1TQCB

Ovine recombinant prp(114-234), arr variant in complex with the vrq14 fab fragment (igg2a)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNLVKQAPGKGFEWMGWINTFTGEPTYADDFKGRFVFSLDTSASTAYLQINNLKNEDTATYFFTRGTDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords prion protein
publication title Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function/immune system
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcB02
5JOPE 2EYTA 3SDXE 4HULB 4GW5B 1TXKA 2L4OA 1FVEA 5F7EL 1S9VB 1Q0YL 5LAXB 1PQZB 1BOYA 1K4CB 2YWZA 2EC9T 3GHEH 2P1YA 2FEDD 3S3PA 1HEZB 1BHGA 1BQHB 3S36X 1JFQH 1IQWH 5I16A 5E8DH 4UAOC 2VUOA 1CICB 1E28A 2VZTA 3GDBA 1CGXA 2F53A 2OBGA 4QRPB 2VISA 4ZTOH 1WITA 4ISVA 1FFPA 1K8IB 4UDUB 1QFWM 4O02L 4EIGB 2YK1H 2FGWH 1FAIH 3PL6C 1A64A 3GMLB 1C08B 5F9WB 1NMBH 4FQ2L 3TP4A 5F7MC 5EBMA 3C60D 3QQ3B 2DN7A 5AYQA 1Y6KR 4OCSH 5EBWA 4Z7UE 4OT1L 1SY6H 1F6AA 4KVNH 3QDJD 3S34H 3ETBF 4HZAA 5MI0B 3SE3C 2ILLA 1Q9WA 5CUSL 4IRZL 1YEDB 3VFOA 1MCKA 3O6KL 3BVNB 1T83A 3MUHL 5HHOA 1T1ZA 1P53A 2Q8BL 4BQCA 1FO0B 2WSKA 1DQDH 5JIPA 3ZLQC 1MQKL 3MRCB 4LK4A 1EO8H 4GAJL 5JQHC 3P77B 1I1AB 5IW3A 1MLCA 4G80A 1RZGA 4NM4H 3FT3A 3BMVA 4NQEE 3BE1L 3LRSB 2AP2A 2GJJA 1AQDB 4JO4H 2DIJA 4PJAB 4MJIA 2BSTB 2R56L 5FHBH 3RDTB 5C07A 3CK0L 1ND0A 2GTWA 2CK2A 3FN9A 4PJ5D 4P23A 3SJVA 2MQ3A 2R69L 4FQIL 5J6GA 4KKAD 4ALAH 3DV6B 1FNEA 2CDGB 4YFLF 1LEKB 1YEGH 4PREA 1L7TL 7CGTA 3B3IA 4L3EA 3AY4C 1LD9B 4KI5E 1OP3H 2D7TH 2CR6A 3WIHL 3ARYA 1GC1C 4I0PB 1RJZB 2IBGA 1H0DA 3GSOB 2VZVA 5H35B 2P44B 4JO3L 1UM6H 4HFWB 3VXRD 4BSJA 1CXKA 5C0EA 5HDQL 3EJYD 4OZGF 4ZNEA 5CSZA 5D9SB 2N56A 3DX9A 5BZDB 2FX8L 4TSAH 1JGEB 5DFVD 4OLVH 2W60A 1CLCA 3MRNA 1HZHH 5HVWA 3WFHB 3DX7A 5DRXB 4OF7A 4HUNB 5I66A 4JQXC 3GIVA 4DN3L 2FH6A 1CFVH 3GMOB 4C4KT 4WWKA 5IB5B 2YEZA 5IOPA 4J4PC 3FFDB 5IMOB 4GRMB 5JXEC 4MXWH 2DWDB 4IJ3B 1O7VA 4KRMB 2VXTH 4H1LH 2AK4B 3LSOA 3S5LA 1NCNA 2YRZA 3QUXB 5D93B 2OMBA 4U7SA 4PP1C 1EO5A 2UUDH 2CXKA 3PP3H 5IQ9A 2P43B 3NFPB 3EYQC 1GOHA 4X4XB 4CADA 1F97A 1AKJD 2CJUH 1WTGT 2PXYB 3LEVH 3OR7A 3NCJL 4L8SB 4P46C 3VG9B 4OFYA 4N5EC 4XCNB 2AXJA 2G75A 4E41E 3RVVD 3NACH 5D8JH 3MREB 5BRZE 1RUMH 4DWHA 2DLEA 2PUQT 1CE6B 4GSDL 3U6RA 1TVBB 1HQ4B 2R0KL 3SDDB 4YXLH 3AS3A 1T7XA 2E6PA 1NLBL 3EYFB 1FYTA 2YUWA 4ZOAA 4OKVA 5DUBA 2W0FA 1ZVSA 1U92B 3QQ9D 5CKAA 1AD0B 5K9KA 1RUPL 1LO3H 4XHQA 2EKJA 1KJVA 4YHOH 1BVLB 4DGVH 3UTSD 3VCLB 1MPAH 4Y8DC 1EMTH 1XGQB 3QIWB 4L4JA 1I3UA 4Y5XC 4PJ7E 2DQIL 3P2TA 5DJ6A 2FJGB 3F8UB 1P69B 3MLZH 1ZAGA 3H3KA 5JPNB 1IAII 2NY1B 4HIIA 1P9MC 5I1JL 3G5VB 5DRZB 3BP7B 3AS0A 3D85B 5GRYA 1WK0A 9CGTA 3OB0K 5DMIH 4OTXL 1K2DB 3EOAA 5DURD 5J06A 1NAKH 3O9WD 4Y4FB 5F96L 2HT2C 4MA1B 4LCIL 4O2CB 1ODAA 3MO1B 1DBBH 3G9VA 1KSRA 4KJWC 4M1GL 4QHKJ 1UM5H 5E5RB 2E6QA 3ULVD 1MFBH 3V4UL 3RI5F 1P6AB 4N0FA 3IDNB 4LPUA 1J8HD 3CCHB 3QP3A 4QO1A 4HGMA 5LWYH 1Z5LA 1KIUA 5B22A 1EK3A 4PUBL 5TQ0H 1MRFL 5CZKA 2PNDA 1CIDA 1QFUL 2MCG1 2DI9A 5IHUH 1P1ZA 3QIBA 3U83A 1LO0H 3MCLH 4F7CB 4GMSL 1A6VH 2FHCA 1NLDL 4G8GE 3R8QA 5E2VH 3TBSA 4IOFD 1HINH 5ISZE 1FPTH 5EU4B 4MSWB 3KYNB 4QRRB 1BM3H 4NQVA 2NXYC 4WI6A 1M71A 1OGAB 1S9XB 1QP1A 3NZHH 4U6HB 5JHDD 5ALBL 4AMKH 1JHKH 5F9OL 2VL5A 2DQGH 5EO0B 3QHFL 4ZOCA 4PJDE 3KPRA 1Q9OA 1QQDA 4XPGH 5E6IA 4NN7B 2CLVB 4QCIB 1MCNA 4EN3B 2FEEL 2BJMH 4NO2B 3LS5H 4IDJH 4Y16A 1F4WL 4G6MH 2V6HA 3RWCA 4HIEB 1B0RB 3QIUC 1MHHA 3W0WB 1A21A 1AXSA 1PD6A 4KQ3H 4YH6A 1UXSA 3MYZA 1I8LA 5GZOD 4TUOA 5IB3A 3TBWB 3N85H 2FB4H 2NZIA 4PJBB 4PTUA 1ACYL 1VPOH 3B5HA 3CFKB 3DOSA 3L5WB 1S7UA 5DUMH 4F9LA 5IWLA 4YHZH 3B9KA 2AJUH 4AJ0A 3AU1A 4X6BB 4UQ3B 3U4BH 4OQ1A 3V5KB 2F58H 4F80A 1Q94B 2J88H 3F7RA 1UT9A 5IW1B 4MD5A 3JZ7A 3ELAT 3OGCB 4NFDA 3HFML 5EZJB 5IJVB 3SKNB 1AXTH 4Q7DA 1AIFB 4PYHA 1A3LH 5EC2B 1YQVL 2DBLL 4PRPD 1KPUA 3QXDB 1I7TB 5EO1A 2X4QA 3I3DA 4M3JA 2IADB 4V1DE 4Y0GA 4HX1B 4XVSH 2AK1H 1FCGA 4LSPH 3GHBL 1AO7A 3RWFA 3QNZB 4BSVB 5BV7L 5DZNA 4AEIL 2OI9B 1NQBA 1KBGL 1OAUH 1LDPH 2B2XL 3JWOH 1NAMH 1R3IL 1HYSC 3O4OC 4NO0D 4Q0XL 1T20A 2VDQH 4JFQA 4BKLA 3C2AH 5DD0H 3A6BL 1NCAL 4RGNC 3ABZA 2DQFA 4ZTPH 5I1KH 1QSFD 3HZVB 3HTLX 2BXZA 2R1XA 5B39B 5ICYA 1VACA 5EULV 4R4ND 1E4WH 1ZMYA 1NKRA 3PHSA 1FN4A 3VMOA 4A6YL 5FGCE 4HMCA 2ZUTA 4GS7B 4AIZA 4WGWB 3BESR 5E2UL 1R24B 2UY7A 2HTLD 4JDVA 3IDUA 2ARWA 2ZSWB 4JG1L 3OR6B 3GSNH 4WTWA 4ETQA 5C0ND 1JPST 1OP3K 1EJOL 2JCCA 2WWKO 2XQYK 4LNRB 4R4BB 5D70H 5ENWA 4Z95H 2FIKA 3ZYJA 2Q1EA 4Y5VA 4LRIA 2YBRA 3DECA 3QHTC 2QADC 1N7MH 4CMHB 5F9JA 1NGPL 1S7WA 2CD0A 4FG6D 3TZVC 2AV7A 3GM8A 3QAZB 2IPTL 3FN0L 1CFTA 1QSEE 4WEBL 3OPZL 1C7TA 4X9BA 5EOQH 1F00I 1DLHB 1D5IL 1QLEH 2XI9A 2XG4A 3QNYA 1MNUH 3F7VB 4F33A 1A14L 5B8CC 4Z8FH 5HVHC 4W81A 1Q72H 2Z93B 3VXQB 4PJIB 3ECBB 4NZUH 3V0VA 3OF6D 4QXGL 4U7KA 3RL1A 4ZUUB 4MNHA 3HS0A 5F1NB 3BEVB 4I3SH 4BZ1L 2GCYB 1KNOB 4GXVH 3UBXA 2UUDK 3PP3K 3FHAA 1XH3A 4UT7L 1G0XA 2CUHA 1OTSD 4Y8AA 4K7PX 1G9NL 3HRZB 3TJHD 4NQDD 1TETL 2A9NL 4G43B 4JGMA 4R2GD 5E8NB 4WY7H 4U0RC 3SGKC 4R6UA 1DBJH 2Z31B 3BXNA 5CJ5A 4Y5YC 2LABA 2KUTA 1Q9LB 1WBXB 1KPRB 3ZKSD 4U6VL 3WN5A 