1TQCB

Ovine recombinant prp(114-234), arr variant in complex with the vrq14 fab fragment (igg2a)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNLVKQAPGKGFEWMGWINTFTGEPTYADDFKGRFVFSLDTSASTAYLQINNLKNEDTATYFFTRGTDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function/immune system
molecule keywords prion protein
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcB02
4G6ML 1MRFH 3LZFL 4PGBA 2ESVA 1KEGL 3HC3H 2C4FT 5I0ZA 5DJAB 5I8OL 4HJGB 3TBVA 1PX4A 3MBXH 4J3OC 4TUKL 3AXLB 3B5GA 1H3PH 4XPAL 5B39A 5JDJA 4JPWH 1U8IB 7FABL 1FO0H 2ERJB 2PW1A 5C08B 3HPLB 4DKEH 4MXVF 2G5BB 2ARWA 5JZ7C 4L8SB 3IDUA 2VE6B 1KIQB 5HVFB 1D9KD 3ZDZF 2VXTH 3M17B 1UENA 2EKSA 3BX7C 3QWRD 5DMGD 5FHAL 4UBDD 3X3GH 5ISZA 1EAJA 5BXFB 3C2SA 2G5RA 3P2TA 4P49A 1U8OA 5FKAA 5KG9B 2R2BA 2Y06H 3HZVA 1SBSL 5GRUH 4YFLF 1IZJA 1QG3A 4GW4A 4KKBC 1MFBH 3DX7B 1A7PH 4AT6B 3RKDC 3G5XA 3IRZA 2A73B 3IETA 1NCBL 3EO9L 3MJ9A 2VDNH 5EO1B 4HJ0C 5E4EC 3H9HB 5CINL 3CDYA 1F45A 1G7HA 1RMFL 1G7HB 2YWZA 4M1GH 2F74A 1FFOA 1RIHH 5DFWH 4FMFA 4U6HA 5IR1B 2VTFA 4NZUH 1OQOA 3CK0H 4RWYL 3MBED 4HMCA 4M5YH 3RUGE 2YRPA 3ULUL 4ZNEA 4Z7WA 2EDBA 3QZWG 4ZNEE 3S36H 1EXUB 2R2BB 3HZVB 3THML 3WUWG 3LV3A 5A16B 5JIHA 4JQXC 2AERT 4LEXH 4QRPA 3QUMA 4L4JA 4ZFFA 2NY3C 3DI3B 1ZT7A 4NQDD 2R0KL 1N7ML 3O9WC 4M00A 4NFBA 4RDQF 1UB5A 3MC0A 4K3GA 2WNGA 1W2KT 1P7QD 2XOTA 3P9LA 3KNBA 3IGAB 2G5BA 3DRQB 5CJOL 4YDLB 2ERJC 4OCRH 1JGUH 1U42A 4E41D 3QXTA 2BMKB 3FRUB 3VFOB 2Q86B 1AGEA 1AGDA 1NUFA 3PWJB 5DZLA 4HIXL 1TVBA 1S9KC 4ZUVB 1FGNL 2ESVB 4ZTPH 3G5VB 2BXZA 4XP1L 3T0XA 1WQVT 4M7LL 3H9SD 4HIIB 4L9LB 4LHUA 4HIHA 5EUOF 4ONGH 5I15L 2VXUH 4WI7A 5FOJA 1A9BA 5EUKB 1A5FL 1A7NL 5ESAA 1AI1H 1SBBA 1EFXB 3BJ91 4NP4L 4GLRI 3K1KC 4PLNC 4KVNH 2V2TB 3AGVA 1KJ3L 3NZ8A 1FH5H 4I5BA 3W81A 3TFKC 3RTQD 2ZJSL 5DD5L 5TE6L 3MBEC 1LD9B 1ZVSA 5CEYA 4ORGB 3S8WA 1JPFA 2VITB 5JR1L 3UTQB 1C08A 4H20L 2YBRA 3OG6B 3RZCA 4FQ2H 2IMNA 4BQ6A 1RJLB 4LKXA 3DVFA 3C2AH 1HZHH 3RVVC 3GMPA 3VFSB 1CGSH 1KELL 1HQRA 5IESH 1LP9A 1FYHB 1KCVH 3RWGB 4PJHA 2ATPA 4JHAL 4E41E 3HRPA 2CKBH 1P7KA 3EOTL 4JGMA 4O58L 5ERWB 3IJYB 1DQMH 3HNSL 4RBPK 1UJ3A 4QHKI 3TGXA 3V52H 3V4VL 1FL6B 5ALBL 1MH5A 3I6LD 4PLKC 2QADC 3K4ZA 1KJMA 1PEZA 1QO3B 3MLRH 4NDMA 4MS8C 3SKNB 3D0VA 1HHKB 4X5WA 5ALCL 5KSUB 1FRGH 3KJ6L 5FUCE 4NC1E 4OF8A 3F12B 4IIQB 4CN4A 3S5LA 1A22B 3DETD 1HINL 3HPJB 4OIAA 5CEZL 5C0GA 1CL7I 4XWOC 5HHME 5LAXB 5LGJA 1I8KA 1FV1B 3CU7A 4XCFL 3P4MB 1QSED 5FUZH 3QI9C 1WK0A 1YZZA 3WN5A 5JIPA 4E41B 5DT1H 2EC9U 4NBYB 4KROD 1I7RB 3QAZC 4K71B 1NMBH 4OBRA 1KCLA 1RUPL 4YGVB 3E6HA 4Q9RL 3GBLA 4Z7UE 3L3OB 3MLTA 4ODTL 3ULUF 2P5WA 2APWA 3DROA 5D93C 5ITFB 4P2OA 5IWLA 4L4TE 1OPGH 2NY6B 3PXJA 1NC4A 2NTFB 1XGQA 1RSFA 1QBBA 5F6HJ 1I1AA 3B2VL 5CILL 3AS2A 4Z5RA 2YPLD 1MF2H 1G7LB 3MLSL 4NM4H 5D2NE 3RGVB 2Q7YB 1MOEA 4MA1C 1HDMB 5K93A 4NNPL 5DJZB 4IHOA 5CD5D 3TO2B 2F54D 5I9QB 5LBSH 2A9MH 4JM2D 3SDCB 1IL1A 2Q6WA 3UYPA 5K9OB 3O2WL 1MCPL 2DB8A 3UX9B 4RBPH 2QLVB 4N8VA 3ILQC 3G9VA 1OD7A 3PL6B 4XB8A 5IKCB 2P8PA 3HG1B 3BP7A 1QBAA 1QSEE 4GBXB 4QXTA 4KMLB 3NFSL 4XX1G 4HC1H 4YIQB 1A6WL 1G7QB 1A1NB 3OHXB 2WBJD 1BOYA 3BEVA 4LQFH 1J0HA 1OM3L 5BMFL 4MHHI 3B9DA 43CAB 4WI4A 1SYSB 1YQVL 4BSVA 1J18A 3QCUH 3PQYD 4HZLB 1PDKA 2CO7B 2MPAL 4WW2C 4YK4B 2HFEB 5F1NA 5I1DB 5DC4B 3WV0A 1FL5B 4P46B 1V3MA 3T4YA 1MVFA 2UVFA 2A1WH 4L29A 3VGBA 5LVEA 3VFUB 1LNUB 2OTUA 2YEZA 4QF1A 3LIZL 3WIFA 3QDJD 3QNZA 4C56B 5D7IE 1D9KB 3BT2H 1ZLSH 5LKNA 2FSEA 1SJEB 1S8DB 1S9XB 4FQHA 4X4XA 3W2DH 2I9TA 1DBAL 2AK4B 4NOBA 3GSQB 1DANT 1D6VH 5I1EL 3QIWB 3V5KB 2Y5TB 3MNWA 2FIKA 5J3HC 3RVUD 3QQNA 1BD2A 5BRZE 1U8KB 1Q1JH 2P8LA 2OZ4L 1JNJA 2D7OA 2IPKA 4TSBL 1ZT1A 2VUOA 1Q38A 3D39B 2P49B 3H7BA 3KR3L 1FVEB 1WLHA 4TPRL 4HLZH 3OJVC 1H5BB 3CVHL 1LE9B 1P6FA 2V5MA 3B9AA 1BD2E 4Y1AA 2CQVA 3AREA 5C0JA 3P11L 4TUJA 1DVFD 2OJEB 2EXYD 3IDNA 2APBA 3FQWB 3QEQA 1KB5H 2GITB 2DKMA 1I3RA 2W07A 1UM5L 3P4OB 4PJ9D 4BJLA 2EXYC 4ONFL 3T0BA 1DBML 3LOWA 1AQKH 3KS0H 1S7XA 5E00B 4JHWL 3RP1A 3KPSE 2BCKB 5DRZB 4LPUA 4UNTA 2R56L 3T2QA 2HRLA 3H42L 1CFTA 3SE9L 4PLJC 4M7KL 2P5EA 5DUBB 1UWEH 1OP5H 1TJGH 5FA4A 2ZZUT 4WWKD 2LTQB 1G6RB 2YZ1A 5GHWH 5HI4C 4OT1H 5DRWA 4G3YH 1IC7H 1PD6A 2DQTL 1DQLH 4PJ7E 3KPRE 4PRHB 1DSFH 1IARB 4CADB 1NANH 5C09A 2DQHH 4KJYB 5KAQG 5CP7A 4AH2B 5C07A 4WTZG 5E56A 1QRNE 5DS8B 5FA3B 3NCJL 5HYJD 2VL5B 4YX2L 4WFHD 1WICA 5JUEL 2AV1A 3VRLE 2I9LA 5BW7A 1G9NH 1JPST 3U9PH 1DTUA 1D5MB 1Y18A 1MRCH 3IXTB 4R4BA 3UPRB 2YWYA 4LMQE 1N4XL 3V6ZB 4M7ZC 5TE4H 1ZTXL 1H0DA 4GAGH 1U58A 5SWQA 3INUL 4BFIA 1G9ML 5SWSE 2EH7H 3OJDA 4TSAH 3SGKA 1UEYA 5DJ8A 1TNNA 3WO3B 2AEWA 2FB4H 5JLZB 2FBJH 2UUDK 2X2YA 5FM8A 4M7LT 4XWGH 4KWUA 1G1YA 1T1ZA 2YSSA 4MAYD 5CZKA 4G8IB 4FP8H 1P69B 3CFBA 3NCBB 1VADA 3FO2A 4UIKL 4YGAB 4ZFGL 4K7FB 2VDLH 1X44A 4CU7A 4ODXB 4YBQD 1R5IA 3BI9X 2K7PA 1MJUL 1NFDB 3UO1L 1F3DH 1KV3A 2CMRL 4A6YA 3GSNH 3BT2L 3HI1A 3MRQA 3TNNB 4O2EB 2CDEB 4PBXA 4ZYKB 1QSFB 4L9DA 4XP9L 1BQHB 3LD8B 4PRAB 1P4LB 3ULVD 1EHAA 3JWOL 1MY5A 4M6NH 5I1HL 3JBG7 3Q6FB 3VWJC 4NO5A 5H35A 5JOEA 3CIQA 