1TRHA

Two conformational states of candida rugosa lipase
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title Two conformational states of Candida rugosa lipase.
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase(carboxylic esterase)
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trhA00
1MJ5A 4W63A 4KRYA 5AKLA 3C8DA 3WIOA 3PE6A 3CCCA 1CUZA 2ZJFA 3OURA 3WK7A 1UK6A 5AK4A 4QDOA 4JH0A 2WJ3A 4Q1VA 3AINA 5CT4A 3V1NA 4W1QA 3DQZA 1BN6A 4WDQA 2I3ZA 3IUMA 3WA6A 3S2ZA 1ACLA 4FFVA 5E4YA 2Z3WA 1UXOA 4Y9SA 4A5SA 3AIMA 3OOSA 1QOZA 1EK2A 1XZEA 1P0QA 2YASA 4B80A 5AI6A 2V96A 4CFSA 3C70A 1XKTA 5JYCA 4C89A 5AK3A 1GT6A 5CW2A 3NOXA 3A2LA 2HHAA 4ZXFA 1B6GA 2ES4A 2FX5A 7YASA 3OC0A 4QWMA 1R4ZA 1DTEA 4H7FA 4ZREA 5FOQA 2VQ6A 5DYTA 2WFLA 2QJWA 1ZD5A 4B7ZA 4WJLA 4W1PA 1UFOA 1OXMA 5JD5A 4GDMA 3X3HA 5ALMA 1XLVA 2BAGA 1CUAA 2IITA 3RARA 3FYUC 2CBGA 1OILA 1YB7A 3R3XA 2FJPA 2W6CX 3I2KA 1MNQA 1R9NA 3V1KA 1BS9A 2RIPA 3BIXA 5J3JA 2VT7A 1TCAA 3RKSA 3VDXA 3I6MA 3HSSA 3D3NA 1ZD2P 3DDUA 2ZYSA 4MXDA 3C5WP 4TGLA 4PQEA 5ALHA 2WQZA 4D9JA 1QIIA 4P92A 2HA4A 3SX4A 1HLGA 3WWOA 4KE6A 3Q0TA 3H2HA 2DSNA 3O4HA 1R3DA 3VJLA 4Y2YA 2RHWA 5JAPA 4KACA 4BRSA 1KU6A 1AC5A 5AKIA 3WYNA 1DINA 5K3CA 2XMQA 4UPDA 1N5MA 1UWCA 1QJ4A 3R3YA 1YAHA 4HRXA 1BN7A 3I2FA 5I8PA 1WPXA 3C8HA 3FVTA 1CUHA 1LPOA 3ICWA 4U2FA 4QA9A 3AFIA 1WB5A 2B61A 2WTNA 5LP1A 5CURA 1AQLA 5ALUA 5HF6A 3FCYA 4MJ3A 3CXUA 1GQSA 2VEOA 2WU3A 1WB4A 4L0CA 3WWDA 3G0DA 1KU0A 3QMMA 4G1FA 4K5QA 3IB3A 4H7IA 6YASA 3EQ9A 2EDAA 2XMRA 4M0FA 1T4MA 2DQZA 3ESBA 4HXEB 3BL8A 3H19A 4FTWA 4FNMA 3OPMA 5C8ZA 3WLAA 4Y2XA 1YR2A 3EBLA 3NGMA 4EBBA 1IZ7A 1DX4A 3AUKA 1N1MA 3QYJA 2V98A 4BCDA 1ZOIA 1E89A 4Y2TA 1IVYA 5CT9A 4OYLA 1GQRA 1ZI8A 1QFMA 4YASA 3I2HA 3C6BA 5HFAA 3U0VA 2JGEA 3RM3A 4FHZA 4WY5A 5LZ9A 3W04A 1AMNA 1ZD4A 1T2NA 4ARAA 3WK9A 2XI4A 2HU7A 3GFFA 1UKBA 1CQWA 5LZ2A 1Q0ZA 2WIKA 3JW8A 4BRZA 2XUPA 3I2IA 2ACKA 4K6GA 