1R3KA 5E6YA 4PRIE 1WV7T 3QG7H 1CI5A 3K2MC 4G6KL 4P2RA 3C8DA 4H0GA 3EFDL 1NMAH 3BD5A 1IAIM 3TYFB 1MI5B 2HFEB 2Y6SC 1T22A 2NX5A 3QI9D 1CFSB 1FNFA 2MPAL 4LLMB 4JQVC 3ZE2E 1JK8B 4PP2B 2ZUYA 2DRUA 3QDME 1ZT1B 2XWJA 3MRBA 2VN7A 15C8L 3UO1H 5K9QI 1G7QA 3KYOA 1TFHA 4JVUA 2H32A 4KH2A 3BYTA 1FZOB 4BELD 3MODL 4XAWL 5D7SL 4PD4K 3U0PB 3D9AH 3VXMA 2WBJD 3S88L 1A9EA 4ZXBC 3H7BA 1T2XA 1IL1A 5T33H 3V2AR 3TV3L 1QZ1A 4OM1L 5CJXC 4IMLA 2HLAA 3T0WA 3EYOA 2HJLA 1EFXD 2X1OA 3VDCA 3TVMA 4X0KA 1XGUB 2HRPH 4JFXB 4NNYA 2HWZH 5HI3D 1LO2L 4KRPC 1J0KA 4Q9QH 4XP5L 5MP6H 1G7JB 4S2SB 2VSCA 2I9TB 5IKCB 3B5GA 4M3KB 1FJ1B 3MRKA 5J1AA 4QRSA 1G6VK 1OSZB 4E0RA 4RDQF 3MJ8B 5L88H 1II4E 4XWGH 2E8ZA 2VITA 1INDL 5E2JA 5SX5H 4I2XA 4Z76B 3OL2A 5FGBA 2ZPKL 1XGPB 2A77H 1IC4L 1EAJA 4LRNL 1R3LB 5C09B 3VRIA 4C4KO 4ZFFB 4V2BA 2OX5A 1VADA 3DETC 3GJEA 1YJDC 1TZHB 3V4VH 3JVGC 2C1OA 4JY6B 5BW7C 1LGVA 3QUYD 4KRLB 4UIKH 5F1SA 1WFTA 5EU6B 2EICA 4HKBA 1J1XH 3FZUC 2GHWB 5D2NA 4NRYA 4OLYL 1WWCA 1PYWB 4RA3A 4BJLA 4I48A 1DVFD 3GBML 2DF3A 5DEZA 1OAYL 3OKDB 3LPWA 3GBNL 5GGSY 1VFBA 5J11B 1SJEA 1BECA 1FDLH 2BOBA 3G9AB 4PB9L 5FYJL 4PGEA 4MS8D 1ZHLB 2VAAB 3I9GL 4TPRH 4HG4J 3ALXA 4PJFB 2VXVL 1A1MB 4CNIB 5SWSD 1JYWA 4AL8H 2XTJE 1VESA 1I1FA 4JFDE 1KIQB 4RMTA 2ZG1A 3P0YL 2ESVB 2HJKA 4PJAF 2W0KA 2ADJA 1ZT7A 5D93C 4LNVA 1UB6B 2B1HL 3DTXA 3LS4L 1QA9A 1T1YB 3HE7A 3IDGA 4KAQH 5F7DA 1IC1A 4N0CC 4P57A 3GSVA 5JR1L 4OZGA 5DSCB 4N8VB 4F57H 3DXAE 2IH1A 2BDNL 2NTFB 5IB1B 4ODXA 2GYSA 1I8IB 3NCMA 1OAXL 5AZ2H 5FKPB 1JZ2A 5E7BA 2V7HB 1MAJA 3P11L 3P73A 1ZOXA 5EUKA 2D31B 2ZOKB 1R0AH 4QYOA 4PJ5E 8FABB 3JV0A 5CP7B 5ESVB 1W72B 3MBEA 5FKAA 1X5LA 3MUJA 3QO0A 2YD8A 2QLVB 4IRSC 1UACH 2XACC 1A7OH 5T3ZE 3GGWA 5HGBB 2XKNB 3NA9L 4TVPD 4PJGB 2NXZB 1X4YA 5KVFH 3QZWA 4TUJB 1WVZA 1G7IB 2NY3C 4TSBH 4CVUA 2X9XA 1HQRA 5HYQB 1BBJA 5C9KA 1CFBA 3QEQD 4LHUD 1GC1L 5DZOA 3TFKC 1PKOA 3B43A 4N0RA 2CRZA 1X44A 1P4BL 2F19H 1F3RB 5HYFA 2O61A 4P4RB 2OL3H 3OG4B 5ADPL 2ADGA 3HCVB 5DJYB 5E4EC 5D2LB 1KULA 4R96B 1GAFH 4JKMA 5HHVL 4HWNA 2IBBA 1XIWA 2AJYH 3FB7A 4JFOB 1YDPB 4XNYL 3K2UH 5LXGH 2NY2C 5DHXB 1F3JB 4GRWE 5D71H 1XF3A 3TWCL 5EA0L 1WZ1H 4O5LH 3TF7C 1UZ8B 1NMCB 1EHXA 2HMIC 4WU5A 5AYUL 3T4YB 3MV01 3DUSB 3QUMH 4M6MH 3RWIB 5JXEA 3VXOB 3BJ91 4D94A 2BVQA 4CN6A 2GUOA 5SX4I 5SWQB 1NPUA 1FVCB 3VFSA 1R3HA 4KTEH 1SVZA 4UTBL 4KROB 3IAPA 3RTQB 4P46A 3M1BB 3KPSD 4WENB 1VERA 1WQVT 2OJZL 4EJ1C 4XTRD 5BOPA 4M48L 3V79C 4CMMB 5IGXL 1T7ZA 1JZ8A 3UTSE 5I1EH 5KZCB 3VW3H 4EUPG 1KF9B 1KGCD 4JR9L 4OUUA 4AG4H 1HHIA 4RFEB 5I9QC 5T5FH 4P3DA 4U49A 1NEUA 1R5VA 4PG2A 4JO1H 3RZCD 2Z91A 2VSDA 1TVHA 3E3QE 3ARDD 1UWEH 4HWEL 4J1UB 3HLAA 4YDKL 4L4TB 4Y19A 3CUPA 1ZHKB 2VLKD 4U1IB 4MA7L 4ZFZB 5HJ3B 2NY4C 1MY7A 4I0KA 3ARWA 3ULUD 3RX7A 3OXRA 3TBTA 3FRUB 4Y4HC 1JN6A 2CGRH 1BEYL 4Z18A 4PJ8B 4XC1H 5E8OB 2PCPB 2CSPA 3VFTB 3MTRA 3F6LA 2BMKA 2JB6B 3O3AA 4MD4B 1IGTB 1A6WL 4QWWC 1I1RA 4PLJC 4PV8A 5LKNA 1I7UB 3QG6B 1OAKL 2I26N 1IGIH 5ITFB 3TA3C 2H41A 1I7RA 3IFLH 3VXPB 3BRFA 5AWNL 4NCC1 1FNSH 5CEZL 2FHBA 3DIFA 1OP9A 1IGJA 2VDKL 4WFGE 3QDJB 5J13B 2F74A 2FYYA 4U3HA 1GGBH 4NC0B 4YBLC 2EYSB 2F8OA 3EO1A 4I3RL 4WEMB 1AJ7H 3A6CL 3FQTB 4ZFGH 1OSPL 1MFCH 4PV9A 1TLKA 1K8DB 2MFNA 1CFNB 3ESUF 2HVKA 5CZVL 2A9MH 3Q5TA 4M1DL 5EU7E 1S7XB 3T2PA 3G5ZA 3TM6A 2FX9L 4PJBF 2VE6B 4X6FB 2FSEB 2JJUA 4JB9H 5SX5K 1JWSA 2B7DT 3ZE1E 3WS6C 1MCLA 4YC2B 3FFCD 3SPVB 2M1KA 2EXWD 4KDVA 4XC3H 4J8RA 5D7IE 3LN5B 1CU4L 4YPJA 1HHJB 2IAMB 4HWBH 3SQOL 4YXHH 5T1DH 3NGBC 4R7NB 4DQOH 1LE5B 1LE9B 1AFVL 1H5BB 3FO2B 4OGAD 4JM2D 1E4XL 3VDBA 5C0RH 3KPTA 1FFOB 3QIUA 1NFDE 4LMQE 2VLJA 2GT9B 1JF1A 3MOBL 4XP1H 1AE6H 4ZO9A 5F97E 5FYLL 4PJHB 4F3FB 1T03L 3WIFB 1JRHH 2BVTA 3VXRB 1JNHB 1OHQA 2AJ3A 1G9MH 2IANB 3D0LA 1H3TA 2JELL 3SGEH 4Y1AD 3WKNA 1N2RA 5AG9A 4NJ9L 4LAQL 3V9FA 1GXEA 1KTRL 5KN5B 1PGRB 3GKWL 4Z77B 1JWMA 1XGYH 3PWNB 4AT6A 3OGOE 3MRDB 3RVUC 4LDLB 5KSBB 2IQAA 4QY8A 3ILQC 3TO4C 4L4VE 4XCYA 2J1KA 4AQ1B 2DWEA 2WINB 2FO1A 5DMGD 2V7NA 1OTUC 3OJDB 2P8PA 5I1LB 3L3OA 1KJ2L 3QHZH 5IW6A 1ZLUH 3JUZA 4ZS7H 1NCBL 3P40A 4I1NB 3FO9A 5IFAH 2CIIB 2Y7QB 3PWPD 2DQHH 1JPTH 4P9HH 1KJ2A 1R6VA 3MBXH 4MA8H 1YMHA 4HAFA 2Y5EA 3NIFE 4WI3A 4L5FH 3FOLB 4P2QA 1FRGL 2B1AL 5E56A 5L8KB 5GGUA 3KPLA 3NH7L 5GS2D 5J12B 3MLRH 4U6XA 1AGCB 4PJXB 3OZ9L 5E8EB 5HGDB 3RUGE 2X1WL 3HPJB 3Q6FA 2PYEE 5F3BB 1JNLH 1MQKH 1HE7A 2R2HB 3FL7A 4XXDA 3UAJD 3PGDA 1QSVA 3WS3A 1J10A 2P5EE 2BFVL 5GS1B 2MCPL 4XVTH 3BE1H 2X42A 4YXKH 1JHLL 5DJ2A 3S97C 4L8CA 4CU7A 3B6SA 5ACZA 1IAIL 2P8LA 2XA8H 4IDLA 1WIUA 4OI9A 5CJQL 4Y88A 5TGBA 3N1FC 3QYCA 1IEBA 5BOZG 5H2BB 2CLZA 2GSIA 1BQLL 2F53D 4FQIH 4UV7H 4QXUH 3H9HB 1WAAE 2FATH 2FR4B 4LEXL 1NDMB 1Y18A 2CRMA 4P2OC 4W4NA 4WI2A 2VLRE 1UKQA 4H1LB 4ODUB 3TH2T 5KAQG 2GSGA 4JO3H 5GRWA 2KL6A 3MLUH 4JFYA 4KXZI 3OQ3B 2J7LA 3LVEA 4JY4B 1C8PA 5C0JB 3GSWA 3BRGC 1J8HB 1REIA 1YUHB 1E6OH 4RQQA 5FB8B 4NQDE 3O2DH 3ZKMD 4G9FB 4XMKL 1GZQA 4XWOD 5K9OB 1V7NH 1V3LA 1MCWW 2FLRT 1YYLH 5HHOD 3IGAA 4JLRA 5CHNA 1IT9H 2VNCA 1G1CA 2YUZA 4KZDL 2QQLL 3PV6B 4U1KB 3SKMB 1A7RL 4DVBB 2YUVA 