3MLWL 1S7VA 3H7LA 5C0NC 2GJZA 2DQDH 4XCEB 5ICYB 4OI8A 3GRWL 3AS0A 2P24A 4JVWA 4ENED 4Z7NF 2FEDD 2OLDA 2DJUA 3P30H 4LRIA 2AJYL 2YA1A 4PG9A 2PUQT 3C9NA 4IMKC 4V1DE 3ZO0A 4EUPH 2WWMD 4LQFL 1YMMA 4ALAL 1IM3A 1B90A 2HT2C 3DXAB 4MD5B 5DZOA 3NFSH 4NFDA 4GJTB 1P9MC 4DVBB 3FQXB 4Y19A 4YHLH 4AL8H 4MD0B 1Q9KB 3GEWB 1P1ZB 5HGDA 4LCCC 4OB5H 5BVJA 1JWMA 3TIEB 2P1YA 4WJ5A 1YYLL 4R96B 5KVDH 5J1AB 2VZSA 5B3JF 4P4KA 4TULH 1U91B 4YE4L 3V7MA 4RGOH 5DTFB 3M8OL 3GSNL 4ZS7H 3ROOB 1N59B 1XT5A 3SQBA 1TJIH 5FEBA 4NO3A 5FYKH 3MROA 3LRSA 3QPXL 3X17A 5IW1A 5E24E 4UV4H 5T3ZE 1I1FB 4ZFGH 2DI9A 2UYLA 2EDOA 4RFOH 5CAYB 3OJMB 3C08H 3ULUE 2MWCA 3IDXH 1D5BA 4WV1C 1CFSB 4HPOL 4N0FB 2ICWB 4XWGL 1OVZA 4ZFOB 5C71A 3DX9A 2MJWA 5IVZA 2IQ9H 3OXRA 3DTXB 1OSZA 5IBTH 5DXWA 3QEUA 3LRGA 4FQLL 5CIPB 3O11B 2Z9TA 1V7NH 3UC0H 5HY9A 1RZ8A 2E7HA 3FB6B 2AJZA 4AENA 2JCCA 3P4NA 1X5FA 5F8QC 3HNTH 3KJ4C 4RFNB 2PNDA 3PGFL 2H2SD 1MJ8H 2QSCL 4U0RC 1CDCA 3QUYB 4LSSH 3VFPA 4LAQH 4N9GB 5HSFA 3OGOE 1NDMB 3OKEA 3Q3GA 4ALAH 3K80A 1G9NL 4X6FB 4MNGA 2NX5E 1G6RH 2AKRA 1EHNA 5HHQB 4XCYA 3REVA 4HF5L 1IFHL 3S96A 2AJVL 4LQ1A 5D7JC 4Z7QE 1OHQA 1JHTB 3BKCH 4RMRA 5JDSB 4PJFF 1L7TH 1XF2B 5ESVB 3QIUB 3M45A 4NQCD 3GSOA 3S35X 3FB8A 5KANI 1M7DA 4LSUH 4PJ5A 4EN3D 3QQ9C 5JA9A 5INCB 1KGCE 4NC1C 4H26A 3Q1SH 4TNVK 4AIZA 1HYRC 4QOKE 3WIIL 5IW6A 1XGPA 1TENA 4UUJB 3T0EE 1SM3H 4JM4L 1KULA 2NW2A 3DGGB 2R0LL 2CMRH 5B4MD 1CFNB 4L3EA 4L8CA 4JKPL 1CICD 4YO0A 3SE9H 1KG0A 4UIKH 1LILA 1MNUH 4FTVB 4JRYD 2BNUB 1ULVA 1EA9C 2DQUH 4PJ7F 1A47A 4LNVA 4NQVB 3ZKXC 2CLVA 5I66A 2G9HA 4X6DB 4R3SB 4AEIL 2A74A 4QGYA 3WJJC 3GSNB 4JFOB 2P46B 2E9BA 4HIJA 1M71A 5MHSE 4B7LA 4TPRH 3CD4A 1T2XA 3TIDB 5IMKA 4APQB 5IMKB 4LPYA 4OD3H 1ZTXH 3U9UA 5CMAB 2XKNA 5CWSA 4MVBD 3TZVC 5TE7L 4S0SD 1N4XH 3O9WB 3VXUE 1LO2H 4JZNA 4HIJB 1JUFB 2AEQL 1T1XA 9CGTA 1DBAH 1HOCB 5ITBH 2F54B 5CHNB 3MRCA 2V5SA 1KC5L 4TRPL 4XMLH 5F6IC 4PRDB 4XNXL 3HKFA 1E6JH 3NCJH 3D6GA 2DYPD 2EDRA 2GTZA 4N5EC 5FM5O 5CKAA 2EDHA 2BNUA 4MJIE 2OJZL 1GC1H 2VAAB 2RR3A 3NIFE 4GG6F 3UPAA 3IKKA 1VSCA 1KG0B 2RGSA 4X7CC 4TVPH 1Q9LA 4L3EB 5T3ZL 2RIKA 3NBNA 1L9NA 4Z7VB 2IWGA 4JN1L 3TZVD 4MVBC 4C83B 4LP5A 3ELAT 1ORQA 4DGYL 3ULUH 4N8VG 5IM7A 1A7OH 1L7IL 4WI2A 3CH8A 5CBEA 5TFSL 4KFZC 1NCAH 4J4PD 1DLFH 1MFCL 3T1FA 1M7DB 3MREA 4M1CC 1MCJA 4G8EB 3CVHA 4LSDA 3VGAC 4XBEH 1JGVH 5ESVA 1YEIL 2E8YA 5C7XL 1JHTA 2HLAA 4ODUA 1HKLL 5KVGL 1J1XH 1J9CT 3C5SA 3D2UB 3MRIA 1X4YA 4FFWD 1T66C 4O4YH 4WHTA 4ACPA 2EC8A 2CKNA 3VFPB 5DJDB 3VRIB 5HDOA 3QUYA 4YUEL 2ATKB 5JW4R 4GRLA 3GI9H 2CDFA 3TT3L 3RI5K 3U1SH 1R3HA 1MFBL 4OZIB 2MHAB 3JTTB 4IS6A 4KJPC 3MUHL 2DJSA 3CSYB 3TZVB 5ADOH 3VXPA 4F80A 3ARGC 3ZDXE 4JM2F 1RJCA 3QDGD 2QSTA 3VDAA 5L2KD 1RD6A 4PJBA 4RGNB 5I2IB 4KKCC 4LU5H 43C9A 4UOW0 3SKOB 4ZFOA 4UILL 3GMMA 3QPXH 3I2CH 4FQCH 3TO4A 3QSKB 3U0WL 1TJIL 1DLHA 4LVHB 2NYYC 5HI3D 4ODTH 3BGFB 3HUJE 1CD1A 2PYEB 5D9SB 1FVDA 3CMGA 3DURB 2ZNXA 4DKEL 2AABL 4UQ3A 1HIML 2WUBL 1G0YR 1FO0L 4POYA 4HWEH 5DQJB 4DEPB 2PETA 2DBLL 1OF2A 5IB4A 2J8UF 4TTDD 2MMXA 1XR8B 2VR5A 3F8UB 3WNKA 1NFIA 5EZOL 2PCPA 3MFFB 1AD0B 4P4KB 2BSRA 2M1KA 5CEZH 3VFVA 3QUZD 3MV7A 1NUDA 1FRGL 3FT2A 5BVJB 3QXVA 4XZUA 4HH8A 4LDEB 4PD4K 1JV5A 1H8SA 4LCWA 5D4QA 4R26H 2I5YL 4NGHL 4JGJA 4M8VA 5I16B 2ICEB 3BRGC 4XHJC 3D18B 3MNZB 4FQXD 3HNSH 5I1JH 4ODBD 1BOGA 1IGTA 3EYFB 4YBLB 3DBXA 4P5MB 5EZLB 1BEYH 3ARRA 3L3DB 2ATKA 3GGWB 3LKOA 1S7VB 3UO1H 4LOUC 1LP9F 3PL6C 4HMDA 3VFNA 3MRIB 4X4YB 5JR1H 3C5SB 5IBUG 4ODUB 1QLEH 5CILH 1P9MA 1N8ZA 4ZYKA 2PXYA 5E6ID 5J06A 1WBXA 5D1QC 3GMLA 1FAIL 2Y5EA 2VNCA 4BELD 3EJJX 3FQTB 4LPCA 2L7JA 1A7NH 1KIRB 4ELMF 5JXEA 4N1HB 1JF1A 3WN5C 1NDGB 3DX8A 4C83A 2FEEI 1OY3B 3N06B 2VZUA 4D8PB 1KYOJ 2XN9D 1OT1A 5FHBH 2YN3A 5C0CD 3SJVB 2DWDB 4QT5A 4X7SH 4QYOA 3ULVE 1MRCL 1EUTA 5KSAC 1RK1B 5KSVB 1XIWC 4P2OC 5IWLC 1H3VA 4IM8A 3E6FA 4JFFB 3TESA 2EE9A 2VR4A 3MV8E 1JTTA 1WC7A 1PAMA 4JFYB 5BZWA 3S34H 4LP4A 3WFHA 4P9HC 4WUKL 5FO8A 4YDJA 3UJTL 3V6ZA 2EDFA 2O26U 1N7MH 1D5MA 4G9FD 5D5MF 3V8OA 4AM0A 4U3XA 1A2YA 3EDDA 4Q7DA 3OGCA 3DECA 3DVIA 1T4KB 3U9UB 3SGEI 1ADQH 2ADGA 1IAKB 1MEXL 3LQZA 1ZHKB 1FPTH 2YRZA 5DGQA 4AMKH 1UM6H 5GGQL 5DZNA 2DWEA 4OCWH 3GSNA 2WZPD 4XRCB 1HXMA 4QHNA 2E27L 1JPGA 3TYGL 4M5YL 5D2LF 1TZHA 4PRHA 3FQRB 2P7TB 4LLMA 5BVPH 4MJ6A 5FGSA 3JSSA 4KRPB 5BV7H 3SDAA 2HTKC 3U82B 3HE7C 4J3TA 3VU2A 1KXQE 4NQVA 4M7ZB 1G6RA 2AJUL 3BDXA 3P9WB 5DD5H 5B8CA 1QHOA 4TOYL 4QEGA 2P5EB 3V5DA 1VFMA 3HR5A 1CFTB 2Z31A 2BDNL 1NL0L 4HS8H 4FQ1L 5GIRA 4KVNL 5HTSA 4ELMA 4WW2A 4YO0B 4MQSB 4JN2A 2BCKA 5DEZA 1S7XB 2G2RA 4YPGB 1T03L 2HMIC 3L5IA 3E8UH 1YN7A 2HKFH 4GKZB 4LNRA 4TSBH 2MCG1 2UWEE 1PFCA 3FRPA 3IDMB 4S0TD 4YFEA 3EFFB 4PJ5B 1K4CB 4JRXB 4N8CH 5LCVH 3GZKA 2OR9L 5E2VL 1QEWA 3GJFA 4GW5B 4PV9A 4XTRD 1H5BA 3D85D 1UKQA 4Y5YC 3QDGA 4OLZH 4D0DA 1JGUL 1P7HL 4U05A 3WHXA 5I30L 3SBWA 2H32A 4HHAB 1CXKA 4KMTH 1QBML 5F88A 3WJJA 4XCYB 4YDKH 4R9HA 4N9GA 2R0KH 4JFEB 3HZKA 3V5KA 3IU3A 4S1QH 1BPVA 3U7YL 4R90H 4E0RB 4X4XB 1A9EA 1FFNA 4QRUB 1DJSA 4Y4KC 4KTDH 2DI7A 3BN9C 3CLEL 5IHUH 2FH6A 1FLRH 1N2RA 