 4G6AD 4R4NC 3BMWA 2ZUWA 5J11B 5E8OB 3CFDB 3IJYA 3FQTA 1PD6A 4HJ0D 4Y8AA 4NRYA 4KJPC 4QYOA 1INQA 3BSZL 3UJIH 2HFGH 2Z8SA 3HPJB 4QHNB 2XIDA 2BHZA 5D1XB 4DZBA 3MXVH 4PJ8D 2C9AA 3WFEH 3VXME 2WANA 1HDMB 1R24A 5D5MA 4Z77B 5MERB 3FFCD 4OV5A 1Q0XL 3HCVA 1QR4A 4FXKA 1JWUB 1ZHLB 2G2RB 4D0DB 4CL7A 4H5SA 4K9EH 2QR0B 4P9HC 3HMWL 3GBML 1QHOA 4KKLD 4PJBB 5AYQA 1A0QL 4ONGH 3WNPA 2BNRA 3QIUC 1NCUA 5CEYA 4M6NH 3H9HA 3QFDA 3TZVA 4F9LA 3MPCA 3U9PH 4JG1L 4KKBD 1VGKA 3CSYB 3SGDI 1IEAA 4TUOA 1KBGL 1O0VA 3K4AA 1AJ7H 1R5IA 3FRPA 3PG2A 1M7IB 4YQXH 4ODHH 5SX4H 3FB5A 5FYJD 2CMRH 1FZMA 1N3NA 3HI5H 4KK5D 1F3JB 3HUJA 3VXSE 3CX5K 3KHQA 1QBAA 3WD5H 3K8LA 4ODTL 3EOAB 1EEZA 1GRWA 1RULH 1U8IB 3RDTD 3WIHL 3TGXA 1KB5L 4FTVD 3MRQA 4F7CB 2YUVA 3JSSA 2FECI 5FYKL 1HKFA 4DKEH 3GHBL 3T77B 3A67L 1X6NA 1BWWA 1WISA 4UTBH 2WZPD 4JFYA 5F7UA 5CZXC 1CXLA 5F93C 4GXUN 2FLBT 3U30B 5C0AB 3DX7B 3QFJD 2ICEB 2BC4B 1T4KB 1TVBB 5IB5A 3UPRA 1WAAF 4FQCH 3NIGF 2HFGL 4HH8A 1LEIB 3C09B 3SY0B 2BY3A 4TNVK 4XGZB 4LFHD 4G9FD 3HG1B 4PJ5B 2GIYA 4Z7UA 4ZS6C 4PY7A 2A73B 2GT9B 2WUBH 1ZA6B 1CD0A 5T1DH 4X6FB 4LEXL 3CVHB 4QXGL 5DHVB 3SGEI 4D94A 4AIOA 3I3BA 1VACA 4K9EC 1OL0A 2QHLA 1MQ8A 3LRSA 3SDAA 4K8RC 4YO0A 2OQJA 1XR9B 4Y4KB 1ZHKA 2Z31D 2F54B 3QP3A 5CD3A 2FHBA 4BQBA 4LEOA 4N0RA 4PB9H 4NWTH 4UV4H 4WI5A 2NY0D 3Q3GA 4F8TA 5AYUL 1WSST 4ODHL 1FG9C 1M7DA 1ZA3A 5JA9A 3HLAB 2VAAA 3CDGB 3LKNB 1I3GH 1T83A 1T3FB 1IAII 3H6JA 3RX5A 4G3YH 4DEPB 4C56A 4MNHB 4LQ1A 2LVEA 4JRYB 1K6QH 1CLYL 3V4UH 4MD4B 3L3HA 5LQBH 4X5LA 2BVQA 4HF5H 1RULL 4XWOC 4F9PC 2GJ6B 4J4PC 3V6ZA 3W0WB 5CLTA 4K23L 3X3FH 1CR9H 5IVZB 2BY0A 4W6WB 4M6AA 1MAKA 1QYGH 2BY1A 3X17A 5E94A 4KUZL 4LSUL 1NBZB 1INDH 3L7FB 1IQWH 4MQ7B 2GEEA 1WCBA 1G7JA 4P5MB 3D3VA 4WI6A 5B22A 1NFDF 4JRXB 1JPGB 2G5BA 3UAJD 1UEYA 3ZE0F 3PF2A 4KI1A 1VPOH 1TJIL 3BD3A 4MD5B 3TV3L 3QAZC 5HHOB 2NQCA 3V0VB 1AGCA 4KPHH 3A6BH 5DD1H 1AR1D 3BP4A 2WSKA 4R96B 3F65A 4HW6A 1JGUH 3AS0A 5IBLD 3QR2A 1C5CH 3RNQA 2HT2D 5DTFA 1E4XH 2DQEH 4XVUD 4HZLA 1ZE3C 4R7DB 2AW2A 3RVTD 5A2JH 4X6CF 1T1ZB 4O51A 5JNYB 3P77A 1EVTC 3DJ9A 1YEGL 1EK3A 4ZUSB 3NZHH 3NIDF 2ZOKB 3UC0L 4WI9A 2F5BL 4X7TB 3VXRD 1FYTD 3JV4B 4LLDA 2Y7QA 4Q2ZA 4M03A 3H8NA 2DQHL 5D6DC 5ICYA 1D5BB 1PEZA 2RFXB 1SQ2N 1XF3B 3O6KL 4F7PB 3D39A 2D7PA 3IKCA 4FFWC 5DC4B 4FQXA 4OZGB 1QLRB 3AM8C 5C0EB 1MFAH 2VL5A 1KV3A 2NTSP 1QLEH 1A9BA 3CZFB 2ID5A 3DHJA 5B38B 4I0PB 1KCUL 3SE4A 4GH7B 3HE7C 3VMPA 2H8PB 4I2XA 2UUDH 1UYWH 1NQBA 3BIKB 1M71A 3I6KB 3RL2B 1G0YR 1K6QL 2VE6B 5CJ5A 3QCUH 4FABL 4JGJA 1GGIH 1K8IA 4DUVA 1SEQH 4S1DD 2ZUSA 5I18L 4JM2D 1TCRB 3U9UB 1CDHA 1OD9A 1T1YA 2BVYA 5A1AA 2Z92A 4OQ1A 4KMQA 3LN9A 5DS8B 2RGSA 1QYGL 1ND0B 3BZFB 4J3WA 4HUWA 3PGFL 4JKLA 2A0LC 3ARBC 3MRPB 4O2CA 5E2WH 4JGMA 3RPIB 1ZSDB 4Y19D 4JO4L 4XC1L 3N0PB 4U3XA 3FN9A 3QG7H 3UBXB 1VPOL 4N8VG 3TC9A 3NCCB 3ZKMD 3RA7H 5F7EH 1MOEA 2YUXA 3A6BL 4JZJA 2J4WL 3MCKA 1EAPB 3BPOC 5DD1L 3T0VA 4WDIB 2QSTA 4PJBE 5HHPB 7FABL 1JGUL 3MCLH 2YPLA 3B2VL 3BXNA 1S9XA 5DUPH 4MWFB 4ZTPH 3W82A 5E2VH 4HKZB 1BAFL 2PW2B 4R2GD 4N5ED 3H9SB 1VFMA 4R9HA 5H35B 1VDGA 3UZVB 4U6YB 1LWRA 5FO9A 1F4YL 2WIIA 2VZUA 4XTRD 5IMOB 2BP3A 5DVNA 5FFLA 5AAWA 4OM0H 1CE6B 4XMPH 5CINH 1W72H 4FNLH 3MV11 5D71L 2O5ZL 1VGEL 1ZLSL 3GFUA 2NW2B 2O61B 5E03A 4HGMA 1DUYB 5I71C 5C2UB 2MCG1 2NY6D 5IEKB 2ADGA 5T3XH 2F5AL 4U6XB 3PWNA 4CVWA 1FSKC 3MV01 4DKAA 4ELMB 5IWLC 3TIEB 1MFAL 3M07A 5INCB 4JPVH 2DQDH 5E2UH 2DWEB 2JJSA 1JIBA 1JGLH 4BSJA 2CH8A 5DJXB 3ZKNC 3NVQA 1CD8A 3JWDH 1J8HB 3F7YB 5C0AE 2PTTA 5HY9A 3PNWA 3FO1A 2DICA 3OL2A 3UTOA 1HYSD 1BOYA 1GGIL 2CXKA 2YBRA 2P5EE 2AI0L 2DM3A 3VG9C 1CLZH 2P49B 1CI5A 5LKNA 2N1KA 5DC0A 5D1ZA 5IQ9A 2W60A 4PJ5E 2MTPA 3ARSA 4D8PA 1GC1L 2D7OA 3DVNA 1Z5LB 3C5ZC 4FG6C 3IYLW 1MIML 5J13B 2Q86B 2EKSA 1FZKB 3MRCA 3OKMB 2W0LA 1ADQH 4HWBA 3Q6FA 4WI4A 1QLFB 4FQIL 3E0GA 2F54E 3RRQA 3VWKC 2AXFA 4OF5A 3HR5A 3QUKB 3HNSL 2JB6A 3WE6B 2R4SH 3I2CL 2O5XL 5ALCL 5AG9A 3VWJC 2EYTB 