2Y4SA 5CSGA 3MV9A 3O6LL 4YUEL 5FDYA 2E5EA 4ONOA 4OSUL 5IEKB 5JHDB 3ARPA 3SGKA 3AS2A 2GITB 4GW5A 1X5GA 4MJID 3NPSB 1Q8MA 2N7BA 1U8KB 5E9DB 1S9VA 5LAXA 5C07D 1PQZA 1R3JB 1BQHA 4LSUL 4P23D 3SJVD 2YRPA 4NHUB 1QLRB 5EPMB 4NC1E 4M6NL 1CICA 1NLBH 3GSQA 2H1PH 5IHLB 3LKSA 4S1RL 4L3ED 2J8UA 1NDGB 5AZEL 4JQVA 4XNUL 5DEFB 1RZ7H 4YHPB 5EB9A 4B53A 4DZBB 4UDUA 4HXBL 5GJSL 5DK0A 3ZTJG 4EUPB 2Q20A 4UQ2B 4RMRA 5LBSH 1F2XK 4FZEH 1RUKL 5LCVL 2PO6C 4N1EA 4HK3N 1PG7X 3GMLA 4J7RA 5I73B 1F90L 2AJXL 3C09C 1C08A 3U0WL 4I4WB 1YPZB 3FQXA 4HF5L 3TYGL 4XH2B 4NQSB 1JTTA 5GSRA 4WWKD 1VDGA 1RK1B 2CR3A 5LQBH 2RHEA 1UC6A 1YEDA 2V2XB 1KCUL 3BVNA 3NZ8B 5AAMA 3HZMB 4OTXH 3LH2L 1FO0A 5GSVA 5T3ZH 3MRCA 2VDNL 5BQ7A 3P77A 1I1AA 4LHUG 1DFBH 1NBVH 3FJTA 3RGVC 3LRSA 1IM3B 1BFOA 3MYJB 4P4KC 5L7XH 4PJAA 2EH7H 2BSTA 3H42L 4X5WB 3RDTA 4LQFL 3X3GL 5JDSB 1ZANL 2EE3A 3D6GA 1FYTD 1QFUH 1MHCB 3D39B 4PJFF 1QSFB 1SM3H 4OLWH 1NGQL 3LKOB 1QO3B 3JVGA 2BRRL 2CDGA 4OGXL 4TULL 5BW7A 4L29B 3T2NL 2OK0L 3HUJB 5EIQA 1LD9A 2OR9L 4GRWH 4I0PA 3GSOA 1NCWH 1MQ8A 5B3JF 4JE4B 4XBPB 5ALBH 5M95B 1SEBB 5E2TL 5F9OH 2P47B 4MWFB 5BZDA 3JTSA 1JGEA 2I07B 2BX5A 3B9AA 1MFAL 3WFHA 3R06B 4ZAKC 5DRXA 3G6JA 4PRAB 5GGTH 1FC1A 5MERB 3LCYA 4CVXB 1CYGA 3GMOA 3HI1B 1FLTX 2C7UB 5IMOA 4GRMA 2H2SC 1U93B 3V8CA 2DWDA 1IARB 1OAQH 3NPZB 2LE9A 4LVHB 2DOCA 2AK4A 3PUCA 4LSVH 5IVXB 1S3KH 4BFEA 2VRAA 3IRZA 3LKRA 4M1CC 3BN9D 5EOCL 2R9HD 2X4PB 3CH1A 4BFGA 3NFPA 4PJGF 1OL0A 1A6AB 4X4XA 2PXYA 3VH8A 3G6DH 3P9MB 5C2UB 4MAYB 3NIGE 4NZTL 4NO3B 3MREA 2BSED 4KK9C 3SQBA 3NN8B 1L0XA 3O6FC 4MHHG 1TVBA 3QIBD 3SDDA 3HR5A 5EFIB 4OFVA 4U0QB 1M6OB 1CBVL 1ZV5A 4G8EB 5JORB 1ZLUK 2RR3A 1S9YB 1RFDH 4HV8B 1U92A 5FYKE 2NPLX 3FKUS 5D2LF 3S35H 5BJTA 4JREB 3T0EE 1G0DA 4R2GB 3MA9L 1FFNB 1X5YA 1U3HC 4OQTH 3CMOL 4KUCD 3QEQE 4YDIL 5IIEA 1BVLA 1U36A 4C56B 5SWZD 3VCLA 1NEZB 5C0AE 4IRSA 1XGQA 4KDWA 4MXQC 1OD7A 3KPRD 3WE6B 4DVRH 2NMSA 3STBA 5E6ID 2Y25A 2KZ1B 4TRPL 4D0CB 4MB5A 3BO8B 3QJHB 3RA7L 5JPNA 1RPQA 4Z7OF 3GSNB 3WO4C 4HWZB 4LF3B 5KJRH 1NCAH 2G5BA 1BBDH 3QXTA 1A02N 5DRZA 2DQEL 1YY9D 2APBA 3BP7A 5HYJE 4Y7MA 4PGBB 5CGYC 1YMMB 1K2DA 1N4XH 4HGKC 2XN9B 4YR6B 4MVBD 4MAUH 4JRXE 5I1IH 2QSQA 2IWGA 4Y4FA 3GSRB 1MHPL 2CRIA 3B9KD 3MO1A 4RGMC 3V6OC 1BD2A 4KTDL 3KS0J 3WXVH 3BIAX 2O5XL 1FVDB 3IDNA 4JKKA 2OS7A 3CCHA 4K3EL 5J13C 4TTDC 2EIDA 4RNRA 3H3PL 1EJOH 3QEGH 1VSCA 2P5WA 2FZ3B 1ZLVK 3ROOB 1MCPL 3LIZH 5CBEB 1N64L 3LEYH 4F7CA 4G7VL 4NCC2 5C8JB 4FFZH 2ICWB 5CJOL 1S7RA 2VZUA 1RUQH 1KGCE 5EU4A 4OCWH 2RGSA 5D6DC 4MSWA 4P2CG 4NKQB 5D96B 3KYNA 4X4MA 1AO7D 3EOYG 4QRRA 3O0RL 4CN4A 1CLZH 1XF5B 3OSKA 1OGAA 4ACPA 4U6HA 4XT1C 1D5IH 1QBML 2AEPH 5TE4H 4MA3B 3P4NB 4YZFF 5EO0A 5F93C 4BH8B 4PRBA 3BFOA 4ESKA 3OKOB 1GSMA 2CLVA 2VLKE 4QCIA 2I5YH 4EN3A 1EEUA 4NO2A 5IB2B 1IBGH 1Z6JT 4GW1A 4EOWL 3ULUE 3BN3B 3VFUB 4OF3A 4HIEA 1B0RA 2ZJSH 2HH0L 2E7CA 2MQCA 3UTOA 3W0WA 5ADOH 4U1NB 1E6JL 4PBXA 5ILTH 3ES6B 2J4WH 1X4XA 4KZEL 3TBWA 1T5WB 1AI1L 3OAYK 4Z7UB 3L3IB 4PJBA 1UB5B 3CFKA 1MCWM 3CLFL 3L5WA 4JPKL 3AMLA 3T1FB 4OLZL 1A7BA 4X6BA 4Y4HA 4UQ3A 3ESVF 3V5KA 4DW2L 1K9TA 3BKJL 3D25A 1M7XA 4RMVA 3U36B 5AAWA 5IW1A 4OZIE 2DTSA 2GTZB 5HHPB 5EZJA 2Y06H 5IJVA 1A3RL 2BHYA 5SWSB 1AIFA 1MF2H 4UIMB 3QR2A 4HJJH 4HPOL 4LSQL 1Y6NR 5EC2A 5E1AB 3EFFA 3HN3A 5EUOA 3QXDA 1I7TA 3SCMB 3TA3A 2IADA 4HX1A 3DMMC 1MCOL 4F15B 1DQJB 2F8XC 1FGVH 2ARJQ 4FNLL 3QNZA 4BSVA 2EO1A 1UYWL 4LCWE 4EBQL 5DD5L 2VDML 4KK8C 3S88H 3KPPB 1QFWH 5E08L 5K59F 3RWJB 5IP4A 3S96B 5FFLA 2HTKD 3WFZA 3AREC 4Z5RB 3V52L 4XP4L 3KLAB 2F5BL 1IAOB 2J8HA 4LLWB 4PJHF 5TQ2L 3Q1SL 3L9RB 2HT4C 1QPPA 3HZVA 3MJGX 4R97B 5B39A 5I0DA 2DMKA 5DDHB 5ANME 1D9KB 1DL7L 2X4NB 5JNYB 3FCTB 3FQUB 3WS6A 5IESH 4ONGL 4PTTB 3VXUE 4PLNC 1NANI 5HD8C 2Z8SA 4IM8A 1UH3A 1YNKL 4P59L 5F9DC 3HB3D 5TPWL 1R24A 4HD9A 4P2RD 2WQRA 2AI0H 3RWGB 5KSBF 2ZSWA 3L95A 1MIEH 4HS8L 3FT4A 2WIIB 3MGOB 5AUMB 2NX5D 4LKXB 1M05B 4NQTA 2CMRH 4LNRA 3MNVB 4Q74A 4R4BA 4HQQH 2ORBH 2VTFA 1IVLA 4U1GB 2ATPB 1C5DA 2E9BA 4FFVC 3SKJH 3GNML 1KC5H 1K6QH 1NCCL 3VXMD 2D7PA 3BKYH 5E00B 1A7NL 1DLHA 5HDBE 2Q87A 4DFHA 4G6JL 3S9DB 1XCQB 2ED8A 1J12A 4TVSa 4NKIH 3NTCH 2Z93A 3VXQA 5EBLA 3ECBA 1MCSA 4PJXF 2R8SL 3W39B 3QT2A 4J3XA 5F1NA 4HCRL 5ERWB 4JPIB 2AJZB 3TVMD 1MJUH 1WFNA 2XZAH 1W2KT 4RFNB 2GCYA 1P2CA 2ZCLL 4OJFH 4DFIA 2HJFB 3BQUB 4OZHB 4GLRH 3FB5A 3WLBB 4HCRA 4XMPH 4MQXD 1DBAL 3CFEB 3HZKA 3REWB 4G43A 5E8NA 1ZHNA 2X1XR 3KYKH 1JTOA 3B2VH 5IFJB 2Z31A 4MX7B 3E6HB 3VRJA 3O81A 5DC4B 1WBXA 1KPRA 5FECA 2BDNH 3TT3H 1ZTXH 1TZIB 1RMFL 5KS9E 4YHMH 2NW3B 1JNNL 1MY5A 1MI5A 1CG9B 4ERSH 4OF0A 1U6AL 5T5NF 4LLMA 4N0UA 4QNPF 2JJWA 4H0HB 3EUUA 2IH3A 2OL3B 2J5LB 5FM8A 4KTYA 4PP2A 1CF8L 1A1OA 1ZT1A 5EG6C 4NZDA 3ZHLA 1A7PL 4U1HB 3S5LG 3T2OA 5F7LB 1KPVA 2D0GA 1FZOA 5DR5L 2R0WH 4LU5L 3U0PA 1TTUA 5GRUH 1WWWX 4R3SB 2LAGB 5GJTL 3PGFL 5FF6B 5DJAB 3GK8H 4G8GB 4OZFA 3V4PH 3GIZH 2D4FA 3FMGH 4LLUB 3DGGB 5FYJD 3VI3F 1INEL 2YRLA 4P2OA 3CFCL 1FSKC 4JFXA 5ABDE 2J12B 4F7TB 3SO5A 2Z8RA 5HHOE 1G7JA 1MFDL 4S2SA 2I9TA 5IKCA 3BGFB 1BWWA 1FJ1A 1I1CA 5ACMA 1NC2A 1OSZA 