1HXYB 5D1QD 3OXRB 4NUGL 4WTZA 4PG2A 1KEGH 4HGKC 2A6DB 3AS1A 3CFCL 4RWYH 4HW6A 1F4AA 5AAMA 3HCVA 4FABH 3FN0H 1CFSA 4JFQA 4N0FA 3T2PA 3VA2C 2O5XL 5E08L 3NIGE 1A6WH 1IM9D 5F1NB 2PW2B 2VLRA 4OM0L 4FQJL 4PYGA 5D6CA 1U41A 1SYSA 1I1FA 4GQ9L 5D2NC 2WLZA 2QHRH 3HC0B 3MROB 2F9BT 2HJKA 1IM9B 3LQAC 3PHOA 2X1OA 3ULVL 5LBSL 5E9DD 4ZSOB 5J1AA 1AKJB 4HPYH 2BXYA 2VZ1A 2JJTC 2OTWB 4Q6IA 2D31B 4PRID 2B4CC 4WUUD 1B0WA 3MCKB 2Y06L 4Y4HB 1P1ZA 3KXFA 2NY4C 3ZSTA 4MD0A 3QUXD 4DVBA 3RTQA 2XQBL 4X9GA 1YMMB 5I1KH 3MRDA 2VABA 3UTPD 2ZG2A 3RGVA 1XFPA 5ICXB 5L0QB 2EYTB 1VKXA 1NMBL 5EU6D 2P24B 5ETUA 1NC4B 1NSNL 1MWAH 1KCSH 1A6AA 1ZA6A 4LHJB 4LSVH 4P2RB 2D7QA 4NO5B 1CXIA 1A6VL 2XN9A 4YDVA 2D7NA 5C9JB 5HHMB 4MNQE 1TTFA 4G8GA 3MBXL 1LMKA 3RIAK 5C86A 5EO9B 3QZWB 1K8IA 4XVUD 1OB1B 2XWJA 3HI1B 4JY6B 4X6BB 2ENSA 4Y19E 1JGDB 1J0IA 4CRPA 3BZ4B 4JDTH 3GHEH 3C6LA 1YMME 3HN3A 3FO2B 3RWIB 3QIBC 5KW9L 1QYGL 2I24N 2VXQL 2YD9A 3IFLL 3L3IA 4LLUB 5D96C 2FWOA 4G9FA 1JWSB 3P0YH 3TP4A 3TN0C 5T3ZD 2DQJL 3KDMA 1HCVA 1ZHNB 3DV4A 4JZOB 3BZEA 4G9DB 4XPHL 1HQ4B 2Q8BL 3BPOC 1C7SA 4ZD3L 2RAMA 1UJ3B 1A0QH 3NGBC 5BOPA 25C8H 2J1KA 2VDKL 5KSBB 4KQ3L 4BH7B 5GS0D 3MRLB 1I1YA 4LFHD 3IFPB 5ACZA 4S1SH 3GMPB 1Y18B 4UNVA 1NC2D 1T6WA 3PJSB 2IPTL 5I8KH 4NQUA 5FYJU 3CPLA 2CLRB 4P3CL 4NP4H 4XPGL 5F7EL 3U6RA 4GMTH 2MCPL 4DCQA 1G9NC 3GRWA 2VXUL 1ZVSB 5E5UB 5FYLD 3T8XB 2R15A 3DO7B 1A6ZA 5DJXB 4CUCA 5CP7B 4AH2A 3MLVH 3LAFA 5C09B 3KS0J 1PQZA 3TWCL 3WDHA 5DHXB 2HFGL 2ZUYA 1FZMA 4U1NA 3OB0H 2VDRH 2QADD 4J23A 4NQCE 1IBGL 1ORSB 5ESAB 2EYRB 1EO8L 3O8XA 4B41A 3R8BB 3WD5L 5HVWA 5D7LD 3T1WA 5DUBA 4ZO7A 4H0GA 1L0YA 4GKSA 4L1HA 4WO4D 1RIVH 3DPBA 1AGEB 3FAWA 3RVVD 2Q86A 3TN0D 5HJ3A 4TQEH 2W9EL 1DE4A 4PIRF 1BM3H 1RK0B 3WKML 4OBSA 5EZIL 3SCMC 3PHQB 3MRBA 1YNLH 4XPTL 3W0WB 3D0LA 4WNQB 3WFCH 1EMTH 1LE9A 5F7MC 1AGCA 1FNGB 1EV2E 1I3VA 4FOMA 4QHKJ 2P47B 1RIUL 5DQDL 5KOVC 3CK0L 2RB8A 4DOHB 3U30C 3QUMB 1L4IA 4HXBH 1V7ML 1BD2B 1MWAA 2FIKB 4NKIL 1TNMA 1RIHL 1FZJA 4KTDL 4U1JA 1S7RA 2Y5TA 3JXAA 2C9AA 2XQYG 2EDLA 2FR4A 3G6JF 4OCLC 2N4IA 5B38A 4S1RH 1BGXL 4OTXL 3RWHA 5IR1A 1D9KA 3RBGA 4OLVH 4F57L 1CDUA 2H41A 4KTYA 2O5YH 1QBMH 1LNUA 4QF1B 3VFUA 1JPSH 3WIFB 1XF4B 1F8TH 1WISA 3ORJA 1NGQL 4K2UL 1FNAA 3BISA 4CKVX 1U8PA 2X89D 4DOHE 3NACL 1OWRM 1TJHL 2AGJH 3IETB 2A73A 1UQSA 3FAXA 2Q87A 1AXIB 1CVRA 2IG2L 4KHTL 4HXAH 2BJML 4Y2DA 5C0IB 1MCSA 3I9GH 3AROA 4GW4B 5HYFA 1NCUA 1S7RB 4JPVL 4H1LG 3PP4H 3VDBA 4UINL 5C0BD 1HSBB 1QD0A 1W0WA 3ZT7A 2MFNA 4M61B 1FIGL 1XZ0A 4JFFD 1NL0H 2FZ3B 1FNGA 1YYML 4MJ4A 1V3JA 3CMOL 4H5SA 3D0LB 4NSKA 1W0YT 3FZUD 1UYWH 5TDNA 2OS7A 1LDSA 4JCMA 2GK2A 1IAII 5F1OB 5F7YC 3C5JA 3MACH 5HJ3B 1CLYH 2AV7B 5B39B 3PE9A 2XY1A 3V6OC 4L4VB 4U1MB 1BJ1J 2Q7YA 2R2CA 4XNMA 3QO0B 1K5NB 4NQEE 4XPTH 3X3FL 3GIVA 3HE6D 4GKSB 2V7NA 1LQSR 1YEKL 4ZOCA 4PGBB 2R39A 1MI5A 3QNYB 4JPIB 3KYKH 1P4BL 1RZJL 3WYRA 3MRRB 1CR9L 3BP5B 3W5MA 3OF6A 1RZFL 1WBZA 4NRZB 4KZDH 1A64A 2EYRA 1CF8L 5HYIA 2V6HA 4XMPH 3QWRA 3UJTH 3ARGA 1PZ5B 4H0HB 1KFAL 4OFKA 3EFDH 1PKQE 2DQCH 4NKOA 4U6XB 5IF0A 1JZ2A 1A6ZB 4LMQI 4OFYD 4XP4H 3WN5B 3T8XA 4LRNH 4XNZB 2YKLH 4DCQB 4M6MH 2GJJA 5EC2B 4KVCH 1GC1C 1X5JA 3MGTB 4KDTA 4U6YB 4E42B 5C0GB 1FNLA 5D2NA 4DZ8A 3HPJA 4PB9L 4QRRE 3PJSA 4QHLA 1WWBX 3F12A 3I50L 3BPLC 4DFIA 5TQ2H 3VE0A 3OBAA 4BH7A 3UTTE 4CMHB 4NC0B 3ULVC 1MH5B 4MAYC 5M95B 1J5OL 3MV01 1KLUB 5GS1B 2BVOB 2YD5A 1J0YA 1B4JH 1AJ7L 4Z7UB 5ERWA 3OKMB 5CZXC 5D1XD 1HQ4A 3L95A 1LO0L 3WLBA 4JDVA 5GJSL 3LDBC 4ODVH 1VGEL 4MNHA 1JYNA 1WAAE 4HKXB 4P59H 4KY1L 1FC2D 3VFSA 4G6JH 1BJ8A 5I71C 3VRLF 5T3XD 3EFDL 1Z2KA 2A77H 2ORBL 4QRPD 5D2NB 4DZ8B 5CJXC 4NBXB 3MGTA 4E42A 2VITA 3I84A 5DF0A 3VRJB 2F58H 4K3JH 3JWDC 1HHIB 3MJGX 3F58L 5I1JL 2WP3O 3WLWD 4NKOB 4U6XA 5LQBH 3WCYA 3MJ9L 4R26L 3K8KA 1GAFH 3R06B 1EO7A 2ARJA 3X3FH 3VXTA 2NMSA 3CZJA 5I73C 1NC4D 3UJJL 1A9BB 1WZ1L 2VZOA 1NCWL 1QFWM 3BP5A 4XH2B 1A6AB 4X99B 1CU4H 2CKBB 1GGUA 5E8DL 2BVPA 4M43L 3VGHA 4JPIA 3KHQA 3LY6A 3QNYA 1JPTL 1LP9E 3KPRD 4ZUVA 2Y72A 1IGYA 2V7NB 2W65B 3AM8C 3AY4C 1VKXB 1UYWL 1BJ1H 4XNMB 1JRHH 1AGDB 3PWJA 4L4VA 4WTWA 4M7JH 3PIQA 3CMOH 4NUJB 2AV7A 2BMKA 2IGFH 2NNAB 4OLXL 3LH2L 2WUBH 1RUQL 2AJXH 1HIMH 5E7BA 4WUUB 4NKDA 3TCLA 4X4ZA 4W6YB 4WW1B 3QUML 3LQAH 3KXFB 1X3DA 4KAQH 4M62H 3ECBB 4U1LA 4UINH 4PJ9C 5ISZD 1NEZB 4MQXD 4ONHA 4RISL 3CSPA 4YFLI 3NAAH 3WUWB 3HMXA 1JNNH 4XVJL 5C6WH 4PJ8A 4ZSOA 2BHYA 3B5HA 3IF1B 3O2DA 2X40A 4KI5F 2JELH 4M93B 5E8OA 1W0WB 5A16A 2VDML 3PHOB 3BEWB 5GRYA 1EVTC 1ZAGA 1WWCA 3L5WB 2VISA 2VO5A 4IEFB 5JOFB 1RHFA 4UDUB 1N5YL 4L4VD 1T04B 3EYSL 4OCMC 5EIVA 4HPYL 4FZEL 4HUNB 5SV4A 4BUGA 2OI9C 5DJ0B 3GI9L 3MOQA 2E7CA 2VLRB 1AD9A 1UQSB 1WFUA 3C5ZA 4OLVL 1GGTA 1T6VN 5FK9B 2X1XR 3WJLA 2Z93A 1U8PB 1YEDA 1QFWL 5FYJL 1JNLH 3L1OH 1JYWA 2B1HL 5D5ME 3MV9E 2F74B 1HHJB 4OGAD 3TNMB 1XF4A 3OKKA 3QPQC 1YPZB 5C0EB 1C8PA 3QDJE 5MEOA 4C54A 1N2RB 5FYKE 1TZGH 4F9LA 5TH2B 3IU4H 4HXBL 5E08H 5F9AC 3VXNA 1ODAA 5B38B 2D9CA 5IEKB 3HZMB 2FR4B 1L7IH 5KS9A 3KPSB 4FG6C 4JFEA 1U3JA 1PGRB 3ZSSA 1NEZG 3H3BC 2D03L 3KLAB 4I4WA 2X10A 