1TR1A

Crystal structure of e96k mutated beta-glucosidase a from bacillus polymyxa, an enzyme with increased thermoresistance
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
447
structure length
447
Chain Sequence
TIFQFPQDFMWGTATAAYQIEGAYQEDGRGLSIWDTFAHTPGKVFNGDNGNVACDSYHRYEEDIRLMKELGIRTYRFSVSWPRIFPNGDGEVNQKGLDYYHRVVDLLNDNGIEPFCTLYHWDLPQALQDAGGWGNRRTIQAFVQFAETMFREFHGKIQHWLTFNEPWCIAFLSNMLGVHAPGLTNLQTAIDVGHHLLVAHGLSVRRFRELGTSGQIGIAPNVSWAVPYSTSEEDKAACARTISLHSDWFLQPIYQGSYPQFLVDWFAEQGATVPIQDGDMDIIGEPIDMIGINYYSMSVNRFNPEAGFLQSEEINMGLPVTDIGWPVESRGLYEVLHYLQKYGNIDIYITENGACINDEVVNGKVQDDRRISYMQQHLVQVHRTIHDGLHVKGYMAWSLLDNFEWAEGYNMRFGMIHVDFRTQVRTPKESYYWYRNVVSNNWLETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of beta-glucosidase A from Bacillus polymyxa: insights into the catalytic activity in family 1 glycosyl hydrolases.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Family 1 beta-glucosidase
molecule keywords BETA-GLUCOSIDASE A
total genus 180
structure length 447
sequence length 447
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tr1A00
2XTKA 2J7EA 3DYMA 3W82A 3WH9A 4U3AA 4AD3A 2G41A 1FH8A 2XSAA 3WD3A 3AZRA 2J78A 5IFPA 1KQZA 3CZGA 3WD1A 1BVZA 2JALA 4AYSA 3IAPA 2WZIA 3W37A 1CGTA 1H11A 1JZ6A 5I0DA 1LLOA 2D3NA 3PZNA 5GNYA 3O6AA 2HVMA 1XSIA 1H2JA 5A3HA 1HF6A 1WPCA 1GOMA 2VT0A 5JUVA 1ZBCA 2GJPA 1NOFA 1OD0A 1SYTA 4M82A 1ZBKA 4JHZA 3CUJA 4UZSA 1R86A 1VBUA 5BXPA 4ZE4A 4JFSA 3K8LA 4CCCA 2AAAA 2YLAA 1XH1A 4NI3A 3DYPA 1OM0A 1EGZA 1UKOA 1BAGA 3GH4A 4PTWA 5M17A 3BAXA 4AZBA 5DT7A 4JCMA 4U5KA 1WE5A 3POCA 3GYCA 3WY1A 4JL1A 3PN8A 3VGEA 1BF2A 1GOOA 3A4AA 4H8UA 5ABGA 1FOBA 2WPGA 2WWCA 3L4WA 3CMJA 1WZKA 1CXFA 1KQYA 5D9PA 1EDTA 3VIHA 5DO8A 4AIUA 1C7TA 1BYCA 2D23A 5TD4A 1C90A 3PZTA 2VZOA 3W26A 3GZAA 5M5DA 4MNLA 1M01A 3FXYA 4TTUA 4EKJA 1B30A 3WH8A 4HZ7A 2AMGA 2WVSA 3HU7A 3WQVA 1RPKA 2YBUA 1OD8A 3SCNA 2OYKA 3W29A 3B9AA 1C3FA 4KH2A 2GVYA 2D3LA 2CIPA 4YPJA 1HJVA 1B9ZA 4W5UA 1OGBA 1EO7A 2ZX7A 1BHGA 3IANA 2VUYA 4QCEA 2DIJA 3I3EA 1V0LA 4MNJA 4AD2A 1MW0A 2BY3A 1DWGM 1OINA 2J62A 1TVPA 4JFUA 3WL1A 3OB8A 1QBBA 2GSJA 4PMNA 1C92A 2VNCA 4R27A 4Y7EA 2GJRA 4XB3A 1EDGA 2VCCA 1NWSA 2W67A 4EK7A 1M04A 3L2LA 4ZXLA 2PWDA 1W9VA 4B9YA 1GOQA 4PMOA 2V3FA 4J3TA 2W62A 1BTCA 1PPIA 3WUFA 4CN6A 3WF0A 4MJ2A 4P7NA 2WK2A 5A2BA 3T0DA 2V3GA 3VIOA 4A3YA 4HMEA 1PX8A 1CECA 2BNJA 5HNNA 2XUCA 1VFFA 3LPPA 1JDDA 4J3UA 4V27A 5I77A 5CSUA 3WL0A 2J7DA 1UWTA 2C0HA 4ZE5A 1E6QM 2XGIA 2WLZA 4CD4A 1UKQA 2FHBA 3EBVA 2FH6A 4MB4A 4U2ZA 4C7GA 3VIFA 2J79A 4PSPA 3E1F1 3VX1A 5BXTA 1R85A 1KCLA 2A3CA 3EDFA 5E9AA 5E6YA 5I78A 1WCGA 5A6JA 3AXXA 4JCLA 1HKIA 2V3EA 3SUUA 3WD4A 2CCRA 3N9KA 2WKLA 1ZS2A 1UR2A 2BHUA 2ZXQA 1LG2A 1JF5A 5A95A 4N0RA 3AISA 2EQDA 3OZPA 3CHFA 3VNZA 2WVUA 4BF7A 4UFMA 3WQ4A 3RIKA 5I23A 3RO8A 3T08A 2CEQA 2DQXA 1XH2A 4A4AA 1TCMA 2A3EA 3ARQA 2XVPA 3F5JA 2VRKA 3BLPX 4GPNA 4TOQA 1NARA 3RM4A 4W86A 3WH6A 1KXQA 5E09A 4AXNA 1LG1A 1PBGA 4U31A 3AS2A 1ITCA 1GQJA 4KWUA 4BQ3A 3CGTA 4MAVA 2DT0A 3BMWA 1CBGA 1H5VA 1Q6CA 1B3YA 3T2OA 3D5HA 1W2PA 4AIEA 3CUHA 4Z2HA 2GDVA 4JHOA 4HOWA 3AHZA 1EOMA 8CGTA 4TUFA 3ALGA 2NSXA 1XYZA 4AZHA 4AISA 2JEPA 1JI2A 4CCDA 2XM1A 3GXDA 2ZWZA 4OUEA 4GINA 2Z1KA 1E5NA 1EHNA 3CUFA 3EDEA 2CERA 3SCRA 5JBFA 2CPUA 5GNZA 4ZENA 2E40A 4HPHA 4JIEA 3WDHA 4DWSB 1ODUA 1MXGA 4P7LA 3VX0A 3HN3A 1KWGA 3ZM8A 3NYDA 2FDMA 4P8WA 2D2OA 3RPMA 3RM9A 4PEEA 3MMWA 2BVTA 3PHAA 4N42A 1LL4A 3WEMA 4JL2A 1E3ZA 4UFKA 1WZAA 4IISA 1PX3A 4HPGA 4AZ7A 3VNYA 3QHOA 3WQ6A 1ISXA 3VD7A 4E8DA 2VX4A 3BLKA 3CZKA 4J3VA 4F79A 3GXIA 4KGLA 4CD5A 4P7OA 3ARSA 3AXIA 1CGWA 5LA1A 3VIGA 1V3HA 4UOZA 5GPRA 4B15A 4UOQA 3FHQA 1OT2A 5E70A 2BHYA 4U2YA 4WF7A 4KRUA 1V3LA 3W53A 3W28A 2W92A 1EOKA 5FIPA 1UQYA 5A2CA 1JL8A 5AY7A 2UY2A 4L4OA 1DTUA 1VB9A 3CPUA 3N18A 1UWUA 3VDHA 5A6LA 2F2HA 3L4UA 1HJWA 3CZ8A 1JAEA 1XCWA 2W91A 1TA3A 1I75A 4YHGA 1CEOA 1GVYA 3TONA 3AMGA 1DWAM 1AQMA 3MV01 3AIWA 2J8FA 3TA9A 4DUXA 3SUWA 3CZEA 2XVNA 2J74A 1H41A 4E4PA 3G6MA 1GOKA 1QI2A 2WHKA 3VIPA 1EXPA 3FHAA 1XRVA 1H3GA 3ZR6A 4Q22A 1OIMA 2VX6A 2JE8A 3TTOA 2JFEX 1V6WA 2F8QA 3B9DA 3WENA 4PBGA 1ZJAA 3SCUA 2VX7A 2W5FA 2NW0A 1CPUA 2ZWYA 1E1EA 3NIYA 1UA3A 1LWJA 3WUEA 1JFHA 3CZJA 4W7WA 3RCNA 1U30A 1HVXA 3BMVA 5A6MA 3AZSA 3IAQA 3W27A 3VILA 4BQ5A 3RJYA 2GJXB 1JZ4A 3VGHA 1JYNA 1UR4A 3WSUA 4TVDA 2WNWA 3CH9A 3SEPA 4B3KA 4FF5A 2OSXA 1R8LA 2E8YA 1GHRA 3BAIA 1Q6FA 5ABFB 1J11A 4GO9A 1NP2A 2PWHA 2YJQA 4ML4A 5I3DA 1HX0A 1EO5A 1UR0A 2BV9A 2AOSA 3DC0A 3GNOA 3T0BA 5ABFA 4OBSA 3BXWA 1J0KA 3CHCA 1E6RA 1V0NA 3N11A 4MPKA 3RMEA 4UQBA 4NRSA 5AYIA 3WH7A 3ZJ6A 2J4GA 1US2A 1XC6A 3AI0A 2JIWA 2BVDA 2JIEA 3MKKA 1QPKA 1QI3A 1W3KA 1V3KA 3ZR5A 3VD4A 1K9TA 1VEOA 1W91A 1NM9A 1HN1A 4HU0A 2XFRA 3JUGA 4PYSA 1LJYA 5AYBA 2J7CA 3M46A 1PAMA 5A6AA 1YHTA 4UQDA 1A47A 4CGTA 3QHMA 3APGA 2PWGA 1UD4A 5DFAA 4S3KA 1W9BM 4NF7A 5ECUA 4PMZA 1QNPA 1JD7A 5HPCA 5CXPA 3KWXA 1FA2A 3SCPA 5C8BB 1GCYA 3IJ8A 3KL0A 5LYRA 1JFXA 4CU7A 3WD0A 1UA7A 4XX6A 4R5EA 4RE3A 2XIBA 4WK9A 1O6IA 1V3MA 1QNOA 1G01A 1IZKA 1GOWA 5CG0A 3UESA 4AC1X 1VRXA 2FHFA 4UCFA 2A3BA 4FLQA 2XG9A 1B3XA 2XHYA 4PCTA 3GBEA 4AZCA 3ARUA 