3CD4A 4CW1B 4NP4H 1BZ7B 5EFIA 3S8WA 4ODBD 5GGVL 5EC2B 5E6ZA 5B8CC 4OM0L 4XMPL 5CINL 4DTGH 3MA9H 2B7DT 2OTPA 4KHTH 4LVEA 2HTLD 1MCIA 1H8OA 4LLWB 1VHPA 5B21A 5C08D 3A6CH 2DYPB 5T3XL 4XNUH 4JRYE 3MRKA 5GGTL 4WO4B 1XIWB 1YUHB 2GJ6E 1OF2B 3W0WE 4ENED 1T7VA 2V2XA 4GKOA 5ADOL 3MRFB 4YGVA 1NCWH 1QEWB 4JFDD 4MVBD 5KSAB 3FN0L 4G8FA 4JPIA 3SOBH 2HG5A 4F7EA 5C0FB 5HYFA 4YXKL 4HJJL 4S1QL 4NQCB 1YEDA 3JWDC 4WTXA 3VFRB 4M7ZC 1XCQA 5FO8B 1N2RB 3LV3A 5EO0B 4G42A 1S9VA 3O41A 1HXMB 2A1WL 5HHOE 2NLJB 1U3HC 1L7IH 5C0DA 3MOBL 4H1LA 3EYOB 5IQ7H 1LGVA 4HUMB 4RMWA 1JRHH 2E7HA 3TH2T 1NGPH 4LLUB 2YD7A 4NCC1 1B4RA 4JQVC 4GW1B 3I6LE 2D7TL 5D2NB 4HV8A 2KL6A 4Y5YB 4X5WB 1NC2A 3JXAA 25C8L 3TNNA 3LIZH 1U8HB 3ARZA 3GEWB 5TQ0H 3RVVC 3S37H 5CEXA 1XF5A 2VLJB 4TVPD 3MNZB 2H26B 4HK3N 3S4SB 3VFPA 2CJUL 1QSFD 3TFKC 4TN9A 4G8EB 2BMKA 4NFCA 5HDQL 1BFOA 3WDJA 4HD9A 4OZGE 3ZDYE 3MLUH 2H3NB 2Z35A 1NUFA 4GRWF 5EU7C 3KPPB 1I9RH 1OP3H 3DVIA 4QOKE 1DVFA 3QI9A 3I85A 1QBLH 5C09B 3WS6C 3OGCB 3VI4F 3B9DA 4DTGL 5IEHB 3ILQD 4Z7WB 5I2IA 1FQ9C 4OFDA 2HT3C 4Y16C 4WVRA 2X7LA 5FAAA 4NO0B 3VXMD 4PTUB 4HIIA 4M48H 2DKUA 5H8DA 1ZV5A 2FSEA 1DN0B 1I8MB 2JJTC 4ODUA 4Z7OE 3N85H 4M5YL 1NCWL 1TQBC 4ZO7A 4ETQB 5TDPB 1J0YA 4MSWA 3SOBL 4LGRB 1HEZA 5LXGH 3K8MA 2P42B 1J1PH 2BSED 3T0DA 4IRJD 1YNTB 1Z3GH 4KKAD 1B3JA 2V7HB 2R8SL 1AGDB 3E1F1 2IANE 2H41A 1F45A 1B6UA 3V6FB 2WBWB 5GISH 2E6PA 5F7LB 1L7IL 1KG0A 5E9DB 4EI6B 3NPSB 1L9NA 3BP6A 1FL3B 2WWKO 3VXTA 3ARED 1MHPH 2CDEB 6FABL 4WV1B 5E00B 4D9LL 3H9SE 3PIQA 3QDJB 2AJSL 4M7JH 5T5FH 4MJ2A 2EDFA 3VXSD 1EPFA 5KVFH 4I18B 3ARGC 1MFCL 5TFSL 4N1HB 2DOCA 4K3HA 4Q58C 2WWMC 5KVDL 2PYFA 1ZK9A 2L0DA 1NGZA 5IW6A 4JRWA 3O3EA 1YEJH 5TE6H 4WCYH 3KJ4C 4K3JL 5C0CA 2AS5M 1I4FB 2W0PA 3EO9L 3KYOB 3E8UH 3TN0D 2ZSVB 2O5YL 3GKWH 4ELME 2Y06L 5F8QC 4P46B 1OWWA 1MLCA 3M8OH 3UP1A 3AMKA 4OZHE 1CDGA 1RZJL 3BFOA 4YHOH 1G7IA 3M1BB 2NZ9C 5I74B 4G8IB 2HMIC 4KTYA 2WBJD 2NY4B 2YS4A 4U1IA 2WBKA 3L3GA 3QG6A 4X6DE 1U8OA 3PHOB 1U8KB 3V0WL 3HRZA 1V7NL 5ERWA 3EZJB 1RZKH 1EHLL 3LD8B 1RZ7H 5FF6A 1F97A 1MLBB 2EO1A 2H1PL 3N85L 1WWWX 5FOBB 4GAYB 2YRPA 4YR6B 1E6JL 3QIBA 2DD8H 1DLHB 4POZC 1F6AB 2APBA 4OUUB 4YBQC 2X4QA 4TYUA 3LEYH 4DN4H 3B5TA 1TVHA 2NR6C 3R4DA 2BERA 5GSVA 2PTUA 3V8OA 2VB5A 1WBZA 4RDQG 2EEAA 4HXBL 5TPWH 3LMJH 4ZG1A 1MELA 4PRID 1R3HA 3DMMB 2C1PB 3L9RB 3PXHA 1AFVH 1OP9A 4LNRB 5F1SA 3UYPA 4ZNCD 1PGRB 4TOYH 3X12B 4U2ZA 3LN5A 4LSPH 3MROB 2VKXA 2X1QA 4PRDA 8FABB 3VXNB 3QEUB 4GBXC 5INDB 3GGWA 1S5HA 3EYQC 2MWCA 4MJ4A 3MJ9A 5DDHA 1BF2A 2AV1A 3VH8G 1JUFB 1YEEL 4OZFH 1KJ2L 3BP5A 1IL1A 5DRZA 1G7LB 5DSCB 3UDWA 2V6HA 1VESA 3PV7A 5DRXB 1PDKA 5ECJE 4BSWB 5BV7H 4XXDB 2GKIA 4NUJB 4IOFC 5DI8B 3GKWL 2D7QA 1UWGL 4M61A 1FIGH 4AEHH 4LSSH 3KLHD 4X80H 2BOBB 4NO2A 2Y72A 1BGXH 4O02H 3V52L 3P11L 5C0JB 2NY7L 4MCZA 2XXCB 5J3HD 2P48B 5KOMC 5FA3A 1I8IA 4XI5C 5I19L 4MA3A 1OPGH 3JTTA 5IJKA 1NCDL 4N0UB 3ULVH 3UZEA 1RK0B 4Q6IB 1X5YA 4F57L 2ITDB 5GRYA 3LQZA 4MJIA 1FGVL 4DGIL 1RZKC 4P23D 5LWYH 1BX2A 5GRVL 1HZHH 1H3WM 2D3VA 4XCCH 1M6OA 3RBGA 3C6LC 5IV2A 2MCPH 2DD8L 4O2FA 4PP2A 5E99H 5JPMA 3KXFA 1UCBL 2NXZD 3K4DA 1NGYB 2W92A 5CGYC 2WUCL 4ZUUA 1D9KB 2OL3A 2A6JB 4X4YB 5D2NE 4HS8L 3QNXA 3EFFA 5ETUA 4G6FD 2PO6C 4F15B 5H94A 4OCWL 3MUHL 4PREA 2V9QA 15C8L 3MLZL 3DRTA 2Q1EA 5IROC 1RHHB 1CXIA 4XRCB 3T3PE 1CD9B 3IFNH 4KI5E 3BEWB 1B6DA 4N9OB 4WEBL 3SGEH 4X9GA 5I1DA 5GZOC 4LCYA 5C09E 1NLBH 3U7WH 4KQ4L 1MJJB 4YFEA 4YBLB 4Z0XA 5EDXA 5H37H 3QIWB 4UT7L 5CSZB 2R1XA 4Z7WE 1HQ4A 1J88A 1Y18A 5D1XD 4BQ8A 4UDUB 4M8QB 3ZDYF 5BV7C 4M00A 3T0EA 4GG8B 4Y4FB 3MJ8A 2J8HA 4FFYL 3BDYL 5D7JB 4BH8A 2OJZL 3ZSTA 4UIKH 1FNEB 2D9CA 1BGXL 1T89C 3GMQA 1RJCA 4GS7B 2HJFA 1Z9OA 5DHYA 1ED3B 3MRHB 4G80A 3D85A 5EORH 5KAQG 5F6HI 2FX9H 1JZ7A 5IIEB 3S5LB 3ULVC 1CDUA 1N8ZB 3HMXL 1LVEA 3OKLB 4PJCF 4UBDC 4EDXA 4Z7OF 4OLXL 3B5GA 3FL7A 5HVHC 5FO7B 5GGQL 1H3TA 2BSSA 3QSKB 5E9DE 4XNYL 3CFIC 1OGAA 2GYSA 3F7QA 4GSDH 5CBAB 2BRRL 