1FG2B 3ARBC 3MUY1 4UT9H 3MJ8A 2YN5A 4XCEB 3C6SB 3D1MC 4JM4L 2R2BB 3PWJB 5DRNA 1IMHC 3HNVH 3S3JA 4CAGA 3OKKB 3E2HC 3IDYB 4Z76A 5IR1A 2QL1A 1DBML 1XGPA 3HMXL 3U1SL 4ZFFA 5C09A 5C07E 1UA6H 2ICEB 3AB0C 3BZ4B 3V7AG 4GJTB 3PDDA 1NUFA 3KXFD 1TZHA 4JY6A 3HMXA 2RQ8A 3MBED 1ACZA 1T89C 2M8XA 5I1DB 3A67H 3QUZB 1YEIL 4CW1B 4E42B 5EU6A 3IRPX 3FFCB 1WZMA 2VR4A 1OGTB 1YPZF 1C16B 5CD5C 4XBEL 2YPVL 3OKDA 5IUSA 1CZ8L 2OP4L 2AGJL 2Q8AH 4ZNEE 3ULSB 4JM2B 2Y07L 3NAAL 3DYPA 1FZJB 1Q38A 1JUFB 3L3JB 2Z35A 1ZHLA 1L6XA 2VAAA 3NABH 4PJFA 2E7HA 1A1MA 2Q3ZA 4CNIA 4KGJA 1RULL 1EHAA 3MRMB 3WEXB 4B7LA 1LILA 1KIQA 2VH5L 3DVNB 4WHCA 1XIWD 2VL4A 4Z7WE 5CIPH 1T2JA 1WBZB 2UVEA 1OM3L 3EZJB 2QV2A 3WFEH 5DSCA 1YY8B 4DN4L 1I3RB 4KKLC 4N8VA 3BUYB 1KFAH 2C4FU 5FYKH 2NTFA 1WIOA 4BQ6A 1ZLWH 3JWOC 3ZE0E 5JXED 4F7MB 2A6IB 3X13B 3ARFB 2AQ3A 2LU7A 2I60H 1A6WH 1BOGB 4AM0B 1W72L 2V7HA 1XF1A 2ZUXA 4ZDHA 2D31A 1PAMA 3KAAA 1TIUA 3EYQD 3NCCB 4W70A 3VWKC 8FABA 5CP7A 5ESVA 1W72A 4P46D 4N9OB 3PWPB 3IFNH 4APQB 4N5ED 1J0ZA 5CEZH 3ZYZA 4YIQB 4KJQC 4JHAL 1EGJH 4JPWL 5I30L 4JFFE 3WFCL 3INUL 3EOTL 1HWGB 2XRAH 5EC1A 4PJGA 4X6CA 4GG6E 4TUJA 2ATKA 3VXSD 2R29L 1G7IA 4KY1L 4I0CC 4M7LT 2JIXB 3AM8C 2OMNA 5HYQA 4RAUB 5TDNB 3V7AE 4RZCB 5IVXF 5DTFB 3RVXD 1VCAA 2FL5B 1CLOL 2EYTB 1RAMA 2PR4H 4N8PA 1J7VR 4PB0L 5IQ7H 3QPXH 1Z3GH 2K9UA 4G8FB 4P4RA 1YNLL 2QSTA 1IC7H 4Y19D 4EI6B 5CILH 5DJYA 5D2LA 4R96A 4JDTL 1OCWL 3LDBB 1N0XL 2N1KA 3D5OF 3PP4L 3VFPB 4JFOA 5E4IA 5DLMH 1N59B 1YDPA 2HYMA 2Y36H 1KN2H 4KV5F 1F3JA 1E28B 4NHCL 5GGVH 3WSQL 1I9RH 2D4DA 4ZAKA 5GZND 4JQIH 4LSSH 3VRLE 2VISB 3Q0HA 1AQKL 2NY6C 1OWWA 2X9YA 3P4OB 4ISVB 1FFPB 3T4YA 3IFOB 4MDIB 3DUSA 1QSZA 5LGJB 3VXOA 3DSFH 4U33A 1ERNA 5KANG 4R0LB 2YD4A 4HXAL 3H9SE 2OTWA 3U82B 1FVCA 3I6KB 1IGCH 7FABH 5D1QC 2C3VB 4KJWD 5D72H 1A4JB 3D0VB 3RTQA 4K07A 3M1BA 2EECA 4PRIB 1WCQA 4KHXL 1BFVH 5GHWH 2VDRH 4XI5C 3S35X 1UXWB 1DQQB 3VFOB 3ULUH 1JZ7A 2FO4A 4K7PL 4XVJL 1YC7A 2YMXL 3O8XC 1IKNC 1JZ3A 3NBNA 3J8F7 3E1F1 4RFEA 3M45A 2ZUQC 3S98A 3UX9B 1RZGB 2G60H 1IM9B 2NY0B 4LQ1A 1F4YL 1IGMH 3O2VL 1NSNL 2XZCH 1DN2A 4MJIB 4J1UA 5D1ZC 3KLHD 4L4TA 3QFJA 3T0VA 1ND0B 1JV5B 4KK6C 3Q6GL 4ZFZA 5HJ3A 3EGSB 4P23B 3SJVB 1N5YH 2AEIT 1I9IH 2WWMC 5J6GB 4HIXH 3ZKXB 1J87A 2BY0A 3IYLW 4PJ8A 4L3EB 4S1DD 3QIUD 5E8OA 1X6LA 2PCPA 5ETUB 2VLJD 4MXVF 3VFTA 1KELH 4X9FA 4HPYL 3OAUL 2JB6A 4MD4A 1IGTA 3RL2A 1I7UA 3B8YA 3QG6A 5CSZB 3DX9B 1ZSDA 4DKAA 4S1SL 2EDTA 1TPXB 3T0DA 3MRJA 3K8LA 3UBXG 5FYLD 3S8WA 2XXCB 2GKIA 3SCMC 3KHQA 5ITFA 3UPCA 3VXPA 4K3JL 5F1IB 3V6OA 3JBG7 5DUPL 1IAIH 4RWHA 4YHKH 1AHWB 1ROWA 2C4FT 3N06B 2YEZB 2HLFC 2VLME 2DL9A 3L6FB 2EYSA 2XQBH 4KUZL 1BAFH 1EO7A 4P5TB 1RSFA 3OHXB 3FQTA 4UMGA 3AROA 4J23A 3WIIH 4M7ZC 4KI5C 3V7MA 5IQ9B 2OZ4L 1CFNA 3CVHL 3EYSH 4P3CH 1S7XA 2W07A 2DMBA 4OKDA 4Z7UF 4NZRH 4GW4B 2G75B 4NGHH 4WFHD 4X6FA 3WL9A 2FSEA 5IJKC 2OZ4A 5INCB 1KEGH 3GHEL 4X80H 4TN9A 1JFQL 3SPVA 4IRJB 1IQWL 1HYSD 3GMQB 4P2QD 5E8DL 4W4OA 1U2HA 1HHJA 2IAMA 4QOKD 5DUBB 4XBGB 1ZVSB 4R7NA 2BXYA 4YHYB 4RGND 1H5BA 3Q5YA 4Z7QF 3FO2A 1LE9A 4ZTOL 4OCMC 4RISH 3C6LC 4JFDB 4K9EH 1FFOA 1KJVB 1F58H 4X4ZA 2WV3A 3LMJH 2YS4A 3K80A 2YK1L 4JGJA 4N90D 2GT9A 2FGWL 4XAKD 1SQ2N 2RIKA 1AC0A 1FAIL 1X5HA 2JCCE 3GJFH 4PJHA 4F3FA 1LEIB 2YPLA 2D0HA 3WIFA 4WI4A 1NMBL 3WHXB 1LK2B 2X1PA 3JV6B 4JG0H 5J56B 3BIKB 2IANA 4Q6IB 1IRAY 5T1LA 4OCSL 2QHLA 5DVNA 4KVNL 2FNBA 3S34L 1CR9H 3UP1A 4HIIB 3U7YH 4HIHA 5KN5A 1XCTA 1A1NB 1GYAA 1B0GB 4JDZB 1SY6A 4UINH 4Z77A 2ZUSA 5J89A 3PWNA 1NBYB 1DQDL 3SE4A 2EDEA 1EO8L 4UILH 1CS6A 1KTDB 2WINA 3P4MB 2LTQC 2IJ0C 4KKBC 3OJDA 5I1LA 5DC9B 3DMMA 4JO4L 4F7EA 4QXTB 4Y4KC 4WWID 4N0FB 2IFGA 5FHBL 2CIIA 1Z5LB 2Y7QA 3WKMH 3KPNA 5L0QB 1ZLWK 2BC4A 1QBLH 4GO6B 2EDKA 3FO1B 3FOLA 5CINL 3QIBB 4ALAL 2A6KA 5BZWA 3V5DB 1A2YA 1YEGL 3OJMB 5HI4C 1AGCA 4PJXA 5JLZB 5E8EA 2D7TL 3MV9D 3HPJA 5JW4M 5F3BA 4NUGL 1J0YA 1UM6L 4NKOB 5H37G 5SWZB 3TBYB 5IROC 1JRHI 4HJ0D 2VL5B 2A38A 3FO0H 3FAXA 2NX5E 1Q9OB 3KPRB 3N9GH 2WIMA 4OLVL 1QQDB 2R0LH 4TSAL 4WW1B 5T3XH 1HZHL 5E6IB 3H2WA 5I17B 4N8CH 4UU9B 5DJZB 1EUTA 1YJDH 1CFVL 2DQJH 5HGGS 1CICD 1H3GA 4NSKB 4MXWL 1JYXA 5HDOA 2Y6SD 2M26A 4OZHF 2VXTL 1PX3A 2BVOA 2FR4A 4NN6B 1MFEH 1NDMA 5IB3B 3BMWA 5DMJB 4PTUB 2OR9H 4H1LA 1TITA 4ODUA 4PJ9B 2CJUL 3LEVL 2WZPD 3NACL 5D8JL 2GK0B 1D5XA 1U3ZA 3QSKB 5JW4R 3CFBA 1Z2KA 1DE4B 5DQJA 1RUML 1U8OB 4MD5B 4UOJA 3KNBB 4BSWA 4YXLL 4NN5C 2BNUB 5MENA 4G9FA 4HK3J 5K9OA 3PIQB 3MLVH 2EEAA 3OKEB 3QRGH 3QZWG 4I2XE 2X4QB 3ARGC 4U1KA 3L3GB 1LO3L 4DVBA 4YHOL 3O3EA 4DGVL 1AO7B 3RWFB 1I1AD 5CBAB 1MPAL 4RMSA 5KSUA 1EMTL 1RIUH 2YD9A 5IEKA 1VEPA 2J3SA 5EOCH 3QQNA 1YN7B 2DLTA 2P48B 1CL7H 2GITA 4W6YB 1IEHA 5HGHB 1QLFA 1KENL 3VWJB 1U8KA 5E9DA 3MJ7B 3MV7E 3RDTD 1FCCA 4K3DH 1R3JA 3MLZL 5D2NE 4QHUA 3O6MH 3VDAA 5LVEA 4ZO7A 4NHUA 4F9PA 2WUBH 1YEFH 3CXDH 5EPMA 1VKXB 1CBVH 3U2SB 4LFHD 5DMIL 1VACB 3V5HB 4WHDA 1T6WA 4YBHA 3VFGH 5DS8A 1NDGA 1NAKL 1QPXA 5DEFA 4I0PD 1AY1H 4YHPA 3FZUD 4DZBA 3PGCB 4MNQD 2GY7B 4YDIH 4AIZB 1DBBL 5ICXB 3MFGB 4UQ2A 4K94H 1UM5L 3PQYD 4CJ0A 4A6YB 4TTGA 4WW2C 