5IDIA 2J47A 3ZJ7A 2GDUA 2X05A 5A2AA 1XSJA 3VU2A 1E40A 1EA9C 4OZOA 1LQ0A 2VI0A 4PRWA 1ZL1A 1G0CA 2VVNA 4GZIA 1TVNA 5C70A 1Q6EA 1VJZA 1UZ1A 3EMCA 1QNSA 3MSDA 2VZSA 4F66A 3M7SA 1ECEA 1UR8A 4CD7A 4WJXA 4XZWA 1KGXA 5HXMA 1C8YA 1XCXA 1WZMA 2WC4A 3MUIA 2OYLA 2E9LA 1C93A 3BSGA 2VQTA 4ZXOA 1W9PA 3ZIZA 3ZMRA 2E4TA 3ARVA 4X0NA 3AS1A 3FAXA 3MSGA 2Y2WA 2YIHA 4ATDA 1B0IA 2ZUUA 4UQAA 5IHRA 1K9EA 2PF0A 2O9PA 3N17A 3NDZA 4H7VA 4DWSD 1GQLA 4BS0A 3KEHA 3AHYA 1JD9A 1UZ4A 2E0PA 4MNKA 2VQUA 3O2LA 3WIJA 4ATLA 4JFWA 2WANA 1KXVA 2J75A 3K4DA 3RJXA 4AD1A 3OGRA 4D6FA 6TAAA 3UG5A 1H09A 2XJ7A 3K8MA 3KE0A 4LXFA 2Y8VA 4CD8A 1E0VA 1W3LA 4CVUA 1WO2A 3GDBA 1A3HA 5M3WA 1OT1A 3PZUA 3THDA 1UWRA 3N12A 3T09A 4GI8A 7CGTA 5KZ6A 5FOOA 4JZ5A 4RE2A 2VVSA 3VO0A 5BXSA 1CXEA 2XGBA 3AHTA 4D1IA 3OLDA 2WB5A 3LPFA 3VGFA 3A4XA 1US3A 2VR5A 4MB3A 1J12A 4BQ4A 4HU8A 1CXKA 2A3HA 3WNOA 4CCEA 3WDPP 1K6AA 4F9DA 4HZ8A 4W7VA 1QNRA 1UG6A 1XHGA 2WMGA 1M03A 3WUBA 1HVQA 1JZ8A 2J77A 3ARZA 3VTRA 3UG4A 3ZSSA 2WXDM 2PB1A 2Y24A 3LPOA 4UTFA 1JYWA 1KR0A 2D24A 2VO5A 2VZTA 1CGVA 1CXHA 2IUZA 2RGMA 3QGVA 2VC9A 1EH9A 2EXOA 2VCBA 2VZVA 1LL6A 2PC8A 5A8PA 2PBGA 1HKJA 3K1DA 1MQPA 1UOKA 2DPEA 3L2MA 4WKFA 1U2YA 1PJ9A 2VTFA 4H41A 5CPTA 1LWHA 1XH0A 4IUGA 5A8MA 2WVTA 2FGLA 3K4AA 1NWTA 3OG2A 4MDPA 3U5UA 3PZMA 4NZCA 2XSBA 5EB8A 3CHEA 4J28A 5A6KA 1C7SA 1E9LA 3T2QA 1AVAA 2VRJA 3WKZA 1FFRA 2WBKA 1CTNA 3W25A 2XWDA 2DSUA 5CLWA 2BXZA 2VR4A 3NJ3A 1VFOA 2GK1A 4JKMA 5CQ1A 3UETA 4D6EA 5BXRA 5M03A 1HKKA 1B3VA 2PI6A 3WNMA 2VMFA 4HMDA 1JZ7A 2G3JA 1E6NA 1VEPA 1E0WA 5C71A 3AIVA 1TG7A 3O9NA 2DSKA 5IXEA 1DWFM 1QI5A 2ESCA 3EMQA 3GBDA 4DM1A 2D20A 2O9RA 1C8QA 1H49A 2CBVA 1XGZA 4AZGA 3BCDA 3GM8A 1VFMA 1B1YA 1CENA 4AEFA 1R7AA 3VPLA 2NT1A 3MUY1 3BAYA 3WQ8A 2WHLA 2ZX9A 2WWDA 5CPQA 1BFNA 4BQ2A 1BGGA 2YOCA 4GO8A 3WD2A 4P8VA 3W0KA 3MO4A 2W61A 5A8QA 1RD6A 2EPLX 1BLIA 4B16A 1BYBA 3BAJA 4UQ9A 1KGWA 1E6PA 4PSRA 1UD3A 1JXKA 4AD5A 5I24A 3VUPA 3U5YA 3A47A 5E6ZA 2DIEA 1JGIA 4CKQA 2ZUVA 3AS0A 3WDIA 1LF1A 4J3WA 2BFGA 1QHZA 1UUQA 1GUVA 2OWWA 3SCVA 5D9MA 5EFFA 3TP4A 3GH5A 1KR1A 2DT1A 1V0KA 2FHCA 1X1NA 4Z2GA 4C7FA 2CYGA 4GXPA 2DEPA 2VZUA 4OBRA 3OLIA 2D0HA 2V5DA 4JFTA 4PMYA 3I3DA 3UR8A 5A8OA 5CGMA 1Z32X 1NQ6A 1SFSA 5BRPA 1MWOA 3ARYA 3CHDA 1E70M 1OWQA 3AS3A 3G6LA 3AHXA 3K46A 1ITXA 2WZEA 3U7BA 1KCKA 2EJ1A 3KL5A 5HDRA 4TX6A 2HISA 3N1AA 3PBGA 3THCA 1OBAA 2A3AA 4LQ1A 4M29A 4Z2IA 1ISYA 3VDBA 5A8NA 1Q6DA 3D3AA 2ZUTA 4OJYA 4W8AA 2W63A 4GQRA 4DUWA 3WDQA 4RE4A 1CLVA 3VIIA 2QMJA 4PUEA 2TAAA 5I2UA 1FHLA 4PN2A 3VMOA 4W89A 1F4HA 4M8UA 4PUDA 3SUSA 3L4ZA 4UNIA 3AHVA 3VD9A 3GNPA 2OLHA 1MFUA 3U57A 4CN4A 1E4IA 1UD5A 2IXVA 4HZ6A 1UWQA 3AZTA 3UERA 1EQPA 3AYSA 2X8RA 2DT3A 4M81A 3RDKA 5CPSA 2G4FA 3WF3A 3U7VA 1JDAA 3PZIA 4GKLA 4EAMA 3W6MA 1W9DM 3VGGA 2YDQA 2CNCA 1V6XA 1B2YA 2EPMX 3WQ5A 3VGDA 2CBIA 3WFZA 4S3JA 1IT0A 4M56A 1GHSA 1ZJBA 1E71M 3MMUA 2Q8XA 4QLJA 4P7RA 1B3ZA 4PMVA 2F61A 4D6CA 1BSIA 3VGBA 3B9EA 4IPNB 1QOXA 4J27A 3ZOAA 1EQCA 4OIFA 3RILA 1QI4A 1UR1A 3AYRA 3GXMA 1UKPA 3MU7A 3UR7A 5HPOA 1TE1A 3BAKA 3ZSTA 1D2KA 1I1WA 3EYPA 1E72M 1HT6A 2ZIDA 4AWEA 4YHEA 1H0IA 1I1XA 4OOUA 1J0HA 3ZQ9A 2WBGA 2DSWA 1WP6A 4B3LA 1ISWA 4IM4A 2XIIA 4URIA 2J7GA 4PMRA 5BYWA 3WEZA 1TMQA 3OLGA 2J8GA 1CYGA 2O9OA 2YDSA 5A6SA 3WDRA 1JYXA 1IZJA 5EFDA 2QLYA 2QPSA 1V02A 1H1NA 4NRRA 4DM2A 4HTYA 4FLSA 2DDXA 1JZ2A 1CGYA 3M07A 4B9ZA 3A6OA 3PZGA 5D4YA 4LPCA 3WDJA 3ZT6A 3AMLA 4M24A 1MW2A 4U5IA 3W24A 3A3HA 3AMCA 3M6DA 3NSXA 3WF2A 1KXHA 2BY0A 3OLEA 2JEQA 4CU8A 4F8XA 1W1VA 4P8XA 4D6JA 3AMDA 1FFQA 3VKKA 4JFVA 4H2CA 4XV0A 2BY2A 4BCEA 4CUCA 5FCZA 1C8XA 1KGUA 3W38A 4AZIA 1QW9A 2ZUMA 1UD2A 1OIFA 2J7FA 1JNEA 2ZXDA 1PX4A 4XZBA 1K9DA 3VD5A 1E4MM 3F4VA 2VURA 2WVVA 1WDSA 1UD8A 2WMHA 2OYMA 2BY1A 2O92A 4AD0A 1JG9A 1W1YA 4LYRA 4UFHA 4CN1A 2DSVA 3VINA 2E9MA 1BVNP 4JAWA 2V3DA 1NWUA 3VVGA 4GI9A 5GQBA 5D8WA 1G9HA 2D1ZA 1QNQA 1KWKA 5D9OA 2EEXA 3WELA 5I79A 1BYAA 5JIPA 2RGLA 2ZX8A 1OGSA 4UFIA 2OSWA 4QFUA 1V6UA 2E8ZA 5A6BD 2VRQA 2CBJA 4LX4A 3N04A 1NH6A 1TR1A 3WEOA 3ZO9A 4D6DA 5IHSA 2O9TA 2QPUA 2BHZA 4D72A 3OGSA 3W4RA 2DH2A 3PTQA 1VFUA 1ZU8A 1UH2A 3PZVA 1BYDA 3HJEA 5BROA 1CGUA 3AJ7A 2UY3A 4GZEA 4W7UA 4DWSA 1J0ZA 2YBTA 3FN9A 4W8BA 3K8KA 1UYQA 1F4AA 3AROA 2YL9A 4Q7NA 1EDQA 1V03A 1J0YA 4X9YA 5BRQA 2ZXAA 3EDDA 4AZ6A 2PWEA 5CGTA 2X09A 5DEZA 1HIZA 2WCGA 3BCFA 4Z2LA 1HJUA 4HP5A 1E4LA 5HOSA 1HXJA 1VAHA 1FP9A 1KXTA 2YA2A 1MW1A 1JAKA 1HP4A 1RP8A 2OWCA 3WBAA 1CLXA 4AD4A 4W5ZA 3AQUA 2DGAA 3BGAA 2GUYA 2WC3A 3QOKA 1E4NA 4TVCA 5JBDA 3MANA 4H04A 4J3XA 1V6VA 3KZSA 3AFBA 3OBAA 3S6TA 3L4VA 4PCSA 1V3IA 8A3HA 1L0PA 2E9BA 2UWFA 2DT2A 4IPLA 1DWJM 4HA1A 1JF6A 4MADA 4W87A 1GW1A 1WDRA 3AOFA 2WZHA 4NSBA 2WSPA 1CWYA 3UG3A 1PIFA 1UKSA 3CBWA 3NDYA 1FH9A 4X0VA 3SURA 1JZ5A 3VD3A 2J25A 3L4XA 1B90A 1XV8A 5AC4A 3GTNA 4GQQA 3VM7A 1VBRA 5DF0A 3VOCA 4TX8A 1BPLB 4QLLA 4WSJA 6A3HA 1J18A 1BGAA 4E2OA 1JI1A 2W66A 4TXEA 3WNPA 2WSKA 3W6LA 3N15A 2Z1SA 3DYOA 3UCQA 3ARRA 2YDRA 3SCQA 1H0GA 3AIEA 3KL3A 3WMBA 5BCAA 2YA0A 3POHA 1V3JA 3WUGA 3WF4A 1K9FA 1V0MA 3FW6A 2YKKA 1WKYA 9CGTA 3IJ7A 4HOXA 1GZJA 1B3WA 7TAAA 1MW3A 4M1RA 2CESA 3SIMA 1HJQA 2QF8A 1ZBWA 