4ZPVB 5KSBB 1T1XB 3ZYIA 1N0LA 3IJSA 2VMFA 3L3JA 3GSUA 4GKSA 3ME0A 3T1FB 3GRWL 4X4ME 1MCRA 3QDJE 2Z91B 1FLRH 5F7HA 2VJXA 4WFHE 3VMOA 4WFEE 2QV2A 3EOBB 2GJZA 3HE6C 4EI5A 4Y2DC 1JV5A 3GIZL 1EGJA 5KSUA 1IKFH 3D25B 4L5FH 4XC3H 5TGBA 3CCHA 4WJ5A 1FNHA 3FZUD 1JTPA 1S7UA 4GKZB 4I3RH 4MAYA 5FKAA 4NM8H 3C2AH 3BJLA 4NN5B 2OYPA 1CF8H 3MGOA 2BXZA 3G5VA 4HFWA 4P2QE 3CVHL 1UFUA 1FLTX 3IFNL 3CLFH 3ET9F 4P2OC 5C0AD 4UB0H 2R29H 3DUUB 4EUPA 1QHPA 5HDBE 4M7LH 1OQOA 4OLZL 5LGHH 1BVZA 1NPUA 2P5ED 1OTTD 4OZ4B 4ONOA 3NN8B 3UTQB 4XCYA 5DFVD 1IBGL 1RIVH 5EZJB 3MBEC 3O8XA 1EHAA 4JM4H 1S7SA 2YD9A 4G8GA 1Q38A 2ZSWA 1WBYB 5DD0H 1QKZH 4OZHF 1XFPA 3MJ7A 4X0KB 1IC5H 1G7QA 1DQLH 1GHFH 4YDJB 3L95A 1T0NA 3EFDL 3FQNB 4ONHA 3PQYD 1AIFA 5I73B 1IAIL 3ALXA 3MO1B 4HWUA 1IJ9A 4WHTB 4DCQB 2MQ0A 2R2EA 3G6DH 4KROB 2F54D 1HH9B 3KDMB 1G1YA 3IJHA 3IT8D 1LD9B 3VXQA 4ZO8A 2FO4B 4M6OH 4PGEB 3AGVA 3NABH 4MNQE 4L4TB 4UTAL 4LL9A 3RWJA 1HINL 2FZ3A 4JFZH 4QNPF 5HDOA 4JY4B 1BEYL 5DJ6A 1P4BH 4PB0L 3UTPE 1EBAA 4NQDA 4IMLA 5T1LD 4NRZA 3BPLB 1BJ1J 4NSKA 5JOFA 2J5LC 4QRSA 5I66B 1MCJA 2GJ6D 4UOJA 3W0WD 4YWGH 1ZVHA 3QHFH 4WHYH 1KB5A 4HK0A 4K3DH 3DO7A 1A1NA 1DSFL 4PJDF 1OAXL 5K9JH 3QRFM 2ZUUA 3P0VH 3BAEL 1U0QA 1JWMB 3C8KA 1ES0A 5T1KB 2J88L 2R29L 2A2QT 3OHXA 2EDHA 2FB4L 3O9WD 5IFAL 4HPYL 1AHWB 3V79C 2FH6A 3WHE0 2EYSA 2XACC 4IRSC 3ZE2F 5JXEC 4TNWK 5I1GH 2B8OT 3EHBD 3QQ9C 1F4AA 1MAMH 4N0UE 5DJAA 4U1JA 3PABB 5GQBA 1EMTH 3GMPA 4X6EB 3W81A 4KTDL 5DMKB 3I6LD 1FG2B 5D7IF 3MLYL 1V05A 4UQ3B 4ZSOA 5D93C 3OR6B 3IFOB 3NZ8B 1QSEB 3KPNA 5SV4A 3REWB 2E6JA 4U1HA 1P2CB 4LDOB 4YHYC 2FX8L 3ARFB 1I1RA 4LHUG 3QXTA 1URLA 2VDPL 1LE5B 1RK1A 1UKQA 4OZIA 2MKLC 2H6PB 1QRNA 2DQFA 4NGHL 1OT2A 3UEZA 1R3KA 3QJHA 4PS4H 3MLVH 2IWGA 4U6TA 2VXUL 3QCVL 1WBXB 3TBWB 3C60A 4ZQKB 1WIOA 1YMMA 1IM9A 2ESVA 4G6AC 5F6IC 5IVXF 4ZPTB 5C9KA 4MAUH 4FQJH 4QOKD 4HJ0C 5C71A 4W4NA 1EAJA 2MSPA 4XBPA 1I8KA 4ONFL 1D5MB 1ORSB 4HHAB 4JFZL 3G5YA 4Y4HB 5HPOA 3OAZK 3VGDA 3C08L 3RP1A 4PJ8C 1P4BL 3MLRH 4B7IA 1DL7H 4K7PY 1V8HA 4RRPG 4RA3A 3DGGB 3RUGB 2FGWL 1CL7L 1BBJB 4LSVH 2XZAH 2CO7B 4UAOB 4FA8A 5DQ9B 2P1YA 3RWDB 4M6ML 2RR3A 1OTUC 3KS0J 5D96C 5EU6B 3SO5A 1JL8A 4L8SA 5IB2B 1ZLVH 3PV6B 2VXSH 4KKLC 3FN3A 3P0VL 4K2UH 1A3LL 3L5WB 3ZYZA 4LSDA 5C7XL 4HLZG 1AP2B 4NRYB 4J7RA 5F88A 5J1AA 2A9MH 1INQB 3SQBA 2IAND 4ZFFB 1CGTA 1I7UA 2AJVH 4R7NA 4KKBC 2D2OA 2FBOJ 2YKLL 3K0WA 3SCMB 4KU1A 4V1DD 3AS3A 3FT2A 4JG0H 1CFQA 4A2MA 5TE7H 5FEBA 3P30H 1IGML 3PL6B 4PFEA 2DJSA 1MCDA 4KK5C 1TZIA 1AD9A 3HCVB 4FXKB 2K9UA 3RGVD 4QHLA 3EJZD 1OP5K 5B3NA 4H5SB 1LDPH 2AEPH 3NCJL 5CMAA 4HKJA 3RDTC 1JPFA 3MV9A 4HH9A 5KSBE 4U6HA 3DX6B 1B90A 4FOMA 2BNRB 3KYKH 4M9PA 5HYSA 5CEYB 5HPMA 5DJ0A 3IDIA 2ZUQC 3MGAA 5KN5A 5IK3A 3VA2C 2P8MA 5DEGA 2F58L 1VGKB 2UZIH 2AQ3A 1IEAB 3GK8L 4TUOB 4HFUH 1LDSA 3QO0A 3WFZA 4RIRA 2P7TA 3AM8A 1ITBB 3RX7A 2AERT 1FJ1A 3FB5B 3ARYA 4L4VE 5C6PB 1FZMB 3NCMA 2I5YH 3TYGH 1B0RA 4ZFOL 2DLIA 2N4IA 4XH2A 3FOMA 2ZCHH 4NC1E 3RWGA 3HE7A 1C12A 4ODWA 5DK3A 4UDTA 1AKJA 4PV9A 43CAA 1UH4A 3MLRL 3MACH 2Q3AA 3QUYA 5ITFB 3MRQB 1YNKL 1AY1H 3QDHA 5IF0A 4OGZA 2UY6A 2C26A 1JWSA 4P57A 1OCWH 2VDLH 1T22A 4M4RA 1AQKH 1ONQA 3MRDB 5EIIA 1C5DA 3ARBA 1BJ1H 1FFPA 4S1SH 5L0QB 3VDBA 2Z31C 4UNUA 2Y5EA 5BS0A 5IB5B 3UPRB 1H8NA 1L6ZA 3NTCH 3KPSD 2A9ML 35C8H 2FRGP 5I6XC 1S8DB 2NY0C 4QRTA 4LSQH 4JCMA 1YPZF 5HHVL 1RZFL 3V6OE 1P7QA 1WWBX 2AJXL 1KTDA 1U8QA 2XI9A 1JCKA 4PY7B 2X4SB 3GBLA 3SGKA 1CLOL 2FATH 1SMOA 4DN3H 4XCFH 1I9IL 2RIKA 5M95B 4M43H 1K4DA 3JV0A 2LU7A 1VACB 3PP4H 2IGFL 2KQNA 3SDAB 4YO0B 3ZDXE 3L5IA 2OQJB 5E6YA 5SWQA 1F11A 1U92A 5BOZG 5TE4L 4QRPB 4Y5XC 5CJBA 5CD3B 1UM4L 2ZUXA 2DYPD 4Z7QF 4LEOB 3GNML 4XP6L 4P99A 1XIWD 3QXDA 1F8TL 3Q3GB 3JZ7A 3CFCL 3UAJC 4OI8A 3TBTA 4TTDD 3ZE1F 1M7DB 4URTB 1ZA3B 4WW2A 2XTLA 2VAAB 3LSOA 5HVWA 1AR1C 1YJDL 4JKMA 4C56B 1ORQA 5TF1L 2HN7A 4KK8D 1F4XH 2YD3A 3BKCH 5IBLC 2IBGA 3L3HB 4PJHF 3ARPA 2BVQB 2HT2C 3MACL 4DGVL 3KNBA 