1YNLL 4OZGB 4UI2A 1XF3B 1U8OB 4JFDA 4KI5C 4J6RH 2VLJB 2EKSB 5IFHL 5MI0B 3WLWC 1ZSDA 3IRPX 4F8QA 2DL9A 2OJZH 4PV9B 2X4NA 2NYYD 3NFPB 4WNQA 4F33B 1CK0L 3W39B 3O6FC 1BREA 4TRPH 4XMLL 4Z76A 1RK0A 1KLGB 1EVUA 5F3HA 3IJSA 4GKZA 2FJFA 1B0GA 2HVKB 2ICWJ 1I1CA 5D1ZD 4WEBL 3SBWC 2G2RB 4YPGA 2NLJA 4ZO8A 2OR9H 4JN2B 4HWNA 5I6XC 3LVEA 4NCC1 1I9JH 1K2DA 2BVUA 5DMKB 5DJAA 1LO5B 5GGTA 4QO1A 4U1KA 3V5DB 3SDAC 3NAAL 5TF0A 1U8QB 1KYOK 1FNSL 1FORL 1CD0A 1ZXQA 2G60L 4KAQL 2W91A 2Y36H 2MCPH 1ORSA 5GS2H 4KPHL 4DK3A 1I3GH 4QLRA 3WE6A 3EYOA 3LB6C 1TZHB 4P5KA 1BQLH 1MHHB 1OAYH 4F8TA 4Z0BH 4MJ2A 3GSRA 4PG2C 2DWEB 5HYSG 1E4WL 5DJXA 3QXUA 1TTGA 3BO8B 1JRHL 1GGIH 5C0CB 3DMMC 4MAYB 3FO1B 3HG1D 2X1QA 2XA8L 1EJOH 5EO0A 4Y2DC 2DM7A 3VXSB 4MQ7B 4XX1E 1JPTH 1ZLWH 1QR1B 4OFVA 2VLRD 3A67H 5A40E 2UZYB 5H94A 4OCXL 3DUSA 1A2YB 1FNHA 4HT1H 4DGIH 2DLTA 2W0FA 4ESKA 4S2SA 2YS4A 2BRRL 5ACZB 1YEJH 2F5AH 1CCZA 4RDQG 2NX5D 5IHLB 4TYUA 4U3CA 3O2DH 4LSUL 3L3KA 4MS8D 5K59F 5MP6L 1CZ8L 1RZIA 3DYMA 4XNQA 3EDKA 1GGYA 4MA3B 4JY5L 4QT5B 3AVEA 3O6FB 3SJVA 3H9SE 3BZEB 5TF1L 2J4WH 1ZLUK 3S37L 1IFHH 4I48A 1L0QA 4Z7WF 5CS7A 3GKZA 1N0XH 2FWOB 1JF1B 1VGEH 3BSZL 3L3IB 5EU5A 5L6YL 5F96H 3RWIA 4P2YA 4F7EA 4X7SL 2J88L 1NC2A 3QH3A 4MCZB 2JJSC 3BZ4A 4AZ8A 3CVIL 3PP3H 1KLFA 1TFHA 3GMLB 5CSGA 4AYFA 1JGDA 5D1ZB 4IRJB 2V2WA 3VFWB 3OAUH 2AK1L 2XWJB 4FQLH 2J3SA 3LD8C 4UT7L 1K8IB 2Z91A 3MRKB 3SGDH 4F7MB 5TQ2L 1FDLH 2YC1A 3TFKD 4P5TB 5C9JA 5TQ0L 3VFNB 4WHYG 3U7AA 2UZXB 3BH9A 4P2RA 4WY7H 1Q94B 2EDJA 3IDXL 3GNMH 2NCMA 1AXSB 3LQMA 1A3RL 4XP5L 3FTGB 4K9EL 3PV7A 3C6LC 2EYTA 4HG4J 1BLNA 3RQ3A 1DBJL 2DRUA 3VW3L 3ES6B 3EUUA 4NWUH 5EU6B 2VJXA 2F53A 3VH8A 3ZE0F 4LCWB 3MYZA 4GG8B 3S4SG 3RTQC 3CZFB 5FIEA 1S7WB 1BEYL 2NXZC 4XNUH 2E6JA 5JPMA 1KEML 3F7VB 3MLXH 4FXGA 1S7UA 1LE5A 4UT6H 4ZOEA 5HHMD 4OB5L 2ZOLA 3QXAA 4DVRH 2DLFL 5FAAA 2E5EA 5DD3H 3VXMD 5HDBE 1JHKL 3NN8B 4HUUB 4JY4A 4P5TD 1U95A 2GJ6D 3L3GA 2WBKA 3UTOA 3CX2A 4F7PB 3JZ7A 1QTYT 3L3JA 5LG1A 3U46B 4EQ3A 4NUGH 5F72S 2J8HA 4J2XA 4N0UA 1FNEA 3CLEH 1MSPA 3DRTA 4KQ4H 4D3CL 4MWFB 1S78C 4X7FC 1NCTA 3L5XH 2OM5A 1FIGH 4P9HH 2A6DA 1C7TA 3U7YH 3GDBA 4OZFG 5IV2A 1HXYA 4XP9H 5DFVC 4XMKL 3O0RL 2R29H 4XB7A 1IGFH 3JWDH 2CLZA 2MHAA 2J12B 4WO4C 3UYRH 2GQHA 3MRHA 3FFDA 1RJZA 1GZQA 4GRLB 4I2XB 3UTTD 1SY6H 1ZA3A 3JV6B 3AM8A 4P23C 2FX7H 1TJHH 3B9KA 2IH3B 5FB8A 2CSPA 4N8CL 3WIHA 2FO1A 4K2UH 4CJ1A 4WHTB 3VXME 1JL8A 2DDQL 5F88B 4I3RH 4JRYA 1I8LC 4XAKE 5F7HA 1SJHA 1KTKE 1VFAB 2LU3A 4D0DB 3REWB 1F4WH 3ZDXF 3FT3A 5D7KD 5E2TL 2X4SA 5L2JA 3OKDA 3MREB 1U0QA 4HAGA 4OTXH 4MB3A 4S1RL 2E9WA 3EFFA 1T20B 5EIQA 3BPCB 2ED9A 1ZT4A 1J1PH 4RIRA 1XCQB 3QFJA 3B9VA 1JGVL 1T5WA 3ZTJG 3ZHKA 3VWJB 3STZA 1XCTA 2R69L 1MFCH 1LO4L 3BKML 2V9RA 1PJ9A 3GSWB 4WW2B 4X6CF 1GIGH 4DJMA 3QG6B 1RIUH 1ZVYA 3ZKNC 1BFVH 4D9LL 1VB9A 4HBQA 2VAAA 4OCWL 3S5LG 4NO0D 1EMTL 5B8CB 4JB9L 4HFWB 1K8DA 3ARTA 1FPTL 3HAEA 5JHLL 1LEKA 5BJTA 4L3CA 3WKMH 3D87B 3MRCB 1F90H 3B83A 4LLMB 1D9KC 5EOCJ 3FQRA 4JRXD 2J6EH 3CJJA 3KPLA 2CDGB 3ZDYF 4W6XB 3ARVA 3LEVL 2A6IB 3BUYB 3C6SB 3GI8L 4F37F 4LPTA 4EI5D 4Q9BA 1TJGL 1XAUA 4GUPB 3S34L 4XCNB 1EO8H 2QKIB 5EIIA 8CGTA 3C6SA 1YC7A 4JFOA 5C08D 4QY8B 1IBGH 4U7SA 4ONFH 2VDRL 3B9EA 4YDJB 4IOFC 4GS7B 5FHBL 4OD3L 3U0PA 3TWCH 2XZZA 5ID1A 3V9FA 1WAAF 3WDJA 1J0JA 1KB5L 2L0DA 4W70A 3KPSD 4OFPA 2WLYA 2NY0B 2VDOL 4MLSA 2EH8L 1E4XI 1T1WB 3VXMA 4HV8B 1KTDA 5KJRL 3QHFL 4L3AA 4X7DC 1TQBC 3U2SB 4KK8D 5GQBA 5EG6C 4UTAH 1XCTB 4G6AD 4L8CB 4D8PA 1OGTB 3ZE0E 2UZIL 2NW2B 2XICA 5I0DA 5CEXB 3H9ZA 1BIHA 1T5WB 4LLDA 4UUJA 3EO0A 2R23B 1K85A 1NJ9B 4G6FD 4G8GD 5J6GA 4IDLA 4F9PC 1NMCC 2Q76B 4YC2C 1MNUL 2R2HB 3V6OA 5L8KB 1EFXD 4KK5C 3VCLB 1YNKH 1Z0NA 4RGNE 5HHOE 3G9AB 4M9PA 1VACB 5D7SH 5F8RC 4YHYB 3D3VE 3GFUA 1XF2A 4WGVB 3H3PH 5JDSA 3PDOA 1N8ZB 3WNNA 2RQ8A 3DVNA 1XGYL 3BIAX 3PWPE 2YD1A 1WFOA 1GOGA 1FBIH 5HHQA 3ARFD 3P0YL 3RWFA 2DIBA 4JREB 3MLYL 2IBZY 4K7PL 5DRXB 3B9KB 5J6HA 5HYJA 4Y5VA 3QG7H 5E70A 2NY2C 1HE7A 4HJJL 5CJ5A 2JCCB 1NGWB 1B9ZA 3EYFA 3P4NB 5CGTA 1RZ8B 1RZKH 3OV6A 1BOGB 1I7UA 3V95A 1T1YB 3CXHK 4DFHA 5DD6A 4K8RH 2B8OT 4ZQKA 3O4OB 5D70H 5IV2B 5HGAB 5EZOH 4YJZL 1IKNC 1JV5B 1F5WA 4Y5XC 5SX5K 2R1YA 2HJLB 4U1HB 2ZG3A 5I1AB 4Y4FA 5D7JB 4HWEL 3EOAA 3UC0L 2CUIA 3I3BA 4MNQB 3UTSA 1KF9B 1Z6JT 3PGDA 3V0WH 1NGPH 1QNZL 2CO6B 1KIUA 1FNEB 4H1LA 4XBPB 3VFVB 4OLUH 1CT8B 2CIKA 4GG6E 1AD0A 2HRPL 4OLEA 3HLAA 3DHJA 5E7FA 3O45A 2EXWD 1XR8A 5DVKA 4WDIB 4GXVH 4F7PA 5GGRB 1ZVHA 1IQDA 4HPOH 2XTJD 2XQBH 1N59A 3ROOA 2NY0C 5JHDB 3HLAB 4MQXC 4F2MA 4LSRL 3NA4A 3DURA 5DQ9B 4OAWA 1G1CA 3QEQD 1CT8A 2CIKB 2ADFL 1UA6L 1CD1B 2ZSWA 4XBPA 5IB2A 5CJXA 2JJSA 3QXAB 3UTSB 3EOAB 3F7YB 2DQIL 1A3LH 4YK4C 2X89A 3VD5A 3HMWH 3SKOA 1ZOXA 4KK5D 3TA3D 5I2IA 4X9BA 2H45A 5HGAA 5DUPL 4OZHF 3QQ3A 2HMID 2FHFA 4X83A 1U36A 2QHRL 5GRXG 4J12A 3ZTNL 2RCSL 2AEPL 4LVNC 1R3HB 4KK8C 3F6IA 1BX2A 3FTGA 5C2UB 1T0MA 2ZCKL 4XCFH 4FQJH 5IFAL 1EZVY 4NZTH 4V2CB 2Z8VC 3A6CH 2GJZB 2EIDA 4DUVA 2O5XH 3FN0L 3AY4A 1OGAE 4PRBB 3CFCH 3D2UA 1NGYA 4G7YL 4A6YH 2EDKA 1MCIA 4O2EA 5AYUH 4CBPA 