1GNXA 4V28A 4UR9A 3SCOA 2WMIA 5CJ5A 2CITA 1XD1A 1W32A 3WQWA 1G5AA 1AMYA 3OZOA 1JIBA 1FH7A 4ACZB 1CNVA 2XYLA 1MFVA 1DWIM 2E3ZA 4AMCA 4QLKA 4CD6A 4W8LA 1H4PA 1GOIA 1DP0A 1OGGA 2WHJA 1E1FA 2EPKX 1QVBA 3T0AA 2X2YA 4P7QA 3EDJA 6CGTA 4FLOA 4H8VA 1CDGA 4WKAA 4MTVA 2X1IA 2B31A 3CTTA 4LGXA 1V08A 5FL0A 3VIJA 5BWFA 1E15A 1D7FA 4UQEA 4AY1A 5E0FA 4ZFMA 2YL8A 1UQZA 2DH3A 3I3BA 1UWSA 4MAZA 2WYSA 1D3CA 3B8SA 1DWHM 1KBKA 4HMCA 4CU6A 4PTMA 1GQKA 1GPFA 3ARTA 3VIMA 3VM5A 3CMGA 3IJ9A 3SCTA 4KMQA 5FL1A 4Z2JA 2QMKA 2CHNA 2G3IA 2UY5A 1AQHA 3ARXA 5LA0A 4LYQA 4OOZA 4FMVA 2VCAA 5A69A 1QBAA 1OB0A 1UH4A 3AIRA 5DT5A 4F9JA 5GNXA 3QHNA 1XYFA 3TOPA 3AIUA 1VENA 3NSMA 3AIQA 4RL3A 5D8ZA 4D1JA 1ESWA 3GNRA 3WN6A 1GJUA 4C7DA 4V2XA 1E5JA 4HOZA 2XVGA 4MB5A 1VIWA 2WC7A 2GK1B 1CXIA 4AW7A 2VL4A 1JZ3A 2WMIB 1Q4NX 3GXFA 5ABEA 1M7XA 4GI6A 1QW8A 3QOMA 1W3HA 2BXYA 4W85A 1O7AA 5E0CA 1ZB5A 1MXDA 1KBBA 1IV8A 1VJSA 5ABHA 2W4XA 4U3CA 1NP0A 5AC5A 2YL5A 1X6NA 2WKGA 5A1AA 3CUIA 1G94A 3GH7A 3VDCA 1BG4A 1MYRA 2WMKA 4EE9A 1HNYA 2XFFA 1W1TA 1NOWA 3ARPA 4PMXA 2V5CA 3AIBA 4DWSC 4PMDA 2PWFA 3ALFA 2XVKA 3TTYA 3LMYA 4ATWA 3AICA 2YLLA 4DUVA 3NUKA 2EO7A 3ECQA 1OCQA 1W9XA 1XD0A 2BS9A 3VIKA 3UEQA 1E6XM 2X0HA 4Z2KA 1J0JA 3F5LA 3WMCA 4ACYA 1HL9A 5EBAA 2ZE0A 2FH8A 1EHAA 2J7BA 5FD0A 1GJWA 4D6HA 1R7OA 2X0YA 1CZ1A 1DEDA 1E73M 4UQCA 4AZCB 3VDAA 3MV11 4J7RA 1J9YA 4FLRA 1PZ2A 1UHVA 3CZLA 3HMCA 3ZJKA 2Y4SA 2EBNA 1UKTA 4XUYA 1P6WA 2WAGA 3J7HA 2WW5A 4KRTA 3N13A 2BVYA 2WM0A 1JDCA 4U33A 1QHPA 3AMKA 4OKDA 5CSYA 1JYVA 2IXUA 5IFTA 3A4WA 3WNLA 4JKKA 3MMDA 4UOJA 1J01A 4HA3A 4QAWA 2YA1A 1HJXA 4AZ5A 1PEZA 3SUTA 5HBFA 1UD6A 1OSEA 1CGXA 1CXLA 1KB3A 5KEZA 2VX5A 3AXHA 1B31A 3II1A 1NOUA 4MNMA 1E3XA 3T2PA 1UR9A 4FK9A 1ISVA 3NSNA 2ZUWA 3BH4A 4UFLA 3DHPA 3BAWA 3EDKA 1CIUA 3TTQA 2XM2A 7A3HA 3LPGA 1JXJA 4LYPA 4MJ4A 5CZKA 2XPKA 4WSKA 3ZJ8A 1SMAA 3FAWA 2C7FA 2YL6A 4W84A 3ARWA 3WF1A 2QHAA 3TTSA 2OWXA 3OIHA 3WBEA 2D0GA 1DHKA 5DMYA 1GQIA 4UFJA 3PTMA 2CKRA 3NCOA 1E6ZA 1QI0A 1Q6GA 3VMPA 1VEMA 1U33A 2GFTA 5LA2A 2ZUSA 3PZOA 1S46A 1N82A 3PZQA 3CLWA 1WZLA 2VJXA 1BQCA 4GZJA 4HA4A 1WAWA 1E55A 1ODZA 4K68A 1C91A 1R87A 2ZX6A 2FGZA 4TVUA 3W81A 1TFVA 4TTGA 1J10A 1RP9A 1XSKA 1FHDA 1WNOA 2ZOXA 3FY1A 1GONA 5A94A 1BG9A 1X6LA 4H8HA 2ZXBA 3SCWA 4ACZA 4M80A 3IK2A 5D9NA 4D6IA 4QP0A 3BC9A 4QDMA 4PMQA 4EANA 1EIBA 4JKLA 2GJXA 2CHOA 1ZBVA 2PBOA 3SUVA 1TUXA 1J0IA 1HP5A 4W88A 3MUZ1 3CUGA 2CKSA 4W93A 3L4TA 2VOTA 2CXGA 3WNKA 4PMUA 2WHMA 4E8CA 3WNNA 4WLCA 4MDOA 2WMFA 3ZT5A 2J7HA 1PIGA 3FNDA 4WIWA 2EPNA 1V02E 4BZYA 3MS8A 2XFYA 2D22A 3F5KA 1NWRA 4GIAA 2OSYA 2XWEA 5I5RA 2WVVB 4KGJA 1UWIA 1W2VA 5I6SA 1W9UA 2JF6A 2Y8KA 1TA3B 1LL7A 1AQ0A 3DHUA 2UY4A 2G3MA 1HKMA 1RH9A 1E43A 1MQQA 2Y5EA 3DECA 1ISZA 1MVYA 1MQRA 5FKYA 1UH3A 1SR0A 2NT0A 5A6BA 1SMDA 2CBUA 1KFWA 3BSHA 5EMYA 3SCSA 4BA0A 1V6YA 3VMNA 3EMZA 1PZ3A 1WB0A 3RM8A 3QR3A 1M53A 2MANA 3CO4A 3OGVA 4CVWA 5F7UA 4QCFA 4UZUA 2WCSA 3ZT7A 3S2CA 1E56A 4L4PA 5CLTA 1VF8A 2JF7A 2EPOA 1W3JA 4D71A 4ZEPA 2V38A 2WCAA 3WMSA 1JNDA 1HJSA 1WDPA 4PTXA 2WLYA 1GVIA 1HL8A 2WMJA 2QV4A 2ZX5A 3OA5A 4WKHA 1Y7VA 4D6GA 1E6SM 1TZ7A 1GORA 2C8NA 3L4YA 2CETA 4MB1A 1FP8A 3PZ9A 2XVLA 2D0FA 4A3HA 2ZICA 3CIVA 4AIOA 2G8ZA 4P8UA 4AEEA 1L8NA 1G1YA 2DSZA 5JIWA 3MUAA 4YN5A 1W1PA 3WFLA 5JBEA 2G3NA 3WH5A 1QHOA 2ZUNA 1WDQA 1E0XA 3PTKA 1YQ2A 4PTVA 4J3SA
chains in the Genus database with same CATH superfamily
3QMRA 1WXZA 3DDMA 1VKFA 1AZ1A 1AODA 1FH8A 1EXBA 3ME3A 1KQZA 3CZGA 4LS1A 1BVZA 3T40A 4YIWA 3E74A 3QPEA 1H11A 3ATYA 3O6AA 2B7OA 3ITGA 4PRTA 1AL8A 3U8GA 1Q2SA 1ZBCA 2GJPA 2BMBA 3LSCA 2ZDRA 2J88A 1OD0A 1SYTA 5C2GA 1P7TB 2XIMA 1R86A 4CCCA 7XIMA 5HR7A 4BWLC 1EGZA 4R3UA 1ME7A 2FGBA 3GH4A 4PTWA 4Q8TA 3LCFA 3BAXA 4AZBA 1K8YA 2IS7A 4YTQA 1RAKA 2BGSA 3WY1A 5XIAA 3OBKA 1W1A1 1JEZA 4AXKA 3EA2A 3PF3A 1BF2A 4KCWA 3A4AA 1UMYA 4GK8A 4NT0A 3L4WA 2DFAA 1C29A 1YDNA 4GUFA 1CXFA 1RK6A 1EDTA 4Z08A 1XISA 1EP2A 1LRNA 2WZTA 1T7LA 3W2NA 2IKHA 1C90A 2C1GA 2VZOA 3AO0A 3FXYA 4EAYA 3A4JA 3QGKC 2JKEA 4EKJA 5T9CE 4HZ7A 2WVSA 1XRTA 3HU7A 3WQVA 3OBEA 1RPKA 1LORA 4FNPA 1L6WA 1OD8A 3F4DA 3B9AA 1EEPA 3BJTA 4KH2A 2H8XA 4OQVA 4ZO7A 1OK6A 2XIQA 1OGBA 5FJRA 1EO7A 1MZHA 3IANA 2DZUA 2GUBA 4LSBA 1K7FA 2Z1XA 3ANUA 4GQ0A 3GNXA 3RFAA 1HUVA 2A6LA 2NQLA 1CLKA 3H2NA 4ZODA 3W7JA 2CU0A 4TMCA 2YXXA 5AC7A 2ON3A 1QBBA 2OJPA 4FP1A 2QVHA 1C92A 4PMNA 4JX5A 3HBLA 3RMJA 4EK7A 1M04A 1LUCA 4E2BA 1XCFA 3UJSA 4AFYA 4HZMA 3SW6A 3FLUA 1XLJA 3KVLA 2Y7DA 4PMOA 4E2DA 3M9YA 4DHGA 2OT1A 1EJSC 1XLAA 1TV2A 3WF0A 4MJ2A 2WK2A 3KW3A 4IZGA 1JJKA 3V3WA 3RU8X 4H9TA 4IP7A 3H2EA 3FA3A 5HNNA 3MVTA 2O7QA 5CCZA 4XG1A 1JDDA 5I77A 1M68A 1PSCA 3WL0A 3PS7A 4GNVA 4ZE5A 4Q4MA 2PTZA 2XGIA 4H6QA 3NEVA 4GQBA 2Y70A 4U2ZA 3VIFA 3E1F1 1KCLA 5E9AA 3S2MA 3ITXA 3SY5A 3T0TA 5C55A 3AXXA 1HKIA 3TXVA 4WJEA 3SUUA 1DIDA 3WD4A 4XD6A 1WKFA 4ERIA 4DY1A 5HJYA 1UR2A 4IPPA 3EKZA 1PE1A 1Q7QA 5T8GA 3LBMA 3HG4A 4NU7A 2EQDA 2Z6IA 1BXBA 3OZPA 4JTUA 3T08A 2TPSA 2E6FA 2ACUA 1M6JA 2VRKA 3BLPX 4W86A 1KXQA 2PUZA 5AZ1A 1P0EA 5E09A 1LG1A 3TU9A 2I14A 1ONEA 1H5VA 4XZLX 3T2OA 3D5HA 1W2PA 1R3RA 4Z2HA 2GDVA 4JHOA 3GNNA 4HK6A 3E0WA 1H7RA 3AHZA 3FJLA 