1IZJA 2QQKL 5C6TH 3OKDA 4BFEA 1BECA 3RHWF 3WMSA 3SO3B 1OCWL 2VDLL 1IZKA 1ZAGA 2XG5A 1NCBH 1HYRC 4X7EC 1BQHB 1I1FA 1VENA 1SVZA 3D3VB 4EKXA 5F6HJ 3SDXA 2G5BB 2DI8A 5GRXG 4V2CB 1BM3L 4JVUA 4LPWA 2B1HH 1HHHA 3K74B 2MJWA 3VMNA 3GMMB 3Q5OA 4PGDA 4HS3A 3NTCL 1AGCB 3BP4B 1QSEE 2XA8H 3I50L 1GZQA 3VXUA 3KS0H 3C5ZA 1BLNB 3NACH 4CU8A 4Y1AA 2COQA 3CMOL 3R1GL 5C0RH 2X4PA 5DTFB 3OXSB 5D70H 4HZLB 5DD3H 4NM4H 5EO9B 3VWKA 1E4KA 3MLTA 5E8NA 3O2WL 1F3RB 3HN3A 1S7WA 4KI5D 5D1QD 2OX5A 4QRQB 2E9IA 3MRLA 1MAJA 5F3HA 3O4OB 1UM6L 4YC2B 1LNUA 4S1DC 2V5TA 2XNAA 3FB6A 4JM2C 4LLDB 1XH3B 5B8CA 4Q2ZB 4IIQC 5ICYB 1W72A 1I7ZA 2AEIT 3D39B 4L9LC 3IKCB 3ZHKA 5ITBH 2ARJB 1U8MA 2PYED 3K1KC 1MVUB 3U46A 4XXCC 4NKOA 4U7KA 3IXTA 5FGCB 5GGTA 2QQLH 5ELIA 2WINA 5EU6E 4KVNH 5FM4A 5B39B 3VFNA 3WIIH 2F53B 3ZKMC 4I2XB 1LE9B 5D7LD 4ZO9A 1M71B 1KNOA 1T6VN 5I1CH 1F4XL 3BZDA 1HIMH 5K93A 1K8IB 1AQDA 3QEQB 3T09A 4YUEL 4QRUA 5JW3L 4R2GC 4N5EC 5LG1A 2HH0H 4YHIA 4EN3D 1FO0B 1PQZA 4XTRC 3ARQA 1U3HA 3BKML 4FQ1L 3UBXI 4RAHA 2AXGA 5D5ME 4O2CB 1I7RA 2AK1H 3WJJA 4KKCD 5I76B 4J6RL 1F58H 5DHXB 1T03L 1E27A 4OF0A 3QDJD 1BQSA 5EZIH 1ZWIA 1KGCE 4BZ1H 1J86A 4WFED 4DAGH 3LAFA 3E3QE 4JQVA 3GZKA 4JZJB 5IB4A 3ULSA 1AH1A 43C9A 3IF1A 1IC7L 2BNRE 4I5BA 3GUTB 1ZLUK 1KYOK 3BXNB 1S9XB 3DBXB 4WUUD 3DRQA 1KF9B 5CJQH 1ADQA 1KFAH 4P2QD 5FO9B 2WIIB 4XP5H 1EHXA 4FXGA 1FORH 1FL6A 1OARH 1MCOH 1ZT4A 5T33L 2P5WA 3MR9A 5GRJH 4ZAKB 2IG2H 1HYSC 5D2LA 1J0KA 5E6ID 5EWIH 3HUJE 4GAJH 2DIAA 5IW3A 4MJ5B 5BZWA 2ADGB 4LMQE 4FQ2H 4TULL 3ALPA 1C5BL 1J5OH 1T5XA 4Y16A 1IGFH 2YN5A 4LLVB 3HC4H 4OCXL 5HXMA 5C0IB 5MEQA 1VFAA 4EQ3A 4KVCL 12E8H 2YOCA 3FMGH 4YIQA 1N0XH 5CGTA 4PJ7A 5CUSH 2LTQB 1GZPA 4UMGA 4XNXH 2PTTB 3PNWB 4Z7VF 2G75A 1J0IA 2VLLA 1C16A 2J12B 1NBVH 5DFWH 1A7NL 2YBRB 1LP9B 2IMNA 3U83A 1XF4A 3RL1A 1A3RL 4OKVB 3L5XL 5D1ZB 3R0NA 4LU5H 3UCRA 5IQ9B 2W60B 4MNQD 1VADA 1RUKL 1WV7T 5HHQA 1L4IA 4Z7UE 1Z9SA 2BVOA 4JEGB 4D8PB 4YHLH 1WWCA 2R56H 2W59A 2HTLC 3CH1A 1NBYA 4YXHH 3B9KB 1CXFA 2NNAA 3QNZA 3UTPD 1Q9LA 1JNNH 4W70A 1NJ9A 2EKSB 2R2HA 3ARGA 1NAMH 4AT6A 4ENEC 1RZIA 4EDWL 4KRPB 2DQUH 1MRDL 2IH1A 1UT9A 1KACB 4QRRD 2APFA 1KFAL 3BE1H 4PJGA 1A8JH 1QBML 1CE1H 3MRRA 1IAKA 4KTEH 4XP5L 3LHPL 1QFUH 3BP7A 3DTXA 3MRBA 5EFIB 3BYYA 1U3ZA 2RB8A 4NRXA 5L6YH 1WIPA 5GS1C 5C0GA 3I9GL 2JELH 1JF6A 2NY3B 4WY7L 4C56E 5SWZB 2R0WL 1F6FB 2W9LA 4L8DA 5CP7A 3O6FA 1FDLH 4GQPH 2XN9D 3GMNA 5CSGA 2J1KA 3K8KA 3MRKB 1U36A 4K94L 1UXWA 3M17B 5DJDB 1J5OL 1WK0A 2V2XB 4KDVA 3HC4L 4OLWH 1J1OH 1LQSR 4YGVB 2FBJL 4PJEB 4MXWH 3BW9A 4Z7NF 4G8FB 2HG5B 4F7EB 1KTLA 3JUYA 1A7RH 1A9EA 5HI5C 1T2XA 4FFVD 4K07A 1FZOA 3D3VE 4U1NA 5DWUH 2XICA 4MHHI 3TT3H 4D3CL 5ID1A 3LV3B 4DW2L 4G42B 1S9VB 3O41B 2ENSA 1P7KA 4OCSH 1NBVL 1D9KD 2QADD 5EBMA 3AROA 4CJ0A 5C0DB 2W9DL 1U3JA 4H1LB 1CDYA 2UWEA 3U82B 5EU4A 2XWBA 1XMWA 3Q2CA 4IHOA 4WWKD 4JN1L 1RIUL 1JNJA 1NCAH 1YZZA 4KC3B 5KTEH 5CILL 3O6LL 3S34H 3NOIA 5E8DL 3SQOH 2EEDA 1NC2B 3RVWD 2VN4A 1XF5B 2DTMH 1NAML 2QQNH 3K3QA 4LCWD 3VFPB 2HWZL 2IBBA 2MPAH 5GGUB 4AIZA 3D39E 4JREC 1BFOB 1JNLH 3SDYH 1FGNH 3S7GA 2Z35B 1CLCA 4XPTH 4Y4FD 1SM3H 4IRJC 1OSPH 4KTEL 3NCFB 4KKAC 5FGCE 3QI9B 4HGWA 2IADA 5HHNB 4OM1L 2PXYD 1TZGL 1EFQA 2DDQH 1Y6KR 4I2XE 4WU7A 5I2IB 5SX5K 4P9MH 1EDQA 2ZP0T 5E0QA 2X7LB 5DVMA 4WRLA 4XPAL 2Q3ZA 4PGZA 3CX2A 3AREC 2W9EH 5HDLA 4HIIB 3OSKA 3QEQE 2H32H 4ZMAT 5DJ8A 2BFVL 2FSEB 3C8DA 5F96H 4RGOL 1I3UA 3IAPA 3PUCA 3MBXH 4MXWL 4OGYH 4MSWB 1FP5A 5JW4Q 1A22B 2OP4L 5HYJA 5EBLA 2OI9B 5C2BH 4B53A 4RAVB 1XT5A 3TT3L 2IQAA 1LHZA 1RIHH 2KKQA 3QDMA 1Z2KA 1DLFL 1KG0B 4QHNA 2NY1B 4LRNH 2YPLE 5F9WB 5D5MF 2OZ4L 1NCTA 2DQCH 1DQML 4YDKH 3VXTB 1KCKA 4HKXB 2HKFL 3OB0H 2NY5L 4XBEH 4L4VD 3RKDD 2CUIA 3E2HC 4Z77A 3QUXC 3PIQB 1NCAL 1UZ6F 2WBJC 5F9OL 3S34L 1JI1A 4YFDB 5IROA 4Z95L 2JCCF 1KC5H 1LO4L 4X7FC 3WFCH 2DTML 2P43B 3RTQD 1NGZB 4OF7A 5IW6B 1TNMA 2EZ0D 3O3EB 4GRWH 3S36X 1LK2B 5F7DB 3F6IA 5C0CB 2Q8BH 2VDKH 4PG9B 