3VFWA 5C6TH 5D1ZA 3GHBL 4ZAKD 3MLWH 2BSSA 2NZ9C 1I7TB 3ESUF 4R90L 4O58H 2DQGL 3RKPA 3WXVH 5BQ7A 1FCCA 1GC1L 4PTTA 4LLDB 2K9UA 1XH3A 3G6AA 3QO1B 5L8JB 3QIWC 4LLVB 4QCIB 5MENB 4DUWA 4B5EA 3WDIA 1A4JA 5HXMA 3UTZB 1Z3GL 1GOHA 4OGZA 1T1WA 4DTGH 1E28A 1RZIB 5IJVA 5I1GH 1LO2L 5E1AB 4DN4L 4G5ZH 3RWEA 5MEQB 2UV3A 3GIZL 6CGTA 1U58B 5EORL 5AG9A 1IC1A 4LPXA 5CHNA 2F54A 4P57B 5KJRH 1KPUB 3DI2B 1T1XB 3I6GA 1MLBB 3W0WE 1TLKA 3MPCA 1QLRB 4R4BB 5FUOL 1INEL 4XP1H 3KHOA 2AJSL 3SDXE 3VXSA 3QDMA 1OAZH 4TOYH 3VXRA 2C7UA 3BDYL 5IGXH 3LKQB 1GXEA 2LU7A 1FG9C 3EOBB 5C07B 3MNVA 1DQTA 4FNLL 5D72H 3BZFA 4QRQB 2R1XB 4MX7B 2CDGA 5FYLH 2QR0B 2AP2A 4LVNB 3TYGH 2R4RH 2R8SH 4M1DL 4PLKD 4YX2H 5FDWB 2GCYB 4JO1L 3N1QC 3HE6A 4YXHL 4AJ0A 2GT9A 3AMKA 4HFWA 3VGDA 3KGRA 3VWKC 1PSKH 1ED3A 1PX3A 3RDTC 1BJMA 3QG6A 4K8RC 3O2VH 5DRZA 1CYGA 1BAFH 1CFNA 2HFTA 2BP3A 3CFDB 4ELKA 5GHWL 2AK4D 1XGPB 3ARSA 3MCG1 2GUOA 2FJFB 2HVKA 4OGXL 5T1KB 3P4OA 3BKCL 4Z76B 5ANMA 1I3RB 5INCA 2R56H 1T20A 4TUJB 3AU1B 4F9LC 5T33H 4CJ0A 4HGMA 4P9ML 3F62A 4JHWH 2ZUTA 5C2BH 3A6CL 1AQKL 2X4SB 2Z35B 1ZSDB 3REWA 3VH8G 35C8L 5IGXL 4WU5A 1SJHB 2A9NH 2IAMC 2XZCH 1F6FB 1E4XH 1WZMA 5GRJH 4G43B 1IGMH 1BIIB 2XTLA 2XG4A 4JRYB 4FTVD 5CINH 2H32H 2YD3A 4G42B 5L8LB 4JFDB 2XZQL 4X6FA 4EXKA 3KLAA 4I4WB 3UP1A 3AB0B 1V5JA 4LVOC 1PLGL 4JG1H 1RJYB 4OZ4A 2OR7A 4XPBL 5KS9B 1EERB 2XT1B 2JIXB 4RSVA 4LCUB 4F15B 2I9TB 4RMWA 1JIBA 5DGRA 5IVXB 1MIEH 1S8DA 1SJEA 3GIZH 3K2UH 5D7KE 3QUYD 4ODHL 3ARFB 4WENB 3IFOA 1S9VB 3JUZA 3O4LA 4RFOL 5T5FL 5D2LE 1I8MA 2FX7L 4OIIH 2R2EA 4UDTB 5C0EA 5FHAH 3QAZB 1AIFB 1HHJA 1F4XH 1MHPL 2AJ3A 2BX5A 4GXVL 5F3BA 1FL5A 2ED7A 3MOAL 4RGOL 3SE4C 3DRTB 4YE4H 2HRPH 4TULL 5DJ0A 1GSMA 5KVDL 2UYLB 4YEFA 5J12B 5D1XA 5FO9B 1YYLH 3L3JB 3NTCL 4URTB 4NT6B 2CD0A 3CFEB 2A1WL 1RURL 2A6KB 3L5WA 4GAJL 3GSVA 1EK3A 3OHXA 1A1NA 5C09D 2MPAH 4KK9D 1FQ9C 5I8OH 3JV4B 4GSDH 5IW3A 3SN6N 3WUWA 5H2BB 3NGBB 4M1CD 4M3KB 4G6MH 3DV6A 4U1LB 3SGJA 2AJYH 1G84A 5JPMB 1QHPA 4MB4A 5B22A 4JQIH 4KXZH 4NZTL 4PJCF 3PGCB 3CZFA 3RGVD 1DN2A 1F3RB 5IFAH 4DZBA 3D39E 1WZLA 4OFYA 1KACB 4GW1A 4EN3A 3ES6A 3K4AA 1L9MA 1J11A 3C9NB 1DR9A 5L2KE 3NTCH 2AABH 1KEMH 1HILA 3OWEA 1WTGT 3N85L 1EIBA 4P2QA 5HYSA 1AO7E 2A9ML 4NQDE 5ICYA 4XCEA 3MOBH 3LN5B 2BVPB 4XH2A 3N9GH 1ZE3C 3BH9B 5GGSY 3I2CL 1JMXA 3IDIB 5LXGH 1DBJH 1MCWW 2AS5M 2OBGA 4P5TA 3VXTB 1BQHA 2CDEA 3FRPG 3TNNA 4FP8L 1QZ1A 3K1DA 4R97B 2FL5A 1DZBA 1RZKC 3SO3B 4PJGA 3U1SL 4O9HL 4G6KL 3QH3B 1OT2A 4K7FA 3CXDL 4F7EB 3O3AA 1PLGH 4JG1L 3CFBB 4RZCA 4JJ5A 3DMMD 4EDWH 3CSBA 4G8IA 4WFFD 4JFHE 5ECJE 5EB9A 5IMLB 4FXLA 1AO7A 2LVCA 4LLAA 2HH0H 1KJMB 3MMEA 5BS0D 3TO4D 3OKMA 5B39G 5DJYB 2CJUL 2VH5H 1KBGH 4Q2ZB 1BZ9A 1QSFD 1KLUA 4M6OL 5T33L 5KVMC 1NBQA 4H25A 2J4WL 3CFIC 2ATPB 4OZHA 3QG7L 5D7LB 4CMMB 4UOW1 2HLFC 1S5IL 1N26A 1HQRB 4JN1H 2IPUK 4K7PH 3MV11 3DUSB 3PNWA 4Q74A 1NBYA 4I0PD 4IRSC 5GISL 3GUTA 1UH4A 3UTQA 4MQ7A 2AV1B 1R3LB 4WGWB 2DQTH 2FHCA 2M26A 5EO0B 1XMWA 2VL5A 4G3YL 4W4OC 2F5AL 1LD9A 5FA3A 2E3VA 3QUYC 2QQQA 4EDXA 4P3WA 2SEBA 3KJ4B 3TJHD 4QXWA 1PZ5A 3ARGB 2NXYB 1LO4H 3NFNB 4JFHD 2EIEA 4FNLH 4J3UA 5D72L 5DRWB 3RX8A 2IFFL 1SYVB 2V7HA 4LHUB 4ZXBD 2X44D 4WW2F 3MRRA 1FHGA 3X13A 2FDBP 2OCFD 5D7LE 1U8QA 4V2BA 1MI5B 3G5VA 1OAZL 5AYQA 2BOBB 4U1KB 1KJ3H 4UB0H 1QSFE 1K2DB 5DMKA 5J11C 5BO1H 1NBVL 4MZ2A 1VA9A 3SE3A 4GMSL 4CU8A 3NZHH 1JTOA 3FRUA 1IAMA 2ICES 4YZFF 2VDOH 1A7QH 4MA7L 3ZDYE 1CDJA 4IJ3B 1BFOB 2J5LC 4QNPE 1YY9C 1IAIH 3PV6A 1I1AD 4PRIA 1GZPA 1QA9B 3PWUB 3KNBB 3T0EC 3IDNB 1Q1JL 2X70A 3LKPB 3AREB 5EUOE 1SQ2N 3VXQA 4NO2A 3EO1A 4MGXA 1A6UH 4V1DB 2NY5H 5A2FA 1OAKL 1UKTA 4QXUL 2IANA 1OOAA 3KPQB 3EGSB 4GQPH 2A0LD 3B9KC 4QRPB 4X6CE 1HWHB 1CK0H 1MUJB 1QRND 1A21A 3KPNB 4OZGA 4LF3B 1EXUA 4IDJL 3B3IB 4HS3A 3QUZB 3OTTA 2VB5A 2DQGH 5C0IA 4IMLA 3HZMA 2AK4A 2HP4A 5IEKA 1LEGB 5DUMH 3VXNB 4U1SA 2NR6D 2R4SH 1HN1A 1OAXH 4XXCA 3HR6A 1J0ZA 1J8HE 1FFOB 1H3XA 2IADB 4XTRC 2BY2A 4A6YL 4D9LH 3TNMA 3UDWC 2NY1B 1G6RL 4Z7VF 3GO1H 2R69H 4HC1L 2XACC 1MJ8L 1ND0B 1AD9B 3RZCD 1KT2A 1G6VK 2EECA 5I18H 5J9PB 3D9AH 4LBEA 1T04A 3ZTNH 4KRPD 3ULUC 4U1JB 1DQDH 3ULSA 3LKNB 5E6IA 4TNVF 4NN5B 1UCTA 5D8JH 5ID0B 4XNUL 1QFWH 1SVCP 4PTUB 3BEWA 4YIQA 5DUPH 5E8OB 1FIEA 4F58L 1T83C 3BE1H 3MXWL 4QXTB 2B7DT 3IF1A 5FGRA 1OCWL 1RUMH 5FDYA 1YJDC 4IRSB 5GZOD 5IKCA 1MVUA 4F9PA 2VDQL 4I3RL 4ONHB 3PWLB 3ECBA 1QFPA 1CGWA 4L8SA 2NX5B 1KPRB 1CDYA 4D0CA 4LSRH 2PW1B 1T7XA 5C08A 2DAVA 3VFGH 4AG4H 1U8IA 3T2NL 5F44A 3PIQB 4NUJA 3LS4H 1MPAL 4KUCD 1N6VA 3AXLA 4Q9RH 3O0RH 1FDLL 1RUPH 1IC5L 3OR7B 4TTGA 1IGYB 1KCKA 1QNZH 4IRZL 3S98A 4P9HL 3QWQB 4UIMB 1QPXA 4OLXH 4X99A 1RUKL 2CRMA 4CVZB 5JW3L 4QTHA 5ITFA 5C07D 3DOSA 3RA7L 4OFIA 4Y5YA 2A2QT 1FZMB 4U1NB 2IC2A 1I7RA 4HKJB 1HINH 4Z0XB 2Y25A 3U4BL 5J13C 3MV9D 1Q9OB 4HK3N 4HK0A 1FE8L 4MMZC 4XNZC 3DO7A 2VRAA 3H6JA 2VLME 4X9IA 1DBKL 1IKFL 4NRXA 4Z8FH 4PP2B 4O2CB 5LGJB 2YPVH 5F1SA 4PJEE 3U48A 3B2UC 3V8CA 3QCVH 4G80B 2ZCHH 5LQBL 5K9KB 3S5LB 2BRQA 4DVRL 3AC0A 1R24B 1WIUA 1BZ7A 1I4FB 2QQKH 3FOMA 4K3JL 4JANA 3SOBL 4WI3A 5KSUA 2Z31C 3D0VB 