1TQMA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to amppnp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 95
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqmA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqmA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqmA02
1GIHA 3GGFA 4QMZA 3OCSA 5AM6A 5IPJA 3GVAA 3WU1B 4MVFA 2GNGA 2J90A 4BHCA 4ANBA 3AT4A 3ZUTA 2YWPA 3DQXA 5M09A 2IW6A 1LPUA 3MESA 5E1WA 3RBWA 4L9JA 3ZBXA 1PXOA 3NZ0A 5E8XA 3RALA 3NEUA 3PIXA 2ZJ2A 2OZUA 3V8SA 3AC8A 4RMZA 2BKZA 4L00A 3FMSA 4G6OA 4XHKB 2YJRA 5C8NA 3QAME 3MQ0A 2CCIA 3QL8A 3B73A 2QO9A 2HAKA 5HG5A 4DG3E 5GIOE 5HNGA 5KVRA 1UHWA 5DMZA 4A7CA 4RZWA 3BBWA 4NM5A 2KRFA 3WZDA 4Y83A 3WZJA 2TDXA 1QO0D 3EDPA 2XK4A 3HLLA 4GMYA 2JDSA 4RS8A 3VBTA 2J2IB 3OOMA 4AA4A 3TO6A 1LDJA 4Y72A 4RVTA 1W8CA 4EOOA 3R1QA 5H6QA 3NUSA 5I5ZA 2OKRA 2J0LA 2NPQA 4DFUA 2G2HA 3GOKA 5ETAA 2A69F 3AMYA 3MSSA 1IEPA 4BDJA 2P2HA 3LFEA 4S31A 1IXSB 4EOKA 5AAFA 3ULZA 3MPTA 4U7ZA 4BCFA 2PZYA 1KYZA 1ZRZA 4CVAA 4FEXA 3VODA 4H1JA 2HY0A 4RIYB 4O81A 2HR3A 1BX6A 2X0LA 3VJNA 3GUBA 3QCYA 4Z55A 1XDUA 1MJBA 2B53A 2VUWA 3LA7A 3VIDA 3K1MA 4EK8A 3VS5A 3HHGA 3DBEA 2YM6A 3DY7A 4I98B 2YZAA 4YURA 5IQFA 4HBLA 1F3MC 3J80Z 3VS0A 3VHEA 4KINA 4USDA 1FQ1B 2YCSA 4FIFA 5EM7A 4YU2A 3LFKA 2HTJA 1WCCA 3TM0A 3T3VA 2XIRA 3R9NA 4D4RA 3EQHA 4YTHA 2V79A 4MYGA 3E62A 3QQUA 3TKYA 1G5SA 4BC6A 3ZTXA 4WIHA 2ZM4A 3C4WA 2XF0A 5J95A 2EFNA 1P92A 4FTLA 3LXPA 5K5RA 3KREA 4EM1A 2VTLA 3SHFA 3ZZEA 2RNJA 3E7OA 3AC4A 4M0YA 4TWNA 1FOKA 3PY1A 4DC2A 2OJFE 4B09A 4AZWA 4JX3A 4IB1A 1OPLA 1R0EA 3R83A 3DFCB 3QZFA 2GMXA 4C4HA 3CTJA 3E93A 2YIYA 3F5UA 4D4VA 2V7OA 5D6EA 3ENHA 2FA5A 3O96A 5HI2A 4BGGA 3UYSA 5AAEA 1LUFA 3Q2MA 2J5OA 3VUMA 3I0QA 4DTBA 2WMTA 3WZUA 3ZSHA 1FOTA 4MTDA 4BCIA 4J1RA 2XRNA 4JG7A 2A4LA 2VWYA 3ZRMA 5D9HA 4F6UA 1KV2A 5IH5A 2V1UA 4JR7A 3AD5A 1YXUA 1JVPP 4G3DA 3JS2A 4JLCA 5FXSA 3I58A 2OJJA 1U46A 3R8ZA 3FY2A 4O7TA 3MI9A 1WWXA 2EFPA 4AT4A 3L2CA 3O23A 3Q3BA 4HZSA 2X0GA 1MZBA 4DEIA 3CS9A 5EKOA 4MD8E 4P5ZA 5HDGA 2R2PA 4JG6A 3Q9SA 3VEPA 4EH9A 2DS1A 2WMUA 3E8NA 4F99A 3RGFA 4AZVA 3EHAA 2R0UA 4PZJA 5EHLA 1PYXA 3U6IA 3FHZA 4OMZA 2R3RA 4YZ9A 3FHIA 4ZSAA 4JAIA 4F08A 3P5KA 3UP7A 4RAYA 4E4LA 4HV6A 4RIOA 5CAPA 2WXVA 4MXYA 1R39A 3LM0A 3FDNA 3R8PA 5LGNA 5D11A 2XCHA 3E5XA 2KIMA 5A4QA 5IH4A 2WIHA 4BBFA 3NUNA 3F5PA 4BICA 3O2MA 2IZTA 5EKNA 5DEWA 3H9OA 5K4JA 5AP7A 4I0AA 5HLNA 3FLWA 3FX3A 4W4XA 3FI8A 1QPDA 3RI1A 4JNWA 4GRBA 3FI3A 3B2WA 4IVNA 2CHLA 4EWQA 3OT3A 1XMKA 3FLQA 2WTEA 2CW0F 3UO6A 3NUYA 4EC9A 5ETFA 4HZRA 1Z57A 4A06A 3D4QA 3WTXC 4FTQA 3OMVA 2YJSA 2PPQA 2XHKA 3OY1A 4KB8A 5FXRA 5KMMA 4AUAA 4JRNA 5HDKA 3QFVA 4LRKA 4C8BA 2VTRA 4DFLA 5HEZA 2DTRA 4OIOF 1AOYA 5M06A 2IO6A 4OAVB 3UO4A 2PK9A 2OICA 1KU3A 1M7QA 4YZNA 3G0FA 5D5XB 3RP9A 3D83A 3ORPA 4NYEA 1IZ1A 3RK7A 2C6DA 4ARKA 4G2FA 1OIRA 1PJKA 2YEXA 5AX3A 5EM8A 2F57A 1ZG5A 4WT6A 1LEZA 4ACGA 4YLLA 4R7IA 4CCBA 2ZYBA 2G9XA 2FNPA 3L8SA 4CLIA 4RFYA 5FFXA 3EN9A 5E8ZA 4AZSA 3GQLA 5H2UA 5CNNA 2W1ZA 3S2WA 2KJBA 4G7HF 5FD5A 5DUIA 3Q4TA 4NJDA 4KKEA 4Y17A 3QHWA 3OEFX 1KE5A 2PZ5A 3VRZA 4M74A 2ELHA 2YDIA 4BCOA 4BCHA 2I0YA 1ZARA 3MJ1A 3CE3A 1PP8F 4I92A 5LVPA 4CLJA 4AE9A 2IZRA 2VNWA 4RQKA 5H8BA 4EWHA 3EFJA 2H6DA 3IRQA 4ZSEA 3LOKA 4TN6A 1LEWA 4Y8DA 2YCFA 2XIYA 1OB3A 4C2WA 3KE2A 3U87A 3QZHA 4WKQA 2NS0A 3VWAA 5JZJA 3P0MA 4DITA 4YHJA 2WMBA 3H0YA 5C4KA 5M4UA 2MLGA 5HNBA 5TKDA 4JQEA 2I6LA 4QP3A 4FEQA 3ANRA 3HA8A 3M8FA 5HBJA 3VFZA 1D5VA 1FP2A 3DPKA 2OQRA 1GIIA 1QCFA 4A07A 2ITOA 1U78A 1ZYLA 1R78A 2PN6A 2F7EE 4DT9A 2OIDA 2L4MA 4FOBA 4KIKB 4GKIA 4Y73A 2RC4A 2OXYA 3WGIA 2Z8CA 1VYWA 2P5LC 2MLKA 1PHKA 4UXNA 1QZZA 2Z02A 3R9OA 3ZMSA 1Z6RA 4BFMA 4U3ZA 3F22A 3R4KA 3QUDA 4XG7A 3WTSC 3EQBA 2OLCA 4JBVA 1YO5C 5HO6A 4L3JA 3OY3A 4GU9A 1UV5A 3ELJA 3W6KB 5CEMA 2J5EA 1O3TA 5CAUA 4BH9A 5A4EA 5J5TA 2VNYA 2DQ7X 3MTLA 3WZKA 2W4OA 3WF9A 1X8BA 4NFMA 3R1YA 3ET7A 2P4IA 2GQQA 3LFSA 1WKMA 1ZG3A 2OFVA 4I01A 3ZCLA 3R01A 2CPKE 3RDIA 4KRDA 2XAHA 1PW2A 5BVFA 3T3UA 3Q9VA 2B0LA 3PG3A 3KFWX 3KQ7A 2OZ6A 2B55A 4C3FA 3IDBA 4L53A 5HOAA 2VT2A 1B38A 3DNEA 4D0XA 2P5VA 2Y75A 3HOTA 2LNBA 5DV5A 2XJ0A 3EJ1A 4XG8A 1W84A 3D5UA 3NCGA 3R2BA 3D15A 3HV5A 2UW7A 2QU5A 3U9NA 3IONA 3LA3A 2DPDA 2REIA 4HYHA 5E92A 1USTA 3QD3A 2XH5A 4TNBA 3KF4A 5EYMA 4IHTA 4B7TA 4Y46A 3Q4UA 1ZY4A 1T98A 1REPC 2ZO4A 4FKUA 1OPCA 3K1PA 4U6RA 3K0LA 2QC6A 6PAXA 1OIYA 1RUOA 3QP6A 4FOCA 3EQFA 2A27A 4UNOA 4QMQA 4G6NA 2GDOA 4QP8A 3MVJA 4MQVA 5DLSA 2X7FA 1HXDA 3TJDA 4ALUA 5BOXA 5GZAA 5KZ0A 3Q52A 2JITA 4CDGA 4O38A 4QMWA 3NVMB 2CLQA 4R3PA 3UJGA 4XS2A 2GNFA 3PFQA 2QR7A 4CYIA 2C47A 4ON0A 3TZ8A 2YIRA 4MQ2A 1YXXA 4X21A 2WEVA 2A68F 3C1DA 4AIKA 2OIBA 2IVVA 4J8NA 4FV6A 3KC3A 4E4NA 4OIPF 4GVJA 5D41A 3AC2A 5J7HA 2D45A 3O6BB 3KZZA 5M4CA 3KP3A 2BHHA 1MRUA 4WF2A 3DEUA 2FMYA 1RW8A 3E5UA 2W1HA 2WQOA 4PF4A 4RG0A 3F69A 3ZEWA 2VWZA 4E5WA 2ETKA 3R22A 3WIKA 3SC1A 5TE0A 4GT3A 4C0TA 4CV9A 3UG1A 2PE1A 4AX8A 1PF8A 4U41A 4TRLA 5AP4A 2PVLA 2Y9QA 1XDSA 4ZTRA 2XK3A 5FM3A 1OKWA 3EWHA 5AIKA 1CM8A 4NT4A 