5I1IH 4XPTL 1G9EA 3OV6A 1MLCB 1P5VA 1AO7A 1DBAL 5IFJB 2DQGL 2XPGA 2AK4D 3NFPA 5FHBH 1M7IA 4OAWA 3MOAH 3V4PH 4UU9A 3HUJF 1NMCB 4PY8J 2ORBL 1F3JA 1BBDH 4YBHA 3KYAA 3L3GB 1P6AB 4F3FA 4KGLA 1SJXA 3HTLX 3HRZB 1AC0A 1FFNA 3LH2L 3HI1A 5ERWB 5J06A 3EYSL 4YDLC 3FQXA 3HMXA 1YY9C 1DFBL 3QIBB 2Q87A 5BXFA 1EFXD 2HJLA 2AEQH 1GOFA 4JDTH 4L8BB 5CHNA 2VQTA 5C0BA 1FAIH 1HOCA 4UT6H 5C2BL 1TVHB 1A5FH 1AE6L 5GS3A 5GSVB 4MGXA 2ICEA 1WBZB 4H88L 2VXVL 2IMMA 4U3HA 4ALAL 2C5DC 3HE6A 4Y2DA 4EXKA 1LEGA 5E8EB 4LRNL 4IMKA 3KLHC 3ISWA 5GJTL 3HG1A 3IDYC 4LK4A 4PJ5A 4H0GA 5J3HC 5KZCB 1N5YL 2A73A 3U7AA 2H9GB 4PRDB 1ZA6A 3OJMB 3WNOA 4GMTL 4NO5A 1YYMH 3GGWB 3CVHA 1BZ9A 1S5HB 1CZ8H 5DDHB 1G9ML 2AV1B 4A6YB 2VDOH 3BP5B 4EBQH 5M7QA 5F1NA 3P4MA 4QHUA 5AWNH 3O2DH 2Q6WA 2EDYA 4P23C 4Y4KA 3B6SA 3FB8B 5T1MB 3GHEL 4NOBA 2I07B 4NDMA 3RIAK 4M61B 4OFKA 1A7OL 2RCSH 1V3MA 4E42A 2NXZC 3S88L 4NO2B 1JYXA 4ZOAA 4MCZB 1JHLH 3BT2L 4MA3B 2P24A 3CDGA 3LKNA 4NN7C 3JTTB 4IRZL 2EIZA 4P3DB 1Q9WB 4JR9H 4G5ZL 5CJXC 1UWXK 4MD4A 1N6VA 3V5DA 3P9WB 2BZDA 3LQZB 5BOPA 3N1QC 2CIIA 4QTHB 2BJML 5IVZA 1BX2B 1NGQL 2R69L 4NC0B 5DJYA 4YDIH 4XWGH 1M6OB 3TT1H 1NBZA 1T20B 5IV2B 2AEQL 3L7FA 4O2FB 4PP2B 3MV7D 1MWAL 3QUZB 4ZNEA 3KXFB 4MQ7A 3ORJA 4OLYH 2C3XA 3UZQA 4I8DA 4JRXA 5D1XC 4ZUUB 2OL3B 2X89A 3PWPD 1IGIH 4WWID 3QNXB 2HTKD 5ETUB 4MD5A 4X83A 3QWQB 2Q8AL 5I8CB 1A64A 3DV4A 2EXWD 5H94B 1B2WH 4HAGA 2E9JA 4PREB 1JTTA 4YX2H 4LCIL 4OFYD 3DRTB 3AMLA 5EU6D 3MMEA 3NGBC 5GRZA 4JPWH 1AR2A 1M05B 1T7ZA 3ZKSD 5DLMH 4ZOCA 4CUCA 1JGVL 4ZUSA 4LCYB 5B38G 3UTSA 8CGTA 3QHZL 3T2OA 4Z0XB 1KXQE 2D4DA 5TQ2H 2CLVA 1RJLA 2R1XB 1Y18B 3SBWC 4P4KD 3UO1L 3V2AR 4IRSA 3MUZ1 1D5BA 1PX3A 5FUCE 4PJXF 5JXEA 1XF3A 3UJTL 4E5XA 2YA0A 3MRMA 3GMRA 3CGTA 3MRNA 4BH8B 4AYFA 1F90H 1KGCD 1TETH 3CZFA 4HS6A 3GMQB 5ANMA 4AENB 2HJFB 4PV8A 2J6EH 5C92A 5DHYB 3O2VL 5ALBL 1WWAX 1A6WH 4BK5A 5GSRB 4G6ML 3Q0HA 1OLLA 2HFEA 2BNRD 2HRPH 3BIKA 3I6KA 3FZUC 3TZVD 1OSZA 2HT4D 3UBXG 5EIQA 1IGJB 1M4KA 2VE6A 3O4LA 4EDXB 1DN2A 4ERSH 2MOVA 3WNNA 4HXAH 4JFXA 3U9UA 1FN4B 1OGAB 4EJ1C 4NBXB 3W5MA 5DS8A 1OAUL 3L3JB 3TT1L 4ZOEA 1Q1JH 1CU4H 4MA1B 4JFEB 4QWWD 3BI9X 3RPIA 1OTTC 1QFPA 1RPQA 1KJVA 2ZNXA 4S11A 1KCSH 3F5WB 2GJZB 1JV5B 4RWYL 5KSUB 1QQDA 5I1AB 5DQJA 4LBEA 4QHKI 1AXSA 5FGRA 4XB8A 5TGBB 4XVJH 5IB3B 2B1AH 4DKFL 3CCHB 3GBNH 4WJ5B 5HBBA 1RD6A 1NCNA 3AB0C 5C0CE 3IFLH 4MWFA 1EUTA 4HFWB 3GM0A 3G5VB 3MGOB 3THML 3QH3A 1KIUA 2PW2A 1ERNA 2ICWI 1OB1B 3BH9A 3HHRB 5FA4A 4B0MM 4GG6A 2EDWA 3QISA 4EUPB 2VXTH 3QWRA 1MCHA 3T65A 4PR5A 4IM8A 3TVMD 1O7VA 3TJEL 3ZKXB 1EV2E 4XCYB 1GL4B 4AM0A 3O8XB 2MMXA 3HZKA 3CK0L 5L88L 4X98A 4OSUH 2ZSWB 3ELAT 4RFEB 3OAYK 3TIEA 3MJ7B 5FYLL 2BNUB 5INCA 1G7QB 1CIUA 1F90L 2EDOA 4QTIH 1JZ4A 2DWEA 1T0NB 1I7TB 5DD5L 4N5UA 3B8YA 3BIAX 4NWUH 4NZTH 2HRPL 3MLSL 4OFVA 2R2EB 1J8HA 3F7YA 3QIUB 1BWMA 1JFQL 5EBWB 3VFUA 1ZOXA 4U6VH 3G6JA 3LZFH 5JTWA 1MFBL 4WHDA 1IAOB 2VWEC 2YWZA 4M1DL 1LMKA 3CZJA 4BJLA 3O9WC 3LKSA 3QFJA 4PGCA 4JFHE 1YDPB 1KT2A 4QGTA 4LPYA 5JW4R 5AZ2H 4C56D 2LVCA 5DJ6B 4XVSH 5ESAB 3H7BB 4IMLB 2VDRH 4ZFOA 4NRZB 2NPLX 3EHBC 4Z8FH 3WNLA 4NSKB 4QRSB 1BIHA 4K3EH 3NAAL 3SE9L 3HR6A 2B1AL 2Q86A 4PJ9A 1AXTH 5ISZD 1A6ZA 4KJYA 1KB5B 1LO3L 2VO5A 4HK0B 3DO7B 3WBDA 2PR4L 1CBVL 1QLFA 1A1NB 5D7SH 3QO1A 3EW3B 4DFHA 2IPUK 3QUKA 4HAFA 1EJ6A 3D3VD 1J7VR 1ES0B 1QNZH 3C8KB 1UM5H 1LO2H 2JIXA 3OHXB 4CW1A 2X5PA 2Z31A 3RU8L 4HBCH 5J0BA 4XMKL 4U0QB 4MA8L 4G7VL 3OPZL 3OTTA 3BGFB 4RAUA 5FK9A 2DLEA 4LLWA 3E6FA 2X1WL 3KJ6H 3MTRA 5DJAB 3HZVA 4U1JB 4OTXL 4OQTH 1R3JA 1CTNA 1UENA 2R4RL 4WO4A 2FX7H 1YUHA 4YXLL 1N6UA 4MJIE 3OAZH 4RFNB 3UYRH 4ZSOB 5GGRA 3MRFA 5GRUH 2C3GA 3KPNB 4M9OA 4Z0BL 4U1HB 4FQQB 2AEWA 1FNLA 4CDGC 1KELH 4YHPA 2AAVA 5C0FA 4NWUL 4Y88A 1QRNB 3KXFE 4LAJH 3KLDA 2DQFB 4NQCA 3KR3L 3VGGA 4KZDL 4J8RB 3LPGA 5FO8A 1N2RA 1R3KB 2EE3A 3D39D 1I1CA 4P2CG 3KVQA 4FQXD 3KPMB 4U6VL 3T2PA 4J3SA 3BKYL 1FO0L 1YMMB 3LZFL 5C8JA 1IM9B 4MX7B 1TLKA 