1GCFA 1XGYH 1CQKA 4P2OD 2I25N 1RULL 2FJHB 1QVOB 1I7ZB 2BRRH 1CVSC 5I8CB 2EZ0D 1QOKA 1DUYB 1RVFL 1F6AB 5GS1A 1QQDA 4Z95H 5EU6E 1OTUD 4X9FA 3VXUB 5TDPA 4G9DA 3BIBX 4Y5VC 3FO0L 1EJOL 1FVCB 2FJHA 4ODVL 5E94B 3UCRA 3F7RA 5GJSH 1W0VB 2BK8A 1AHWC 1LP9B 4JANB 2YOCA 2OK0H 1I4FA 1BZ7B 2VKXA 4Z18A 4F7CA 5SWZD 5IB1B 4UTAL 4X7EC 4LLUA 3RZCB 5B3JE 2B20A 3OL2A 4U6YA 1C08B 1XGRA 2E7BA 4ISVB 4O2CA 3VD4A 1NMCB 1DUZB 1WJ3A 3VD7A 3MRGB 5I15H 3T77B 4O5LL 3FZUC 3IDGA 1QRKA 1OGAD 4TSAL 3STLA 2DQFB 4Z6AT 2EH7L 1OLLA 4NWTL 4JY6A 2BERA 4X6BA 1YY9D 3KXFE 3QUKA 4KKAD 1OB1A 4I9WE 2V2TA 3QFJD 1EFXA 1VFOA 5K59E 3I02A 5E99H 2BFVL 1WBZB 4NRZA 2IAND 3ZTJH 4CVZA 1GGCL 4X98A 2AAVA 2OX5A 1I3UA 3KYNA 4EUPB 5LGHL 1TVBB 1MAKA 3DLQR 4RMQA 3GIVB 4LCWD 3MUY1 3ILPA 4R0LB 5MP6H 1CGUA 3MRDB 3C5JB 1E27A 2VLRE 1NCDL 1PEWA 3KYKL 3E2HB 2PTUA 3RTQB 1F90L 2YN5A 5DI8A 4B50A 3IGAA 1JNHA 1IGJA 2FATH 1NAMA 3QUZC 4XPFH 5D5MB 1DQQA 1R5VA 4EI6B 4NSKB 4H5SB 4LL9A 4ODWB 5GS3A 4G6AC 1J8HA 3T3PE 2OTWA 2G75B 4M7KH 1AKJA 4ZFFB 4AIXA 5CEZD 1XZ0B 3WFBH 5F1IB 4J8RB 5HGHA 5HHOA 4EIGB 3O41A 3LV3B 4PTUA 4JDZB 2HWZL 2HJKB 1HSBA 3LKNA 5E6IB 3CCHB 3ISWA 4Z7WB 3HUJF 1MI5D 4PGZA 1QFUH 1BQLL 3CX5J 5BRZB 3J8F7 4XNYL 3VGAB 5I1IL 1RZ7H 1ND0A 4XXDA 4KPHH 2C3HA 2CRYA 4I3SL 4JFQB 4G7VL 4J7RA 4JPVH 4L3ED 2OZ4H 2IADA 1R3JB 1I9JL 4J4PC 4QHUB 3TT1L 5J56B 3NACH 2Z8WC 1CQYA 1WVZA 4AEHL 1OW0C 4ODSH 5AEAA 3G5XB 4C4KT 4IMLB 4ZO9A 4EIZC 1F4HA 3U79A 2F15A 3QISA 4X5LA 2I26N 4EUPG 3KPNA 1KN4L 1MUJA 4R0LC 2KZWA 1U2HA 5AG8A 3MGOA 3LIZH 5BXFA 3WFZA 5HVHB 4XNYH 4Y1AD 1JYXA 1DDHA 2IANB 2IGFL 1T21B 2JF1A 2ZUQC 3HZYA 5DHYA 4PRHE 1SJVA 4D3CH 3FHAA 1KIQA 3I6KB 3L7EA 4ZFOL 4JRXA 1K4CA 5EU7E 3H3KA 5EWIL 3GJFK 3FOLA 3HC3L 1GZPB 3JWNC 3LZFH 2EIZB 2O61B 2WAHA 4LNRB 3UEZA 5GRVK 5BOZG 1OM3H 4OZFH 1N64L 3KVQA 5I6XB 1XGUB 1WZ1H 1YMMD 3RVTC 3MRFA 2YPKA 4N5ED 5K33A 4Z7NE 5GIRB 3ZKMC 1CFVH 4ERSL 1KNOA 3SKJH 3X11A 2GJ6E 1EDQA 3D69B 1U8HA 1VERA 4UT6L 4Z7VE 4XXCC 2F58L 4TQEL 3VWKA 3SO5A 3MV8A 5FOBA 3RDTA 2NY1D 4KZEH 2ZUSA 4QWWD 3WFDH 5KZCD 4ZFZB 4NWUL 3KLSA 4FZEH 5DYOB 4XRCA 1GVIA 1N5YH 4EDXB 3VG0H 3WSQH 4EXPX 3MLSH 2JE8A 4NM4L 5JW5B 3RFZC 5JNYA 4JFFE 1C12A 1JTPA 2VDMH 3WS6C 2XKUA 4LCIL 1IAKA 5B4MC 4DK6A 3I85A 4LHQB 3NPSC 2CLRA 1B4JL 1JNNL 5C92A 4R2GB 3O8XC 3B43A 1IQWL 1N6QL 4OSUL 2R0WH 5TQ0H 4MDJB 1J86A 4PJCB 1MCNA 3IFPA 4PREB 4CMMA 3QQ9D 5FYLE 1DEDA 1XGTB 3EYQC 1R3IL 2DMBA 1TTUA 2AJXL 4NYLA 4RAUA 1FCGA 1VFBA 2XPGB 3BOVA 3TJEL 4YXLL 3RPIB 2HT4D 3E6FB 2QSVA 2MNUA 3CVIH 4K55A 4LCYA 2EC9T 4IBLT 2Q8AL 1GHFL 3BWAB 4NNXA 1Q9WB 3T4AB 1HHGA 2RFXB 6FABH 4J3SA 8FABA 25C8L 1MCLA 5BCAA 3HUJB 5TDOA 3GKWH 1JWSA 2YD2A 3OXSB 4EN3C 4JJ5B 4P99A 1MHEA 4FFVD 3GMNB 5MEPA 1WFNA 5C0DA 2K7QA 3FQTA 1TVHA 3C6LB 1CF8H 1M6OB 1T5XA 5IB3A 1ACZA 4PJCE 1X5KA 4PJGB 3BYYA 5C9KA 3IS0X 1WBXB 1EPFA 4Q0XH 3GMOB 5JQ6H 4GRMB 3TH4T 3RGHA 3T09A 2CKBL 4UU9A 3QZWA 2ZCHL 3BAEL 1FFRA 5GGVH 1KELH 1CGSL 4X4YA 3O4OC 2CGRH 4YDVB 1CLYL 3QQ4B 4B53A 3GKWL 4JRXE 1HKFA 1ZA6B 4P48A 1BWWA 2D0HA 3GGWA 4KY1H 4HBCH 4KXZI 4RMSA 3HI6H 1DANU 2P5ED 4P5MA 5EZLA 4HH9A 4JFZL 1GGIL 4PRPB 2Q8AH 2Y6SD 4YHZL 1S5HA 3HNVL 1IE5A 1PYWA 2B39A 1YYMH 2HFFB 3WNOA 4RAVB 2ICWI 2VABB 1OAYL 2ICEA 5I16A 3A6OA 1CDBA 4DZBB 4M6AA 3FL7A 1CICB 3UYOD 5HDQL 3BN9D 4IJ3C 3FT2B 3LS4L 5FV2A 2D31A 4Q6IB 3VWKD 4QOKD 3QUXA 5EN2B 5DMYA 2ITCA 3O4LE 1JZ7A 2IG2H 1FGVL 3LKRB 4HIXH 3NCMA 4OKVA 1AHWA 3LEXB 2FEDC 4HAFA 2DS4A 4AQOA 4ENEC 1ZV5A 5HI5C 3WSQL 4RMTA 3A0OA 2GSIA 3P9MB 3VG0L 5IBLC 1OP3K 1BQHG 5CJOH 2EZ0C 4UQ3B 1A1MB 5HHVH 5D9SA 2OL3H 3O3DB 1YPZF 3IAPA 3BH8B 4R7DA 4F57H 3EHBD 4KRNA 3QDMD 5I75B 5IQ7H 5F3BB 4W4OA 3GMMB 2WWMC 43C9B 2R2EB 4UDTA 4YHPA 5DJCA 2X7LB 4Y2OA 4J6RL 4KJWD 3MCLH 3KYAA 3O4LB 1S9VA 4UQ2B 5E03A 3ARFA 1LO3L 3IDJA 4R7NA 3JTTA 4EOWH 4FHBD 5IVXA 1FL3A 2CRIA 3SCMB 1TCRB 3CLFL 4U2YA 1DN0A 2CDFB 2JIXA 1X5LA 2BNQE 3HZKB 3IU4L 3P77B 1ZWIA 4Y16C 1LK3H 3T3ME 4IRJD 4HULB 5BRZD 3SGKC 1CE6B 1CIUA 3Q5YA 1OAXL 3HE7D 2K3TA 1BIIA 4HHAA 3SDAD 4Z77A 1BM3L 3TA3A 3X14B 4APQC 1NANI 5K9QI 5LGKA 4OCSL 2FHBA 3CVHB 4G8EA 5IQ7L 4GW5A 4RCAA 3RVWD 4PUBL 3TVMD 4K7PY 5IIEA 3EJYD 2OL3L 4RRPA 5H8DA 1ZHLA 1VENA 3BGMA 4KMTL 2IBBA 4I1NB 5ANMB 4QRTA 5DMJB 1ORQB 3O6FD 3VXRE 1CXFA 5EA0H 2HYMA 1M05A 5I1CH 3EYVB 4J3VA 1IJ9A 1FYTD 4KTEH 1FG2B 1Q0YH 1YC8A 4ONOA 3HC4L 2R1WB 3IS1X 3HR5B 1JPSL 3RWJB 4LKCB 4HD9A 1A7QL 3E8UL 2GT9B 4UTBL 1RZGA 2VZTA 4PP1D 4PRDA 5FGCE 5L9DL 3PHSA 4GMTL 5BO1L 3B8SA 2P7TA 2OXHA 2HTLC 1Z9MA 4R4FH 1RU9H 1J8KA 2QR0A 1JPGB 1YUHA 4JPWL 4MX7A 2R1XA 5KSAB 4ZPTA 4OF5A 1B6UA 4PLJD 1S7QB 4JZNB 3EOBA 4UV7L 1MRDH 1ZHKA 4LPWA 5CMAA 2DTMH 3P73A 2C7UB 5F9JA 4C55A 3MR9B 5EU3A 3QDMB 3G5ZA 1CU4L 4Q58C 2V5RA 1QLRA 7CGTA 2BNQA 1NLDL 1GAFL 2WWKT 4KJQD 3PABA 5FO8B 1A7BA 4P57A 5CEZE 2G9HB 5BZWB 3TYFA 4WHYH 1ADQL 3CGTA 3BKYL 5SWSD 4L4TB 5JQ6L 3HMXL 1MCOL 3KPOB 5IJVB 2VXVL 3RY4A 1B3JA 5AUMB 1RIVL 4MNGE 3QP3A 1QFHA 5EOQH 2HT3C 4PJ9A 4HIEA 3MFGB 1X9QA 1GGCH 3ABZA 3G6AB 1NCCL 2YMXL 2N7AA 2ZPKL 3C8KB 4M6OH 4PTTB 4OV5A 2VH5L 4YWGL 5IW6B 2ESVD 4AIZB 