2C15A 3ALGA 2NSXA 2DVUA 1P0BA 1MUCA 4AISA 4IWWA 1JI2A 3MT1A 3CU2A 1DQWA 2AKZA 4QQ3A 1LM1A 3R8GA 1WDDA 3OOQA 3RLGA 2BZNA 4GFIA 4OUEA 2Z1KA 3U0HA 3SCRA 1AA1B 5GNZA 4LBSA 4HU4A 4ICNA 2A79A 2ACQA 3CQ0A 3WDHA 3M5YA 3N19B 4J40A 5KZMA 3ZM8A 4JD4A 3ZS4A 2Q6ZA 3BGJA 4PEEA 5I3JA 1BVWA 3TZNA 1E3ZA 1WZAA 3SFWA 4HPGA 3GU9A 1ISXA 3HGOA 1W1IE 3RNDA 1M9HA 5EL1A 4CD5A 2E7FA 3ARSA 3W71A 1V8EA 2ZRWA 1V3HA 3WK0A 3LI0A 3YPIA 1XLMA 1PO9A 3XINA 4B15A 4IP5A 1C9DA 4HCDA 3GRIA 3O06A 4KRUA 3NQAA 1EOKA 5H2ZA 3NL2A 1S5NA 4LT9A 5FIPA 2G4JA 1VB9A 3H2CA 4MFEA 5A6LA 1EBGA 1DL3A 1HJWA 4XUGA 4RCXA 3CZ8A 3GNDA 3VDGA 4UC5A 1IEQA 1I75A 1TSIA 3KXQA 4O18A 1QFEA 5LXEA 3AIWA 3EXSA 3QKZA 1K8CA 4Q3MA 5BU9A 1RJPA 3LV5A 1AZ2A 3BLEA 3G6MA 1H60A 2RJGA 1KTCA 2YCIX 3M0YA 1EXPA 1F9CA 4DQWA 2VX6A 2JFEX 3E9AA 3UG8A 3B9DA 4KKXA 1YEYA 2OZ8A 3WENA 3L66A 3E5BA 2W5FA 2GQ8A 3B8UA 1XP3A 1A0CA 4NUWA 2FQIA 2V0TA 3E12A 2O7SA 1JFHA 1U30A 7ODCA 1Q6OA 3RGTA 3MKVA 1ZFJA 4DBUA 3VILA 4CNOA 4RZ6A 1BWKA 4WJ8A 1JYNA 1EX5A 1SFJA 2A1YA 1IXOA 3TDFA 1H1ZA 4NKCA 4RR4A 3VFLA 1R8LA 2YB1A 3LG3A 1GHRA 4G7FA 5XIMA 3JR2A 3RCMA 4KCVA 4PFHA 2QAFA 3M47A 2PWHA 4NXKA 4BJHA 4ML4A 3DGBA 4B5SA 1W0MA 2BV9A 4US5D 1DYSA 3BXWA 1J0KA 4MGGA 3F2CA 3SZ8A 4GGHA 3UZ5A 3RMEA 3CWNA 1ELSA 2QCCA 4AG0A 2BVDA 2H90A 4DF0A 5BOEA 1W3KA 1V3KA 1W8GA 1J6PA 4QM1A 3NM3A 1LJYA 3QR1A 1K6WA 1PAMA 5AVHA 1VBGA 4HCLA 2BX7A 3R4IA 1T99A 4AY7A 3QHMA 1SSGA 2W3ZA 3CS2A 4L1GA 1XIMA 4MWAE 4LF1A 4L65A 3W7CA 5CJMA 3KWXA 3SCPA 3HGRA 3GY1A 3MYOA 4AVOA 4LVGA 4CU7A 4R5EA 3MSRA 2P53A 4RE3A 4KFPA 1KBLA 1QNOA 2GQAA 1GOWA 1IZKA 4AC1X 1VRXA 1TTIA 1EL3A 4RJEA 4UCFA 2ISWA 5CC6A 4KEUA 2XG9A 4C1KA 4FEZA 3VZYA 1ZALA 3FV9A 4AZCA 2GDUA 2PDGA 2C18A 3VU2A 4AIBA 4YTTA 2Y88A 1LQ0A 2OMAA 2VI0A 3P61A 5C9RA 5LSMA 4DYEA 3NQMA 3VKJA 3C2OA 3MSDA 1O60A 2HROA 3PB2A 1UR8A 1WXYA 3BWWA 4CD7A 2FIQA 4XZWA 5KZEA 2FTYA 1E1CB 3B0PA 1L8PA 1KGXA 3HPSA 4O4VA 1C8YA 2YXOA 1XBZA 5AHIA 3MUIA 2OYLA 1C93A 3BSGA 2VQTA 2X1UA 4C6DA 4YJ5A 2E4TA 3B8DA 4X0NA 2NX3A 3KRZA 3AS1A 3HTWA 1V6TA 4KW2A 4ATDA 4ZOEA 1YLVA 3CPGA 3UJ2A 2QDHA 2PF0A 4H7VA 4DWSD 4IMGA 5CC3A 4BS0A 2BDQA 3M0VA 1IR1A 4NYUA 5LNSA 3H70A 2ZRVA 5FF0A 1QASA 4IGNA 4J2PA 2VGIA 4NX5A 4IIEA 1UOZA 4D6FA 3VOIA 4HIBA 4ZTXA 3KE0A 4X9SA 1E0VA 2XZ9A 4WY0A 1OT1A 3PZUA 2VENA 3EB4A 4ZOAA 4GI8A 4MG4A 1CXEA 1OVDA 4JXCA 4LUTA 3A4XA 3D3FA 3FVMA 3H7UA 5DCBA 1FCQA 1Y65A 3VOHA 2RDTA 3AU6A 1GTEA 4GG9A 4ZR8A 3PPGA 3AAMA 3S9YA 1QNRA 3VNJA 2WMGA 5A8GA 3IIPA 1SW0A 4IFKB 1JZ8A 2J77A 2X16A 2H3BA 2WXDM 1S1RA 1TE6A 2PB1A 2ZZ6A 2Y24A 4C60A 3LPOA 1KR0A 2D24A 2IUZA 1PKMA 3KTSA 2VZVA 1LL6A 2PC8A 2VFFA 2PBGA 1JCTA 1UOKA 3EOLA 1NELA 2VC7A 4V33A 5CPTA 4PH6A 4O0KA 3K4AA 3H23A 1OX5A 3U5UA 2XSBA 2QF7A 4TQTA 3VZXA 3NPUA 1YTKA 1AVAA 3EWDA 3S9ZA 5LGXA 3CH0A 3TFXA 1OCNA 1FFRA 1T5AA 3WKZA 1CTNA 4V1YA 2Z2BA 5CAKA 2XWDA 4UNLA 4R9OA 5CH9A 1XFCA 3PWGA 3EWZA 2BXZA 2VR4A 3IJDA 3UETA 5BXRA 4D6EA 1G67A 4AHOA 1HKKA 1S5VA 1UBSA 2FPVA 4MLRA 3RX3A 1TPWA 2VMFA 4P5UA 2EHHA 3T6CA 4IIHA 2KX9A 3AYTA 2DUZA 3NO1A 3UWEA 2ZBTA 1DWFM 3QY6A 4MUZA 1XPYA 1C8QA 4D8LA 2CLHA 2PEVA 1VFMA 1B1YA 5TBOA 3NL3A 3DC8A 1L6GA 3VC6A 3VPLA 1PVNA 1D9EA 2ANUA 4QIUA 2NT1A 4GE8A 4CCZA 2ZFAA 5HQMA 2ZX9A 2GWGA 2H6RA 1BFNA 5CPQA 1BGGA 3FSUA 4UCGA 3CV6A 3MO4A 3UR5A 3IGHX 1BYBA 3EEZA 1E6PA 3R11A 2TSYA 1JXKA 3TJXA 5I24A 2PDWA 1JGIA 5F4WA 1TRDA 4CKQA 3GU2A 4LEFA 3DHDA 1UUQA 1QHZA 3IV3A 2OWWA 3SCVA 4V15A 1QJWA 2FHCA 4C7FA 2DEPA 1XYAA 2VZUA 1HFBA 3S6DA 4ZOCA 2WSQA 4Q33A 3W2KA 3G1RA 2JKPA 3UR8A 5CGMA 2VWTA 1SFSA 3LHVA 3ARYA 3CHDA 3LERA 3K46A 1ITXA 2EJ1A 3W83A 3MC5A 5HDRA 4TX6A 3L5AA 4I5RA 4LEQA 3PBGA 4GXWA 1OBAA 1OFEA 1UC5A 2A3AA 4LQ1A 4Z2IA 3UXKA 3F2DA 2CWXA 3D3AA 2ZUTA 1TYGA 3IV8A 5D33A 1DQUA 1EFZA 4EWND 3V0SA 2QMJA 2QDDA 1AFSA 1ZRQA 5I2UA 4PN2A 3QMTA 1H5YA 4UNIA 4J2MA 5JXQA 5AHEA 3GNPA 1FWJC 4R9XA 1E4IA 3NTYA 5K9DA 3UERA 4KERA 3OEXA 2QCDA 2HPIA 4IG2A 3U7VA 2YDQA 3NZRA 4J3ZA 3O6CA 1LLZA 2NXIA 1RJQA 4O50A 3WQ5A 1B5TA 4R53A 3WFZA 1IT0A 2INZA 3GHRA 4ZOBA 3QKEA 4QLJA 4XVEA 4P7RA 4XAPA 2F61A 2CW6A 5C2CA 5DANA 4JTHA 3B9EA 2R8WA 4FXRA 2CLPA 1EQCA 2V82A 1QI4A 1UR1A 3AYRA 4QXIA 2QR6A 1KCZA 5I03A 3TCSA 3N2OA 1TQJA 1G7UA 1I2OA 1E72M 4AWEA 2VGFA 4YHEA 1OG6A 4Y6GA 1J0HA 3R13A 3KS5A 2P8CA 2POZA 1UZDA 2GVGA 2EG7A 1W1B1 4YNGA 3E2QA 3MTWA 1L6FA 4IM4A 2XIIA 2J7GA 3OLGA 1B4KA 1IZJA 2D2GA 2BOFX 3G1DA 1OC6A 3HGSA 4KCUA 2OFJA 4DM2A 2DDXA 2F38A 1CGYA 2HRWA 1SZFA 3IVSA 5C9WA 3PZGA 1H7PA 2ZZ3A 4AB4A 3SADA 3WDJA 3ZT6A 4ORIA 5JVLA 4U5IA 3UNTA 1VHCA 3AYVA 4HHLA 3QMSA 3KLKA 3A12A 3GTXA 1KFCA 3OLEA 1P1XA 4CQBA 3D6NA 1QT1A 3KCJA 4D6JA 2QAPA 1XC4A 4DPPA 4E3VA 3LRKA 3GHUA 1KGUA 2J7FA 4LUTB 1P6CA 1O95A 1EJRC 1PX4A 3VZZA 4CQDA 2WVVA 2FVKA 4HKPA 4QTGA 2O92A 3BW2A 4PUKA 1VP5A 1KM3A 4FR1A 5MHBA 4JTSA 4LYRA 4CN1A 1TWDA 2PP0A 3ONCA 1XUUA 3VINA 3U48A 2VFGA 5B7YA 2E9MA 3DG6A 1VFTA 2FFCA 4FI4A 2V3DA 3VVGA 2X41A 5GQBA 5TAOA 2D1ZA 1QNQA 1KWKA 1XLDA 2EEXA 5D9OA 3H2FA 3G0UA 4LCQA 3WELA 5I79A 3KUMA 3CTLA 3DFSA 3GU1A 2RGLA 4HNOA 4UFIA 3O7UA 3V7PA 1V6UA 1RQEA 4HSOA 3EOEA 3UPWA 1YNQA 3WEOA 3ZO9A 4D6DA 3TQVA 4KETA 3QC3A 3CAKA 3OGSA 1KM6A 1ZENA 4IT1A 