3KPRA 5KSVA 3NFNB 5AZEH 1MCSA 2B5IC 3BRFA 2YD1A 1DJSA 5I1LA 4XBPB 1I8KB 3IAGC 2X4OB 3G5YB 2RQ8A 4YPJA 4LLUA 4XP1L 3ETBF 1KULA 3WJLA 4Y5YA 4K3EL 1EXUA 5DR5H 1FH5L 2EICA 1U8HA 4TSCL 5MENB 2LU3A 4JQIL 2VLJA 1IC4H 3RGVC 2H26A 2ICCA 3S4SA 1OP5H 3F12B 2Y25A 1G6RH 1OAQL 1E4JA 1ZTXH 2APXA 3DUSA 1RJYA 3T0EE 5ADPH 1TTFA 3ULUE 3V7MA 5J7CC 1INEL 1I85A 2XZQL 1FYTA 1UM5L 2PETA 3LS5H 5F88B 4AG4H 2Q7NA 2I9LA 1I7UB 3CFEB 4R7NB 4F58L 2VZTA 1KCVL 2YN3A 1MY7A 3PXJA 5FDYA 1CGYA 4Q0XL 1T21B 4CADA 5EUOF 5I9QC 2YPLD 1CFQB 1DQQA 3FQUB 3BPNC 1U6AH 1KN2L 4OKDA 2KZ1B 5EPMB 1TZIB 1AD9B 4PTUA 3LS4L 3FO2A 1D5IH 4NQVA 4QHLB 1DN0A 3RWEA 1OGAE 2R9HD 3MUGB 4JHAL 3F7RA 2QLVB 4HKJB 3T0WA 1JPFB 3W2DL 5TDPA 3EGSA 1HSAA 4TPRL 4XP9L 4UZGA 1KELL 1F4HA 4TRPH 5HYSB 5HPMB 3QZWA 5DJ0B 3IDIB 4BQ6A 1UJTA 5IHLB 4QEGA 1A14L 1YNTA 2AABL 2P8MB 5DEGB 4XNZC 4OGXH 4I9WE 2OCFD 1G1CA 2F8OA 4Y89A 2LAGB 2XZCL 3GSOA 4L9LA 1U91A 3NA9H 2NX5A 4RIRB 2P7TB 3EDDA 4OGAD 1A7QL 3X14A 1FJ1B 4X7CC 5AZEL 4EI6A 1MHHA 2V2WA 1MCLA 2E27L 3R8BB 4QCIB 1R3IH 4CRPA 1FC1A 4IS6A 1MQKL 5CEZE 3MRIB 4XH2B 1KSRA 3IDGA 2VIRB 5FM5O 3RWGB 3HE7B 1C12B 3CU1A 3GMOA 5EA0H 1AKJB 43CAB 4LCUA 3Q6GH 1VERA 5DR5L 5IESH 1WC7A 1HHJA 5IF0B 3ZYJA 3VFMA 3IB4A 4P57B 5JW4M 3DVGB 3MGTA 3RY5A 1ZTXL 1T22B 3ARDD 3UPCA 5D1ZD 3MXWH 2YZ8A 1WFOA 2YMXH 4H8WH 1FNSL 1OGTB 4G8GE 1QPPA 1XAUA 1ONQB 5EIIB 4U7SA 1BFVH 2ZSVA 3VXPA 1C5DB 2I60H 1FFPB 3ARBB 1MPAH 5T5NG 4YGAB 2X1XR 5HHXL 1WAAA 1A47A 4AG4L 1R0AL 4DUWA 2VUOA 3HC3L 1XIWC 2L7JA 2B0SH 4G8IA 1GGCL 1R6VA 3BPOB 3BD5A 5DMIH 3QDGA 4NKDA 5B4MC 5I1HH 4TTDC 1KTDB 4PJAF 1V3JA 1A6TB 3AS1A 3DECA 4X6BB 4UNTA 1UACL 4NHCH 5L9DL 1D5IL 4TQEH 5FKPA 1WZ1L 4RMUA 4KK8C 5F7FA 3K1DA 1K4DB 4DGYH 3MV8A 4F37F 1G0XA 5I8KL 1MLBA 4HX1A 1YEIL 1KPUB 1ZGLB 3P0YL 4APQA 4S10A 3FB7A 4XAKD 4MA7H 5SWQB 1F11B 1U92B 2VXQH 4I0CC 1X5KA 3UXFA 4NQDE 3TLRA 1NAKL 5I71B 4OGXL 1P1ZB 1NGXB 2A9NH 1S7XA 1FSKB 1DZBA 1KCRH 3S37X 1AI1L 5J89A 4NQXB 4WW2B 2HLFD 4ESKA 3LSOB 1NLDL 1UA6H 5FYKE 4ZS7L 2CR6A 2Y6SD 2HN7B 2M2DA 1WZKA 5DVOA 3LKRA 3MROA 1EEQA 3HI6L 3KNBB 4RDQF 3VXNA 3LKQA 3QEUA 1CFTA 5IVOA 3NFSL 5DA0B 3OKDB 4PRAB 1N6QH 1JUFA 4KI5C 5JO5B 3T2NL 5D1QC 3VG9B 1MJ8H 5DRXA 4H8WL 1I1FB 4XXDA 5JHLH 3SDXB 4K7PH 5I17A 5DI8A 1HHHB 2XRAL 3IDXL 4ZSOE 4FRWA 1VB9A 5GS2D 4PGDB 3R06B 1GZQB 4HIXH 1NC2D 3VFSA 5C0JA 1ZLWH 3C5ZB 4I77L 3G5XA 5BVPL 4K3GA 4KK9D 4Y1AB 4OZIE 3O0RH 1ZHNB 1QRNE 2X4PB 1L7TH 5DMIL 1RHFA 3INUH 4YZFF 1G0DA 5K59E 1DR9A 4X6CA 2ZG2A 4N0UA 3VWKB 3MLTB 4JFDA 4N68A 5E8NB 4NHCL 5E95B 5M94B 1S7WB 5D9SA 1YMME 5JW5A 1X44A 2ESVE 4QHKJ 1DVFD 4AQOA 2DF3A 3MRLB 3QI9D 1GGBL 5F3HB 3KPOA 3VWJB 1LNUB 1X5GA 5JHDB 2XNAB 2P8LB 5E2TH 1ZANL 2A6IA 5B8CB 2ZKHH 1N5AA 1W72B 4EN3C 4BELD 3IU4H 4UILL 2M1KA 1U8MB 1NEZA 2ICWJ 3DURA 2ATPA 1H0DB 4KKCC 3U46B 3JV5A 4NKOB 2W91A 4JLRB 1EO7A 3CXDH 1KCRL 4PBVC 4NZRH 1KJMA 4I18C 1GSMA 4RBPK 1RUMH 3ES6A 3U79A 2CLZA 1UB6B 3QNYA 4CMMB 3GSWB 1KNOB 4JGUA 1YECH 3CFBA 4HC1H 4QT5B 4GMSH 1AQDB 1TITA 3FRUA 3B2UD 4M7ZB 4QRUB 1UKSA 3WKNA 3BRGC 1J8KA 4JO2L 3G9VA 4YHIB 1PQZB 3QIWA 4QGYA 2X6MA 1U3HB 5CCKH 2O26U 2LV4A 1I7RB 4M8QA 3S5LG 5E6IC 1CGSH 3JVGC 4GG8A 3SGJC 1E27B 3HS0B 4K71C 1ZWIB 2WP3T 4GRMB 1OW0C 1OAZL 3C8HA 1C1EL 2Q76A 3V8CA 4PYHA 3MV9E 4M7LT 1CXHA 3IF1B 2FH8A 4JB9H 1IILE 5CIPH 3EYFA 1ED3A 2ZCLL 3MRHA 1L7TL 4UINH 1NAMA 3DRQB 5E08H 3CLEH 4HWNA 5C0CD 4R26H 4OD3H 1NDMA 4FXGB 1FL6B 3RZCD 3MR9B 5FO7A 1HKLL 1LK3H 1G9NL 1JVKA 5D2LB 4GRLA 4LF3A 5CBAA 4G9DA 1PFCA 1X5HA 1KB9K 5KAQF 4XX1E 4MXVF 5BZWB 4W4OC 3T4AB 3IETA 5EOCL 3T2QA 3TO4D 4IDJH 1DDHA 4MYWB 3FFDA 4GAGH 1T5XB 3LQAH 4MJ6B 5CJOH 4QXUH 4ZTOH 4Y16B 4JCLA 1CGUA 3QRGH 3U4AA 4XAWL 3MODL 1SY6H 3AREA 5CD5D 1WICA 2YRLA 5MEQB 3CXDL 2GFBA 4PRHD 4XPGL 5I1JL 2ZCKH 4U1LA 2ENYA 3MLXH 4YIQB 5FB8A 2F8VA 1B9ZA 3QIBD 1YEHL 4PJ7B 3T0BA 1Z0MA 1GZPB 1XGQA 3D0VA 2DRUA 4HEME 2G75B 4PRPD 1C16B 3MJ9L 5BS0E 4O4YL 4P2RA 4A6YL 4JFFD 1S7QB 5HGDA 3T8XA 