4M03A 1MFBL 5C0FB 2B5IC 3MJ9A 4NQCB 2YD2A 4I4WA 4ETQB 1YPZA 5TQ0L 5KSAC 2FBOJ 5IHUL 4NOFA 4IIQB 1LO0L 1ZVYA 3MCLL 4OZGE 4Y5VB 1A6VL 2YBRB 3S4SB 1Z9MA 4RIRA 2V2XA 5E2VL 1HINL 3LPGA 3NZ8A 1FPTL 3UPAA 2AK4D 3HZMA 4FA8A 1BM3L 1T66C 1KACB 2AV7B 1I85C 3NZHL 4AMKL 4ZMAT 1KB5H 1JHKL 5D7IB 5TF0A 4F33B 2PXYD 2DQGL 4N0CD 2VXSH 3KPQB 3SGDI 5TJWK 3V0VB 1IM3A 4XPGL 1U8NB 3MYJA 3RWDA 5IBLC 1RUAH 2O5XH 4JM2F 4LDOB 2PKDA 4CDGC 3I3BA 2EDBA 1CD1B 4K3EH 4ODVH 4X5WA 2BJML 4BM7A 3LS5L 4IDJL 5JDSA 1JGVH 3SDDD 4G6ML 4L9LB 1AD9B 1MWAH 2W9EH 1MHCA 3D39A 1QSFA 4OD2B 2EH8H 3DARA 1QO3A 3IF1A 2IBZX 1MCBA 1T89A 1LO4H 2DIAA 3N85L 2FB4L 1O7SA 5DUML 1VPOL 4IRSD 5DHVB 1RZJH 3X11A 4YHZL 2AJUL 3MRHB 2DMCA 4I8DA 4XBPA 3U4BL 1SEBA 2F58L 2J88L 4MWFA 3TEUA 4P2RB 2R0ZH 4ZUVB 3MR9B 2CDEB 2OCFD 2X05A 3PWLB 2I07A 3R06A 4KMQA 1AXTL 4PRAA 3BX7C 4M8QA 5MERA 4GBXC 1A3LL 3GJFK 3HI1A 2BNQA 5E8PB 1QFHA 5HHQB 3RNQB 4DOHE 4YHIB 4ODBD 4XVSL 2AK1L 4LSPL 5A2IH 3WD5H 2H32B 4Y4FD 5IVXA 2OTUB 5B38B 1FHGA 3TIDB 1Q0XH 3IU4H 3VXMB 1OAUL 5DJCB 1LDPL 5TFSH 2X4PA 1HYRC 3HAEH 1BD2D 4KHTH 2E7LC 1JMZA 1A6AA 1ZT4B 3JWOL 4JFPB 1NAML 1IL1B 4U4BA 4JKWA 2XWBB 2HMID 4MAYA 1BX2A 2VDQL 3C5SB 1PW3A 2HLAB 4NO3A 5HDLA 5CP3H 4LVOC 1JZ4A 3C2AL 4X0KB 1NAMA 2YHGA 5DD0L 4NNYB 2P5WD 5I1KL 5ESAA 2VDPH 2XY1A 4NT6B 5EFIA 1R5IB 3DROA 4G8EA 5JORA 4HLZH 1HK6A 3M17B 5EOTB 1S9YA 3EYVB 1E4WL 4HV8A 1MLBB 4QRSB 4QRRD 4GKNA 4QRUB 1F3DJ 4Z6AT 4LPYA 1FFNA 4FTVB 5JXAH 1OGAD 1WZKA 2V5TA 4OF6A 2VITB 4C56A 4OIIL 2VN4A 2AQ2A 1NEZA 4HUUB 2V5RA 3UTTE 4JKPH 1TNMA 3MLSH 1S78D 4Y19E 3GSNL 3GJEB 3QXWA 4EN3D 5FOJA 2GJZB 4D0CA 3BO8A 4EI5B 2JJTA 3J7HA 5D70L 4Z95L 3GSNA 5I71C 2VLRB 4HWZA 2HFGH 4O51B 2BSSB 4U1MB 5EZLA 2FECI 3QRFM 1N7ML 4EKXA 5EDXA 3W0WD 1YMMA 5FO8A 2QR0B 2V17H 4I48B 2XN9A 4YR6A 1CFQB 4W6WB 5EOQL 1PJ9A 3C08L 4FZ8H 1BVZA 2DS4A 2NY4D 3GSRA 1QLEL 4Z8FL 1MNUL 5L2KB 3G04B 1Q72L 4UAOB 2V2TB 4O58H 4Y4HD 4NZUL 1S5IH 1WEJH 5CMAA 1FVDA 2OJEB 4I3SL 3DRQB 3ZE2F 1CK0H 4GXVL 2FEDC 1OT2A 12E8L 4QWWD 4HMDA 4PLJD 1QRKA 5C08B 3JWDC 3F58H 3ROOA 3PL6B 3QISA 5F7KC 5CBEA 3A6OA 4PD4J 1ZT7B 1A9BB 5C8JA 2ICWA 3DTXB 3TA3D 4Z7NE 4WY7L 1HKFA 2E9JA 1DBJL 1QRNE 1U42A 1XF5A 2FDBP 4WNQA 4CGTA 2X2YA 2P8MB 3MNWB 2EXYD 4HS3B 2IPUG 2EDFA 3QG7L 3PJSA 4MA3A 1ULVA 3P4NA 3RAJH 4BH8A 1A7QH 25C8H 5GS0D 3C60C 5SX4H 3OKOA 1IKNA 1NMAL 2AXGB 2JB5H 5J3HC 3KXFB 5IB2A 1G6RH 2PF6A 5DFTA 2XTJC 4KGLA 1IILE 4GG8A 5FKAB 3VFUA 3QDGE 4X7TB 4F8TA 1L6ZA 3CSPA 3UO1L 1W0VA 4OFPA 3QO0B 2FWOA 3MNZB 2HFTA 4QXWA 4U1NA 1KG0B 3GGWB 1JPSH 3VFMA 2VLJE 5BS0B 1T5WA 3D9AL 1WFOA 5ESQA 4Z7UA 4OD3H 1EV2E 1HQRB 4WFFD 1UB5A 3OG6B 1ZLSH 5D7JC 1BBJB 3T1FA 1ZHBA 4HW6A 1F13A 5T33L 3OMZA 3CNKA 4TNVK 1CDJA 1KCSH 3DO3A 5I74C 1HSBA 1RMFH 2K7QA 3B2UD 4MJ2A 4WO4C 2LAAA 3K1DA 4NWUH 2GTZA 3CAFA 2HRPL 5HHPA 2HWZL 2ADGB 1YC8A 5FA3B 1OD9A 4Q9QL 3MMEA 3U4AA 4UIMA 4M62H 1UWXH 1SEQH 4WHYH 5E1AA 4P99A 4O9HH 3FB7B 3WXWH 2X7LB 2O5YH 4LPWA 3SCMA 5L88L 4G6AC 3P0GB 4XWGL 1K5NA 5I8EB 1DQJA 5JPMB 3N1GC 4OAWA 4XCCH 3SHSA 1PKQE 4WU5B 3HC3H 5T1KB 1F8TH 3EJYC 5ID1B 2A77L 4WFHE 3KPPA 3PGFH 3RWJA 3RVUD 2G2RA 4LMQI 5DFVC 3RU8H 1JF5A 3ILQD 3V4VL 4Z5RA 2BVPA 1EX0A 3KLAA 1DQMH 1IAOA 4RDQG 4YHLH 4UIKL 1BQHG 1OTUD 2HRLA 3GBLA 3BWUC 4G7YH 1G7MB 2FBJH 4P46B 1J1XL 5HSFA 4X6DB 1ZK9A 1J1OH 4OLXH 5DDHA 2A0LC 3RWHB 5KVMC 1D9KA 2X4NA 4YX2H 2Z31D 3FQUA 4HFUH 4PTTA 3VXSB 1ZXQA 1FDLL 2MSPA 5CEXA 1M1SA 2HVJB 4TPRL 2Z91B 5IBUB 3RWGA 1TVHB 2FLBT 3HG1E 2ITDA 1U8LB 4XGZB 1MI5D 2WIIA 3MGOA 4AL8L 3CFJB 5DMYA 5AUMA 3HLAB 1M05A 3MNVA 2ENYA 4MMXC 4DK6A 1U3YA 4Y5XB 3MLYL 2ATPA 5HVGB 2WP3T 3BDYH 4HMEA 3TBTB 2MQ0A 3WFBH 4F57L 1WJ3A 1PLGH 3O11A 3NOIA 5E00A 2JE8A 3PWUB 4G3YH 2DI8A 2Y5TB 3FONB 1XCQA 4X9IA 3MGTB 1G7PA 4WV1C 5AZ2L 3O3AB 1OTTD 4CU6A 1XGTB 4TSCL 4JPIA 3JSSA 2AJZA 3E3QC 4P2OD 1R0AL 1HXMB 3TCLA 5C0CB 1I7RB 3BQUA 3OX8B 4OZHA 5C0AB 3RVTD 1RJLB 2WBKA 4Y4KA 1UACL 4LFHG 1A7OL 3CFEA 3IJHA 1NC2D 3MV9E 5KVFL 3O9WC 5DD1H 3W82A 3ZZ1A 4TSBL 5IFJA 4MX7A 3E6HA 3I6GB 3L1OH 1KXQE 1F6FB 1VB9A 1JIBA 4GH7B 4PV9B 3ULVC 5C09D 1MEXH 2DDQH 2Z4QB 5C86A 2F19L 1YA5A 1TZIA 4YEFA 1YEJH 3G5ZB 1F02I 2OL3L 3C9NB 4V2CB 2NXYB 5DD6A 3TBVB 1CG9A 1GAFL 1TQBC 2GI7A 4QHLA 5EU6D 4FFYH 2E9IA 4MZ3A 2OL3A 1CQKA 1JP5A 2AJYL 4QRPE 5CD3A 2ICWJ 4IOFC 2UYLB 3K2UL 5LXGL 3K8KA 2ADFH 4G9DB 4U1HA 5CS7A 1WZ1L 4LIQH 4O5LL 4D9RD 1JPFA 2EC9U 2M2DA 2XWTB 3Q5OA 3MSPA 4OIAA 1HXYA 4XPAH 4ONFH 3LOWA 4ZODA 2Y23A 4Q97A 3QUML 3QIUB 4M6ML 4X83A 1UH2A 5FF6A 3VH8G 1JF1B 1LK3H 5DJAA 4G8GA 2ENSA 1N26A 1NCUA 5EU7C 4PS4H 1IQDA 4LLUA 2DJ4A 2GW5A 3IS1X 2AJ3B 4OLEA 3GSUB 4KTEL 1RURH 1UJ3C 3B4NA 1T4KB 1CLYH 5F7UA 1PZ5A 4XPTH 3LV3B 2XT1B 4Z0BH 2WLZA 1MREH 3MLPA 5EZIL 2OYPA 2IC2A 5GZOC 4JEGB 1JWMB 4ETYA 1T1WB 1EHLH 3VW3L 4Y2DC 3C6SA 3GM0A 4WHTB 2R2BA 3PWJA 4AG4L 5T5FL 4F7PA 4XNZC 2Z8WC 4JO1L 4X5LA 4PJAE 4L9LC 4QHNA 3EJZC 5AD0B 1CDHA 2ICEA 3BZ4A 4W68A 5F7WC 1KTLB 4Q58C 3ARTA 4WUKH 3FB8B 1UWEL 1JI2A 4GT7A 3WNLA 1H3VA 3FO9B 4YE4H 3WUWB 5C0GB 4NM8H 3QUZA 4CW1A 1V5JA 1EDQA 2EDHA 1OGTA 3O4OB 4XMLH 3KPLB 2CGRL 4QOKB 4U6XB 