1SMTA 3GC8A 2WTWA 3T1BA 1PUEE 2VWUA 4XH6A 4TYIA 3LJ0A 3PA4A 4O2ZA 5HU3A 4I5MA 4DYMA 3PVBA 4FG7A 2G2FA 3I81A 3CO7C 3DJ5A 1NVRA 1NVSA 4QPSA 3B02A 1NXKA 2B1PA 1IAWA 4GFOA 3IC7A 5CASA 1OL7A 3QD4A 3FXWA 1J7LA 1O9UA 3S0OA 3CJFA 5ANDA 3KF7A 4AE6A 3DB8A 2Y4PA 3PVWA 1H0MA 5AUWA 2WTVA 3DQWA 2CKEA 4PQNA 5BYZA 1YFHA 4UVAA 4XNEA 1Q62A 4E6CA 1H4LA 2VE9A 3DA6A 3CO6C 2PULA 4YPDA 4FSRA 4I6HA 3FI2A 4AU8A 4L7FA 4E7WA 2QOQA 2Z99A 4DFBA 5M57A 2CQKA 1OM1A 4RJ4A 2ITNA 2L02A 3UO5A 2JFLA 3PYYA 4EJOA 3B2TA 4QP2A 2H6CA 1U54A 2OZAB 4KD1A 3HMNA 3ABTA 2WNTA 5DIAA 4BXUA 2XM9A 4G6QA 3GUDA 2COMA 4UZDA 1YI4A 4PNKA 3THBA 1K78B 4RAZA 3EL8A 4BDCA 3TDVA 2W06A 5CZIA 3ATSA 5CS6A 4W4YA 3EETA 2HOGA 3CJNA 1JE8A 5BVOA 4NEUA 5CTPA 2HZTA 2IRFG 4RVKA 4R8QA 4F0FA 5L2WA 5DRDA 1U5TC 2YPRA 4OW8A 1XGOA 5DEQA 3G6HA 4E4MA 1R0PA 2FBKA 4UVBA 2G2IA 4ZTMA 4O7YA 2Q0NA 5L2SA 2IT0A 2PE0A 4WG4A 3ERKA 4BNCA 4MXZA 3WIGA 2B9HA 4EKLA 2XROA 5E4HA 1TTYA 4R6VA 1F5TA 4RC3A 5HZNA 1KUTA 2WTCA 3LZBA 4N6ZA 3DU8A 4IB0A 2BDJA 3RPRA 2EVAA 4X2FA 2ZB1A 1UA2A 2UVXA 4L18B 1WBSA 2PY3A 3CGFA 3MZYA 4XSXF 4KSQA 4O0SA 3BU6A 4BBEA 3Q9XA 5ACBC 4Q48A 3GW2A 1PY5A 4O7LA 4I5CA 2IWIA 3L8VA 3DLSA 3SFZA 2KJCA 3OCGA 4RZVA 2QO2A 3I6UA 1H0WA 3LXKA 4H3PA 2R3GA 3F2AA 1Z1DA 1HKTA 3ORMA 3L9FA 1UNGA 2VGOA 2CMWA 1XWSA 2OAZA 4IWPA 3Q5ZA 3HMMA 4O0YA 4IXPA 2W85A 4UN0C 3H30A 5L2TA 4JIAA 1BC8C 4HOKA 2XRWA 4IX3A 3I59B 3PXYA 2HEOA 4E6DA 3MV5A 5DT0A 2UW6A 4D4YA 5CVFA 4Z3VA 3ALNA 5DCMA 4A4LA 2BEOA 2J51A 2OWBA 5IH6A 1ZHFA 4R3CA 4LYNA 2WTJA 1YDSE 3SW4A 2O0UA 3L1SA 3QU3A 4L44A 5CF6A 3ZMZA 3TT0A 2K27A 1ZZ2A 4YIIA 1MRVA 3KK9A 2Z7RA 5BUJA 4EEVA 2OQGA 5ETIA 5AUXA 1UVRA 1GXQA 2VTTA 4E4XA 2JKQA 4I6QA 4RJ5A 3C51A 3ZRLA 3MGYA 3WOWA 4EZ7A 2X6EA 3HSRA 4WK8F 2P0CA 3A4OX 2FYSA 1DI8A 3HOSA 4ENNA 4HYEA 4FA2A 3H3ZA 1ZLKA 3ZMDA 2Z2WA 2HXQA 1NY3A 1FPQA 1ZZLA 4RLKA 4WG5A 4OINF 1WBVA 3SKCA 4IC8A 3CIKA 3ZM4A 5J5SA 2ETRA 1VEBA 5HESA 1IN5A 4PX6A 3Q04A 2RFSA 4WO5A 3IKAA 4QMVA 2ACJA 4C37A 3SG8A 2WC2A 2OI4X 2VX1A 3I0OA 4DA5A 3DDPA 4GGGA 5BYYA 1IXCA 4MTAA 4GYIA 3MY0A 5L6OA 5ERIA 3ORIA 3OXTA 4G5PA 4L9IA 4ACHA 3V5PA 5H6RA 1EV7A 4UVCA 2PMOX 1OKVA 4C58A 4Q5EA 1OKZA 2PZPA 4FVRA 5T3QA 5ANEA 3D7ZA 3F9NA 4JDJA 1GXPA 3I54A 2GSFA 2D2WA 1AD5A 3J7AO 2W1CA 5DCFA 3V8JA 1Q24A 1B4AA 4M73A 3IW8A 3QU0A 1J59A 5AAGA 5FUTA 2ZNYA 3JW4A 5E8TA 3HRFA 4GSBA 4WUAA 3GXLA 2YERA 5F64A 1BI7A 3MFUA 1YQAA 4CFNA 1UU3A 4FTJA 1Z91A 3GC7A 3R63A 4X6RA 5M53A 4H36A 5AA9A 3PZHA 5LVOA 4MHGA 3CSVA 3LAJA 2Y0AA 5ICGA 4CICA 3GO5A 1TKIA 1JKSA 1U59A 3WTZA 4IHSA 2GTNA 2RDPA 3ZHPC 4GCVA 3QGWA 1XMAA 4CKRA 4IRHA 3ZBFA 2VTQA 3SXRA 4D2SA 1J2XA 4YNOA 1FBNA 2FOKA 2KTYA 1HCLA 4OAUC 1LNWA 3P7AA 2XIGA 2YN8A 4JDIA 3G9NA 3QCSA 1I5ZA 1WVYA 2OO8X 2P55A 3LJ2A 3TCPA 3VS7A 5GZ8A 3H4JA 4KIGA 1QL6A 2WMSA 5KUPA 3WGHA 5KBRA 2C6EA 4ZLYA 4U80A 1UCRA 4CFXA 5T6KA 4FZAB 2WELA 4E5AX 3KXZA 1K7AA 5I9ZA 4I93A 5KNJA 4IX4A 5F1ZA 3AC1A 4L5JA 4HGSA 4EOPA 4ZS4A 1ZREA 4FNZA 5H9BA 3VQHA 5CEPA 3ZO2A 4BY9E 5BPYA 3I5ZA 5B7VA 3FXRA 5EYDA 5E8IA 4DINA 1JWHA 3ZO1A 2NP8A 2ZDUA 4BCKA 5BS6A 4OTFA 2W5BA 4QTEA 2HZ4A 3PXZA 5L6PA 5IQGA 4ZMFA 2YACA 2A5YB 4V0GB 5CT7A 4QP9A 2R3KA 3OS3A 3W18A 1ZMVA 3JY9A 4Q4ZF 4J99A 2PVRA 3PSCA 3SQQA 3TNWA 5IF1A 3VUKA 2FNAA 4ZLOA 3P08A 4XG9A 3CD3A 2XKFA 4B99A 3IDCA 4UX9A 5DDGA 4KIOA 5JRSA 4FBXA 2GQRA 3OOPA 1JSUA 2MH2A 4Z9LA 4FEVA 3NSZA 4N0BA 3MEXA 3OW3A 1EH7A 5HX8A 3IK3A 4HOBA 5IUIA 3ZH8A 2RQPA 2VOPA 4ERWA 3BHYA 3CP9A 3LA2A 3HDNA 4CXAA 4WRSA 3FWQA 4X2GA 4PDYA 4BCGA 3DPLC 5GJFA 5TF9A 5L3GA 5CSXA 3VOEA 1O7FA 5HE0A 2IW5A 4FKTA 4FKPA 3W2PA 4LLGF 4ACMA 2FSTX 4LGDA 3FAAA 3LXNA 2UV2A 3DBQA 4GIIA 3NRMA 4O82A 1HW2A 2QG7A 3T9TA 4CKIA 3UMXA 2VGPA 1HW1A 4TT7A 3SX9A 2C6KA 2AC5A 2W96B 4BR3A 3ROUA 3FPMA 4UWYA 1FVRA 4KMUX 4S34A 5CENA 1XCBA 3F23A 1S8NA 5CSHA 5IUGA 1P6RA 5DVRA 3HRTA 3CC6A 4X3JA 4ASNA 1UU8A 5GIPE 3SLSA 3HUCA 1IW7F 4V04A 2FXAA 4XV9A 3BV3A 3WE3A 4RX9A 3FSKA 5BQ0A 3OC1A 2J5FA 5FFZA 2CCHA 2J4ZA 2VTNA 4H3BA 5CAVA 3BZ6A 3W8QA 4NIFB 4MTEA 4A9YA 4E1ZA 4RRVA 5BVDA 5HLIA 2HDCA 2GQGA 3FHRA 1UWHA 3IWZA 4CMOA 1R3CA 1V0OA 3RKBA 4M9XA 4FK6A 2ESNA 3UOLA 3PFIA 5LEKA 1J75A 4LJZF 4MD7E 1YS7A 3R28A 5M08A 1ZYRF 4YTFA 3SV0A 2ZBKA 1XGMA 3CLYA 3I4BA 3C50A 4P90A 4MF0A 4ETSA 3V5LA 3RAHA 4RB1A 1H1QA 3VS1A 3FE3A 4I7HA 1EH6A 5AP1A 1Q3DA 3Q53A 4ZY6A 2FRHA 2XEYA 3PPZA 2F7ZE 3AMAA 1Q1HA 3WE8A 4HGEA 1JNKA 4YBJA 2EFQA 3WYYA 1K6OA 4LMYA 1G3TA 2XVDA 2CGXA 1T39A 4XMOA 1K78A 1ZN2A 3AT2A 3LQRA 3V4GA 4FNXA 4GO1A 4G9CA 3K3IA 3JAMK 4Q2AA 4DEBA 4EH4A 1CKJA 4G31A 3M42A 1UKIA 3FMKA 2YIXA 4KWPA 1SZMA 5AP0A 1W4MA 2BROA 2BAQA 1OITA 4IACA 4I5HA 4EK5A 3N4MA 4I4EA 3PUPA 2QHNA 1NW1A 4ALWA 2EWNA 2HXLA 5HCYA 2WQMA 2WTKC 4C4EA 1FZPB 4YJNA 5M56A 2QYOA 5K0KA 2JDRA 4ERKA 2EU9A 2WQEA 2F4JA 4EH5A 2E9OA 2FUMA 4EHZA 2Q83A 5K1YA 2E7WA 4BI2A 3MB6A 4UXLA 4L0YB 3PLAE 4CT1A 4JG8A 3HGKA 2C5NA 4I24A 3ECOA 2CNQA 4MWIA 5D6FA 5FTGA 1MJ9A 3R0AA 3JAMZ 1PKDA 2CNVA 4A9RA 3AC3A 4DNCA 2GNLA 4X3FA 5HBEA 1YW8A 3BYOA 1E2XA 3UQFA 3A7JA 3DJ7A 3FKNA 1WBPA 1XBCA 4ESJA 4NM3A 2IJMA 1BN5A 