3P80A 1XDJA 3GUWA 3PTQA 4Q8PA 1E9IA 3PZVA 1ONWA 3C3UA 2INEA 3GVVA 5BROA 4W8BA 1UYQA 1OCJA 3AROA 3CO8A 4GCAA 2YL9A 3MI2A 1J0YA 2GQ9A 3GVWA 4OT7A 3HA1A 4C1NB 4HJFA 2X09A 3B8WA 1HIZA 4RZ4A 4Z2LA 3S9IA 5I3GA 1HJUA 3NQFA 3ZYZA 5HOSA 1YPFA 5HMFA 3BICA 3W84A 2E77A 1RLCL 1FRBA 2ALRA 8RUCA 1ZHAA 5CZSA 3WBAA 4KRZA 2WJFA 4GBDA 3BGAA 1A5NC 2VR2A 1E0TA 1FWIC 3TW9A 5E9XA 5JBDA 4J3XA 3KZSA 3D0CA 2R24A 1JUBA 4PFMA 3FIGA 2A7NA 3T42A 1F8MA 1L0PA 3QQWA 1DJQA 2E9BA 1AK5A 2VELA 3UGVA 1DWJM 3B0XA 1GW1A 3NGJA 1XGDA 1MDLA 4NSBA 1XIHA 3S47A 1QXLA 4X0VA 5G5IA 3SURA 4DI8A 4JIIX 3BZGA 4C1LA 1ZAJA 3GTNA 3S6OA 1REQA 4PUMA 4EF8A 3GDRA 3T1GA 3V0TA 3NYZA 3T7VA 1IXNA 4TXEA 3WNPA 4NNCA 2GQ3A 3A9BA 3SN1A 2YDRA 3GR8A 5EBUA 1N55A 1H0GA 3WMBA 1I2QA 2QCEA 3WUGA 1RPXA 3NA8A 1K9FA 2FZ8A 1FWSA 3KAOA 3FW6A 4QQUA 4G8TA 3ISIX 2PCQA 4K7YA 3G8RA 4GRSA 5FF4A 1TMLA 3C61A 1ADOA 5LZLA 1EWDA 1W32A 1XS2A 3OZOA 1JIBA 4YXGA 4O1FA 3G1FA 4XZMX 1Q13A 5BU6A 2E3ZA 4XAGA 2NQ5A 4AMCA 4RNIA 2V67A 2Y89A 2VEGA 2XFWA 1DP0A 2EPKX 3B97A 3GIPA 5FJPA 2NV9A 4XD4A 1X1ZA 2X2YA 4FLOA 3LZ5A 3R0KA 1CDGA 1TWSA 3HFYA 4KWOA 4MTVA 2R6OA 4UTLA 4UQEA 1N7KA 1TX2A 1A3WA 2YL8A 1XDLA 2CLIA 1GKQA 5AFDA 4IXHA 4X3ZA 1UQZA 2X1TA 2ZVIA 1ZTVA 2GVEA 2Z6JA 5DRCA 3T07A 4G5DA 4S2BA 3TUUA 2CZEA 2FZDA 3ARTA 4GABA 2YW4A 3LXBA 3IJ9A 3TYUA 3B9NA 4Y96A 2UY5A 2X7VA 3FDKA 1YXDA 2JBMA 2PDIA 4OOZA 3Q58A 2VCAA 5C9ZA 5HNTA 1UH4A 4HK5A 1E9YB 4F9JA 3GX9A 5PTDA 3H2MA 4LRTA 3R79A 4EACA 4NZ5A 4JNYA 3V35A 3WN6A 4KWWA 3VNDA 2HK1A 4LVFA 1OABA 4C7DA 3UR2A 1E5JA 3W86A 3LQGA 1WYIA 1AD4A 4PL1A 4AMAA 1YDOA 1CXIA 2WMIB 1FWRA 4PC8A 3LTPA 1DIKA 3NO5A 3PG9A 4IMFA 3QOMA 1W3HA 1C8VA 4W85A 5CC7A 2SFPA 4ENLA 3GS6A 1EJ7L 1U5HA 3STGA 1IEXA 1IV8A 1V7YA 1NP0A 1BG4A 1MRAA 3TX9A 3W2MA 1HNYA 3NZQA 1W1TA 2P88A 1NOWA 3G1AA 3AIBA 4DWSC 1P0DA 4H9XA 3ALFA 1LDCA 5C6MA 2ZRZA 3AICA 5IDZA 3GZ3A 6ENLA 2A85A 4C6PA 1OCQA 1KFKA 3UPMA 2BS9A 3EWCA 3VIKA 1J0JA 3WMCA 1P4CA 1RQBA 4QG8A 1GJWA 1M7PA 1CZ1A 1E73M 3VDAA 4F0LA 3VKDA 1UHVA 3CZLA 3LTSA 1UKTA 4XUYA 1P6WA 5FI8A 2PZ0A 4EOUA 3N29A 4NQ1A 3H54A 4KWVA 1K4GA 2VD9A 1JDCA 4HNLA 3VK5A 4LS2A 2C71A 3MMDA 1D8CA 4UOJA 2A7PA 4ZB2A 4F2BA 1UD6A 1CXLA 5KEZA 2VX5A 1NF7A 3BJSA 1B31A 4QG6A 5M2FX 3II1A 1NOUA 4MNMA 1E3XA 1XKYA 2ZUWA 3PJXA 1RHCA 2NQHA 3BAWA 3SGZA 3N2CA 3TTQA 2XM2A 3LPGA 2PURA 4LYPA 3B8VA 2NQ9A 3CAQA 4FOUA 3GW0A 2C7FA 4WXYA 1CB7B 4JQ2A 3WF1A 3MB9A 4ML9A 3WLSA 1GYNA 2D0GA 2FDSA 2PDMA 1GQIA 2VHLA 1I2NA 2EKCA 5L9FA 3PTMA 3P93A 3GDKA 1EIXA 1QI0A 4JYEA 1KFJA 1MDRA 1ADSA 1U33A 1ADDA 4K8GA 2NUWA 5F2MA 1N82A 1KCXA 4GZJA 1WZLA 4HA4A 1BQCA 4K68A 2E09A 3KOZA 2GSHA 4ECLA 2HVOA 1NF0A 1TPB1 3TN5A 4JY9A 1J10A 1RP9A 3PP7A 1GONA 4MOZA 2H9AA 2NVCA 4HHMA 1XQKA 2NZLA 3IK2A 5KMYA 3ID7A 5FJOA 4GJ1A 4QDMA 1A5BA 4PMQA 3GIQA 4EANA 3GAYA 4JQ3A 4RXFA 2W27A 1TUXA 3UYCA 3EZ4A 2CKSA 3C0LA 4W93A 1UIPA 1XLEA 1G69A 4JGDA 4F0SA 3CQHA 4PMUA 2AAMA 3DFYA 3APTA 5HUOA 3KBWA 1Z44A 2HQAA 4MDOA 1PIGA 1A5MC 2EPNA 5HJXA 5CAHA 2ABAA 2PS2A 4RDYA 1A5SA 4E38A 4IHCA 5I5RA 2XWEA 5T9BG 1GT8A 3WQEA 2OZTA 4DJEC 1SO5A 2IW0A 4NASA 2FJUB 4NZ3A 3DH7A 4MUPA 2R1PA 4XZ9A 3LNMA 3TLQA 1TIMA 4UNKA 1MQRA 4AH7A 1UH3A 5A6BA 3V1HA 3P7YA 3QQ1A 3CUZA 2CBUA 1GVSA 3WQOA 5EY5A 5EMYA 5HWJA 2HS6A 2Z24A 1R9XA 2FVLA 5LNVA 1L2QA 4RXGA 4I5UA 1POKA 3QR3A 3EWBX 2MANA 3CO4A 3OGVA 2QS8A 1RD5A 4H19A 4GUHA 1ONRA 1QNVA 4L1XA 3PBWA 1J96A 4GZ7A 2X30A 4DJDD 2EPOA 1TTQA 1ZNNA 4ZEPA 3DN5A 2OOFA 1HJSA 4WD0A 3I6RA 1HL8A 2ZX5A 1RZMA 4D6GA 2XVLA 2D0FA 1P1MA 2ZICA 1QMLA 2DJLA 3SRHA 2G8ZA 3FXGA 2VGBA 1V51A 5C0QA 2DSZA 1NJJA 4YN5A 2WKJA 3S5NA 1WDQA 3NOYA 1YQ2A 4PTVA 2OQLA 4GCXA 3GG0A 2JGQA 3NQ2A 3DYMA 4U3AA 3GDMA 1X39A 5IFPA 4EPDC 4O4WA 3WD1A 5H8PA 1I2RA 2JALA 2FTPA 3CQKA 3W37A 1AJ2A 1CGTA 1JZ6A 3E5PA 1LLOA 3PZNA 5EMLA 1F6KA 2VEFA 2HVMA 1XSIA 1H2JA 1IWAA 1GEQA 2QJHA 1HGYA 4H4IA 1OEPA 1XRFA 4KFNA 1WPCA 1GOMA 1NOFA 1OY0A 1TJ1A 3VA8A 4JHZA 2L5HA 1HW6A 3FEMA 4UZSA 5BXPA 1QPRA 4JFSA 3K8LA 4DZHA 2AAAA 4GKTA 1XH1A 3QPZA 3GO2A 3DYPA 3FJNA 4MF4A 4IX0A 1UKOA 3T9PA 3BCJA 3UXLA 3QR0A 3RLVA 4PULA 3EXTA 2ZADA 4U5KA 4N6EA 1N2VA 1WE5A 4JL1A 3GC4A 3R0DA 4O1AA 3W07A 3TVAA 1O5XA 3BLLA 4LTSA 3Q65A 1F5ZA 1GOOA 3FDGA 2OB3A 3CMJA 1W5OA 1LOQA 1Y5VA 1KQYA 3QY8A 1XIBA 1T96A 3RG6A 1GVFA 4UMCA 4XKYB 2PF8A 2Y8UA 2P1FA 1SZGA 5KITA 2VP8A 2Z1WA 1R3VA 3PZTA 5F4XA 5M5DA 4MNLA 4M1BA 4XBSA 4TTUA 3RO6A 4LNCA 2ZC8A 3W1QA 3P3BA 5FF3A 2PLMA 5DRIA 3IUHA 3UJRA 4POCA 4O14A 5DQPA 2GVYA 2YYTA 3T8QA 3OODA 3UW6A 1JDEA 3U3HA 4B5TA 1B9ZA 1EZWA 4PZVA 2ZX7A 1BHGA 1TX0A 4QG9A 4QCEA 2DIJA 3VNIA 5IOBA 1V0LA 2ZQ0A 1W5PA 1S5TA 3N6QA 5F2LA 4MNJA 2GPTA 3QV8A 4BF9A 4AHPA 5GJNA 1DWGM 3G0SA 4QJ5B 1YTDA 3B0YA 1VFLA 4JFUA 3ZZ1A 3TE9A 3W02A 4RX0A 1QCWA 1TV5A 3T4CA 1ZGDA 3WX7A 4DN1A 4R27A 4A05A 4XB3A 1JVNA 2OX1A 2PU1A 2VCCA 2W67A 1S3TC 4ZXLA 2PWDA 1W9VA 1VCGA 2G95A 1SR9A 3EKLA 4J3TA 2W62A 5KETA 1PPIA 2I7GA 3SY1A 3RR1A 3T0DA 1DQXA 3G3DA 3VCRA 1TCDA 1PX8A 1CECA 4M19A 3FVDA 3F2BA 1A5KC 2XUCA 4GGBA 5GVJA 4B92A 3LPPA 3TIMA 1M1BA 5CSUA 1EPVA 2J7DA 4XKMA 2QJJA 4FHAA 1DXFA 1E6QM 2YYUA 1UKQA 3EBVA 2QJGA 2FH6A 5JH1A 3M0MA 1HGWA 3BDKA 4C7GA 1TKKA 3G8EA 4O1EA 4PSPA 