3VFWB 1N5AA 4RGNB 4XC1L 3K4DA 3K74B 3ULSA 3Q6FB 1EEZB 2YKLH 1FZJA 3L3JA 1JUFA 3PGDB 3L3KA 3FTGB 4RAHA 1GIGH 2DKMA 1BJ8A 1IGIL 1KN4H 5D7LE 3WUZA 4OD1H 1UM4H 5LJYH 5DJ2B 1DLFH 5D7IF 5BCAA 3IFLL 1FNGA 3B6SB 3BYYA 4WU7A 1FNSL 3MRMA 3WEXA 1QR1B 3IU3A 1D6EB 3DVNA 4UDTB 1ZVHA 5A2JH 1B2WH 4C83B 2AK4E 1GVIA 1WBZA 4R4NC 5DMKA 2X4OB 1DSFH 1GGBL 3BPNC 4ZAKD 1AJ7L 3BWAB 1SJXA 5KSAA 3CIQA 4ZFGL 1I3RA 1MFCL 5I1GH 1BVKB 1GHFH 3BUYA 5C1MB 2YD6A 3T0BA 4GAFB 3QJFB 1UWXK 1Y18B 4UUJB 2QADB 2HTLC 4B5EA 4HAGA 2A6IA 2A9ML 5L6YH 3ARFA 4AM0A 3TZVB 2F5AH 2YZ8A 3IDMB 5IMKB 4M1CD 3KJ6H 2WMPA 3I6LD 4KROD 5ECJE 2OR7A 2A73B 2BNRB 3RTQD 5B8CB 3ZDXE 1D6VH 5HVHB 3DHMA 1FZMB 4XC3L 4APQA 5F6IC 1UGNA 5DRWA 2HKFL 1KEMH 4YIQA 1TJGH 4YXHL 5T1DL 4DQOL 3T8XB 1HNFA 1ZEAH 3QDHA 4JFHD 5CHNB 4JKLA 1GGTA 5KZCD 2G9HB 2DLHA 1MRDL 5C0RL 2F54B 4HWBA 1S7QB 4P5MB 1M7DA 1JNJA 4M4RA 2JIXA 2EC8A 4XP1L 1TTGA 1AE6L 2DQCH 5GRVK 2B0SH 5J6HB 4RAUA 5TDNA 4XNQB 1FNLA 5DTFA 2IMNA 1JRHL 3CVHH 1IKFH 3O4LB 4U0RB 1G9ML 3BT2H 4LVEA 3SE8L 3NIFF 5ACLA 4G8FA 4WCYH 4Y5YB 3GJFB 4L4TD 4EI6A 3QFJD 3F6IA 1OTSC 2VXUH 1NFIA 4ZQKB 4E5XB 3TJHC 3VFPA 3P30H 4Z0XB 1N59A 4RX4D 3N1MC 1XGYL 3GSQB 2BERA 3QA3B 3LKSB 5I18H 4PJ8D 2J8UB 4GBXA 4L3CB 3SDCC 3DO7A 4ODHH 4F8QA 3P4OA 4K2UH 4MNGB 3IFOA 4MDIA 1A8JH 5CGYD 5LGJA 5DK0B 2V9RA 4LSTH 1EVTC 1T1XB 3CZFB 3QHZL 3MV8E 2W1NA 4R0LA 4ZS7L 5IFAL 3I6KA 5FEBA 3QI9C 2DQHL 1A6UH 1JPTL 4P9HL 4B50A 2C3VA 3FQXB 1A4JA 1C12B 3D0VA 3MBXL 4ZXBB 4MA8L 2E7LA 5B39G 1JWUB 4PRIA 1WAAF 4L5FL 5GSRB 2D7OA 1JE6A 4QRRE 2LVEA 4TTDD 3JWNC 4PGJA 4LHJB 1UXWA 3IJSB 1OP5H 1DQQA 5E5UB 5KS9B 3UJJH 2ZCHL 3MLRL 4NC1C 1HH6A 1OGAE 4MQSB 1IE5A 2WBJC 1U8HB 4KRPB 1JNLL 5GSVB 3U46A 3UYRH 5BQ7B 1A0QH 1DBKH 4PRDB 3KPMA 1LMKA 5DYOB 3QDMA 5HHXH 1U9KA 2FCBA 2QSCH 1IM9A 1VGKA 5IMLB 4XVTL 1I3VA 4U1LB 1BFOB 4YXKL 4Y2OA 5LGKA 1EH9A 5HI3C 2YD1A 2B4CH 2XA8L 2CK0H 1JV5A 3W0WE 2XG5A 3QEUB 2GJ6E 4S10A 4DKFH 4Y89A 2IAMD 4YGVB 3BP4B 3EGSA 3T08A 4UV7L 4QXUL 5CINH 4BH7B 1I9JH 4PJBE 2FATL 3O3BB 3QCVH 2DJSA 3HNTH 5B4MC 3CFDA 5ETUA 1JGUH 3W9EA 4NUGH 2UV3A 4MNQB 2YPLD 3MLUL 5M94B 2R2CA 2C26A 5I6XC 3PG2A 3PQYB 3RPIB 3WIHA 2IAND 2DBJA 3JTSB 4MB4A 5C7XH 3QUYC 5T1LD 1E6OL 5SV4A 5F1IA 3V0WH 3AAZA 3G6JB 3O2DL 1NCTA 1AHWA 4MHHI 4OFKA 1KB9K 5EIIA 1V7NL 1T2QH 3IDJA 5EORH 1XT5A 4NBZB 4AIOA 1YYLL 1DVFC 3L6FA 1IT9L 1FFRA 3O2DA 3C87A 4P5TA 4A2LA 3HI6H 3X17A 1OB1B 1MJJB 3OHXA 3S37H 4NWTH 1SHMA 2BY3A 1SYVB 3BEWB 3VJ6B 1CQYA 3LAFA 2H26A 4M9PA 3LKRB 4BFBD 3CH1B 1ZWIB 3D2UB 4CUCA 3DMMD 4JJ5B 3C5ZC 4LASH 5MHSE 2CUIA 4FXKA 3VH8B 1DTUA 5F9AC 4GW4A 3FHQA 5INCA 2NY5C 5HY9B 5FM5M 1JF6A 5A1AA 3I02B 4IRJA 4NRXB 4KK5D 4GKSA 3GMQA 1K4DB 4JN1H 3DHJA 3HR5B 1DN0B 3MRFB 1BPVA 6FABH 4XRCB 2H1PL 1J0HA 4XBGA 1QOKA 3LPFA 1SVCP 5BJTB 3D3VB 1RZ7L 5FO7A 5DWUH 3P0VH 4JFDA 5IIEB 4BFIB 2P46B 4OZFG 5LBSL 4FZEL 4IRSB 1LVEA 4R7DB 4RWYH 1RV6X 1LEIA 3L3DA 3WHXA 5I75B 1LK2A 3JV6A 2KQMA 2NY3B 3BIKA 4Q6IA 1OAZH 1KENH 3DXAA 1PSKH 4GAGH 2BY2A 3U7AA 3TLRA 3DVIA 5LQBL 2RFXA 2G5BB 4HHAA 4PJCB 1A1NA 5CCKH 5E99H 1H8NA 2OM5A 1B0GA 4JDZA 4WO4A 1U8PB 4LGPB 4X5XA 1NBYA 3PDGA 4XX1G 5E4EB 5T3ZL 4PJIE 4X6DF 3T0EC 1KV3A 4FFVD 1EBAA 1KTDA 3P4MA 4Q9BA 1D5BA 1DFBL 1NBVL 3MOQA 2NY2B 4JFFB 1BD2B 5L7XL 4QXTA 2LQRA 4FQLH 2EH7L 4GG6B 2NZ9D 2A1WH 3FT2B 1IAKB 3RI5K 3BGMA 4RNRB 1FIGH 1BMGA 4R90H 5MEND 4G9FD 4X6EB 2P5WB 3FO1A 1SM3L 4OLWL 4HZLB 4U1JB 5JOFA 1SJHB 1JYNA 3KLDA 3QDAA 1MWAB 1S7RB 4NO5B 4XNMB 3V5DA 3MACH 5JLZA 1LEGA 3BGAA 2JK5A 1NCWL 3RY6A 3BPLC 4NKOA 3DX8B 5SWZA 3TBYA 1SBSH 2IPKB 4NBYB 1BZ7B 3UTQA 1MI5E 4PRBB 4WW1A 5E9DD 3ARSA 5I1AA 2CRYA 5I17A 2FHFA 3O2WH 4J3UA 5I9QB 4UU9A 5DJZA 1NGZA 5GGTL 4HUXA 4N0YH 2GK2A 2R4RH 1H8SA 5CJBA 4GW1B 1D5ZB 2LV4A 2H2PC 2FECL 4QF1B 4XTRC 4NSKA 5GGTA 1YEEL 1OAQL 4N8VG 4LSVL 5F6HI 4Q9CA 1FO0H 5HHMD 1S3KL 2F9BT 3UTZB 2VQTA 3RZCC 2Z0BA 2NY4B 1NANH 3F5WB 4CBPA 3HI5H 4PJ9A 2H9GB 3IXAB 4QHKI 3G6DL 3ARDC 4Y4HB 4LCCC 2FD6L 4LVNC 3D25B 4AYFA 3HAEB 2GK0A 4HKJB 1DE4A 1L9NA 1U8OA 5DO2C 3KNBA 4WV1A 3UDWA 4OCXH 4L3AA 3ULUC 2BNUA 1P4LB 4P5KA 4PRNB 4HLJA 3OWEA 3PIQA 1EXUB 2VOTA 3BSZH 1AGEB 3EFFB 5DQ9B 1RFDL 4XX1E 3OKEA 5EUOB 5KVGH 3WFDL 3S35L 2GQHA 2A6JB 3TA3B 3LD8C 3L3GA 2AJSH 4OQTL 1JYVA 2QHRL 1J0JA 5C09E 5F7HA 5CBAA 1DJSA 5E24E 3LHPH 1SBBA 5DJ0A 2VWEE 3DYMA 4EQ3A 1T7WA 1I3GH 2RBLA 3DWTA 3OV6A 1OP5K 4DVRL 2MNUA 4YBLB 5FCUH 1YN7A 2I24N 5HGHA 4J3TA 3VWJA 3E8UL 3MJ7A 5IVNA 3GI8H 5DFWH 5KJRL 1BBDL 5MEQB 1EVUA 3D39D 2P7TB 4N9GA 1VKXA 1EA9C 3U2SA 4E9LA 3V5HA 1N4XL 1HSAA 1X3DA 4MAUL 3HE6C 3JV5A 5I1IL 2QQQA 5D4QA 5JW4Q 1UH4A 1D7FA 2ZUUA 4XPHH 3PGCA 4NC2B 1HIMH 5CD5D 1RY7B 5ICXA 1FL5A 4OIIH 3L3HA 4WUUD 4PJFE 3WXVL 4A6YA 2Z9TA 3NFSH 3NGBB 5C0FA 3CX5K 3WNPA 4NQCA 3WJJA 3L95B 4NRZB 5FYJU 5GS3A 1JCKA 5GGRB 2ESVE 3FT4B 3QEGL 2EXWC 3SGJA 1P7QB 4KVCH 3LIZL 2BNQD 5B3JE 4IIQA 3LEYL 3RFZC 1I9EA 1RZIB 4FFZL 1J05B 3S4SA 4H0IA 1C5DB 5TDPB 1RUQL 4OCWL 4OGAC 1CLZL 2QEJA 1QTYT 3L7EB 3C08H 3VFVB 2AEPL 5D7IA 5TE4L 4TOYH 3KPQA 5EBLB 4NKMB 5I1CH 1CL7I 5J7CC 4MAYD 3VE0B 1U8NA 4Y2DA 4LOUD 5DJDB 