4O21A 4TXCA 1WFCA 4E20A 3GFIA 5DNRA 4G7ZF 1QMZA 4IADA 2FMLA 3CJGA 4DH1A 4HLYA 4D2WA 1W82A 3AXWA 2LSOA 3SOCA 5L2QA 1V1KA 2EXEA 3K3JA 1NHAA 2JD5A 4M8TA 4FT7A 2RL5A 1OBDA 4FNYA 3T5XA 2E7XA 4PGHA 3NIEA 4IDVA 4JDHA 3GFJA 4FT0A 3BJOA 3GOPA 2FVDA 3A7HA 4AA5A 5JFWA 2X8IA 2JDTA 2GFSA 5IA3A 1RI7A 3TKHA 3B8RA 5DN3A 1WBNA 1KE8A 3ODZX 4IEBA 3FM3A 2JGZA 3C4CA 4NCTA 3W10A 3HTSB 1SM2A 4N0SA 4S05A 3MIAA 1YKRA 3LQ3A 1CGPA 3PPJA 2BZIB 2W1IA 2VZ6A 2J0JA 4ZTHA 3L9NA 3SZTA 1CDKA 1ZRDA 3IHUA 2VO3A 3O2PE 2VE8A 2DAOA 5E1SA 2PUPA 5FEQA 4HQEA 5FWKK 2R3MA 3KMWA 2V9VA 2OU7A 3H9RA 3MN3A 3BHTA 3LAUA 3DZQA 1HSTA 4EH6A 5GZ9A 3ZYAA 4I23A 3AAFA 4L9VA 2IVTA 2ZAZA 3ETAA 4BCQA 3V6SA 3F3ZA 4AA0A 2ITQA 1UFMA 5DR2A 2C5VA 3D5XA 3ZP5A 4O0UA 1P2AA 1BYGA 4YUQA 3F3UA 3BZ3A 2QHMA 3WTWC 4FG9A 4EOSA 2BR1A 3TZ7A 3S95A 1YHVA 3FZSA 3PA3A 2PVMA 5A2QZ 4RGJA 4IZ7A 1UWJA 2X1NA 4HNFA 1RQQA 3VUTA 1WI9A 5H8EA 5HO7A 3M9AA 3CTHA 3JSOA 4IX6A 3I6WA 2A6EF 1K79A 3MZHA 2QOFA 4YP8A 4PV0A 1YDTE 4WX9A 4F65A 4O22A 3MY1A 3MTFA 3N4TA 4ZSGA 4QQJA 1KV1A 3W55A 3GYHX 2V7AA 5FLXZ 4EH3A 4C35A 3VAPA 4Q9SA 4BYYA 4NW5A 2PUNA 4LQMA 2BYVE 4PTEA 2GFCA 1KQ9A 4B8XA 4E26A 4EJVA 3D5VA 4CFMA 4CFFA 2G9WA 4PMMA 3WI6A 4UMRA 4ANNA 4K9YA 2EA2A 4YSJA 3KGAA 4GJ2A 4EOIA 1O3SA 3LIJA 2IVSA 3CKWA 1U5TB 5HLPA 5BNJA 5AP2A 3MW1A 2HYYA 2F2EA 4FZFB 5C01A 4EUTA 5D8KB 2XKEA 4XOYA 2G1TA 2AUHA 4WNPA 2NRUA 3MYGA 4U43A 5LGTA 4EHEA 3D94A 3UOKA 4QWQA 1IRGA 1ULYA 5EK7A 2UVZA 1SD5A 4OTHA 1QPMA 2HELA 1YLFA 3R7EA 4KIBA 4Y15A 4I22A 4EVIA 5ICCA 4CZTA 2YITA 5ITAA 4G17A 2GHLA 2CKOA 4F9CA 4M66A 1Q8WA 5I0BA 4O5VA 3VS2A 2HOEA 4CKJA 2O0YA 2A3SA 3EZVA 3W2SA 3BLRA 3V8WA 2R3QA 4O86A 3KP4A 5J7BA 1V4RA 3QTUA 3GC9A 3L8PA 4ENYA 4TNDA 4ANSA 3TDWA 3ELKA 4GK4A 4ZZOA 4KBCA 1YDRE 1Q61A 4C36A 4PDPA 4TYJA 3I7CA 4N9IA 2WMQA 2W1EA 3CTQA 3VVHA 3FMRA 1U4DA 2IVMA 2VN9A 2VC1A 2DYLA 3P4KA 5E90A 4ZAUA 5AFVA 3RVGA 1H28A 4ZIMA 3COAC 1O6YA 4DEHA 4M0ZA 2VV9A 4RGSA 2ZM3A 2GS6A 2Z33A 4F9WA 3O51A 4OLIA 2UW8A 3KVXA 4ZSJA 3IGOA 4LG0A 3FZ1A 4DGGA 2ADUA 2WIPA 1QZYA 4OBQA 4C59A 3TUBA 3WU0A 5GINE 3EQPA 3S00A 2FA2A 4RWLA 3SAYA 4AGUA 1W83A 5IDPA 2XNOA 3NLBA 3MWUA 4YJSA 3QWJA 3V01A 3A7FA 3TNHA 4JQ8A 4ALVA 2ZV7A 4EORA 2PMLX 2GXGA 4F1MA 3ZM9A 5AR3A 1SFXA 2RN7A 2L4AA 4WXDA 3G73A 4RB2C 2C6LA 2PWLA 4UXQA 5J9YA 2YM8A 5BMMA 2XNBA 5ETCA 3HV6A 4J95A 1JKKA 2BV6A 3A7IA 3UP2A 4CT2A 4I5PA 2Q2EA 3ZC6A 2ITUA 2UXXA 3LM5A 4WRGA 3NW7A 1GJOA 2UZOA 4FUXA 2BALA 2CLXA 2I40A 3E6DA 4AOTA 4AXAA 2QVSE 2UZLA 3HMIA 1USSA 3U51A 5L6WL 2CGVA 4YJOA 5HTCA 4BDBA 2DT5A 4FVPA 1YTYA 3ORKA 5BPDA 4UYNA 5AP5A 1Z5MA 4ASDA 3D7TA 4BHPA 4KRCA 4U79A 4IWQA 3EN5A 3F3XA 5EW8A 4MQ9F 4FTMA 2SRCA 2HK5A 4L3LA 4MBLA 3RWQA 3U9CA 5IQIA 5JMSA 1P4OA 2VO6A 5ANOA 2QBYA 1Y6AA 4LD5A 3ZN1A 2OK1A 4FV1A 1F4KA 4KICA 3UIXA 4DBXA 2Y4IC 4BBMA 4K2RA 3ANQA 5CQUA 4BDAA 3T9IA 2BZJA 5JEBA 3BDDA 3D5LA 4TYGA 5D4SA 4NW6A 4XV3A 5HU9A 2BRHA 1XH8A 2YFXA 1EH8A 2R3HA 2Z9OA 3UG2A 4UMPA 3L09A 5BMSA 4BQAA 3Q4ZA 1B9MA 4C4JA 2WU6A 4CMTA 3BWGA 2VTPA 3BELA 1MD0A 3V5QA 5CLSA 2H8HA 3FZVA 4EGYA 3QRIA 3KN6A 4AT5A 3NYNA 5C8KA 3M1SA 4X2NA 4OTRA 3WF8A 4ORKA 4LL5A 1FPUA 1IG1A 4AACA 5ILUA 4A6DA 3I7BA 2KIUA 5HTBA 5IQEA 2CSOA 2QOOA 2OH4A 3OZ6A 4OTPA 4I6BA 2UZEA 5EYKA 4IJPA 3Q6UA 2OD5A 5JFRA 3W6JB 4FKGA 2XKOA 4MBJA 2R7DA 3EQCA 2I7QA 3FF5A 4R3RA 4LG0B 4U7BA 4G1WA 1YW7A 4AT3A 4ZS0A 5I9WA 3QTWA 2BGCA 4U7DA 3W2OA 4BCJA 3EN4A 4D0PA 3NS9A 2YM7A 4P5OA 4MX9A 1R1WA 3OCBA 1LJ9A 2ITPA 2WKMA 4IM2A 3FQEA 4XV1A 2X39A 4NKAA 4C02A 3UZPA 4HVIA 2PJPA 4RFMA 4BDGA 3BLHA 3FC1X 1Q99A 1FYLA 3NQOA 4G6DA 4QP1A 2ZJWA 3QQFA 3ACJA 4KA3A 5I9UA 3R7UA 3R60A 1H25A 1HKQA 1DDNA 5E8UA 2P4WA 4IANA 3PZEA 4QMOA 1C0WA 1Z9XA 3V8TA 2WMVA 2BRNA 2Q0BA 1W98A 5DR6A 3VN9A 1BBYA 3MDYA 4ITIA 5K5QA 4HA8A 3DPTA 4UV0A 4PGGA 5BUEA 5EOBA 3ZLSA 5DFPA 2Q0OA 1XSVA 3RMFA 5AEPA 3SG9A 2X81A 2GTMA 1Z6TA 4IXAA 4X6QC 4XLVA 3G3ZA 3BEGA 1XH9A 2R3FA 3AQVA 4DCAA 3KULB 3PE2A 5I4NA 3BYUA 5HLGA 1FBSA 3DV8A 5FO5A 4H58A 1J1BA 4D5HA 3TWJA 5KZIA 3N4UA 3O7LD 4CZYB 4HX8A 2W1DA 4HDUA 4FMQA 5CSVA 4BF2A 1ZGAA 3M7GA 2FE3A 4UV8A 2ZMEA 3GU8A 5L3CA 3AT3A 4WXCA 3SGCA 1XGSA 2XASA 2YLFA 1UU7A 2STWA 4QMSA 2HWOA 5CJ9A 2IZUA 4D1SA 1W7HA 2KULA 1V0PA 4W9XA 2C3IB 3EQIA 5EW3A 4KMFA 3MPAA 3QYWA 4ZTSA 4FG8A 1YXTA 2HZNA 1QQIA 2O65A 1SD7A 1F1ZA 3RYPA 5JFXA 4TTHB 3OHTA 5J8CA 3RPYA 2W5AA 4FKOA 4AWXB 4M9ZA 2WPAA 4FZDB 1DP7P 4O1PA 5BX0A 4FYOA 1FLIA 2GNIA 4A0XA 4F09A 2GIVA 4MCVA 5JQ8A 1H07A 1GVJA 3BKBA 2BFYA 4Z7HA 3ZLWA 3MS9A 2BDFA 1ZLTA 5EW9A 2ZFWA 1H08A 4F6SA 1URWA 3QBNA 2NAZA 3O3KA 3K5UA 3N51A 4I21A 2IG7A 4EJ7A 4FT5A 4Y5QA 5E1EA 3P9CA 2UZKA 5GHVA 4EH7A 1YI6A 3CPCA 4ZSLA 3BV2A 2XK8A 3SDJA 2JT1A 2ESHA 3LCOA 4ZTLA 5CWZA 2YDJA 3IW7A 4YFKF 2XK9A 1H9GA 3Q2JA 5E1XA 3LE6A 3ZXZA 1REKA 2WGJA 3EH9A 2G7UA 4PPAA 4B9DA 5LMKC 2RF9A 3OXZA 3QA0A 2X2LA 2PHKA 2R7BA 2ETHA 3FXUA 2X2KA 3CPBA 4MNEA 2FGIA 1M52A 4DEDA 1Q8TA 2BTSA 4FX4A 3UBDA 3R02A 4MXAA 4FC0A 3BP8A 5JFVA 3GLXA 2RFNA 5LMAA 1LVAA 1I44A 4S30A 4O7ZA 4ENMA 1ZOHA 3EZRA 3R9DA 5IT3A 3EOCA 1GY3A 3I79A 4RX5A 3F72A 