1KIRA 1F3DJ 1KN2H 4Q9CA 1AGFB 2HH0L 2ZNWA 5IHZB 2J6EA 3HG1E 5T1DH 1E4KA 3LPFA 1H3TA 4R8WL 3FB8B 1UCBH 3RWCB 3GB7B 1BD2D 2PXYB 2OL3B 4O5LH 4GAFB 4ZSOE 4OKDA 5E2WL 3ETBF 2Q1EA 5DHVB 3QULA 4CNIB 4OSUH 4R8WH 4O9HH 2AKRB 4EBQH 1FZOB 1OTSD 1MFEH 2IPTH 5I8KL 4PB9H 3ROLB 1NDMA 3OKEB 3Q3GB 4HCRL 1H8OA 3W0WD 1KXVC 1MHCA 3WS6A 1NAKH 3BFOA 3L3DA 5CUSL 1T0MB 1UEMA 2WBJC 1AQDA 2VIRB 3WNMA 1TIUA 2GFBA 3O11A 1J1OH 4MJ5B 1ZGLA 3QEUB 5JA8B 5DK2A 3UTSE 4HWUA 3NH7H 4PY8I 1N0LA 4KZEL 5LWYH 3ZKQD 4K71C 4WV1A 3DIFA 4LVEA 3DGCR 1RZFH 2DQJH 4C57C 32C2A 2FRGP 1L0XA 1EGJA 1FFQA 5GS1C 3VGFA 2W0KA 4APQD 1TQBB 5KW9H 2X4TA 3WKNA 5IFJA 3MFFA 4GRLD 1NFIB 2Z8RA 4JQIL 4KUZH 2HVJB 1NPUA 1N64H 2C3GA 4IRJC 1DBKH 1T7ZA 1IQDB 4PLOB 5GGTL 5DTFA 3QRGL 4UAOC 3C09C 3LKSB 3OX8A 1P2CA 4H1LB 4HLJA 1MRDL 3IYLW 3MLUH 4WJ5B 3QDHA 4F3FA 1JWMB 2EO1A 3QI9B 1WAAA 5D7JA 4Y4FB 1MWAL 2VKWA 5HDBF 2HJLA 4FS0A 5EULV 5C3LD 3P4LA 1IC5H 5KZCB 3VXPB 1WV7T 4CU6A 1NKRA 1A14L 3CSYA 3TZVA 1I7UB 2EEBA 4JZJA 2L7UA 5F9DC 5T1KD 1MQKL 1MAML 2NY2B 3VMPA 1T22A 3HS0B 4MMXC 4UILH 5I30H 3HC4H 4I18B 4ZUSB 5EC1A 1MCWM 4GH7B 4ZODA 3GSXA 5A43C 3FMGL 3VRIA 5BZDB 4YR6A 3CFJA 3K3QA 3V7AE 4BKLB 3EIFA 4U31A 4LEOA 3LHPL 4KROC 1NGQH 1N5AB 1QFWI 4P46C 3T0VA 1P4LA 4WFEE 3Q0HA 4PRAA 4D94A 2O5YL 2X4OB 5FM5M 1QSFA 5SWSA 1QRNB 2FCBA 3K8MA 3MRQB 1VACA 4G8FA 4ZUTA 1YNTB 4XP6L 3T1FB 5C0AD 2C1OB 1F3JB 1FN4B 5C8JB 2H3NA 2GK0A 3AUVA 5CBEB 3SJVD 5EBMB 3NCCB 4GQ9H 5IM7B 2BVQB 2F5BH 2Q76A 4OLWL 5DFVD 1CL7H 4NZRH 4BFBD 1ZKAA 4Z7VA 4LARH 2GJ6A 1YNTA 5GPRA 2XWTB 1MI5E 3VI3F 4DGVL 5BV7L 4OM1L 4P9MH 3T0AA 1QRNA 3FQNB 4R2GC 1EO5A 1UH2A 1KTDB 1PG7X 2ZWLT 2P8MB 1A7OL 4P3DA 4P23D 1KCRH 4EOWL 1A02N 4DGYH 3WFCL 5DJ8B 3MCLL 2NPLX 3OJDB 4BZ2H 4BFIB 1FO0A 3RIFF 5DUML 2V17H 3U0PB 5JOPD 1RAMA 5EC1B 3E3QE 4OZHE 4XVTL 1NCDH 4S1QL 5AD0B 4CW1B 4JZJB 3IXTA 2W0PA 4XCCL 1M7IA 2XKNB 1UB6A 4ZOAA 3BW9B 3GBNH 4GUPA 1EEUA 4QXUH 1KCUL 2GTWB 1RFDL 2UWEB 1IT9H 4ZUUA 3N1FC 1TZIB 2A6IA 5E2VH 1D5XB 1Z9SA 2QL1A 2IQAA 4CADA 4Y1AE 4LHUD 1P2CB 3N50A 1CXLA 4X0KB 3FN3A 1YA5A 4P23B 5HDLA 5DHVH 4YNYA 1MCRA 3HAEB 1K8DB 3EZ8A 1C5BH 2VLKB 1CE1L 2RHEA 4GMSH 4BQ8A 2DQEH 4FTVA 5IFJB 2GSGB 3OAYK 1FSKC 3GSWA 1FAIH 4X8XA 1A1OB 3TBSB 2N56A 3VWJA 2OK0L 3O8XD 2AJUH 32C2B 2VQ1B 2E7LA 4KGLA 3QFJB 1XCQA 1IAIM 3RUGB 4Y16B 4H26B 1UH3A 3S3JA 4P2QE 1A0QL 2VERN 2NTSP 3H2WA 2OQJB 4GRWH 5T1LD 3OKDB 5KOMC 3QEGH 4F7TA 3Q5TA 2OP4H 2VIRA 1L6XA 3H7BB 1RQ5A 1RUAL 4LFHG 1ZT1B 3D39A 4LLWB 3OKOB 1INDH 3L5JA 3VJ6A 4JQVA 3RDTD 2P8LB 1P4IL 4X5XB 1U8KA 2QQKL 2DM3A 4Z9KB 3ROLA 1IEAA 1LDPL 4IOSD 5CJ8A 4DAGL 3GHBH 3MNWB 3JUYA 1DEEA 3QCVL 3QULB 2IH3A 4CNIA 4RFNC 3JV6A 3FFDB 3RY5A 2OL3A 3GJFH 4O51A 3RWCA 2CLZB 5HY9B 4UBDC 3G6JE 5CIPA 3HI5L 3KPPB 1D5IH 5D6DA 4MXVE 1OSZB 3QNZB 4LSSL 5IVZB 2YEZB 2OTUB 3DX9B 1QFOA 1GHFH 2ZCKH 3RA7H 1EFQA 5JW3H 1O0VA 5T1MB 5JZ7D 3TJEH 2PR4L 3ARWA 4L8DB 4RQQA 2HN7B 4HIEB 5MHSD 4POUB 1YN6B 2J8UB 1J87A 4N0UB 5IBTL 3CUPA 2IQ9L 1NBZA 3U46A 1TCMA 4PJGF 4PRNB 1YPZE 1J10A 43CAA 1HEZB 5D2LA 1N6QH 3KPOA 3LRSB 4MDIB 3BEVB 4TN9A 2XXMB 1J88A 4NQDB 3VWJD 3OPZH 4YQXH 1U91A 3NN8A 1UA6H 3MJ8A 3BVNB 4GBXA 1JI2A 4QRRB 2P5WE 2P8PB 4R96A 5ADOL 5BV7C 3PL6A 4N90E 5CLTA 4UV4L 1KJ2H 2BY3A 1LE5B 1B88A 1DBBL 3F7VA 2NXZB 3N9GL 4JLRB 1Q9KA 4LLQA 3WFDL 3G5YA 3G5ZB 3MV7D 1S7WA 3MXWH 1XR9B 5EU3B 4YUEH 3N85H 4KHXL 3DXAA 4IHOB 5EU6A 1IM3B 3V0WL 5D8JL 5DO2C 1S7QA 4GRWE 2X4PB 4ZPTB 3VXSD 4Q97A 3FFCD 4Z5RB 2D0GA 4L5FL 5CZVL 5L7XL 3SDYL 1DVFB 2Q7NA 4M02A 2KH2B 2J2ZA 1F58L 5D70L 1O7SA 4YHOL 1RZGB 1OQXA 2CUMA 4QHMB 3VFMB 4X6DE 4LKCA 2P5WB 3DROB 2E7MA 1EHXA 2YXFA 1LVEA 3E6HB 4HK3J 4D9QD 2P4AB 1PG7L 4XGZB 4KI5D 4K23H 4OF6A 4F7MA 5IHUL 3B8YA 3T04D 3O3BB 3QA3A 4E41A 3D48R 2ZCLL 2DBLH 1CFQB 2JK5A 1YEFL 5F7LB 3EJZD 5C6PB 5DVLA 3QJFB 4PJAA 4RA0C 1TPXC 3QUXC 5ILTL 3KPRB 4OQ1A 1XF5A 3BESR 2EDNA 1I8IA 4WFFE 2FX9H 3NPSB 5D71L 5HYQB 4I48B 1YJDL 3QPQD 1S9WA 3U0WH 4OGAC 4FQCL 4X5WB 5C0CE 4EI5B 2BNRA 5IB5B 4L4TD 5JLZA 1BVKA 1A6UL 3VXSE 2AEQH 1AXTL 3DUUB 4P4RB 4JHZA 1S3KH 1CE6A 3KPMB 3L3KB 1I9IL 5LCVL 4JFPB 4NQCB 5DRNA 5EPMA 3IJYA 4ODHH 1J12A 2X1WL 5SWQB 3L7FA 3TT3H 4PJHB 4NQTA 3KYMA 4MA7H 3RWGA 4S2SB 4NJ9H 3UPRA 5IP4A 1NBVH 4UQ2A 1AGBA 4MZ3A 1G9MH 3K8LA 2JTDA 4FQ1H 2BNQD 2KBGA 1QR1A 3BHBA 5HD8C 3TM6A 1CGYA 2ZOKB 1JPFB 3UBXB 3UMTA 5CEYB 5IQ9B 2LAGB 1P84J 4JAMA 5C0CA 3ARED 1Y0LA 5DS8A 3IJHA 4XBEL 1A4KB 4DKFL 4NIKB 2DQUL 4KJYA 3BRFA 4I5BB 4FQQA 5BVPL 4NZDA 3EYOB 5TFSH 4PJAE 3LSOA 2RJMA 4PY7B 1UM6L 4YHNB 4HIHB 4QRPE 4X6CB 4HS6A 4XPFL 4NJAL 3R0NA 3LEVH 3W9EA 2B4CL 1Z0MA 1LK2A 2KQMA 1BAFL 4TVPL 1HSAB 3O2VL 4FFZL 4HEPG 5CJQL 1K6QL 4ZXBB 3IKCB 5EN2A 1TPXB 3QUXB 4A2LA 3RL1A 2YZ8A 1PSKL 3S88H 4NJAH 4JB9H 4D0BB 1B0GB 4WUKH 2ZKHH 3IJSB 1U8LA 1U3HC 2R8SL 2YUVA 2OJEA 3QCTL 4MXQC 1V8HA 1UB5B 2ED8A 4F33A 2HFFA 2PYEE 2HG5A 1UT9A 4W4NA 4PB0L 1EGJH 1ZT7B 2QSCH 2VAJA 5E95B 4HH9B 1FVEA 4PGDB 1FC1A 3QEHA 1HCFX 4H88H 2EDEA 2IPKB 5I75C 2VLJA 4LSPL 5IVXF 5HBBA 4UOJA 3WHE1 5JO5B 3DX6A 3DJ9A 3CVHH 3QIWA 3SEPA 3GSQA 5ACLA 4U4BA 1D6EA 1FZKB 1S9XA 