3T2QA 5KG9B 4OF5A 4FQPA 4PG9A 2I5YL 1CD1A 4QLRA 3TO4B 1IBGL 3MUGB 1P2CB 2C1PA 1HH9B 1MAMH 3VI4F 12E8H 4L9LA 1X5FA 1VGEH 1AD9A 3FB5B 4PJGE 2ZJSL 5JIIA 4OD2A 5ADOL 2VDOH 3HZKB 5CLTA 3VWKD 4K8RH 4K9EC 5ILTL 1ZHNB 2J4WL 4D9QD 1VFOA 4PGDA 4C56D 4KJQD 1A6TB 3VRJB 1DQLH 5DHVA 5DMGC 1EEYB 5FECB 3MRHA 3FAWA 3B9DA 3KYMB 3NCYP 4XP9H 2P4AB 5D2LE 4ZUVA 3MR9A 2CDEA 4LEOA 3PWLA 2AVGA 2Y06L 4L4VA 5E70A 4XCFL 4HT1L 1MF2L 3ARRA 5TE6H 4HJJL 4BK5A 4N0UB 3ROLB 2IH3B 5D1XC 2IQ9H 1TZGH 5E8PA 4RRPA 4JZOB 1KLFA 1YMMD 1A1OB 1E4KC 3RNQA 5HHQA 1BQUA 1QD0A 4YHIA 2XN9D 2A83A 4RGOH 2DL2A 5I8KH 1ORQB 1FGVL 2OTUA 1KPVB 1S7TB 5B38A 2ZCKH 3TIDA 3ZDZF 4Z7OE 4H88H 5GISH 3HMWH 5DJCA 5D6CA 1QFWL 4MB3A 1ZT4A 1P7KB 1XAUA 2XV6B 5DGRA 4JFPA 5B21A 4OZFB 2VQUA 3TO2A 3I6LE 2CXGA 2XWBA 2EDOA 2NY6D 2EEBA 5FIEA 3T65B 3D48R 3C5SA 3LKQA 3UJIH 2PYEA 4P2OB 1AH1A 4JFEE 2DM7A 4K3GA 4JRYE 4NT6A 5H94B 2P5EA 1R5IA 3UCRA 4JHWL 5FHAH 4JFHE 4MGXA 3M17A 4DEPC 5EOTA 5JZ7D 3EYVA 5HDBF 1MLBA 3HZYB 1NC2B 1YEHH 5IESL 4QRUA 4FTVA 2DYPD 4XI5D 5DRNB 1JZ5A 3SDAC 4KJPC 5HYEA 5IMMB 4TQEH 5IR1B 2DTMH 4HUUA 2AI0L 4DKEH 4PBVC 2J8UF 4EXPX 3O8XD 1MIEL 1WAAA 2RCSH 5DC0A 4POYA 2ZNWA 3QWQB 2GJZA 1EUUA 2Q7NA 4EI5A 4FABH 2CMRL 3ZKMC 3FRPA 4HQQL 2ORBL 2VLRA 3MXWH 4O51A 1GGUA 2BSSA 4U1MA 4D0BB 4YQXH 4OCLC 1T83C 2H3NB 3SKJL 2Q76B 3I3EA 3VGGA 3UPRB 3I50L 1KC5L 4URTB 2QR0A 1K6QL 4FQXC 1CFQA 4PY8J 3QH3B 1LO5A 3BKYL 4YBQC 1FL3B 1ZGLP 2P42B 5L2KA 5KS9F 3G04A 1GGCH 4NKIL 3NTCL 5FYKU 2V2TA 4QRTB 3MZGB 1I1YB 2Z35B 2X4SB 4HEME 2OJEA 1MJUL 2NY7H 2XZAL 3DRQA 4DGYH 3MFFB 2WUCH 5GS0H 4OJFL 3QDJE 1YQ2A 5ITBH 2X41A 3IDIB 4XMPL 5C08A 2IF7A 3WDIA 5A3ID 2PO6B 3PL6A 4WFED 3C09B 5C0BB 1A9BA 3MLYH 1QVOB 3SCMD 3MLWH 3KYKL 2DKUA 2XTLA 3MV7B 3EKCA 3B2VL 3T3MF 2XA3A 5F7FA 4B0MM 2P8MA 3MNWA 5A43C 1V7MH 1J1PH 4HS3A 2HLFD 3SE3A 1VFUA 1RU9H 3TT3L 2XQYG 1JGDB 1ZTXL 4LLVB 1HNGA 4FQQB 4YHML 4KI5D 3S3SA 1MJ8H 5C2BH 2AXGA 4ZSOB 4TSCH 4OI7A 1QUNA 3KG5A 4ZDHB 4ERSL 3KXFA 4JN2B 5I2IB 2BCKA 1GOFA 3HRPA 1TJIH 3RGVB 4X7TA 5INDA 5K59E 1CGVA 4P4KB 5F8RC 1D9KD 3MNZA 3VD9A 1G7HA 1KG0A 5F7YC 5EC1B 2LU4A 3G6JF 1QG3A 4X6CB 5I75C 4DKDC 3QO1B 2R0WL 5BS0A 2Q86B 2ATKB 4K94C 5EN2B 4PJHE 2RAMA 2XOTA 5GRUL 4H1LG 3VXRE 1DEEB 5T5NG 5BMFH 1ADQH 1DUZB 2IANE 3GK8L 3LEXB 3V4PL 3GIZL 3OKLA 1IC5H 3G6AB 3FMGL 1X9QA 2LVCA 4YO0A 4GQ9H 3AY4A 1NL0H 2XFXB 5HI5C 4OF8A 2DQDH 5FA3A 4JO2H 5J9PA 1XFPA 4FQHB 1GOGA 4JPVH 1WT5C 3K4AA 3JTTB 5KSBE 4ODTH 5JIKA 2X7LA 4UT9L 1H3WM 5BRZD 3TN0C 4ZAKB 2NCMA 5I8EA 4PJEB 5JPMA 1T6VN 1L0QA 2ICCA 3HNVL 4JQXA 5T1KA 5ID1A 3GKZA 4J4PA 3TH3T 4Z7VE 1UA6L 4K7PY 4JJHA 4M5ZH 1BGXH 1KT2B 3FQWB 2OTWB 5A40E 3C8KB 5EZOH 3BQUD 1BFSA 2IGFH 3WHE0 3A67L 2MJWA 1GH7A 1U2CA 1FGNH 2CUMA 1G7MA 3C5ZA 4Y4KD 3L5IA 4PJXE 4X6DA 2ZKHH 4NUJB 4XP6H 1CVSC 2OLDA 2H6PB 3RWHA 5EZIH 3CVIH 1OARH 1Z9LA 2FO4B 4QGTA 2CIKB 1RZJC 3O6FB 3T3PE 2Q8AL 5C0DB 1I8KB 4H25A 4PJCF 3VXSA 2R9HC 4J6RH 5D5ME 1EZVX 1FNAA 3W5NA 4X7FC 1ORSB 1ZE3C 3OJ2C 5HI4D 2HVJA 4DOHB 4X8JB 3UJTH 3NABL 5FUZH 1DEDA 3K7UA 1U3HB 1U8LA 4XGZA 1MIMH 3LKPA 3CFJA 3UBXI 1LDSA 1OVZA 3S7GA 3EDKA 3QFJB 1Q9KB 4D2NA 3VGAC 3CFIC 4GG6F 2YSSB 4Y5XA 1BQSA 3WFEL 2GEEA 5CIPA 2YD3A 4C59B 1NC4A 1KFAL 2O5ZH 3WO4B 5FYKL 1P9MA 5EIVA 1HCVA 3PWUA 2Y5TA 3FONA 5DVKA 3QULB 3ULVE 3MGTA 4G8GD 2VERN 4FMFA 2I60L 1J8HE 4JCLA 3RL2B 5ISZD 5AG8A 1XGTA 2UZYB 3QUKB 1MCDA 1ZSDB 2V5YA 1QYGH 3EJJX 2AERT 3MRJB 4Y16C 4G9FE 1HXMA 5D7KD 5DI8A 5C0CA 1XF4A 5GRXG 4RGMB 3OX8A 5C0AA 3IFNL 1YY9C 3UTTB 1EGJL 1RJLA 4OGYH 5C6TL 1V3MA 2XZZA 3BPOC 4J12A 4YAQB 4PY7B 1I8LC 4WJ5B 2XRAL 4MVBC 4HH8A 4HDIA 4Z9KB 3VI3E 5C0IA 4KFZC 2QKIA 2VIRB 5IWLC 5JHDE 1EAPB 3I6GA 3B9KC 4LHQB 1U8JA 1MRCH 5HYJA 2X40A 2Z4QA 5L2JB 5E95B 2PR4L 5IQ7L 3QPXL 1Z3GL 3C9NA 2OQJB 4JRXA 4OUOA 1IC7L 1FNHA 3WL9B 5CILL 3TBVA 3CVHB 1FIEA 4K71C 1A4KB 4UOW0 1CXEA 3QUZD 4R4FH 1RQ5A 3P9LB 4QHMA 3RZWA 3UEZA 5DLML 2Y36L 1PFCA 2UYLA 2HKFH 4NJAH 1KN2L 5GGVL 1I9RL 4G9DA 5CWSB 4JQIL 4LSSL 1F42A 2XWTA 3OKNA 1B4JH 1P5VA 5KTEL 1MRDH 4EDXA 5EUOF 3KJ4C 2AABH 4FQJH 4ELMB 3DSFL 5BV7C 2J2ZA 5JHLH 1YPZE 2AAVA 3CXHK 4ZD3H 1MAKA 2AEQH 4UV4H 2YPLB 2KZWA 2VC2H 1QRNB 5F71A 1WUNT 3AS1A 1IGCL 3L7FA 4QEGA 3SE8H 7FABL 3GSUA 3GZKA 3MRRB 5D72L 1T4KA 3NIDF 5T1LB 5HVFB 2Q6WB 3LV3A 4PRPE 3CSGA 5GHWL 3VMNA 1BFVL 2VDRL 3VGDA 4HIHB 4YDLC 1XCTB 2Z92A 1T3FB 3ULUL 5KSAD 1X5ZA 8CGTA 1T1WA 2L7UA 2UWEB 2MHAB 3CU1A 4WHTA 1NEZG 2G60L 3ARFD 5JW5B 5AD0A 1IGML 5DK3A 4MQ7B 1KTLA 2XZCL 3DMMB 3FB8A 4F7EB 3KDMA 2YUXA 3T77A 1WGOA 3D39E 1QSFE 4YFLI 3WUWA 4LRIC 4M7LH 3KPNB 4APQD 5C0GA 2BC4B 5J4MA 3DVFA 5IBLD 1N5YL 3GB7B 1I9IL 3HUJE 1ZA3A 4HIXL 5FXCH 2R1WB 4NP4H 3AREB 2A6KB 4DTGL 3E6FB 5BZWB 1S7SA 2ZCHH 1A2YB 4QOKA 3VFWA 2JIXD 4JZJC 2YXFA 1IGYB 3UYOD 1EEZA 1KELL 5JMRA 2ERJC 1MVFA 4EVNA 3FTGA 3BP5A 5DEGA 4JFZL 3BP6A 4Z78A 1N0LA 3CMGA 4PIRF 4WTZA 3RIFK 3U4EB 5DVOA 1INQB 3EZ8A 4LCWA 4M7JH 1QR1A 5TE7L 1D6EA 4YHKL 4UDTA 4C83A 5IVXE 2X4OA 1IZJA 2XQBL 1BAFL 1GGIH 1G9NC 1KCVH 2X09A 3BWAA 1Z9SA 3V6ZB 4K55A 4GBXD 1A22B 2BVOB 4M43H 3WIIL 1BVKA 3H7LA 3WN5C 3HB3C 