1S6LA 1B1BA 3ZMMA 3OOGA 1LEBA 4NB5A 5JR3A 4IB5A 2DW4A 1IAJA 4BHZA 5HDNA 4NZWB 5CU2A 3QA8A 2VU3A 2J5PA 2P7CB 1RZ4A 1R5GA 2OH0E 2ITZA 2JRTA 2X9EA 3KRRA 2PVJA 3ID6C 3K9TA 3DTCA 3HV4A 2X2MA 1RJBA 2E9NA 2XCKA 2MBFA 3HHHA 3LCSA 2UW5A 1B59A 2JC6A 4JDKA 1K9AA 1HSJA 5AIQA 3O0GA 2VBYA 1R23A 2BAJA 3DBDA 4U88A 2VOOA 3PXFA 1MKMA 3JXWA 3C13A 1ZY5A 3H3UA 5ICPA 4OIRF 1GIJA 2OSCA 4APPA 1YHWA 1ZMUA 3AGMA 2PI0A 4OOIA 4R79A 4O2PA 4JI9A 5TT7A 3RPVA 3UTOA 4EJWA 3LCKA 1YOMA 5KE0A 4FT3A 1OYWA 4NIFA 5E17F 1GZKA 3RI4A 1OR7A 3ERED 5LRRA 4IVBA 2J0KA 4BCMA 2J0MB 5FEDA 4O0TA 4XV2A 5CU6A 3EQDA 2VN2A 1S9JA 1QBJA 4PTGA 3MIYA 2ZXJA 3OROA 2WV0A 2VODA 1R5HA 4IAYA 2PQ8A 5C9CA 5E9EA 1SYKA 4BTJA 1Y0UA 1U54B 2RSVA 5CQWA 5HG8A 4JBOA 5T68A 4LG4A 4GH2A 3EUHA 4BL1A 3E3BX 2IN6A 3DJ6A 4FKWA 1W7PA 2R3JA 3ML6A 3Q9ZA 2XAJA 3LKMA 4USFA 1YW9A 3UQGA 2J7TA 5LOHA 4AFEA 1TLHB 5AP6A 4L52A 2WMXA 3FM5A 3HP2A 3FLYA 3HX4A 4RJ8A 4HGLA 3OTVA 2O6GE 4KBKA 2PE2A 3DGKA 3QLGA 3RK9A 1R00A 5LMBA 3C1XA 3QAHA 2EV6A 3V04A 3ENMA 3GU7A 3R0JA 4NFNA 1OL1A 3TDZC 5J8FA 2F5CA 4USEA 1REJA 5HLWA 4A4XA 1FMOE 4RPVA 4YIFA 3OV8A 3Q4CA 5DPVA 3DXJF 2GPHA 5M4IA 3I5NA 2JDVA 1XO2B 2XK6A 2IP2A 3GI3A 2Y0MA 2Y48A 1CKIA 5EI2A 3TQNA 4RX8A 4EK4A 4F1TA 3DF8A 3K2LA 1KSWA 3WILA 3U2RA 1SVGA 3HEGA 1ZXEA 4YPSA 4UALA 1J0RA 5IA4A 4CO8A 3FZRA 5E18F 2XJ2A 4WHZA 4XG4A 2JFMA 2YAKA 3TOAA 4I0BA 4I6FA 5CSWA 4EQQA 5BUIA 3FLNC 2QOKA 4FSQA 4YJQA 2W9FB 4PUZA 3FMQA 2UVYA 3QQHA 5ICFA 3WGGA 4TKSA 3EYGA 4X3FB 4BDFA 1SNXA 4ESBA 4G94A 2UW0A 2WOUA 3SRVB 4LMNA 5C1QB 5DT4A 4AZEA 3M1EA 3G33A 4D2VA 5HE3A 4MEXF 2QLUA 1H1RA 2X8DA 3GX4X 4A9SA 1ZH5A 3QHRA 2A2AA 4FV4A 5I3RA 5KKRB 4O6JA 2HW7A 3MFSA 2PL0A 3R04A 2EK5A 2EFWA 4S32A 5IQHA 5ED4A 4EZ5A 3UIMA 5AUVA 5FGMA 4E70A 2C30A 5KMLA 4QO9A 4ANOA 5CAOA 4EK3A 3R00A 2JEDA 4DT8A 5C03A 4AIJA 2CG4A 3DXPA 5IT9K 3AD4A 4U0WA 3KXNA 3PJ2A 4YZCA 3KVWA 2VTSA 4BGQA 3BWJA 4A0YA 4GT4A 4XBUA 3L9LA 2B0QA 1I27A 4F7NA 5KCVA 4X0MA 4RX7A 4BTMA 3PJ3A 4EQCA 5CF4A 5GNKA 3EYIA 4IM0A 3ZMTA 2P2IA 3I53A 2ACXA 3EN6A 3V8LA 3QXPA 5KHXA 4CXFA 4FV9A 1PP7U 3TV6A 2YX7A 1V3FA 4UB7A 3MAJA 2XNGA 3RM6A 3RPUA 3EIDA 1H26A 2KIFA 1WVWA 5IA0A 3TNPC 3NGAA 3PDTA 2XKDA 3S1HA 5AV4A 5HE1A 4QP7A 3PJ8A 5LEJA 4CG8A 2JSCA 2HENA 1FBQA 2ZOQA 4KFCA 2CGUA 1PMEA 3RYRA 3QRTA 5TRDA 3DXNA 3O8TA 5CXHA 2C0TA 1BL6A 5A54A 3HP5A 3DXQA 3BLQA 1XB4A 4ZYGA 4FR4A 2ZM1A 4FSMA 3WF7A 4IX5A 3ZLXA 4RC4A 3EYHA 5LXMA 4YFNF 3WYXA 5CVHA 4TYEA 4H39A 5EI8A 3UNKA 1S9IA 4HPUE 5IA2A 5CX9A 2QLQA 3K1NA 3DV3A 2YABA 4RWKA 4TY1A 2FO0A 3Q5FA 5IZFA 4Q5HA 4GCJA 5HVYA 1ZRCA 5I3OA 2NNWB 5DR9A 1XCVA 2FSMX 2PZIA 1VJYA 4AS0A 1VTNC 2F5EA 4QTCA 2W5HA 2UW3A 3TDUC 4HYSA 3FXQA 2PMIA 4O3MA 5HVQC 5J6XA 5L8LA 2IPXA 3IECA 3HZTA 4WSYA 3HMPA 3K54A 3QKLA 2OIQA 3ROCA 2B4SB 5FEEA 2YLEA 3C4EA 1YS6A 3RM7A 2D1HA 3UPXA 3U4UA 2OA4A 4A5NA 3ZOSA 1E1VA 2C5OA 1FY7A 2BDWA 5FXQA 4YZMA 5E1ZB 1UHMA 4K33A 1BJAA 1BIAA 3FQSA 2QU6A 3RCDA 3R7IA 5HS9A 4DEAA 2YM4A 1PXKA 3F8BA 2YHVA 4JRVA 3W33A 1WZYA 3ZLYA 4EONA 1G3WA 4QQCA 3LCDA 2PVHA 2W9ZB 4UMQA 3DT1A 4L3PA 5LBQA 4G3EA 3HUBA 2QOLA 4ZK5A 3HKOA 2ZV2A 2P8TA 5ACKA 3FYJX 5E8YA 4BI1A 2FU4A 4QYGA 4IDTA 3F8FA 2QBYB 3KY2A 3UODA 3GU5A 5FBNC 4XG2A 4V0GA 1CKPA 3FEGA 2ZMDA 5DI1A 4K11A 1GZNA 4TYHB 3IW4A 1BLXA 1MRYA 2QQ9A 3VBQA 2LGCA 2YCRA 5EEHA 3UC3A 5CSPA 3UGCA 3A61A 4F0GA 3PQJA 5CVIA 3PG1A 5EQYA 4E6QA 3MB7A 4DGOA 3E5QA 5LQFA 2DQLA 4FNWA 1XSXA 3DBCA 3GBZA 2JZYA 4FGBA 4Z7GA 4M69A 4FEWA 4I0RA 5AP3A 4CRSA 4BTFA 1Q97A 4AGWA 3GU4A 2HGCA 4U0IA 3QOPA 4QMUA 2OJIA 3HUGA 4AIHA 4WWCA 3U8WA 4HF0A 1MUOA 3OWLA 3U6HA 3BYSA 3FLSA 4FSUA 3QQLA 2VX3A 3F8NA 4CCUA 4F9YA 3DB6A 3TZ9A 4XCUA 5HTIA 3GFMA 3U55A 4EOMA 3HA6A 2GZWA 3RHXA 4N9HA 2Y6OA 1IUYA 2QKWB 4M68A 3JTGA 4FIEA 3TACA 4KN7X 2K02A 2GNHA 2WTDA 2L54A 2VC0A 4IAIA 4LL0A 1YWNA 3PWDA 4QMTA 4YJUA 3QKKA 3DFAA 3PIZA 4ZJIA 1FGKA 4B8MA 1CF7A 3DLZA 3FKLA 3MPMA 1YG2A 5TJJA 3LMGA 4ZTQA 3ZXTA 5A46A 3F2RA 4F7ZA 5JFSA 3VS4A 1H9TA 2QQBA 2QG5A 2C0OA 4RSSA 2H94A 3MVHA 3DK7A 2GNJA 1OBGA 3UNJA 4GL9A 2WTKB 5K0XA 3ORLA 5DEYA 5HICA 1STZA 3E92A 4UY9A 5B2LA 3HIFA 3NAXA 2IA1A 5E8GA 3PJCA 4L45A 4UMTA 5LCJA 3IPHA 2P3GX 4L43A 4EHGA 1KOAA 3Q9YA 3ZSGA 3FZTA 3KA0A 5E91A 4FX0A 5IMXA 3FKOA 4YTCA 4B0GA 4UV9A 4FL1A 5BMZA 1BIBA 3R8LA 2QD9A 3G9LX 4EBWA 1EH4A 1MDMB 4U3YA 5AONA 4BHNA 5C4LA 4LUEA 5HS7A 2C6TA 3Q96A 4E5BA 1JXSA 3F21A 3UNZA 3NWWA 4UUVA 4W4WA 1S29A 2UW4A 1HQCA 3M11A 3DK3A 1WQ2A 3LFNA 3VJOA 3V51A 4I20A 2AS5F 2WQNA 3A99A 3SHEA 3RKXA 5FD6A 5EM6A 5EQPA 3TTIA 4B8LA 4CG9A 1SD6A 4IJAA 3ACKA 4R1VA 2QNJA 4R1YA 2XM8A 3BQRA 5IA1A 4AN9A 4F6WA 4C2VA 5I9XA 4EUUA 1P2FA 2ITWA 1IF1A 2O8YA 5K5NA 3N4VA 4UHTA 1L3LA 3CD8A 3PA5A 4GW8A 2OJ9A 3EQLF 5D5VB 4HGTA 2K4BA 5HKMA 4J98A 4N57A 3GCSA 3C18A 2ITTA 3DDQA 1QNTA 4J7BA 5DGZA 2W57A 3CQEA 4L6QA 4NL0A 3P7BA 3ORZA 3A60A 3D9VA 5FTOA 4FTOA 3SQNA 4EQMA 2R3PA 3CBLA 3GEQA 2XJ1A 1KYWA 1RUNA 4K18A 1WBTA 3LFQA 5IQCA 2IJLA 2ZMCA 4O0WA 4HW7A 4C57A 2HTSA 2YAAA 4RLLA 2JPBA 1G3YA 3C4XA 4FKIA 3DP7A 4LUDA 1T6SA 2YM5A 3I5UA 2M30A 1O7LA 4S2ZA 1XH5A 