5EORH 3SDCC 1II4E 1WT5C 1WTLA 5TH2A 4DN4H 5DEGB 4XC1H 2EICA 2DMCA 5IB3B 4C56A 1U93B 1UG9A 1RV6X 5MEOB 5ENWA 1YPZA 4K94H 4KKLC 5MEPB 5KN5B 4GG6A 5EO1A 4GS7C 3ZHLA 3OXSA 3UYRL 5TDOB 3GSUA 4NKMA 2HFEA 2E9JA 5AWNL 3IB4A 3RJDA 4HZLA 4FXKB 1ZHBB 4WWID 3WIIH 1UXSA 5DLMH 4OCYL 4Y16D 4AT6A 5JXED 5CSZB 1WF5A 3CDCA 4LLYB 4CDHA 2DD8H 2ESVE 5FKAB 2GKIA 5KSAD 1CG9B 2CR3A 3G6JA 4FQIH 3FT4B 4KRPC 1OP9A 3ZYJA 1G7PB 3MRPA 3L6FA 4L8BA 1AY1H 3WIHL 4PJ8B 3BP7B 3RZCC 1IKFH 4PJCA 3NIFF 3M17A 2BSED 1NEZA 2FLRT 3HE6C 4GSDL 1F58H 4WW1A 1IL1B 2Q6WB 3BDBA 3HPLA 4NKDB 4MCYB 1LGVA 5CZVH 2YUZA 2Z8SA 1EHLH 2APTA 4N1EA 1JP5A 4YBHA 5DJZA 1RUKH 1HDMA 3D3VA 5DYOA 1HWGB 3UJIH 4HJGA 2W65A 2X05A 2PTVA 1JWUA 4ZUWB 5FYKU 1N3NB 2AXGB 4NNYA 3MOAH 2HKHL 4P2OB 1JK8A 1KPVA 3VW3H 4HKBA 5J1SC 2FLBT 5JW4Q 2VDLL 4MNQD 1KJ2L 3B9KD 1MF2L 3SKUD 3R06A 2F8VA 4K9EH 3QWOB 5IJKC 2GHWB 2YPKB 4PV8A 2IAMA 2BVTA 1OPGL 3T0WA 1HHIA 1XIWA 1XGUA 3MXVH 1MIEL 4PGJA 5FYKL 3WUZA 3CU1A 5JPNB 3P4MA 4YBLC 3M8OH 1FV1A 4ZS7L 4WU7A 3I3EA 2EIZA 3ME0A 1MCEA 2O61A 4XPBH 5LAXA 4OLUL 4KU1A 2IBZX 1S7SA 4UT7H 1R0AH 1S78D 1V3LA 4IIQA 2XZQH 4O4YL 2A6JA 2DL2A 2VXSL 5DDHA 5IEHA 4LSPH 4GXUM 4HKXA 3WBDA 1J1XL 3SKNA 5C7XH 5KVGH 1DDHB 1P84K 4NDMB 5TE4L 35C8H 2QADB 4JDVB 1QO3A 3TPKA 3WLBB 1T3FB 1FL6A 3BSZH 5C2BL 1NMAL 5FF6B 4PJIF 4N0YL 4K8RL 1K4DB 1UXWA 2BC4B 4NOFA 3O6ML 3KJ6H 1IMHC 1UZ8B 3VFRB 4LCCB 3GBML 3MYJB 1JJUA 2ZKHL 2WBJA 3M1BA 4WI6A 2HT4C 4JJHA 3VE0B 5DWUH 2LTQC 2V2XA 5J7CC 2BOCA 5F9WC 3OR6A 1JN6B 4DAGH 3V4VH 1KENL 2VSDA 1WEJL 4G6FB 1LDPH 1MLCA 1RJLA 4LKXB 3NCEB 1EEZB 3RRQA 3JWOH 1P4IH 2XWBA 5CJQH 2BHUA 3G08A 4OCYH 4I0PC 2NY7L 4IRSD 3H3PL 4OT1L 1KCVL 4CGTA 5IESL 2OP4L 1ZS8B 5IF0B 2R4RL 1DFBH 3H42H 2H1PH 2I60H 4JFDD 2JKXA 4NN6C 4QKXB 4Y8DC 5IROC 5EUKA 2YPLA 3EYQD 3VD3A 4HFUH 5DEFA 4PRPD 2UZIH 1QACA 2ZUQB 2QHLA 2NY1C 1UM5H 3P3YA 1FH5L 4F37K 3ZLQC 1LHZA 4J8RA 5F1IA 3WHE0 1BECA 2FO4A 3MUGB 5FKPA 1I9EA 2P5WD 1F2XK 1AI1L 3FO9B 4N90D 3LN4A 3VFOA 2GI7A 4GXUN 3TPUA 1PY4A 1DQQB 3C60A 4UB0L 1JNHB 2FIRT 5DI8B 2CK2A 3DRQA 3FFCB 4H88L 5I9QC 1VFUA 2O5ZL 4JKWA 4WEUD 2DLEA 1JRHI 1HH6B 1AXTH 3LN4B 4HMEA 2PF6A 4WEBH 5IUSA 3KLHC 5DD0H 1Z3GH 2CXKA 2FZ3A 3QCTH 2FO4B 5FKPB 5GS0H 3D5OF 5I17B 3L9RA 3RAJL 1K3ZA 1OAQH 4JREC 2FBOJ 4HG4K 2YPLB 3S88L 3I02B 3PXHA 3Q1SL 2DQHL 5DJ6A 3MZTA 5ANME 3WXVL 1EEQA 3L3HA 5GISH 1BQUA 2FNBA 3VMOA 1IC7L 2H26B 4HGWB 3NIGF 1ZS8A 2DQFA 4S1DD 4U6HB 2ILLA 4PJIE 3SDDB 2D03H 4I18C 4MSWA 1U3ZA 3QCUL 4K23L 4O02L 3QR2A 5IK3A 1XGRB 4MJIA 2AJVH 3H9HA 2XWBB 1IRAY 5E9DB 4BFEA 1UWXK 3MLPA 4E9LA 3ARQA 2CJUH 5A1AA 1U92B 4DGVH 1NMAH 15C8L 5GGUB 4MA8H 3H0TA 1DBMH 3SDYH 2J8OA 1OL0A 4L5FH 5E94A 4M1GL 3PQYE 1FVCA 3HNTL 1HYSD 1IVLA 2AEPH 3FB7A 1CDGA 3MTRA 3CC5B 1FFPA 3VXUA 4B7IA 1T0PB 2B1HH 4YH6A 1JNLL 3L1OL 5KG9A 3N1PC 4NZJA 1F6AA 4Y8AA 4KHXH 3UPCA 3SDXA 1G0XA 1REIA 3TLRA 2Y7QB 2LQRA 3HMWL 4PJIB 4NNPH 4WEMB 1AGCB 5GJTH 5HPOA 1C5DB 5DK3A 4LGRB 3DO3A 1R24A 1R3KA 2LABA 2M8XA 3W0WA 4RMVA 2MTPA 2VE6A 1S7SB 5K9QG 5I73B 2VUYA 4AEFA 3B2VH 1U9KA 1S9YB 5I1EH 1D6VL 4WU7B 4YQXL 1MCBA 4XVJH 1MQKH 1DE4B 2ENYA 1PKOA 5SX5H 3DARA 2Y23A 2HJFB 3SE3C 3QFDB 2IAMB 2PO6D 3LCYA 4M62L 3TBVB 1J05A 3ZT5A 5FV1L 3TH3T 5ILTH 4Y5YB 1JF5A 3WS3A 3RBSA 2X41A 3LH2H 3UBXI 4CDGC 3O8XB 3L5XL 1YEFH 3T0EA 2PR4H 1WT5A 4HKBB 4B0MM 3EDJA 5FUZL 4PJDA 3TN0A 5IMOA 4UIMA 5DR5H 2EEDA 4YHLL 3WS3B 3LRHA 3PDDA 4U49A 3DMMB 3K4DA 5BS0A 2BSTB 3FONA 1PQZB 1YQVH 3AS3A 2HJFA 2KUTA 2MQ0A 3H9SB 4PJEA 5GGTH 4R97C 1Z9OA 1AY1L 3UAJC 1KB5A 3PWPB 4D0CB 3U6RB 4G9FE 1KPRA 1KTLB 2DICA 4FQIL 4XBGB 1AR2A 3HRZB 3TC9A 1R3KB 1RURH 2H6PB 1MVUB 4L1DA 1INDL 3BP6B 1K9TA 3L6FB 4L8BB 4QGTA 4ORZC 4JQVC 5I8EA 5F7DA 2VZ3A 3SDXB 1JHLH 1CTOA 5E6ZA 3QEGL 4ZDHB 3NH7L 3OMZA 1HZHL 3TVMB 4IMKA 3OKLB 1YNKL 3ZYOA 1IEBA 4LLYA 1FFPB 3MUZ1 5SX4I 3BPNB 2VQUA 4NRYA 3QXDA 5CSZA 1K3IA 1JBJA 3MODL 3KDMB 2JB6B 4JO4H 4JPKL 2YR3A 3DNKA 3GSUB 1AJ7H 4NKMB 5C08E 3WMSA 4X80H 5C0BE 4G9FB 4GG6B 2Z31D 1C16B 2XKSA 1U93A 4XVSL 1B6DA 3CAFA 5E8NB 5E5MA 1D3CA 3OAUL 1P53A 5DURD 1B2WL 4GAGL 1OTUC 5EO9A 4Z7OF 1D6EB 1RY7B 3FB5B 1KSRA 1U3YA 3Q5OA 5K9JH 1EGJL 2Y07H 4LDLB 4M6ML 5F89B 4Y89A 2XN9B 4PP1C 2DLGA 1RFDH 5DD1H 1KCUH 2WK2A 2YMXH 3PQYA 4YHML 1VEOA 4KKNA 1Z9LA 2EDWA 4BFGA 3S37H 1MFDH 1Q72L 1QBLH 3GBNL 5EOQL 4PGDA 3SPVB 4K9EC 5C0BB 4PD4J 2CR6A 5ICXA 4JVUA 4V1DA 3EO1B 3GI8H 5ALBH 4XCCH 3ZZ1A 4CN1A 1HH6A 3MRNB 4YBQC 1BBJB 3O81A 1CR9H 1H3GA 4GKOA 1DSFL 4KKLD 1QUNA 5D93B 3C5ZC 4PS4L 2V17L 4JFEE 3ARBA 5F7WC 1YEKH 2B4CH 5KS9E 4BZ2L 3BXNA 3MRMB 3WEXB 2WINB 3THMH 2JIXD 1YEJL 4Y4HA 4YXHH 2D7MA 1OGAB 1PVHA 4JO1H 4S11A 1U8MA 1VGKA 2GYSA 5DSCA 3ARBD 3C2AL 1ETZA 1X5ZA 3BKMH 1HSAA 2BOBA 1LK2B 3HAEH 2VSCA 4DKFH 4X6CA 5C0FA 2F19L 3ALXA 5TE6H 1SEBA 5KVFH 1I9RH 3BDYH 2Z4QA 4NCDA 3V6OE 4PJXB 2KPNA 4F15C 2KQNA 4I0PA 5EUOA 2EEAA 2PW2A 1HHHB 3DXAD 4C58B 1CE1H 1MCFA 3T3PF 1BVLA 4NJ9L 1C5BL 5E2TH 4TUOA 2C3VB 3HCVB 4MB5A 4JAMB 1FNSH 1FORH 4KJWC 1OTTD 4JCLA 1ZGLM 1U3HD 1FGNH 3MA7A 4G5ZL 3GK8L 3B5TA 3QJHB 1I9IH 2A38A 1S3KL 3PWVB 1YDPB 4DTGL