5BXTA 4HGXA 4H6EA 5I78A 1VLIA 5A6JA 2YPIA 2V3EA 6REQA 3E0FA 3TC3A 2BWGA 3BOFA 4CEXC 3G1YA 4MWAB 1TV4A 2BHUA 1LG2A 3G1SA 4S3BA 2OEKA 3AISA 4QSFA 1KC7A 3VNZA 3RX2A 5C9UA 1OFOA 4N9CA 3QEZA 1DBTA 2A2IA 2CEQA 3EB3A 1XH2A 2WNZA 4Z0JA 4GYPC 2A3EA 3ARQA 1TV8A 2XVPA 3REQA 2PGRA 3OYXA 3WH6A 1F73A 3W7LA 1A3XA 2HTMA 4RE0A 4U31A 2GDQA 4O54A 1FTXA 1GQJA 4KEVA 2OGYA 4KWUA 1S1PA 2Z00A 2EPHA 4AIEA 4WOQA 1EOMA 2FZNA 1NY1A 8CGTA 2HV5A 1Q8JA 4XD3A 1XYZA 4WR3A 1A50A 5T91A 4LCSA 2XM1A 1EX1A 3GXDA 1KFBA 4FSAA 1TQXA 2ZWZA 2FTWA 4GINA 1E5NA 3ITLA 4CNSA 4IH3A 5JBFA 5I06A 4NJGA 4EPKA 5HANA 4HPHA 4HD5A 4DWSB 4M6PA 1ODUA 1DJYA 1G4PA 4XSMA 1UPPA 3P74A 1LBFA 3ZLFA 2FDMA 3RM9A 1TMHA 3MMWA 1QOPA 3PHAA 5F1UA 2NUXA 4G7EA 3WEMA 3V16A 4JL2A 3BTNA 4XVDA 4AZ7A 2QV5A 1RQHA 3QHOA 2ACSA 2VX4A 2V81A 1Z8AA 3PBUA 3CWHA 1F3XA 5TF0A 4R33A 4P7OA 3G1VA 4IOTA 3VIGA 4MJZA 1DE6A 5GPRA 4UOZA 4H9UA 2C0AA 3L65A 4YVVA 2YZ5A 4UWMA 2PLJA 5E70A 2BHYA 3VKCA 3W53A 1UQYA 5A2CA 2UY2A 3C3NA 3SFKA 4L4OA 3N18A 3O8AA 3UJFA 4UTWC 1UWUA 3L4UA 1A0EA 3SSZA 2W91A 1TA3A 2PTYA 2AQWA 3ZVHA 4YHGA 3T81A 1GVYA 3AMGA 4LUJA 2W6RA 4R7OA 3MV01 4WDUA 4ZGYA 3V36A 3CMFA 3IIXA 4E4PA 3E2VA 3REQB 3ATZA 3VIPA 3DFTA 3W7QA 1JUKA 3TLLA 1H3GA 4JDBA 1NDVA 1IGWA 5I3IA 4FB7A 1XXXA 3TTOA 3QSRA 5CEWA 5CBBA 4E3TA 2F8QA 3QGAC 4PBGA 2VX7A 3CM4A 1RVKA 3CZJA 4W7WA 3A5FA 5A6MA 3IAQA 3W3OA 5DLCA 3W1LA 5J5DA 4LAZA 3B40A 5B80A 1XIDA 1PDYA 4BQ5A 3CPRA 3PBMA 3VGHA 4IJRA 3V4BA 4PEKA 4PE8A 1W17A 4DBSA 2WNWA 1UCWA 3RUBL 3CH9A 2QXWA 4FF5A 3BV4A 1VPXA 3EWUA 3BAIA 1Q6FA 1Y5XA 3EPOA 4IG2B 4U28A 2Y7GA 4NL1A 1EYEA 2P0OA 3NL5A 2YJQA 5I3DA 1HX0A 1Y5WA 1UR0A 3GNOA 3T0BA 2GGIA 2PDHA 4Q8VA 3BW4A 4DBEA 3N11A 4UQBA 1WAUA 4NRSA 5AYIA 2OQHA 2J4GA 2CLOA 3TYDA 1EB3A 4DJFD 1OFQA 1QPKA 3HZ3A 3PPHA 3S2JA 1VEOA 2NXGA 1W91A 3E49A 1HN1A 1NM9A 4MIMA 1XICA 4PYSA 2B7NA 5AYBA 3M46A 5A6AA 1PWLA 3BLFA 1TWZA 3L67A 1DXEA 2Y63A 4CGTA 2NVDA 3NQBA 2PWGA 3LMZA 4RNJA 5A5WA 4BF5A 4QE1A 1V7AA 1LUCB 1GCYA 4Y2WA 3BVJA 5LYRA 1JFXA 3WD0A 4XX6A 3HQNA 1ZCCA 5K4ZA 4WK9A 3OP2A 1TREA 2GGGA 1V3MA 5CG0A 3GSMA 2V5KA 1KRBC 4ZO9A 5HUPA 2A3BA 4F0MA 2ZZ4A 4I90A 1KRAC 3ARUA 3O6YX 4DB7A 5B7ZA 3TJ4A 3ZJ7A 1M7OA 1XSJA 2PDFA 5U7SA 3PWIA 4PRWA 2VVNA 2QYGA 4H3DA 1BEUA 2AQOA 3QV7A 2YX0A 1Q6EA 1UZ1A 3QXBA 3DFOA 1XLHA 1VZWA 3M5VA 3M7SA 5AVNA 4NP7A 3A21A 3HB9A 4OFCA 2RHGA 3R2GA 2VEKA 3IARA 1WZMA 3WLRA 3I6EA 1YNYA 4HYVA 3ZIZA 3ZMRA 2UBPC 2QIIA 3MSGA 4YS1A 2ATMA 1BWLA 4AC7C 4M3PA 1XYBA 2PLKA 3URQA 4E2VA 3W7OA 4UQAA 1F6PA 2O9PA 3O6DA 2HXTA 2E5BA 5FSDC 4Y8FA 2Z26A 3A64A 1UZ4A 1ICSA 4MNKA 3O2LA 4LU0A 3CL8A 1XIJA 6XIAA 3R0UA 4JIPA 5KINA 4ATLA 3SQSA 3H26A 2J75A 3K4DA 3SB0A 3OGRA 6TAAA 2XJ7A 2GSEA 1W3LA 3IJ6A 3GDBA 4Y8EA 1A3HA 5BOFA 3ERPA 7CGTA 4JTDA 3DENA 5KZ6A 5FOOA 3P81A 3AHTA 4C5ZA 1KFLA 3FX4A 1RCXB 3VGFA 1V79A 1EP1A 2VR5A 2BOEX 3A13A 3MWCA 2I16A 3N2XA 4MB3A 4MY8A 3H8AA 2HBVA 3RX4A 4C90A 4HU8A 3DXIA 1UP0A 3WNOA 3WDPP 4GJJA 1K6AA 2QCMA 4F9DA 2QCDB 4W7VA 2Y62A 2A0NA 4ADTA 3MJMA 4XIMA 4XKYA 1XHGA 1J6OA 4DPQA 3WUBA 1HVQA 3ARZA 3DCPA 2IPWA 1JYWA 4HPXA 4NHVA 1CGVA 4BR1A 1OF6A 1EH9A 2QCFA 4UTTC 4UMAA 5AC6A 2Q71A 3HG3A 1K8ZA 1MQPA 2XSXA 3L2MA 5G2IA 3R10A 4FNSA 1U2YA 1PJ9A 3JW7A 4Q8WA 2VTFA 4H41A 4GACA 4DO6A 1QDSA 2WJDA 2ZCGA 3PJTA 5A8MA 2WVTA 2FGLA 4S3DA 3KOYA 4NZCA 5EB8A 2W9MA 4C1NA 1E9LA 2ZRUA 1KRCC 2POTA 5KSWA 3UT0A 4IJBA 2HE5A 2ONEA 2WBKA 3B03A 3W25A 4O28A 2YDAA 2DSUA 4Q7BA 4CQAA 5CQ1A 1VFOA 2GK1A 1B3VA 2PI6A 4R34A 1JZ7A 1E6NA 5C71A 3AIVA 4HHPA 3O9NA 2DSKA 5IXEA 2ESCA 4MHBA 1RK5A 3QZ6A 2O9RA 3PVFA 1GW9A 3KOFA 2CBVA 4AZGA 3AUJA 4PCPA 3C52A 2FB3A 3LV6A 1CB2A 5HULA 2VEIA 3MUY1 4OVXA 2WHLA 4GYJA 4KFOA 2Y85A 2YOCA 2CLEA 2NV2A 5H8MA 1VYSX 3KHJA 5LNUA 2V5BA 5A8QA 1RD6A 2EPLX 1J2WA 7REQA 4IJCA 2EKGA 3WJSA 2DIKA 4ICCX 1KGWA 1DJXA 4PSRA 1UD3A 4B4FA 4AD5A 3VUPA 5JU6A 3U5YA 4TIMA 2RJHA 3A47A 2DIEA 4D2JA 3AS0A 2Z7KA 3WDIA 4A3UA 1EA0A 1KM2A 3NQ8A 2ZA3A 1EPXA 5D9MA 4N9EA 1KR1A 1PKNA 3NEHA 1X1NA 4O1BA 4QAIA 4S3CA 4OBRA 2V5DA 4JFTA 1UPMB 1P0NA 1R2RA 3C2YA 5FSEC 1Z32X 3H7RA 3RPTA 4JQAA 2O4QA 3AS3A 3AHXA 2E5CA 3THCA 2WJEA 3RHGA 1J79A 5A8NA 1OYAA 1J2BA 4OJYA 3UZJA 3KBJA 2NLYA 4GQRA 3UJEA 4I7UA 4WGXA 3WDQA 4E0CA 3SSJA 4K8EA 1ECQA 2CXEA 2XZ7A 3KDNA 1K02A 1UP2A 1FHLA 3VMOA 4JN6A 4JTTA 2QW5A 1VYRA 3M0LA 3W22A 2OLHA 3NQGA 4RLIA 4HZ6A 2GUUA 1HZYA 3AYSA 1YPXA 2PWVA 3GB6A 4IFRA 4CNNA 3RDKA 5D38A 5CPSA 3QSTA 4LBRA 1JDAA 3PZIA 4DLMA 4GKLA 4GI4A 1NFPA 2E28A 3W6MA 4QE4A 3VGGA 3LYEA 4RW5A 1V6XA 1B2YA 2EPMX 1JCNA 5CPMA 4OV4A 3O05A 1ZLPA 4RZBA 2NX1A 5HNUA 1BWVA 3VGDA 1M7JA 2C19A 4ROPA 2I5QA 4S3JA 2VEMA 3LZ3A 1GHSA 1JULA 3LHWA 1T41A 1SJDA 3S8HA 2RFGA 4D6CA 4RV3A 1BSIA 3VGBA 3WLPA 4BKNA 4IX2A 4QEHA 1QOXA 1AW1A 3BO9A 3Q67A 4J27A 3S5OA 1UMLA 2QCLA 3GXMA 1UKPA 4JYDA 4S1FA 5HPOA 2ODOA 4O19A 3EYPA 3FA4A 1HT6A 2UV8G 3BQ6A 4Y9MA 1M3UA 1I1XA 3ZQ9A 1WP6A 3H12A 1Q66A 4QJ3B 4URIA 4Z1BA 1QPQA 3CC1A 2J8GA 1IE7C 6ALDA 1MEIA 4I7WA 2YDSA 3VYLA 3MY9A 3WDRA 3B9OA 4DYJA 1JYXA 4C6MA 2QLYA 1KRMA 1V02A 4H9MA 3IPWA 5TQLA 1LRTA 2DW7A 1POJA 1JZ2A 4GXMA 3GVGA 3H24A 3C0SA 5D4YA 4ADSA 3SGUA 3QBUA 1MW2A 2WJZA 1W31A 4KIEA 3EPNA 3FKKA 