2LDUA 2XP2A 5CNOA 4LFUA 2CN5A 2QURA 4D4SA 3JSPA 4AW1A 2GCDA 5DHJA 3TG1A 3HV3A 3PRFA 3REOA 5AADA 3F7ZA 1FP1D 3GP0A 4FSWA 3C3WA 3EL7A 4BAYA 1OKYA 4F63A 5B0XA 1R1TA 3U1DA 4RWIA 4A9TA 4YJTA 3TV7A 5TR6A 2WOTA 5D8LB 1OZ1A 3ZDUA 2R9SA 4G34A 3AOXA 1ATPE 3QC4A 1U5TA 3PP1A 2FEZA 2W84A 1GNGA 5JGBA 3HL7A 2QI8A 2IA2A 3GCUA 2QQ7A 3BHHA 4FICA 3NYXA 2Z3YA 2Y4IB 1JHFA 3NX8A 4QRCA 2DWBA 3LAPA 2WD1A 4O6EA 3OXIA 3R7VA 2XYNA 4GV1A 2ZB0A 2RV8A 2VT3A 2PTKA 3E87A 4BB4A 4NM7A 4D28A 2OW3A 3FPQA 4DG0E 1JOWB 3KZYA 4CNHA 5F4NA 1F0QA 5EEGA 4FKVA 4A4OA 4WBOA 3VBYA 2BRBA 2Y6MA 4LOQA 5AUTA 5TOZA 4C38A 3UIUA 3CUQA 2NO3A 4YZBA 3MWMA 4JK1X 2A61A 5DD4A 4ZJJA 4HX7A 3PXQA 4U81A 1E17A 3BIZA 2BIYA 2DPUA 2UZDA 3BHUA 3K5VA 3DAJA 1FGIA 2BVAA 3OWJA 5EM5A 4FV3A 1T0FA 3R7YA 3I64A 5HD4A 4OMYA 2R3OA 4D58A 3EFWA 4D5KA 4FTTA 3GEZA 4WOVA 1OYIA 4ANQA 3R61A 4H1MA 4LLLA 5J79A 4FIGA 4L0ZB 5DBXA 3L9MA 2XK7A 4TW9A 4W9WA 3VUGA 2YWVA 4IRIA 1UB9A 3P9IA 5HE2A 4BCNA 1W5SA 2P33A 1GZ8A 3QPTA 4B6LA 2CN8A 5BVEA 5DD8A 2C1BA 1Z7UA 4EGZA 2H96A 3E97A 3KRWA 4PWNA 5L3DA 3QTXA 1NT2A 4QTDA 4PMSA 5HG7A 2EB3A 4K2EA 2AC3A 3A4PA 4HF1A 3Q5IA 3CR0A 1U5QA 3OTUA 2QQAA 3VS6A 4FTUA 3LSTA 4R8HA 2C3JA 2FSLX 5ANKA 1X3UA 2L3DA 3TEIA 1QPCA 4JQ7A 4LRJA 5HBHA 1XR1A 4C62A 2PYWA 1KA8A 5J1VA 4AP7A 2OJGA 1WVXA 5JSMA 2ITXA 3JUHA 3NPCA 4MQ1A 4BN1A 4JX7A 5BVNA 1NA7A 2CFXA 2HYGD 3MFKA 3HVCA 3DKWA 4EH8A 3O50A 4DCEA 4RGUA 1JSVA 3OWPA 1Q3WA 2EB2A 4L68A 3DZOA 3BJ6A 5JGDA 2XEZA 4NQWA 3QTIA 5HIDA 2A19B 1A04A 4X2KA 4FVQA 4U0YA 4AW0A 3GZ6A 2E2BA 4KDPA 1ZG1A 4KA4A 3TI1A 3CUQC 5IG1A 3FMLA 4RIWA 1YXVA 3G0EA 2HCKA 3GQIA 4MK0A 4U44A 4I2OA 4X7QA 1SFEA 3KP6A 3NIZA 1KU2A 3KEXA 2BZHB 3HECA 4GU6A 3T0YA 4YZDA 3REPA 3CUQB 3P86A 5LRSA 1KE7A 2FSOX 2M5WA 4G9RA 1H00A 4ZH4F 3HDMA 3UIBA 4AGDA 4OUCA 5C26A 4X3FC 3F82A 4E8AA 2W7XA 2O3FA 4O7WA 3OUNB 5HORA 2DK8A 2XVCA 5LHGA 1BKXA 3E64A 3NW5A 4ZYHA 2VTMA 3IGGA 3QXOA 5D5WB 3M2WA 3FMEA 3F2NA 4XYFA 2PMHA 4OTGA 5E8VA 1ERKA 5AIRA 2M1BA 3A2CA 3DS6A 3ABUA 3FC2A 4O27B 5AR7A 4II5A 4QTBA 4FUYA 5LVLA 2EB7A 2ZVAA 1FC3A 4YJRA 3BPVA 4XLPF 2XS0A 1BMKA 2YCQA 4L42A 1CSNA 3FUPA 2CO5A 1D3YA 3DNDA 2V55A 1OVEA 3I4PA 3LVPA 3C5IA 3BCEA 4EMSA 5H8GA 4F9AA 2W24A 3OVVA 5L3AA 4AFJA 1OKRA 1BM9A 4D9UA 4I1ZA 5ICEA 2W25A 4BWKA 5CYVA 2XIZA 5CVGA 1S3JA 4ACDA 3F66A 1PMVA 3MH3A 5EDPA 4G3GA 5LCKA 4WNKA 4EH2A 2B9FA 4R7HA 1W7PB 5JK3A 1AWCA 4RBLA 3H0ZA 2WHBA 1ZOGA 3L8XA 3QTRA 4ZMEA 1KWPA 4IJ9A 3QRUA 4APCA 4AN3A 4BIEA 4OTQA 5IQDA 1JQHA 3PXKA 4AW2A 4G7OF 4UMUA 4YO6A 4JS8A 2HKOA 3CCNA 4BRXA 3EN7A 4QQ5A 3IO7A 3F6VA 3IQ7A 2NRYA 3VUHA 2P6TA 5EQEA 1MQBA 3BGQA 2PVNA 2F5FA 3LQQA 4FT8A 3EKNA 1Z05A 4ITJA 4HYIA 3J81Z 2R5TA 4QQTA 1P5EA 3HRUA 2XUBA 2RG6A 2WEIA 5HGIA 3JTHA 1YQJA 4W8EA 1SFUA 4HZFA 2Z7SA 2O03A 2IZSA 3A62A 2C5XA 3RWPA 4NSTA 4I3ZA 3HRCA 1H0VA 1J7IA 3KLOA 4QTAA 5EYCA 3ATTA 5F20A 3G5DA 2EJRA 4OU0A 4PL3A 2XBJA 3KLNA 1A9UA 4M6YA 2WWYA 4I41A 4GK2A 2VBZA 3GXOA 4DTAA 4IB3A 4LOPA 3J80K 2I0EA 5E20A 4P4CA 1MDMA 2M87A 3LCTA 4RIXB 4FT9A 4NCTC 2G7HA 3TL8A 2W1GA 4CFUA 1S7OA 3PJ1A 2HW6A 1Q5KA 3NAYA 5HX6A 4IHPA 4KABA 4NK9A 4EK6A 3KXMA 2QOHA 5HCZA 3NEWA 2BMCA 2CJMA 3C0GA 4A2UA 3P23A 4RB0A 4TL0A 1IA8A 3E5AA 4YC3A 5AV0A 4U97A 3T8TA 4CFVA 4A9UA 4XRJA 3FMNA 5M55A 5ILSA 5L2IA 3R8MA 2OXDA 5CI7A 3R7GA 4WD5A 4WUNA 4IBMA 3W2QA 4KNBA 3R9HA 5I9VA 3JVSA 3IW6A 3KXHA 4DQ2A 4MXXA 1U8RA 1DPUA 5E8SA 4XBRA 5AV3A 4ESFA 3NYVA 3Q9WA 5KX8A 2XA4A 5C8MA 4BZDA 1OL6A 4D2PA 2W05A 3WTTC 3DKCA 4ID7A 4W4VA 3KRXA 4DE4A 4KKGA 1ON1A 2NRAC 2C3KA 4BWPA 2ERZE 2B7AA 4XG3A 2BZKB 4FL2A 3WTUC 4OTWA 3Q32A 3JYAA 5CF5A 1HBXG 1P4FA 3POOA 4XBFA 3PIYA 4RT7A 4AZFA 3F5GA 5A14A 2HWPA 4KT5C 2DQRA 4KN4X 5FB2A 4OGRA 4FTCA 1G4DA 4L9NA 2BTRA 2GXBA 4O96A 1I6XA 2YISA 5HVKA 3KEQA 3U9GA 3VB2A 2ZDTA 3SVVA 3EYYA 5AA8A 4MXCA 3Q60A 2KKOA 2DI3A 1OPJA 3W1FA 2EXMA 2F2UA 3HNGA 4EM0B 3N97A 3FZPA 4H3QA 1AGWA 2QWWA 3NUAA 4A6EA 3KP5A 4XLIA 3FMDA 3QTZA 4KUMA 4ONAA 5CVRA 3PPKA 3COMA 1URCA 5G1XA 4NJ3A 3QZIA 3C7QA 2OGVA 5CEIA 2XAGA 4WNOA 5AR4A 1WBOA 3DOGA 4D2TA 2C1AA 4GEOA 3AC5A 2M45A 1STCE 4KIKA 1ZLJA 1BC7C 1UU9A 1APME 4KIQA 4FODA 2E9VA 2JBOA 4JOAA 5DOSA 3DBFA 4FEUA 3TO9A 4FTRA 4JBPA 2GWRA 4BHBA 1M2PA 5HG9A 1FSEA 5D7VA 3S2PA 3AG9A 1VZOA 1BI3A 1J1CA 1XSDA 4QYEA 3WARA 3K69A 4I0TA 1M7NA 4HF2A 4QMPA 4EI4A 3MBLA 3NYOA 4FTKA 2Z60A 4D55A 4LI5A 4BYJA 5CYIA 3H3CA 5CU3A 4YLKA 1DI9A 3BPRA 2DLLA 5D10A 4FSYA 4M9SA 4BTKA 4ENXA 4FIHA 1FNNA 4FK3A 5AWMA 4U9AA 3OF0A 1D8JA 4DHFA 5BPIA 1FWZA 4BDKA 3GNIB 5DUKA 4U42A 3ZSIA 4QYFA 4DGNA 2WB8A 4J8MA 3RIRA 2QO7A 2C69A 3L00A 4O7SA 4HVSA 4GIHA 5JQ5A 4O0RA 3FQHA 3SXFA 4MHAA 3BOQA 3DAEA 4CQEA 2BAKA 4OBPA 3FZOA 3KMUA 4IWDA 4F7LA 1ZGJA 4IAZA 1P4WA 3RKWA 5EHOA 4HPTE 4DH8A 1XBBA 3C4ZA 4YHFA 4I09A 5CU4A 1O6LA 4M13A 2RGVA 1JAMA 4ZOGA 4LGGA 3JY0A 1M2QA 3KCKA 4ZYDA 4OR5A 5LVMA 2FBHA 4FSTA 4V05A 4O6LA 3RTRA 3VBXA 3OD6X 1SNUA 4BDDA 3ZZWA 2XKPA 3DTWA 5FD2A 4ZEGA 2RKUA 3F6OA 3LQ5A 4DFXE 4CEGA 5CEKA 3RTPA 2O2UA 2L01A 4EOLA 5AV1A 3E88A 4F9BA 5J9ZA 1G6NA 4MKCA 2HQNA 4L5IA 1QPJA 3UMWA 3WTYC 3DKFA 