4M1GL 1UWEH 3GI8H 1XF4B 3RL1B 2YXMA 3U7YH 2A83B 3F7VB 1MFDH 3SE3A 4N9GA 5CCKL 3JWNC 4WENB 1DBBH 1VADB 5DD6A 4HDIB 2BVOB 3HC0B 2OZ4A 4MCYA 2XKSA 2EDJA 4JFHD 5KZCD 4PTTA 3CH1B 1NBYB 2NNAB 3QNZB 3QXUA 3QUXA 3JWOL 4WI3A 1Q9LB 1MEXH 4X0KA 5ACZA 1NJ9B 3ARGB 3BQUA 4YDJA 4EVNA 4Q6IC 3GO1H 1RZIB 4YE4L 4RSVA 5DMJB 2B4CL 5KVEH 1QFWL 2AP2A 1MI5B 4RNRB 5LBSL 5KS9F 5E7BA 3MO1A 4DCQA 4G7YL 1GYAA 4YLQT 3CLEL 3D9AL 5JQ6H 1UCTA 1E0OB 4FFVC 4PJGB 4OB5L 5CKGA 2SEBA 1YN6B 3KDMA 4R4FL 2ZZUT 1WT5C 3BP7B 4GXUM 3DTXB 5GXBB 3MRBB 3GSRA 1I9JH 5HHMB 4JKWA 3FKUS 4LVNC 1EJOL 1RMFL 1D9KC 2QADC 5C0GB 2RBLA 4BQCA 4L4TA 1H5BC 5GS0L 3QPXH 2OL3L 5LGJA 5CP7B 1ULVA 1HCVA 2E5EA 3GMNB 2VR9A 1IVLA 4RCAA 1HHIB 2ADJB 4IDJL 4P49A 4PRIA 4ZTOL 1ZMYA 3VI3E 3LQAC 4HG4K 1GOGA 4WWKC 1Q8MA 4PLKD 5I66A 1H3PL 4LAQH 4MJID 2H32A 5GZND 4LDLB 3ZTJH 1KTLB 1A9EB 3FQWA 1Y0LA 3TWCL 4FXLA 5KBNC 2GW5A 1FZOB 4U1NB 3SDXE 4PJIF 3QUMH 3SDCD 4R0LA 5ID1B 1BOGA 2DM4A 3GSQA 5T1KA 1P7KB 3LEVH 3VGAB 1KIQA 1GPOH 1B4JL 5EBMB 3RWFB 4F7MA 3VXUE 2VDNH 4Y4FC 2UWEB 5F9JA 3TESA 3O3DB 4Y1AE 2BVEA 2EO9A 5CP3H 3ULUL 5GIRB 4PJFF 4OJFL 4JE4B 5GHWH 2PXYC 4RGND 4Z6AT 4JO3L 1PJ9A 4GS7C 2CK2A 3H2WA 3KYNB 3PABA 4F33A 4P5TA 5BJTA 2WM0A 4NJAH 2VLRB 2LU4A 3IFOA 1QSEA 4OZIF 1D6VH 1KLFA 4GBXB 1P2CA 3DLQR 1MRFH 2B2XH 5TJWK 1SEBA 5C1MB 4AIZB 2OR9H 3TCLA 4J3TA 3T0ED 2UYLA 4FP8H 1Q72H 1FCCA 5T3XE 5L8JB 4TTGA 1WBXA 3QA3A 3QXAA 2ZPKH 4HGWB 4YEFA 1QUNA 2R0LL 3UTTA 1YMHB 6CGTA 4NO3B 3WO3B 3WFBH 4WU7B 3S36L 3DX8A 3HNVH 4HHAA 3QT2A 4M7KL 1XEDA 1EGJL 2XY1A 3D85D 4O58L 2V5MA 2BK8A 4Z76A 1GAFL 2VZ1A 3RKDC 4HUXA 3GSVA 3DGGA 1T2QL 3RUGA 4NN5C 4MD0A 5CJXA 4LAQL 4NC1C 5DQ9A 2MQ3A 5DJCB 4DVRH 2ZNWA 5CEZL 1OGAD 1IFHL 4OT1H 5IB2A 3C5SA 5I15H 3BN3B 3PV6A 2F74A 4ZFGH 4CJ1A 5HYJB 5EBLB 3RTQC 2CKBH 5HGBA 1YQVL 2HJKA 1WEJH 1FRGL 3C6LB 4JY6A 2EZ0C 1RUPH 2IQAB 1UH2A 1K5NA 3F8UB 1MWAA 1QD0A 5KVGH 3QDMB 1AP2A 1GPOL 5DQDH 4I9WD 4EI5D 3CSPA 2CRMA 4ZFFA 1FL5A 4BUGA 1DCLA 1T6WA 1QR1B 4Q9QH 4O5LH 2R0ZL 1ETZA 3SCMA 3VFTB 3GJFH 2PO6B 3P4LA 4MAYD 5DURD 3PL6A 3I6GA 2H2PD 2Y5TA 4FQPA 4KRNA 3ROLA 3FRPG 4D0CA 3HB3D 1PYWA 3VXOA 2P5WE 1MFEH 4LPCA 3RKPA 4JFOA 4U05A 4P9HL 4ODVL 3CDCA 5D2LE 2GCYB 4PUBH 4HQQL 5EZOL 3Q5YA 4K8RH 3QPQD 1KLGA 2J8OA 3DX6A 4FZ8L 2L4OA 5I1EH 5DUBA 4RZCA 4HIHA 4WW1A 1I1AC 1QFOA 2VDMH 2Y36H 1BPVA 2P44B 4OZFB 2OR9L 3O8XD 3SBWA 2XG4A 4JM2F 4BH7A 2R2BA 3O2DA 5DZLA 4ZXBD 4G8GD 3RWHA 1C8PA 3ZDZF 5BV7B 1AO7B 3AY4A 2XPGB 2ZPKL 3BN9D 3N06B 3NFPB 4ZDHA 2D03L 4OAWB 1FCGA 4N8CH 5K33A 4UU9B 3CVIH 3CPLB 3BPLC 4CVXA 1GCFA 1YY8A 4LSTH 4PJ7E 3BHBA 4DJMA 4PJAB 3EOTH 2IH3B 5GGSA 4F3FB 2ED9A 1MRCL 4OCRL 1HQRB 3HAEH 3EYUH 1FFNB 1J05A 4I3SL 3HI1B 3P9LA 5HJ3A 1CFNB 2OSLA 3FQXB 5ITFA 1MJ7H 1QACA 5DMYA 2PF6A 3IU3B 5HVHB 5BXFB 2HJLB 1NMAL 2IALA 5I15L 5CHNB 5C0BB 1VCAA 4DK3A 1HOCB 3MRDA 2YPKA 5GGVY 4NQDD 5KVGL 5FUZH 1QSZA 4PLJD 4HUVA 1I3RA 3HE6B 3UJIL 4Y2DB 2VH5H 1LEGB 1S8DA 3H42H 4KH2A 4JKPH 4L1HA 1JBJA 4U1KA 3MXVL 1D6EA 3WFEL 2KDGA 1PW3A 3HKFA 1F42A 5FYKD 2X4SA 4U0RB 2BNQA 3K2UH 4PJGE 1I9EA 3WNMA 1JPTH 2ED8A 4U1SA 3RZWA 4NO5B 4AL8H 5SWSB 1GH7A 2A6DA 3PQYA 4KUCF 1BZ9B 2K7QA 5HHME 4WTZA 4NZDA 3OKKA 2D9QB 4K9EL 5DC9B 2XKNB 4K8RL 4BQ9A 5E1HB 5F1NB 3P4MB 4ONGL 4QHUB 2Q6WB 2D0GA 3B6SB 3VA6A 2UV3A 4M6NL 5IM7A 2YWYA 4QRPA 4NDMB 4BYHA 5DGRA 3U9PL 3MBEB 1HWHB 4CBPA 4PBWD 3LN4A 4E42B 3T4YA 5DK0A 1AJ7L 3T3MF 3VRLF 3VH8B 3BDXA 5MEPB 4YQXL 4YH6A 1EHNA 2HTKC 5IOPB 3P3YA 2CMRL 4PD4K 3OZ9H 3RIFK 2VN7A 3HI5L 2P24B 1BQHG 2PW1A 5C07B 2EXWC 1NCCH 2E9WA 2EIZB 1QRND 4Y8DC 4NPYA 3EYUL 1TIUA 3WD5L 1MF2H 3V5DB 3C9NB 2CIIB 5DZOA 4UNVA 3C60D 1YMMD 2UWEE 2JJUA 1IM9D 2QL1A 2ESVD 5DJYB 4BKLA 1HCFX 4DKEL 1EBPA 4U49A 2J8UB 1BQHA 4UTBL 5J1SC 4LHUD 3O9WA 2NTFA 4P4KC 5HI3D 3MLWH 5HVFB 4LSRH 1IGTA 4OF6A 3VG0H 1ZVSA 1Q0YH 3GMMA 4UIMA 4FQCL 1JPSH 3DV4B 3EO1B 4AMKH 2VH5L 2EH8H 2J5LB 1BLNA 5F21B 4XWOD 4JKPL 3MMEB 3DSFH 5DUMH 3OXSA 4R4BA 3K2UL 