3W24A 2QCGA 3AMCA 1RV8A 1TPDA 3TYZA 2PD5A 4CU8A 2NQJA 4P8XA 2OEJA 3PNZA 3VKKA 2BVWA 3GK0A 4XV0A 4BCEA 2I56A 3S1UA 4YYCA 4AZIA 1QW9A 1W56A 1JNEA 1EKOA 2ZXDA 3G1XA 2D2HA 3DFNA 2PDCA 1PHQA 2WMHA 4K39A 3ABQA 2OYMA 1WUEA 2BY1A 4Q8OA 1Q4WA 1JG9A 3WQDA 3UF9A 4Z42C 2DSVA 5TIMA 3K30A 1JDFA 1UW9A 1NWUA 4LWWA 3QLLA 5D8WA 3QM3A 5HAOA 4B4HA 5DN1A 2ZX8A 1OGSA 2OSWA 3UWZA 4QFUA 3UVAA 1XRSA 5A6BD 2AL1A 3W7KA 2CBJA 3N6JA 1NH6A 3BURA 2O9TA 3RR4A 5CPNA 1PZ0A 3JU2A 4D72A 1X1OA 3DX5A 1VBJA 3PC0A 1R3QA 1VFUA 2KZHA 1BYDA 1WBHA 1US0A 3HJEA 1CGUA 4W7UA 1QPOA 1S2CA 1J0ZA 1HTIA 4DWSA 4F40A 4H6KA 2BODX 2YBTA 1S2WA 1AH3A 3EGJA 3MP5A 1DVJA 4Q7NA 1EDQA 4X9YA 4ONVA 2XN2A 3WLQA 2PWEA 4CNTA 2Q3RA 1UZHA 1S39A 2F6XA 3SY8A 2I1OA 5LXXA 3PG8A 1RA5A 3P0XA 1AH4A 3P67A 4HP5A 4HJWA 1VAHA 1KXTA 2YA2A 2NLIA 4ASTA 3PJWA 2WSYA 3KWSA 1JAKA 1HP4A 4DO5A 4LYKA 1TPUA 3S1VA 3PBVA 4DZAA 3RU6A 5I3HA 1OX4A 4OU1A 1ZJHA 1UROA 4PGLA 2DJXA 1OQFA 3MANA 4H04A 3W1XA 3WLOA 3AFBA 4LRSA 3PAJA 1SUXA 3OBAA 3S6TA 3L4VA 2VKZG 3GDLA 8A3HA 1VPYA 5EPDA 2X1SA 4GX9A 2DT2A 4PB5A 1WDRA 3M0IA 2WZHA 4H83A 2OX4A 4I3GA 5DMMA 4NZFA 1CWYA 1QOQA 3UZZA 4I6KA 3SECA 1P43A 1JZ5A 2IQDA 4GY1A 4PB4A 3L4XA 3ZR4A 1B90A 1XV8A 2CLMA 4GQQA 4IGSA 1QRQA 4GY0A 4QLLA 1BGAA 2VXNA 4K1GA 1JI1A 4A8LA 2W66A 1LRQA 4K36A 4IL2A 3ARRA 1BD0A 2HSAA 2LLEA 3CK5A 4BEQA 1XM3A 1PKYA 1MO0A 5BCAA 4RPPA 4C6KA 1T40A 1UASA 3EPMA 4IMDA 1Q6RA 3WYZA 3STCA 1B3WA 2V5JA 1JGMA 1MW3A 2CESA 4DF1A 1R38A 3BV7A 2QF8A 4BY3A 3F4NA 2PFHA 3U2ZA 2WMIA 4ZQOA 2R94A 3NXFA 1XD1A 5DX7A 3WQWA 1G5AA 1AMYA 3HQPA 3NZPA 1FH7A 4I9JA 3WQFA 2XYLA 1BTMA 1CI1A 1MFVA 4QLKA 4CD6A 4ALDA 1BSLA 2P0IA 4W8LA 1GOIA 1OGGA 2WHJA 4F4RA 2Y1HA 4F0HA 1FWEC 1MMFA 2FJKA 1U5JA 4P7QA 3EDJA 3C0QA 4TO8A 4H8VA 3HURA 2X1IA 2B31A 3CB3A 1NFGA 4LGXA 1EYWA 1V08A 5FL0A 2W0UA 1AMKA 4MPQA 4AY1A 2IKGA 5E0FA 2DU2A 1FCBA 2DH3A 1H61A 2YCEA 4LY4A 1O1ZA 3I3BA 1UWSA 4MAZA 1D3CA 2YB4A 3B8SA 4QHRA 1DWHM 2JQXA 1X8FA 1KBKA 1GYMA 4HMCA 3IGSA 4CU6A 3KP1A 3UD6A 1YXCA 4H9ZA 4KMQA 5IBXA 2P8BA 2G3IA 2V68A 8TIMA 4LYQA 5HJLA 1F3TA 5HK4A 4S3FA 1KKOA 4Q8NA 4EXAA 3W6YA 1TVLA 4ZB0A 4NILA 4IXXA 1P5BA 3OVQA 5FA5A 3HPFA 3QHNA 1XYFA 3TOPA 2REQA 1SZEA 3U6WA 1VENA 3NSMA 3AIQA 4RL3A 1LT7A 4ILSA 5D8ZA 2F2KA 3GNRA 1KM5A 1GJUA 1L2UA 1U1JA 1ZQ5A 1UB3A 4V2XA 3TC6A 3THQA 2XVGA 4JTLA 3F4CA 1E0UA 1VIWA 2ATSA 2GK1B 3PFMA 2EF9A 2Z1VA 3B05A 1Q4NX 4GI6A 2BGNE 2BXYA 3PULA 4A22A 5E0CA 1ZJIA 3MP4A 6XIMA 4LOCA 4YCOA 4LAOA 4LH8A 4NJHA 4EVZA 2W4XA 4U3CA 3ABZA 2YL5A 2WKGA 2XH4A 5A1AA 1G94A 3GH7A 3NQEA 3VDCA 1WQ5A 4C6OA 2WMKA 4PMXA 4B90A 1PWMA 2XDFA 2XVKA 4O0QA 3TFCA 3LMYA 4ATWA 2ISFA 4LV9A 3NUKA 1SW3A 1O12A 4ZL1A 1RY8A 1RBLA 2Y5JA 1I0DA 3PM6A 4H01A 3V0UA 4ACYA 4B5VA 2VOMA 1EHAA 2J7BA 5FD0A 4O13A 4D6HA 4P2VA 4EF9A 3CYJA 4AZCB 4UQCA 1XYCA 3PJUA 1PZ2A 1LBMA 3F7JA 2OO6A 1Z42A 2WAGA 3CAWA 3J7HA 4JTEA 1F7BA 2BVYA 3N13A 1QHPA 1REQB 4IIBA 3AMKA 2DZAA 4OKDA 5CSYA 1WOBA 2IXUA 5IFTA 3L12A 1IZCA 5DXYA 4JKKA 4C5YA 3C8FA 5CPLA 1R3YA 1H62A 4JEQA 1HJXA 4E5TA 4ZQCA 3F4WA 1OSEA 1ZP4A 1KB3A 3MHGA 4I5XA 1WXJA 4NIRA 4G1KA 4FK9A 1ISVA 4E6MA 3MYPA 4UFLA 3EDKA 1JXJA 1WUFA 3TEVA 4WSKA 4PTDA 3ZJ8A 3DIPA 3MVIA 4IICA 4MM1A 1SMAA 3FAWA 2PU0A 3KTXA 1G7VA 1UUMA 3MUXA 1LROA 4CQ8A 2QHAA 4HN4A 3TTSA 2OWXA 3M0ZA 3OIHA 3W7DA 1OZQA 1XIEA 4UFJA 3W1UA 2B81A 4EIVA 3UYIA 3WFAA 3DERA 1XGEA 3VMPA 2EG8A 4KS0A 3GHTA 3PZOA 3TJLA 3TN3A 4YYFA 4M5PA 2VJXA 1ODZA 7PTDA 2G37A 1C91A 1DJNA 1YADA 2VEPA 2ZX6A 1JUEA 4JX6A 1RCOB 4TVUA 4FNQA 1GG1A 1TFVA 2DW6A 4HK7A 1WNOA 4JNMA 5A94A 1BG9A 1X6LA 4GQGA 4ACZA 5D9NA 3BC9A 3R12A 2DV0A 1QTWA 1EIBA 3RLUA 1AUSL 2GJXA 1ZBVA 1YBQA 3BL3A 1V4YA 5LNRA 4Z17A 3MUZ1 4CQ9A 3BOLA 4BHYA 3NQ6A 3WNKA 1VS1A 3E3HA 1HKWA 4E8CA 1TPFA 4K3ZA 1F2JA 3ZT5A 3PFRA 1X98A 1FBAA 3FNDA 4WIWA 1S2UA 3GXTA 4OV9A 1XWYA 1V02E 3MS8A 2XFYA 2D22A 4FZIA 2CWNA 1U1HA 3NPWA 4GIAA 4GIYA 4QROA 4KGJA 5G1TA 1UWIA 4KCTA 3G5EA 5H1WA 2ACRA 2FPTA 1IWBA 1LL7A 3UU0A 3W7GA 1E43A 2YBVA 4F48A 2X40A 4OE7A 1GVQA 2OPJA 5FKYA 3RAOA 1SR0A 3OJGA 4YLWA 5ENLA 3GFZA 4PBEA 4C6QA 3LI1A 4QX4A 3QV9A 1GVOA 2E1WA 3GWQA 3BSHA 4GVIA 4MWAD 2ZYFA 1V6YA 3AXMA 3VMNA 1R30A 2QGHA 1XF0A 1PZ3A 3LEPA 1WB0A 4NAEB 4Y9NA 3RM8A 2TYSA 3LDVA 3BJFA 1GQNA 4CVWA 3L7RA 3THUA 3ZT7A 2J8TA 4FXFA 1FCUA 3VOJA 5CLTA 4KT2A 4MZ8A 2NSOA 3ZLGA 3L0GA 3R5EA 1W3JA 5EGRA 1D7KA 1WDPA 4GA8A 2WLYA 1GVIA 1UBPC 2WMJA 2QV4A 3OA5A 4QBXA 2I9EA 3W73A 2QGYA 4MB1A 1OG0A 1FP8A 3PZ9A 1IXQA 3K1GA 3KZPA 4JN7A 3JS3A 3LBCA 3KHDA 4YVXA 5AHFA 4HNUA 3SN0A 2R82A 3WH5A 1QHOA 4JIRA 3PTKA 4DO4A 4J3SA 3NFUA 2XTKA 1XLGA 2J7EA 3W82A 4AD3A 1GK8A 2XSAA 3WD3A 3AZRA 1WDWA 5HATA 3MWAA 1ML1A 1HL2A 4AYSA 3IAPA 2WZIA 3JVAA 1KLYA 4UB9A 3VC5A 4O1CA 1NVMA 3TWBA 4H7CA 3ZXWA 4I7VA 2XH7A 3GQYA 1HF6A 3WQGA 2PDPA 5JUVA 1PIIA 2GZXA 2J24A 2TRSA 2OTDA 4JHMA 4M82A 2CZVA 3CUJA 2Z4GA 1ZUAX 4ZE4A 2YLAA 5F2IA 5G4WA 3W7HA 1MRQA 3T44A 3RF9A 1BAGA 1EJUC 1W37A 3EX4A 2WNNA 3FYPA 1YNPA 5DT7A 1DJIA 1LCOA 4JCMA 2PDYA 1M5WA 3H4WA 3PN8A 5EYWA 4AX7A 1FOBA 3UY8A 3LXAA 3TN4A 5A6TC 3ANYA 1R2SA 5D9PA 3BPWA 3NPXA 3VIHA 4O53A 3QV6A 5DO8A 1C7TA 2VC6A 2D23A 3P8IA 3V5OA 4MSSA 4DWDA 1IEWA 2PDUA 4IQLA 