2YM3A 4FKRA 4YNEA 4P55A 1GZOA 2F5DA 3OP5A 1R58A 1W5TA 2FF4A 1V0BA 3CY3A 4CV8A 2MH9A 4KUJA 2HFHA 4AZTA 2C3LA 3QYZA 3EMGA 2OF2A 4ENJA 1B6AA 3OT8A 1P4AA 3GCPA 4JVGA 4AWIA 4YJPA 4ZZNA 3II5A 3G90X 3ECHA 4QP4A 4WSQA 3SXSA 1T2KA 1PXIA 3ZFXA 1JSTA 3F6XA 1MP8A 5IU2A 4TPTA 4AGCA 4HNIA 1WBWA 3FMJA 4OTIA 3FL5A 4Y13A 2YR2A 1DUXC 2EV0A 5H3QA 5HLHA 4PNIA 4PL5A 3UOJA 5HVJA 4F4PA 2CGPA 1I1SA 2W1FA 2RVCA 4TWOA 2EV5A 2BIKB 1YOLA 3EB0A 2VWWA 2AXLA 3VF8A 5DH3A 4HW0A 3BGZA 3R1NA 4ACCA 4ZZDA 1LR4A 4IFGA 4GUEA 4P5QA 4N6YA 4ENKA 1TBXA 2UZTA 3I71A 3ZU7A 5IDNA 4UEUA 3PTGA 3WF6A 2UZUE 2UWMA 2UZNA 4NM0A 2ESMA 4EC8A 1IRFA 2XGXA 4ZZMA 1SD4A 3BBTB 3ZUVA 2PFBA 3KP7A 4I4FA 1M2RA 3CKXA 3FXZA 4KKHA 5KMIA 2OU2A 3WE4A 4TZRA 5HNIX 3V7RA 2FQ3A 4HYUA 5FTQA 4LK1F 3QTQA 3IRRA 3F8MA 3UPZA 3QALE 5IQBA 3IWFA 3ZS5A 4HVDA 1FVTA 4IAFA 3BEAA 2UUEA 3BROA 3V3VA 4C34A 2PVFA 1BI0A 1M17A 1PXMA 4BKYA 2ONLC 3KETA 1LB2A 3IOKA 5L8KA 4U8ZA 5CT0A 2WZJA 3VO3A 3EQRA 4FTNA 3ROYA 1R36A 4ZLZA 5FBOA 4YC8A 4C3RA 3UOHA 4TV7A 3HYHA 2HYFA 2HZ0A 3P1AA 3HAVA 5LJJA 5HS8A 4YGAA 4YTIA 4HJOA 4MNEB 2VX0A 4CTBA 3G2FA 4UWBA 3VHKA 3QC9A 3HRMA 4FZ7A 3V8KA 4C4GA 2VAGA 4XSZF 1PYEA 3D0SA 4V01A 5L3BA 1YYVA 3VNTA 4JJRA 4RJ3A 4P9UA 1W0XC 3ZRKA 1KQ8A 4IZAA 1ZYJA 3T8RA 2NNNA 2E1CA 3D14A 4PCQA 3FL4A 4LGWA 4QPAA 4O7NA 1KE6A 4M69B 4Z16A 5DG5A 2W4JA 2WTIA 4UWCA 3CDHA 1ON2A 4ANLA 4KS7A 2WU7A 2GHGA 1VR2A 2UZWE 3TUDA 4KBAA 3BRBA 4GG5A 5CALA 2I1MA 3EFLA 2W17A 2PMNX 3QGYA 3P78A 4JR3A 3ZC5A 5B2KA 3W2RA 4FYNA 1LQ1A 1WAKA 4NU1A 3PRIA 4U0VA 4NUSA 5K5XA 1H27A 4TWCA 1FYKA 2JIIA 2H34A 4K8AA 3T8OA 2WFYA 2C0IA 4QD6A 4IVAA 4RGRA 2M8EA 2E1NA 3PXRA 4A5MA 4L8MA 2FB8A 4BDEA 1OGUA 4YG2F 3QX4A 4LV8A 3BE9A 2RGPA 3UE4A 2VO7A 3UQCA 3KL8A 4FGRA 4YFXF 4AF3A 4QMXA 5AJQA 3WZEA 2BRMA 2V62A 5A3XA 3O17A 3GCQA 1QGPA 4O91A 1OUKA 4YO4A 5EHYA 5M44A 5IQAA 1Q4LA 3BYMA 2EXCX 1Y8YA 2VONA 1H01A 3R30A 3QRFF 4M67A 3COKA 5ILVA 1BUHA 1TNSA 3O8UA 4LK0F 5JI6A 3KMMA 2R0IA 4BVUA 5K3YA 2V1XA 3SRVA 4HVHA 4P96A 3F3TA 5L4QA 2XAFA 2JKMA 2OF4A 2H09A 4BWXA 2X6DA 5AUYA 2K7LA 4J53A 1RDQE 2MA3A 4ZXTA 1Q8YA 5LWMA 3F61A 2F49A 4IQ6A 4PY1A 4RIWB 2VWXA 2YDKA 4ZY5A 4RWJA 3ZN0A 3GVUA 3HYIA 2R3LA 2JAMA 3C4FA 1RNLA 5K4IA 2C6OA 1G3SA 1LP4A 3LJ1A 2JDOA 4GG7A 4IAAA 1XJDA 2DO7A 4IVCA 1J91A 1Q8ZA 3BX5A 3CQUA 4LB5A 3ORTA 3HRBA 2BILB 3DFGA 4H0EA 2BRGA 3LQ8A 2F9GA 2OBPA 2A1AB 1WMKA 4EV0A 3KK8A 3FMHA 3QTSA 3F88A 3NNVA 4PDOA 1TNTA 4GFMA 3WBLA 4RGXA 5DYMA 4GVAA 4DBNA 2QM3A 2IA0A 2XB7A 1TQIA 1G3NA 4ASZA 3C5UA 1H24A 5LVNA 3TKIA 1XH7A 2PUUA 3BPXA 4RIXA 5AR5A 3LLTA 3UYTA 4L9TA 3CQWA 4O0XA 4PMPA 4NHJA 4K6ZA 3ZO3A 3OCTA 3QKMA 3NRVA 2HIWA 3LXLA 2PZRA 1J5YA 2VBWA 1IN6A 4PPBA 4ITHA 5FP6A 1O6KA 5HD7A 3E3VA 5FDPA 4YHTA 1BL7A 4WXHA 4GFGA 4HX4A 3KRJA 5CEOA 2V0DA 3SZPA 4DAWA 1DM2A 2P6SA 4MEYF 3H10A 1A06A 3QZGA 5A4TA 4O83A 1IASA 4GT5A 2PMUA 2VTAA 2X7GA 3E8DA 3QX2A 3KB7A 3LFBA 3QP5A 4QMNA 5HIEA 3QCQA 1OYYA 3HAMA 1ZOEA 1K3AA 5FQDC 1IRKA 2VXZA 4L7SA 2XIKA 4IZ5A 4DN5A 3A8WA 4DGLC 1KOBA 4LM5A 1R1UA 2IW8A 5HO8A 4RFZA 4KNYA 5LGUA 2UZVA 4DFYA 3RJPA 3PSDA 2XNMA 5DRBA 3FBVA 5GJGA 3OWKA 1YW2A 2O64A 3I59A 1ZMWA 3FY0A 1IA9A 4CFWA 1JBPE 1ZAOA 4XRLA 3DQVC 2A0CX 3U6JA 3RPSA 4PRJA 3LMIA 3BI6A 3RNIA 4K1BA 1B9NA 2BKKA 2V1DA 1Y8GA 3W16A 3U4WA 1YOJA 5KMKA 3U54A 2C6YA 2VTIA 4IH8A 3LFFA 3PWYA 3R8VA 4M84A 3NUXA 4FHTA 4K0YA 4R5YA 3MA3A 1GHCA 2VO0A 4AG8A 2BCJA 3E8EA 4K77A 5JZNA 2PUIA 4PDKA 1ONVA 4WG3A 4DFZE 4RQVA 4FF8A 1OUYA 1HKSA 4F1OA 4JIKA 3D0EA 4DH3A 1RIOH 2QOBA 3F5XA 5KMNA 5D12A 3FSFA 3TNIA 3LFDA 3WF5A 5L3FA 3GFEA 3VUIA 2FSWA 4ZTNA 1IN7A 4KSPA 3MFRA 4IE9A 2YX4A 4PDSA 1PXJA 5EI6A 3R6SA 2R3SA 3FMMA 4RVMA 4JT3A 2HQRA 3E8CA 2ERKA 2CNUA 5LARA 4GXOA 3UDBA 3FXXA 2Q8KA 4PPCA 1HOWA 3RAWA 1SVEA 5KO1A 4HAMA 3KCCA 1G8SA 4AW5A 3P7CA 3NNUA 3ALOA 4QMMA 2PVYA 2J50A 3ITZA 5FM2A 4ZZLA 4R78A 1TW2A 1J7KA 2OFUA 2OG8A 4RVLA 2CSNA 5AMNA 2MD5A 3DCVA 1NVQA 3D2KA 3R1SA 4ZY4A 5IT9Z 5LHHA 3PP0A 4GJ3A 3FJQE 5AX9A 4YR8A 3HSEA 2XNPA 2BHEA 3VBVA 2GS7A 4IF4A 1I09A 4KIPA 4CHUA 4ZP5A 4BYIA 3R2YA 1DAWA 3QD0A 3NVKI 3QF9A 2JLDA 1WSUA 4XJ0A 4XEYA 2V6CA 2CYYA 3R6XA 3QCXA 2V22A 3MVLA 5LHIA 1K2PA 2STTA 1YWVA 2R7FA 2GHMA 3SD0A 4NTSA 3HRSA 2QOIA 5BYLA 5JRQA 1KU9A 4BI0A 2P5KA 3KEOA 4FZ6A 4MD9E 3ZO4A 3D5WA 4Y5HA 2RFEA 4NWMA 1OPKA 4C61A 2ZV8A 4C7TA 3PVGA 3MY5A 3ODYX 5FLXK 5AM7A 2D1VA 3RPQA 3VQUA 4X2JA 1IXRC 5KMJA 1XH6A 5CVJA 3ZFMA 2DU9A 2O3PA 5J87A 2H6BA 2HY81 3KFAA 1ZYCA 3P79A 1UNHA 4F64A 4G8XA 2QONA 3A8XA 3EKKA 3IDPA 4KIFA 1JKTA 4UYAA 3TTJA 2ONLA 1Q8UA 5A9UA 5JVTA 5M07A 4E6AA 4S33A 2P7VB 5AR8A 2A6HF 3IKVA 4M72A 3BGPA 5FRIA 1FT9A 5A2QK 5KKRC 3JR1A 4RA4A 5AR2A 4P9FA 3RHKA 3FV8A 5F95A 2G15A 3VBWA 3E6MA 1DS5A 3KN5A 4JAJA 4QYHA 4BIDA 3RKYA 3UVQA 2QODA 3OEZA 1B6CB 3ZFYA 4CGZA 2WQBA 1OMIA 2RFDA 3RINA 4GKHA 2PBIA 3GFWA 4PP9A 4M97A 1KE9A 2XUUA 4D2RA 5B2MA 4WCGA 4EYMA 4MWHA 2YU3A 1ZRFA 5CVUA 5C27A 3TV4A 3LWFA 5A6OA 5EG3A 4MXOA 4D0WA 4YMJA 1L3RE 3E63A 4Y85A 4U40A 3NR9A 4JQFA 2UW9A 4R5SA 4IWOA 2PLYA 4EQUA 4HVGA 4J96A 2PEXA 3WG9A 4DTKA 4GYGA 3VC4A 1M14A 