1CT8B 3QJFA 4PFEA 4UUJA 1C5BH 3PE9A 3IKKA 1CDIA 3EYSL 4P3CL 1AGDA 3CH8A 5BO1H 5ANMA 4KV5E 2R4SH 3TZVA 4GUPB 4NZRL 4NGHL 1TJHH 3IDMA 1KIPB 5IMKA 3BOVA 1I4FB 4RCAA 5JQ6H 1D5XB 5F3HB 1KEGL 4H8WH 3ARVA 3CFBB 4M00A 3VXUA 1RZ8B 1NGXB 2A73A 2BNRA 5DQJB 4X80L 5B8CA 4PRID 1FZMA 4BSWB 3QWRA 4X99B 1P84K 5MENB 1J5OH 1H3XA 4D9QE 2PW1B 2OSLB 3JWDH 5E94B 3T8XA 4C56E 3EO0B 4U2ZA 3LB6C 4P3WA 4RISL 2G9HA 2C9AA 2F54A 4K9EL 4JZNB 4FOMA 1S7QA 4P5MA 1F58L 3LMJL 3O3EB 3DSNA 3QDMD 5J6HA 5KSUB 1OT1A 1IM9D 2NY0D 4XNQA 1OOAA 4JG0L 4P0DA 3O4LA 3TVMC 2HKHH 3SGDH 1QLFB 5ID0B 5EH1A 4C58B 4Y5YA 5T1MB 3GJFA 4J3VA 2BVEA 5DF0A 2DLIA 5I1HH 2XPGB 1CR9L 1YMME 4QHUB 4UTAH 3U7YL 4ZQKA 4E5XA 3FQNB 3MCKB 2XN9E 5FUCC 3DJ9A 4Z0XA 1G7LA 1WBYA 3MRPB 4UINL 1QNZH 3QA3A 5K33A 3W9DB 1U0QA 3BKMH 3BHBA 3UZQA 3WV0A 5DS8B 3FQRB 4MLIA 4L3CA 1CGYA 4UILL 4OLUH 4MNGA 3SO3C 5D1XA 3ALWA 5HHMB 4XXCC 2COQA 3I84A 4XPBH 4CU8A 4Q9RH 1QBBA 4FQ1H 1KTKE 4M93C 1T1XA 3CZFA 1RIVH 4DCQA 5JMOC 5KVDH 3ARUA 4POZC 4NQXA 4JHZA 5ALCH 1F45A 5EO9A 3U9PH 3WKML 3M8OL 1YECL 1C12A 2WBWB 4ZXBA 5BXFA 4MXVE 5D2NC 1QBLL 3T04D 1JWUA 1KOAA 5CLWA 4POUB 3F12B 4NOBA 2G5RA 5C9JA 2X6MA 1JPGB 4D8PA 5CJXA 3IJSA 3O3DB 5KS9A 1EJ6A 4RIRB 4P5TD 1Z9OA 2GFBB 1HDMA 5A16B 1FSKB 3U7WH 5IVZA 1H3PH 4RMUA 3OTTA 1UCBH 3GMRB 1U8HA 3A0OA 3MC0A 4PRDA 5DYOA 5KVEH 2FGZA 4I13B 2QBWA 5IMLA 3FO0L 3ARBB 3N9GL 4U1LA 2R0LL 5T3XL 3SE9H 1FLRH 3RWDB 4N8CL 3SDAA 4U3XA 3MX0A 2D0FA 2I27N 2KQNA 3E2HB 5E2WH 1YJDL 4IRJD 3GMNB 2X4TB 3CX2A 3ZTNL 3QEUA 2DQJL 3HE7C 4YGVA 3BP4A 3AB0B 4QT5B 1L9MA 5CFHA 5J3HD 4LCYB 4BH7A 5L9DH 1KCLA 2DD8H 3IF1B 3O3BA 2XTJD 4ZUSA 5AEAA 1MFEL 4JFDD 3CDGA 5F21B 4J3OC 3RY5A 3X11B 4MNQA 4ORZC 4WUUB 4FQXA 3PQYA 5GPRA 3RPIA 5SWSE 4Z7QE 3ZO0A 3DXAD 3MBEC 2VYRE 5D7JD 2EZ0C 3MOAH 4WFEE 3PWVB 4I18C 1BIIA 4YK4C 4M8QB 4H26B 3MLVL 1MCFA 1LP9E 1FZKB 2BNQB 4KPHH 3OKMB 4WO4D 2VUYA 3QRGL 1BJ1H 4J3WA 4XPFH 1PBYA 1L7IH 1YEEH 3EO9H 3RHWK 1OB1A 1MJJA 4ZG1A 4XNXH 1SYVA 3BEWA 1RIUL 3VJ6A 5T3ZD 1MCIA 4LGRB 1E4XI 1ZWIA 3D2UA 4G6AD 4X6CF 4JJ5A 2XY2A 1CL7L 2NR6D 4BA8A 5CAYB 5FUOH 2FD6H 4K3DL 1BX2B 3N0PB 5HY9A 1SJVA 3DBXB 3O6ML 4CN1A 1NAMB 1XIWC 3I02A 4D9LH 4NRXA 1KIRB 5ESAB 1K4DA 2DM2A 1T0MA 2WUBL 1YEFL 3CXDL 4PRHB 1DN0A 3MRFA 5BVPH 3CDYA 3DROB 4TVPE 4XRCA 2MOVA 4GRLB 5D7LB 4DAGH 3VFGL 1DQTA 1X5AA 2D9CA 3WFDH 3VWKB 3D3VA 1EHNA 4GKNB 1AY1L 1F3DH 1BZQK 4BFIA 1N6UA 2F15A 2QHRH 2A0LD 1X5JA 4K94L 4XVUD 4Z7WA 4R7DA 1UQSA 4PJEF 5C6WH 2IG2H 3ULVH 2C3WA 5DD3H 3E8UH 5IHZB 3BDXA 4K7FB 1VENA 4R26H 4M9OA 5EZLB 4PJCA 4FQCH 1YYMH 4IS6B 1U8PA 2Q3AA 5FO8B 4EDWH 4PG2C 3GO1H 1QEWA 3PHQB 1MJ7H 3X3FH 1KB5L 1WT5A 4PJ9D 4ONHB 4G8IA 3RVXC 2B39A 3BKCH 4ORGB 2VXSL 3OXSB 4JFFA 2X4UB 1WICA 3TN0A 1OPGH 5CMAB 3V0AC 1RUAL 1S8DB 4OZHE 1KB5A 5EU3B 4GG6A 2K1MA 4RAVB 4ODVL 3FT2A 2NY6B 1IAKA 3Q48A 5E7FA 2EIZB 1JGVL 3KPSE 3RKDC 1MWAL 2W9EL 4X6EA 1KJ3H 2EH8L 3EOBA 4HZLA 4U1JA 3SDXB 5GZNC 5I8OL 1BJMA 4KJYB 1EFQA 1SJHA 2A74A 4XNMA 4LARH 1MWAA 4NO5A 1LO4L 5D1QB 4NDMB 1WCBA 1T7VA 1A5FH 35C8H 4WNQB 2VLLA 1RZJL 5IFHH 4DGIH 2DYPB 2OR8A 4EUPH 3DX8A 5F6HJ 2IPKA 3EDDA 3PJSB 1BZ7A 2R0ZL 4LLYA 2ZG3A 1ED3B 3VWJD 2W65A 3MJ9H 4HH9A 3UC0L 3O8XB 4GMTH 3ZT7A 1TCRB 1FORH 5GIRB 2ZUQB 1D5ZA 4GG8B 3STLA 2BOCB 4QF1A 2V9TA 4HC1H 3MV8B 1W0VB 4YWGH 2FWOB 3H9SA 3UYPA 3WD5L 5D1ZB 3VFMB 2AKRB 3UTZA 1Q0XL 3IU4L 5ESQB 3NMEA 5TFSL 4WFGD 3SN6N 3WO3B 4KHTL 3AFLA 3F5WA 2X70B 3H9YA 1ZHBB 2H9GA 2GIYA 3F65A 3IXAA 4NQCD 5D7KE 5F8QC 5K9JH 3MZTA 3HAEA 3KLHC 1HSBB 4D3CH 1QACA 4HKJA 4HS6B 1QKZL 5CGTA 1NGWB 3N1QC 2VDPL 2UZIH 3SDYH 4XCFH 3MMEB 4HT1H 1MOEA 5CP3A 1P4LA 4PRNA 1EXUA 4NQEB 1AGEA 2CKBH 4HWUA 4RA0C 5DQ9A 4M61B 2ADIA 4FP8H 2A6JA 4O00A 1WFUA 4S1DC 3CDFA 5JXAL 2DQTL 1K5NB 4BQ9A 1ZS8B 3U30C 4GKZA 4MJ6A 2GJ6B 2J6EH 4OAWB 1QFOA 2CDFB 4JKPL 3MLSL 2W0PA 1GJIA 3H0TB 4RBPH 5DA4A 3D18B 4Y2DD 4OI8A 5HGAA 3ZL4H 2G2RB 2B4CC 3TT1H 1UEMA 4KKCC 4U2YA 5HYIA 1Z0MA 4P49A 4FXGB 4ELMF 2BVPB 4M7ZB 3FFCE 4I5BB 1P4IL 3EJZD 2HFGL 4Z7NF 5MEQA 1U91B 2P7TA 4AEHH 4JHWH 1LQSR 3ZKQD 2V17L 4R8WH 2PTUA 4X7SH 1MHEB 4FZ8L 1GL4B 1N3NB 2NLJB 1WISA 1BWMA 3QFDA 4U31A 4O58L 5IB4B 1S5IL 5CEXB 1WEJL 1KCRH 2APWA 3RGHA 2UWEF 4ZYKB 5EOCJ 4WDIB 4UB0H 1CK0L 2XYCA 4NRZA 4M5YH 1HHGA 4PPTA 1RIHH 3L5HA 3C6LB 5HHNB 5GGRA 2IALA 4L4VD 2ITDB 4Y1AE 1F4HA 1P7QA 3F58L 1PEWA 3STZA 3L5XH 1RZIA 2QQNH 4M7KH 1J05A 1BLNB 5TDPA 4E41B 3IDXH 3I50H 1RK0A 4XHJC 5BRZB 1CTOA 2R1YA 1CE1H 3O11B 3BDBA 3L7EA 4L8DB 1OLZA 3MGAA 3QWOB 1IFHH 3VFVA 4TUKH 3VXNB 1G7PB 3RAJL 1K3IA 4NKMA 5TH2B 4F37K 1A7QL 25C8L 4ZOEA 1JZ6A 3VE0A 3V6FB 1CDGA 2YD5A 5DJDA 3PWPE 5KG9A 2JB5L 5IEHB 4ZO6A 2PYED 1ETZB 4JHBA 3TO4A 1G6RL 3TCLB 3MUGA 5FOBB 1HH9A 2LTQB 2P5ED 4X4YA 5C71A 5E5MA 4Y4KB 1G6RA 4BZ2H 4PJ7B 3RX8A 3IJHB 1F4XL 1JPSL 4FTVD 4OD3L 1F11B 1A6TA 2X89A 1ZLSL 4MCYB 3TC9A 1EEYA 3T09A 1Y6MR 4ZFOB 3DV4B 3KYMA 1GCFA 2RB8A 1KCSL 5J1SC 2XIDA 3BUTA 1ONQA 2YXMA 4JZJA 3H8NA 4NWUL 2W9LA 4EI5D 2D7MA 1CVRA 5DD6B 5IVOA 3VG0H 4YDJB 1U58A 2VLRD 1C5CH 4U1SB 2E27H 4M62L 1SEQL 4QHLB 3ROLA 2F53E 3WJLC 4RFOH 4O9HL 4JZOA 4KWUA 3C8HA