4IPJA 3GZAA 2J6VA 3MP3A 1OFDA 1M01A 4AQLA 1JCLA 4C65A 1B30A 5DCDA 3KDOA 3TN6A 2AMGA 4CNPA 1R46A 3OVGA 1XLLA 2CLFA 2YBUA 3HG5A 4GD0A 4KF1A 2OYKA 3W29A 1C3FA 4HCHA 3S1WA 2P50A 4PODA 2CIPA 4YPJA 3ABSA 1HJVA 3WQPA 4CLMA 4FA3A 3I3EA 3W76A 4A21A 1GYLA 3FK4A 3TQKA 1MW0A 4A8NA 1OINA 3C2FA 3WL1A 1FWWA 1XBYA 3UWUA 3GC5A 5K7JA 2GSJA 1RBAA 4O52A 3O16A 4Y7EA 3T05A 2HPMA 2CZFA 3C8NA 1RA0A 4ZSUA 2V3FA 1BTCA 5FEPA 3WUFA 1UR3M 3SDOA 1RCQA 1AJ0A 4PMJA 3WZ0E 3VIOA 3W1RA 4A3YA 4HMEA 4RPQA 4QS6A 4B5UA 1VFFA 4J3UA 5K9CA 4AX6A 2OT0A 2HDJA 1EC8A 1JQVA 1UWTA 4YMZA 2WLZA 3VNMA 4JOMA 3OTRA 2X2GA 2BLEA 3VX1A 3LCWA 2NVAA 1R85A 2A3CA 3EDFA 3PB0A 3ES8A 1WCGA 4M7SA 1XKJA 4JCLA 3W9ZA 2CCRA 2WKLA 3CV7A 3PUOA 1ZAIA 4ADUA 1Z6KA 3WBXA 1JF5A 5A95A 4N0RA 2YCKX 2HJPA 4GIRA 2CZ5A 3CHFA 5D03A 4BF7A 3GIYA 4L4MA 4XZNX 3WQ4A 3RIKA 2V5LA 1NQKA 3GW3A 4MYAA 2J27A 2DQXA 9XIAA 1SO6A 4A4AA 3FFSA 1TCMA 3QW4B 2G97A 3ABOA 1QW7A 4AF0B 1FDYA 1VCVA 1C9WA 4X61A 4AXNA 1PBGA 3AS2A 1VH7A 1PKLA 1ITCA 3NAVA 4PR4A 3S0CA 4BQ3A 3CGTA 1DIOA 3BMWA 3L2IA 5D2TA 3TSDA 1CBGA 1Q6CA 2GJLA 1OFBA 4RW3A 1ZZMA 3CUHA 1DPMA 3KFTA 4FALA 2A21A 4HMNA 4WUIA 4TUFA 2WOQA 4HPJA 3LM3A 4CCDA 3VOGA 1XINA 1AD1A 4G2DA 4NZ1A 3PTDA 5BZAA 7TIMA 4C6BA 4TV6A 3KVJA 3M7WA 3CQJA 1EHNA 3EDEA 2CERA 4GISA 3DFQA 2A3LA 3FJ4A 3H21A 2BGQA 3K13A 1H7XA 3KP0A 3WO8A 4P7LA 3VX0A 3HN3A 3EX2A 1KWGA 1TV3A 3RPMA 4I8DA 5K9XA 4N42A 1I8JA 1GJPA 3QFEA 4L1WA 5CBIA 1S2TA 1QAPA 4IISA 5DBUA 3VNYA 3VD7A 4E8DA 4S38A 2HWGA 1SZNA 4F79A 3KTCA 4KGLA 6REQB 3TYEA 1CGWA 1ME8A 2PDXA 4IF2A 3M1ZA 2RDWA 1OT2A 3XISA 4WF7A 4KWSA 1WKDA 1GZ1A 4JS3A 1YW1A 3W28A 1FKXA 2W92A 3CT7A 4ES4A 1R0MA 3CPUA 3D46A 4XWUA 2YGYA 2F2HA 1XBXA 5K4XA 3E2RA 1JAEA 2E5DA 1CEOA 1CT5A 4LFYA 3GDTA 2H8ZA 1VYPX 2Z7GA 2J8FA 1IF2A 1PL9A 1U22A 3SUWA 1YIXA 2J74A 4PCNA 1PXGA 1H41A 1UUOA 1GOKA 1TTPA 1QI2A 4C91A 2WHKA 5DMLA 1FQ0A 4IPIA 3ELFA 3N34A 3LD5A 3ZR6A 1OIMA 2ISDA 1F8IA 2JE8A 1Z41A 1V6WA 1H7NA 5FJJA 5LHEA 3SCUA 4BI5A 4MKNA 2NW0A 3MDUA 3BMXA 1RSCA 1UA3A 1LWJA 3RCNA 2VM8A 1E51A 2X1RA 5FJUA 3W7MA 3BMVA 1QK2A 3W27A 2P10A 3JZEA 3RJYA 4DEFA 1FWAC 1KNWA 4DUOA 3ITVA 1JZ4A 3GKAA 4TVDA 4YL2A 1HO1A 4ZZ9A 3CIWA 3SEPA 4B3KA 2OSXA 4HU3A 3HQ1A 4ZQNA 3S1GA 3LK6A 1DJHA 2E8YA 3CB8A 3MPGA 4FR6A 5ABFB 3O1NA 1IHIA 3EAUA 3C56A 3QRHA 2PMQA 1EO5A 4HBKA 4LAKA 4C6FA 3IIVA 5ABFA 4OBSA 5AHNA 1LQ2A 3CHCA 3BQ5A 1SFLA 1V0NA 3O63A 4MPKA 1A5LC 1US2A 1XC6A 3WQCA 1Q85A 2JIWA 3APYA 1JCJA 4WX2A 4ERGA 2JIEA 3MKKA 1QI3A 4ORMA 3NVDA 4UTHA 3O15A 2XFRA 1TUFA 3JUGA 3FS2A 4UQDA 4FIQA 1A47A 4GUIA 5CG7A 4L64A 5LHFA 3LX9A 3APGA 2G5WA 2I5IA 1ZAHA 4S3KA 3UBPC 4NF7A 5AKQA 1VCFA 1JD7A 1KV5A 5CXPA 3LHYA 3IJLA 3OQEA 3CWOX 5AB3A 5C8BB 4HNTA 2BG5A 3URAA 2R91A 4DXXA 4BWLA 4C6CA 1W5QA 3UESA 4Q7IA 3MBDA 2FHFA 2NXHA 1OF8A 1R2TA 5FAJA 2P5NA 2YXGA 1GG0A 4FLQA 5D09A 1PDZA 4ZQRA 5E5CA 4A8IA 1O4UA 4PUUA 3EX3A 4FX6M 4X2PA 3HOJA 2J47A 4Q4SA 4O15A 4XBKA 2X05A 5A2AA 2E6DA 3XIMA 1EA9C 3BOXA 1ICPA 2MNRA 4WRHA 3W7IA 3P5YA 5C70A 1XIIA 1XJBA 4FNRA 1VJZA 5DBTA 3LY0A 3EMCA 1QNSA 2VZSA 4IMCA 1ZPTA 1G4TA 4F66A 1ECEA 5CBJA 1RR2A 2Q3OA 2FZ9A 2HE8A 4W4QA 5HXMA 3C4UA 2KAUC 1XCXA 3TJIA 2WC4A 3TR9A 3PWAA 3V1PA 1FDJA 2ASHA 3MZNA 4ZXOA 1W9PA 4FO4A 5HNRA 3VUSA 4WVXA 2OODA 2ZUUA 4L7ZA 3HV8A 1LT8A 1OFAA 3LGEA 1SQ7A 3KEHA 1J4EA 3GD6A 2HVNA 3WLTA 2VQUA 4L80A 3WIJA 1H1YA 4HB7A 2WANA 4RUBA 1YKWA 4N9BA 4AD1A 4H6RA 4IL0A 4JX4A 4XAYA 1H09A 3N9RA 3UWWA 3K8MA 3KS6A 4QS5A 2B4GA 2Y8VA 4CD8A 3LS9A 3NQVA 4UMBA 4CVUA 1WO2A 5M3WA 4HYRA 3OHIA 3THDA 4XD5A 1B4EA 5F4SA 3ABRA 3ZWTA 2VVSA 3VO0A 1YDVA 2XGBA 5F2GA 3OLDA 3LPFA 1US3A 3QFWA 5LKYA 1J12A 2Y7FA 4BQ4A 3A3WA 1VPQA 5FEXA 2ICSA 3N6HA 2IMRA 1EC9A 1NTHA 4QJ4B 6TIMA 1XYLA 1UG6A 2BP1A 1SJCA 1NIUA 1SZRA 3M64A 1M03A 2F6KA 3VTRA 3UG4A 4UTFA 4DYKA 2C3ZA 4L9YA 2CC0A 3QGVA 4MZ1A 1EEXA 5A8PA 1HKJA 3K1DA 4WKFA 5FF7A 3WMLA 3RYSA 5FACA 1LWHA 1XH0A 4M7TA 1SGJA 4IUGA 4B5WA 4LCRA 1YDYA 2BB0A 2PTWA 2ZRXA 1WBJA 3PY2A 3STPA 3CHEA 4J28A 5A6KA 3GUGA 5C2XA 3UGRA 1UP3A 3T2QA 2QUNA 2BXVA 2WZMA 3K4WA 2GLKA 4NNBA 4IQDA 1E1CA 3KOXA 3MCOA 3WNMA 2G3JA 2ALDA 1VEPA 2QT3A 3B8TA 1E0WA 4F0KA 4DM1A 2X42A 1EZ2A 3G77A 3CL6A 4HTBA 1H49A 3WLHA 3NQ7A 2PGWA 3GG7A 1VQTA 1XGZA 5HINA 3BCDA 1K7XA 4G6CA 4QRNA 4YU1A 4C6NA 1CENA 5GJPA 4GC4A 4CNUA 1JPKA 3BAYA 3WQ8A 3NXLA 4AYGA 4D9PA 3E96A 4Z0SA 1HQTA 3BK0A 4BQ2A 5F1VA 4GO8A 1O5RA 1B9BA 1R3TA 3WD2A 4L9XA 3W0KA 3UWQA 4XBJA 5C7HA 1BLIA 4N2YA 3W1AA 1DJGA 3BAJA 3URBA 3NPVA 4WGHA 1S5WA 2HMCA 2IKJA 2OZ0A 3IIZA 3IACA 2Z28A 2ZUVA 2YFOA 1LF1A 2E6YA 2BFGA 1R6WA 1S38A 1GUVA 4XTDA 2PZNA 1GKRA 3GH5A 3LB0A 3WK3A 3E2SA 4Z2GA 4GXPA 2D0HA 2MUCA 5G2HA 2J6XA 3GXPA 3I3DA 1UJPA 1NQ6A 4YTSA 5BRPA 4L5ZA 4DBWA 2OCZA 2XH0A 1Q45A 1MWOA 1OWQA 3G6LA 3CJPA 5EKYA 4IP4A 3U7BA 1KCKA 2CLLA 1VBHA 3KL5A 1I60A 2VWSA 4WEVX 4JTAA 3N1AA 4M29A 4WDXA 3VDBA 5CGQA 1FWDC 1TR9A 1B54A 4W8AA 2W63A 3UNDA 1VIZA 2CLKA 4Y9PA 3KX6A 3Q2DA 4LV4A 2PGFA 4DJED 2TAAA 4Q4PA 1ZCOA 2C16A 4IGHA 4W89A 3M0XA 4PUDA 3SUSA 3U9IA 3L4ZA 2OZ3A 3VD9A 1JPMA 3AHVA 3D47A 1MFUA 1KM1A 1HO4A 4CN4A 1UD5A 1UWQA 1I6NA 4QNEA 3IK4A 4O10A 4M81A 2DT3A 3WCZA 4NAEA 1A4MA 3U4FA 2G4FA 3RITA 4H2HA