5KHWA 3F3WA 1CF7B 2Z7QA 1MJAA 2I0VA 2EFOA 2GAUA 3MCZA 4JBQA 4O84A 4IPAA 4EHVA 3RCJA 5D5UB 4FTIA 4FSNA 4P7EA 2QCSA 3G6GA 5K9IA 4Z2YA 3RNYA 2YIWA 3PY3A 1YHSA 4JL9A 2JKKA 4FKLA 2JTVA 2VRXA 3PQKA 3N9XA 3W8LA 5IKWA 5FG8A 3O8PA 3TIYA 2QVOA 1YI3A 2WMRA 4GK3A 4G16A 5HIBA 1UNLA 1BOAA 1U3EM 3ZMUA 4O0VA 4O1OA 5CAQA 3FI4A 4WA9A 1O57A 1LEAA 2K86A 2J0IA 3FYKX 4UZHA 4OTDA 1KQ0A 4HCUA 3RPOA 5J9LA 2RKHA 4LV5A 3V5TA 3ZONA 4QNAA 3MJ2A 1G8AA 4Y95A 5HHWA 3KXGA 3UC4A 5AUZA 4MF1A 3RAIA 4XUFA 4R77A 1OIUA 1HCKA 1DPRA 2GS2A 3KXXA 4R7BA 3C0IA 3VUDA 4MAOA 2YSRA 4Q5SF 3NNWA 4C4IA 4U45A 2C4GA 3MH1A 3GWZA 2VBXA 4MNFA 3V6RA 3VW6A 1Y91A 4ZYEA 1W7PD 5E8WA 4TYHA 4L67A 3D2IA 3NNXA 5M51A 5BVKA 3P7NA 4XP3A 4C33A 3NW6A 3IW5A 1H1PA 3NUUA 5D4RA 4A12A 3RK5A 2JKOA 2DUVA 4Q47A 2F2CB 1IN4A 1PKGA 1TQMA 4MH7A 1GOLA 1O3RA 1RE8A 3OFMA 2XYUA 5J1WA 1SVHA 4ANMA 2QLZA 2I0HA 1OL2A 4EBVA 1OI9A 3GENA 2CKPA 5F9EA 4EL9A 4E73A 4QT1A 4CMUA 4FKQA 3RZFA 5CF8A 2EWAA 2DFIA 3D7TB 3GC0A 1Z9CA 3ZPLA 2RG5A 3IL2A 1FYMA 4BDIA 5AUUA 4QLCU 2XIXA 2F7XE 3ORNA 2R4BA 5EFQA 1PMNA 5TO8A 2XZSA 2B54A 3ULIA 3CY2A 4L01A 4M12A 3S3IA 3QLFA 2R3NA 4FL3A 4DLIA 3GCVA 4I0SA 4CZUA 1P14A 3TGNA 4L46A 1CTPE 2NNYA 1AQ1A 4M6XA 1ND4A 4PTCA 3SXYA 5CEQA 1U5RA 3E3PA 4BIBA 4EZ3A 1KU7A 3RZBA 4CRLA 3OUKA 4F70A 4G3CA 3M8EA 4BZNA 4AN2A 4DH5A 4J52A 2XRUA 4G3FA 1TW3A 3H9FA 2C5YA 2K4JA 2ITVA 2QR8A 3C0HA 5CANA 4XG6A 2XNEA 3UZRA 2WAJA 2DBBA 1SMYF 3GB2A 4AQCA 3TUCA 4HQMA 4CYJA 4F7SA 5CZHA 3DK6A 2LAVA 3KULA 1D8KA 4FE2A 4OT5A 2YIQA 1YIOA 2X9FA 4BKZA 1FBUA 4LB6B 3BJAA 2HKXA 3ZDIA 5F94A 3QWKA 3V7SA 1A48A 3DAKA 4ZJVA 4XX9A 2OZOA 4HLXA 2X4FA 4YJVA 1YRPA 3R21A 4ASXA 4I02A 2ETMA 5A4LA 5CVVA 2HZIA 3IG7A 1YVJA 2VD5A 5KBQA 4FI1A 5J8IA 1SMHA 4YLJA 4G9YA 2XBAA 2UXNA 1TQPA 4IZYA 2WO6A 2E9PA 1XKKA 3KU2A 1J7UA 5K5OA 4S04A 3ZEPA 1OIQA 1B39A 1R7JA 3VRYA 2YZLA 5EDRA 2FH9A 1GAGA 3J81K 3LFAA 1T46A 3H92A 5D1JA 2X4HA 3ORXA 3SA0A 1BI8A 5IMEA 3IKTA 2W4KA 1XD7A 5JN2A 3C9WA 5AV2A 3KRLA 4GS6A 2RIOA 3CTAA 5A4CA 2J6MA 2X8EA 4NH1A 5A6NA 4YC6A 3TXOA 1QPEA 2H27A 3OG7A 2O63A 2C6IA 4QPMA 3BE2A 4KS8A 2IW9A 4D9TA 2QZ8A 5IISA 2CDZA 2NYXA 3HMOA 2UZBA 4XRFA 4PL4A 4CZZA 4IW0A 1I1GA 3AMBA 1FMKA 5HCXA 1JPAA 2ZV9A 1H1SA 3AGLA 2QKRA 4XP0A 5IEYA 5FDXA 4F0IA 5IA5A 5ANGA 4MBIA 2ZKZA 4AVPA 1BI2A 3V5WA 3QRJA 4CSVA 3C7JA 2LF8A 5CY3A 3BU3A 4IRGA 5M4FA 3LLAA 5JKGA 5EOLA 3NDMA 5DT3A 2BFXA 4CQGA 1L0OC 4G5JA 2G01A 4XLNF 2ZMEB 4BGHA 4C4FA 4IM3A 3CXWA 3PSBA 4XP2A 3E6CC 4FIJA 2J9MA 5FGKA 3HV7A 1H8FA 3WTVC 2O61A 3AD6A 3LFCA 1PRYA 2R7IA 1DAYA 5I9YA 4RB3C 2BPMA 1ODDA 3O71A 3TJCA 2BUJA 4TWPA 3GFLA 4FV0A 2ISYA 4RIYA 4AOJA 4BCPA 5JT2A 4M7IA 4QOXA 3VF9A 2Y7JA 1TVOA 5F6FA 2CWEA 3BWFA 3KCFA 4FSZA 1MGTA 3ZMVA 5FLFA 4HDVA 5CLPA 3QQKA 3POZA 4ASEA 4O7RA 2JAVA 2HS5A 3IS5A 4D1XA 3ZUUA 2VTHA 3CUOA 3UVPA 3TOBA 4UBAA 4LFIA 5CXZA 1J9IA 1UKHA 4DGMA 5D7AA 3MH2A 2XMYA 4LMUA 4IC7A 4QMYA 2XV4S 4E3CA 3DKOA 3PY0A 3OW4A 1OECA 1PMUA 2OZAA 2EA4A 5L3EA 3PVUA 4F7JA 3ISPA 4AD9A 4CYDA 5GJDA 4P2KA 5ANIA 3K2ZA 2VWIA 3QUEA 4HCVA 1OL5A 3QPHA 5DWRA 5BQTA 3A7GA 4IFCA 4O7VA 3F3VA 3R7OA 2IPQX 1FX7A 4RC2A 5JHUA 4JBAA 2GQSA 4HCTA 3GT8A 2A07F 4M71A 3R71A 4DLJA 3BYVA 4CTCA 1YXSA 3P9KA 4EKKA 2JIUA 3ZQ7A 3GU6A 1CMKE 1LDDA 3ULQB 2GA2A 3QQJA 3SW7A 3BU5A 5JH6A 5EDQA 4BZOA 3E7VA 5F1RA 4KAOA 4MGRA 1IAHA 1O3QA 1Y57A 4LOOA 1ZYDA 4D1ZA 2X7OA 2H9VA 2Z5UA 3TO7A 4DFNA 5BVWA 1KGSA 4QNYA 1XHAA 2ISZA 3RAKA 4EM2A 4FV5A 4FV8A 4OT6A 4KYWA 3UVRA 1SAXA 4BDHA 1S7AA 2AYPA 4FV7A 1T38A 4C3PA 5IUHA 2XAQA 2WMWA 4DEEA 3WODF 2HWVA 4AAAA 3TNQB 2BE5F 3KP2A 4I94A 3COIA 3W2CA 5DE2A 3KKVA 3FLZA 3CEKA 4FTAA 4IMYA 3FWEA 5LWNA 3HSFA 3MFTA 3O7LB 4PP7A 4FV2A 2XNNA 4RA5A 4YBKA 1ZYSA 3SOAA 5CI6A 3W32A 5DYJA 2JPCA 4JXFA 4QP6A 1XGNA 5JGAA 4LLNA 4IVDA 4M3QA 4CGAA 4H05A 3VW8A 5E7RA 3R73A 3VULA 1ZWSA 3MH0A 4RJ6A 2LKPA 2QUFA 1U2WA 4MNUA 2XKCA 3LMHA 4FKSA 3GF2A 5IEVA 4DH7A 2OXXA 3NCZA 4Q9ZA 1F5QA 4FIIA 3I60A 1Y6BA 3MA6A 4M14A 3G51A 2BBYA 4CD0A 3LW0A 1L8TA 1FINA 4W8DA 3TIZA 4EOJA 3RJCA 2IVUA 2C68A 1P4XA 5HOOA 3BQCA 4NTTA 3NMUF 3QD2B 1Q41A 1H1WA 2V5QA 4A0ZA 2YA9A 1XBAA 4IIRA 3P9JA 3TKUA 3CGOA 3Q6WA 3OBGA 3OBJA 4EJNA 1J3HA 5FP5A 2CGWA 3R9RA 1R1VA 1T45A 4E93A 1FSHA 2JIVA 3LHJA 4PMTA 1YWRA 2OBJA 2O5KA 1XH4A 4AOIA 4NKSA 1VYZA 3JVRA 3L9PA 2O8XA 5LLQA 3S4QA 2E9UA 3B8QA 4WBBB 5DCMB 3R0TA 3G15A 4LGHA 2B9IA 2B9JA 4G6LA 3CLOA 4IAKA 2W0JA 2DK5A 3BY6A 4QMLA 2ITYA 4J71A 4WNMA 2ZNZA 4DEGA 2B52A 2VWVA 3UZTA 4R1HA 1PDNC 2GU8A 3PE1A 3I0TA 2C6MA 3L7WA 2EUFB 1JHHA 5LMKA 3V7CA 2LF7A 2MC3A 3BHVA 1BI1A 4RJ7A 2R3IA 2GA1A 3MVMA 4LRMA 5ANJA 2R64A 4N70A 2VWBA 3IOPA 5G6VA 1F9NA 5L8JA 4GUBA 3DKGA 3WE2A 4MEDA 3NUPA 4EYJA 2ZCWA 5EH0A 3EFKA 4J97A 2VTJA 3R8UA 3E6BA 3GZ5A 2PG4A 3PLSA 4EJUA 5CU0A 2PVKA 3F7WA 5IEXA 1MQ4A 1IN8A 4EJTA 1XQZA 4HV5A 3V5JA 2CKQA 3JPVA 2W99B 2Y8OA 2QOCA 5HQ0A 3QRKA 4XOZA 1FVVA 2VTOA 1JKLA 1E9HA 1OMWA 4BKJA 2X4ZA 4N4SA 5KMOA 1IR3A 1PXPA 3I1AA 3TZMA 3QQGA 4YSMA 5AIPA 2PSQA 2Z7LA 5H20A 2JBPA 1JLUE 3TN8A 3EQGA 3HTUA 1PXNA 4QYYA 1WRJA 2WMAA 4DF3A 4FX3A 4EOQA 1JGSA 3QU6A 4OBOA 3LPBA 1HW5A 4B4LA 1U6GA 2PU8A 1PXLA 4OIQF 3QUPA 4FKJA 1E1XA 4DG2E 4U5JA 2FBIA 1LDKB 5DA3A 3F8CA 1R22A 1XN7A 2QENA 5KK1A 3VS3A 3COHA 4M15A