2I9TB 5EO9A 2WUBL 3WXVH 5T1DL 3FQRB 4P59H 4RFOH 3MOQA 3TZVC 3UTSB 2HT4C 4F9LC 1UVQA 5A3IC 1MJUH 3WXWH 4QRQA 2CLVB 1RJLB 2R0KH 1XH3A 2IBZX 4IRSB 1CFVH 3G6AB 4Z5RB 4E5XB 3MRMB 4JO1H 5FDWA 2ARJA 2DQIH 3GMRB 1T5WB 1MVUA 4UV4L 4PB9L 4NWTL 3MRNB 4QWWC 1CDCA 2J7LA 1MREH 4NQEA 1A7PH 1PG7H 3UJJH 4HS6B 5ANMB 1IKNA 4PV8B 1N64H 4XCNB 4E41B 5B39A 2IPUG 3MV9D 2F53A 1L9MA 4J3OC 1LE9A 2HFEB 3RX8A 5HYJE 1I3GL 4OCLC 1NCCL 4G3YL 1CT8B 3B9VA 4YHYB 5L2KD 4LPTA 1OSZB 2W1NA 5EN2A 1MIEH 3V4UL 3O4LB 4P3CH 1YYLH 3QDME 5LQBL 4PJCA 4HF5L 1AXIB 3QEQA 2XV6B 3KPTA 4JFXB 3X3FL 1CR9L 2DB8A 4MLIA 4J23A 5E4EC 1FO0A 2ZOLA 1NDGB 5EUKA 2BDNH 5F6IB 3PWJA 4ZUWA 3WKMH 3MA7A 5JXAH 2W07A 1INDL 5D4QA 1IQWL 5DYOA 3RVXD 3K4ZA 3TVMC 2GAZB 1DQDH 4NOFA 1IT9H 5I76A 1KJVB 4G43A 1AKJD 1NC4A 3CFKA 2UUDK 1QQDB 3MRGB 1H3GA 1JGDA 4LBEB 4V1DA 5DQJB 1AXSB 1RURH 2BVUA 4KPHL 3QUYD 3OAYH 1RUQH 2EIDA 1FPTH 1NMBH 3QQ3A 2EH8L 2ILLA 3W39A 4GJTB 2EDQA 3FFCB 3GUTA 1C5CL 3DBXA 5D96B 1PEWA 1CICA 2A77H 3OX8A 1E4XL 2DQEL 2VR4A 3QH3B 2CDGA 2HAZA 3BH9B 5FA4B 2LABA 4LP5A 3B9AA 4YJZL 1AO7E 3ARBD 3WXVL 4GG6B 3H3PH 5BS0D 1F2XK 3NZHL 3G08B 2FNBA 3T65B 4LARH 4PR5B 4ZAKA 4JY5H 2FCBA 4AM0B 1T04A 4YHZH 3EAKA 2ADFH 1BIIA 4MJ5A 3HZKB 5IB1B 4EEEA 1P7QD 4X98B 5BMFH 1H8SA 5BRZA 4R90H 4WI8A 1XF2A 4LLVA 1T83C 4NNPH 3ULVE 5I30H 1QLEL 1T66D 1AGFA 2EDBA 5C0IA 4P48A 1PY9A 2XFXA 4HPOH 4C4KO 1N7MH 2DWDB 2UVEA 5BO1H 4LP4A 5C70A 4KUCD 2I24N 1ITCA 4UOW0 1ROWA 1UZ8A 3RDTB 5C0BE 1UYWL 2X1OA 4Y5VC 2FJGA 4S2SA 2ZUQB 3WSQH 4DOHB 3VFUB 1YYLL 3QCUL 1BREA 4L3EA 3G6JB 1SEQL 1LP9A 2HVJB 1BF8A 1HHKA 4OKVA 3TIDA 2DQJH 1PVHA 2W0KA 3HG1E 3LKSB 3QFJB 1IGYB 4PGCB 2EYRB 1KT2B 5E2WL 5T3ZH 1NGWA 5C3LD 1DQDL 1QFHA 3KPSA 4HWEH 3DOSA 4ZFOB 1JYWA 5SWSE 3B9KA 4RX4A 4KDTC 5E5MA 1HHGB 3QG7L 1RQ5A 5A16A 4XPFH 3VW3H 4HT1H 4FZEH 3RA7L 4G9FB 5F7EL 4PJ9B 1UB5A 1A6ZB 4KJYB 2DLHA 3FHQA 1CK0H 3BIBX 3WNKA 3MCLL 5BVJB 3SKMA 4PJDA 3QO1B 5J6GA 5DUPL 1JNHB 2YK1H 4ZTPL 5E2VL 3AVEA 1G6RA 4BSVA 1W0YT 1LO0H 3O6MH 1QOKA 3EO0A 2JIXB 4WFGD 3O11A 1JJUA 3H3PL 1KENH 2Z31B 4B5EA 5AD0A 4OI7A 2DMCA 4FQXC 4BZ2H 4PRBB 3HZYA 3VXUD 1W72L 2WMPA 4FNLL 3C5ZD 4RAUB 2C3WA 5FK9B 5I6XB 1SJHA 3BJ91 4Y1AD 4Q9RH 5SWZA 2EDEA 2NY0B 3E6FB 5MI0C 3SE4C 3HZVB 5J57B 1R3JB 3GMLB 4PRNA 1UADC 3LKPA 1ZT7B 3M17A 5DJDA 3WEXA 4X7SH 3VWKD 4FN0A 5D7IA 4GXVH 2C3VB 4M5ZH 5GGRB 1EO8H 4H1LG 1CQKA 4JPVL 5EU5A 3SJVD 2L7UA 2DQDL 5E2UL 4PJEA 4X4XB 1ZKAA 2VR5A 2DLFH 4ODXB 4YHPB 2FJHB 3OQ3B 1JGLL 3FT3A 32C2A 4ZNEE 3GSNH 3JWDL 1P53A 1HNGA 4JRXE 1NUNB 4OCNC 2CK0H 1IM3B 2IPTH 2AXJA 5C8JB 3H7LA 5IVXA 4L29A 5T3XD 3KPRB 5KSVB 2I25N 5CWSB 5DK2A 1CLZL 3SDDA 1RU9H 1I1YA 5I1LB 2R15A 3B8SA 2HP4A 3KLAB 5EOQH 1U93A 1Y6NR 1YEFH 4JZJC 4ODSH 5T3ZL 5DRNB 3WLWD 4R6UA 4NQUA 2C4FT 4HWBH 5A2LH 5ESQA 1U95B 2JK5A 3PHQB 2VZVA 2VQ1A 4QKXB 3UTSE 2OR8A 1EXUB 3KYMA 3V95A 1S7TB 3IDJA 2AJYH 1CK0L 1ADQL 2R9HC 4KV5E 5F89A 5L7XH 1IAMA 1RJYB 3DUSB 5GGUA 2C4XA 5D1QA 3LVEA 1GIGH 2R4SL 1FE8H 1FYTB 1LO0L 2AJUH 4NCC2 2I9LB 4NP4L 1KENL 5ANME 4POUB 5HHNA 3VJ6B 1KN4H 3ARVA 4PGBA 4BZ2L 3X3GH 1MH5B 4MB3A 3MA9L 4XVTH 4CADB 1SMAA 4KHTL 2PYEA 4OGAC 4UUJB 4Q97A 1DQQB 4DQOH 4B50A 2WQRA 3A6CL 4XNUL 3O4LE 3FO2B 4CGTA 4NQVB 1IQDA 1MCCA 3RWEB 5D7LA 1W8OA 2IAMD 5IBTH 2P5WD 5GRWA 3D1MC 1OP3K 3EGSB 1HSAB 3F58H 3QZWB 4JZNA 4MXQD 3F62A 4HIJA 4JM2B 3MSPA 3N9GH 1S3KH 1WFUA 2EDLA 4RAVA 4IIQB 3P4OA 3ARDC 5GJSH 5D1ZC 4NKIH 3GSOB 3W11D 3WFDH 4L9LB 1U91B 4WGVB 2NX5B 2AQ1A 5ABDE 3X14B 1A6UH 2NXYB 4TUKH 1MHHB 2V2WB 4Y19B 5GS2H 2BOCA 3VGHA 5IQ7L 4HKXA 4IS6B 1WGOA 1JRHL 1WQVT 4Z78A 5KW9H 4UI2A 1NGPL 3IDGB 2P46B 3JTSA 3GMOB 2X41A 3TA3A 3PWUA 5ILTH 3ZT6A 4GG6E 4LASH 3C2SA 4LCUB 3RFZC 1TFHA 1P4IH 2CO6B 5C3TA 4PJBF 1WC7B 3LIZL 5TQ0L 1HHJB 3S37L 4WUUA 1X5ZA 2GITA 4CKVX 3VFMB 5J1TC 3UTZB 3MGTB 4NNYA 1LK2A 5E2JA 5F7DA 2A74A 2OK0H 4JDZA 2FLRT 1QA9A 1EEYA 4PG9A 3VXPB 5C86A 1H9VA 3MLUL 2EE9A 1I9RL 3GKZA 2GK0A 4GOSA 5IFJA 5JQHC 3DSNA