chains in the Genus database with same CATH superfamily
1GIHA 3GGFA 4QMZA 4MLOA 3OCSA 5AM6A 5IPJA 2GBYA 3GVAA 3WU1B 4N4OB 2GIZA 4MVFA 2GNGA 1X3WB 2J90A 4BHCA 4ANBA 3AT4A 3ZUTA 2YWPA 2DYSH 3DQXA 5M09A 2IW6A 1RR7A 1LPUA 3MESA 5E1WA 3RBWA 4L9JA 4RAFA 3ZBXA 1PXOA 2XAMA 3NZ0A 5E8XA 3RALA 3NEUA 3BTIA 3PIXA 2ZJ2A 2OZUA 3V8SA 3AC8A 4RMZA 2BKZA 1WH5A 4L00A 3FMSA 4G6OA 4XHKB 3DWLE 2YJRA 5C8NA 3QAME 3MQ0A 2CCIA 3W0RA 3QL8A 3B73A 2QO9A 4AXFA 2HAKA 5HG5A 4DG3E 5GIOE 4LIUA 5HNGA 5KVRA 1UHWA 5DMZA 4A7CA 4RZWA 3BBWA 4NM5A 2KRFA 3WZDA 4Y83A 3WZJA 2TDXA 1QO0D 3EDPA 2XK4A 3GCMA 3HLLA 4GMYA 2JDSA 4RS8A 3VBTA 1D0ZA 2J2IB 3OOMA 4AA4A 3TO6A 1LDJA 3ABLH 3FK7A 4Y72A 4RVTA 1W8CA 4X0GA 4EOOA 3R1QA 5H6QA 2JQ7A 3NUSA 5I5ZA 2OKRA 2J0LA 2NPQA 4DFUA 2CJJA 2CUEA 2G2HA 3GOKA 3H9GA 5ETAA 4CYCA 2A69F 2F5VA 3AMYA 3MSSA 1ERDA 1IEPA 4BDJA 2P2HA 3LFEA 4S31A 1IXSB 4EOKA 3EUHC 1FIPA 2A98A 5AAFA 3ULZA 3MPTA 4U7ZA 1OGYA 4BCFA 2PZYA 1KYZA 1ZRZA 4CVAA 1UMQA 3TL4X 2RQQA 4FEXA 3VODA 2QKMB 4H1JA 2HY0A 4RIYB 4O81A 2HR3A 1BX6A 3PIOF 2X0LA 3VJNA 3GUBA 3QCYA 4Z55A 1XDUA 1MJBA 2B53A 2VUWA 5J1RA 3LA7A 3VIDA 3K1MA 4AQKA 4EK8A 4O4EA 3VS5A 3HHGA 3DBEA 2YM6A 3DY7A 4I98B 2YZAA 4YURA 4FE4A 5IQFA 4HBLA 1F3MC 3J80Z 2O9LA 1OR7C 3VS0A 3VHEA 4KINA 3HB9A 2V26A 4USDA 1FQ1B 2YCSA 4FIFA 1DU0A 5EM7A 4YU2A 2I8DA 3LFKA 2HTJA 1WCCA 3TM0A 3T3VA 3RZDJ 3DEEA 2XIRA 3R9NA 5FKNA 4D4RA 3EQHA 4YTHA 2K9LA 2G0EA 2V79A 3ZCOA 4MYGA 3E62A 3QQUA 3TKYA 1G5SA 4B4CA 4ZDPA 3A2KA 1W2CA 4C2MJ 2VIXA 4CCKA 3GLLA 4BC6A 3ZTXA 4WIHA 2ZM4A 3C4WA 2XF0A 5J95A 2EFNA 1P92A 4FTLA 3BCBA 3LXPA 5K5RA 3HKZA 3KREA 2FJ1A 4EM1A 2VTLA 3SHFA 1S5LC 3ZZEA 2RNJA 3E7OA 3KIOA 3IAS2 2Z1DA 3AC4A 4FJVA 4M0YA 4TWNA 2DA7A 1FOKA 3PY1A 3FXJA 4DC2A 2OJFE 4B09A 4AZWA 4JX3A 3BTJA 1DU6A 5FJ8J 4IB1A 1UAAA 1OPLA 1R0EA 3R83A 3DFCB 3QZFA 2GMXA 4C4HA 3CTJA 3E93A 2ID3A 1ETQA 2YIYA 3F5UA 4D4VA 1ZGWA 2V7OA 5D6EA 3ENHA 2FA5A 3O96A 5HI2A 4BGGA 3UYSA 5AAEA 4AVZA 1LUFA 3Q2MA 2J5OA 3VUMA 3I0QA 4DTBA 2WMTA 5EEAA 3WZUA 4DHZA 1A6IA 3ZSHA 2IGKA 1FOTA 4MTDA 4BCIA 2BHZA 4J1RA 2XRNA 4JG7A 2A4LA 2VWYA 3ZRMA 5D9HA 4F6UA 1KV2A 5IH5A 2V1UA 4JR7A 3AD5A 1YXUA 1JVPP 4G3DA 3JS2A 4JLCA 5FXSA 3NWTA 3I58A 2OJJA 1U46A 3R8ZA 3FY2A 4O7TA 3MI9A 2MFZA 4CA0A 1WWXA 1VQLI 3VYUB 2BOLA 2EFPA 4AT4A 3BCAA 3L2CA 3IH2A 3O23A 3Q3BA 4KJZA 3HEFA 4HZSA 2X0GA 1MZBA 3GTOJ 4DEIA 3CS9A 5EKOA 4MD8E 4P5ZA 5HDGA 2R2PA 4JG6A 3CCLI 3Q9SA 3VEPA 4EH9A 2DS1A 2WMUA 3E8NA 3V42A 4F99A 3RGFA 4AZVA 3EHAA 2R0UA 4PZJA 5EHLA 1PYXA 3U6IA 3FHZA 4OMZA 2R3RA 4YZ9A 3FHIA 4ZSAA 4JAIA 4F08A 3P5KA 3UP7A 4RAYA 4E4LA 4HV6A 4RIOA 2RNGA 5CAPA 2WXVA 2BXYA 4MXYA 3CC2I 1R39A 3LM0A 3FDNA 3R8PA 5LGNA 5D11A 2XCHA 3E5XA 1K6YA 1YX5A 2KIMA 5A4QA 5IH4A 2WIHA 4BBFA 3NUNA 3F5PA 4BICA 3O2MA 2R5YB 2IZTA 5EKNA 5DEWA 3H9OA 5K4JA 5AP7A 2QKLB 4I0AA 4IOAF 5HLNA 3FLWA 2YU9J 3FX3A 2CRGA 4W4XA 3FI8A 1QPDA 3RI1A 4JNWA 1A35A 4GRBA 3FI3A 3B2WA 4IVNA 2CHLA 4EWQA 3OT3A 1XMKA 3FLQA 2WTEA 2CW0F 3UO6A 3NUYA 4EC9A 4AXDA 5ETFA 4HZRA 2KT0A 1Z57A 3HOYJ 4A06A 3D4QA 3WTXC 4FTQA 3OMVA 2YJSA 2PPQA 2XHKA 3OY1A 4KB8A 5FXRA 5KMMA 4AUAA 4JRNA 5HDKA 3QFVA 4LRKA 1E3HA 4C8BA 2VTRA 4DFLA 5HEZA 2DTRA 4OIOF 1AOYA 5M06A 2IO6A 4OAVB 3UO4A 2PK9A 4GRIA 2OICA 1KU3A 1M7QA 2ZJRF 4YZNA 3G0FA 3ZQGA 5D5XB 3C2BA 3HC7A 3VWBA 3CCUI 3RP9A 3D83A 3ORPA 4NYEA 1IZ1A 1OCZH 3RK7A 2C6DA 4ARKA 4G2FA 1OIRA 1R9TJ 1PJKA 2YEXA 3M4OJ 3FISA 3BZKA 5AX3A 5EM8A 2F57A 2XGCA 4PJMA 2K9MA 1WZ2A 1ZG5A 4WT6A 1LEZA 4ACGA 3MKYB 4YLLA 4R7IA 4CCBA 4UUTA 3Q0UA 2ZYBA 1JI8A 2E2JJ 2G9XA 2FNPA 3L8SA 4CLIA 4RFYA 3QODA 3HOXJ 5IP6A 3E1SA 5FFXA 3EN9A 5E8ZA 4AZSA 3GQLA 4RLFA 5H2UA 5CNNA 2W1ZA 3S2WA 2KJBA 4NUBA 4G7HF 5FD5A 5DUIA 3Q4TA 4NJDA 4KKEA 4Y17A 3QHWA 3OEFX 1KE5A 1HLVA 2PZ5A 3VRZA 4M74A 2ELHA 2YDIA 4BCOA 4BCHA 2I0YA 1OCOH 1ZARA 3MJ1A 3CE3A 1PP8F 4I92A 5LVPA 1EJ9A 4CLJA 4AE9A 2IZRA 2VNWA 4RQKA 5H8BA 4EWHA 3EFJA 2H6DA 1JTXA 2XB0X 3K4BA 3IRQA 4ZSEA 3LOKA 4TN6A 1W1WE 2UV1A 4PSXA 3PUFA 1LEWA 4Y8DA 2YCFA 2XIYA 2M7BA 1OB3A 4C2WA 3KE2A 3U87A 3QZHA 4FQGA 3W3CA 4WKQA 2NS0A 3VWAA 5JZJA 3P0MA 4DITA 4YHJA 2WMBA 3H0YA 5C4KA 2W1OA 2BY2A 2Y0SA 5M4UA 2MLGA 5HNBA 5TKDA 4BJ5C 4JQEA 2I6LA 4QP3A 1Z77A 4FEQA 2KHMA 3ANRA 3HA8A 3M8FA 5HBJA 3VFZA 1D5VA 1FP2A 3DPKA 2OQRA 4DJAA 1W5CC 1GIIA 1QCFA 3H35A 4A07A 2ITOA 1U78A 2VXDA 1ZYLA 1R78A 2PN6A 2F7EE 4DT9A 2OIDA 2L4MA 4FOBA 4KIKB 4GKIA 4Y73A 2RC4A 2OXYA 3WGIA 2Z8CA 1VYWA 2P5LC 2MLKA 1PHKA 4MUQA 4UXNA 1QZZA 2Z02A 3R9OA 3ZMSA 1Z6RA 4BFMA 4U3ZA 2F4MB 3F22A 3R4KA 3QUDA 4XG7A 4I6LA 3WTSC 5IYBJ 3EQBA 2OLCA 4JBVA 1YO5C 5HO6A 4L3JA 3OY3A 4GU9A 1UV5A 4C3JJ 3ELJA 3W6KB 1WH7A 5CEMA 2J5EA 1O3TA 3MKZA 5CAUA 2L7MP 4BH9A 5A4EA 5J5TA 2VNYA 2DQ7X 3MTLA 3WZKA 2W4OA 3WF9A 1X8BA 4NFMA 1HCRA 3R1YA 3ET7A 2P4IA 2GQQA 3LFSA 1WKMA 3AFHA 3VYTB 1ZG3A 4ITVA 2OFVA 4I01A 3ZCLA 5GAHJ 3R01A 2CPKE 3RDIA 4KRDA 3S3MA 2XAHA 1PW2A 5E79C 5BVFA 4X1EA 3MKLA