4DM7A 3O9VA 5AHXA 3WL7A 1TIBA 1CUJA 1IZ8A 2HA6A 5ALRA 5K3AA 5KWIA 4FOLA 3E0XA 1ZIXA 4GWLA 2AJDA 2H1IA 3KXPA 1PFQA 2PSEA 2XMDA 1J06A 2AJCA 2IIVA 4C01A 2OQIA 2FUKA 1VA4A 1EA5A 2CB9A 1QZ3A 2ZSIA 4GW3A 3G0BA 5AOCA 4BP9A 4BC0A 4X6YA 4B9AA 3TEJA 1VXRA 1ZGBA 1XRQA 2O7RA 3G9TA 4BDTA 3PICA 1TAHA 2XB6A 4C4ZA 2Z8XA 2I78A 5DJ5A 5AM0A 2VJCA 3KWJA 1UOPA 3C5VA 5JAOA 3F97A 5C7YA 3ZLTA 1BCSA 4I3FA 2OCLA 2QJRA 1CRLA 1VE6A 4UBJA 2XMGA 3PI6A 2DHEA 1ZICA 3ZV7A 1O6FA 5DWDA 4W9RA 1P0IA 4Y2PA 4ARBA 1TCCA 1YB6A 4U2GA 3F98A 3B3QA 4RE5A 2XMCA 3WKDA 3BWXA 4B6GA 4XIIA 1A88A 3ICVA 4JYPA 3EQ8A 4L9AA 1YS1X 1QIGA 1XKLA 3OM8A 5A7GA 1CUGA 5AKJA 4KEAA 3D5EA 2C5FA 3ZI7A 2YYSA 3O0DA 3ZLUA 1E3QA 5I7UA 5SYNA 1W1IA 3QZUA 3BF7A 3BDVA 3G7NA 1X2EA 4B0OA 1U8EA 5AM4A 5A7FA 1XRMA 1SOMA 3G9ZA 2QUBA 1EINA 1THGA 4MEAA 4UFOA 3BE8A 4J3JA 3DYVA 4C87A 3WZLA 3G8YA 5FPQA 5ALQA 2EEPA 2XQIA 4Q05A 2WG2A 3LIPA 2H7YA 2I03A 3DEAA 5ALIA 3W06A 3P2MA 4CG3A 2Z8ZA 1H2YA 3V1MA 3I2GA 1LPSA 1XZMA 2QXTA 4P93A 2G4LA 4BC1A 1ACJA 4OB7A 3M83A 5ALNA 4N8DA 3DJYA 1IUOA 4TPKA 5AO9A 1K4YA 3I6ZA 2K2QB 2Z3ZA 4N5HX 4LXHA 1A8QA 3FSGA 3G0CA 2XUHA 4FWBA 4C88A 2OXEA 2XQJA 1GXSA 1XQVA 4ETWA 3ESAA 3JWEA 4WFKA 1C7IA 1EDBA 5JD6A 3C6XA 4AO8A 2XQFA 3UMJA 5T4FA 2QMQA 2FJ0A 1MX9A 3AZQA 3VVLA 4HXFB 4B84A 2WFLB 3B5EA 4YPVA 2QUAA 4AZ3A 1XZBA 3PFCA 1AKNA 3AZPA 1JMYA 4X6XA 5CH3A 1ORVA 4YX9A 5JARA 2B20A 1X2BA 3IULA 1QIKA 4DNFA 3VXKA 3NUZA 1YA8A 4BATA 4UBOA 4Q82A 2PL5A 2WIDA 5ALJA 1UOQA 4KAJA 4DSAA 2B4KA 1L7RA 4G4JA 4M0EA 5JANA 5YASA 5JADA 1XZGA 3VKFA 2WJ6A 3VVMA 5ALSA 5D7BA 3H2GA 2OPHA 5IVIA 1YSCA 2ZJ7A 3WKEA 5CRIA 5ALTA 2HU5A 2WHRA 4M0MA 1E8DA 5FLKA 1R9MA 3ILSA 1LPMA 2YH2A 4J0CA 3FNBA 3DL7A 4DYHA 4RE6A 5A71A 1IUNA 1OCEA 1LZLA 4X91A 4H18A 4IQ4A 4QE3A 2Y6VA 4MYSA 3O9MA 5AI9A 2VF2A 2D0DA 3FOBA 1LBTA 3PF8A 3I2JA 1E8MA 4FBLA 1XRNA 2ACEA 3ESDA 5ALOA 3DKRA 4UFPA 1XZDA 1X70A 1XZHA 1AZWA 3KD2A 1C4XA 3R3UA 2C7BA 2JGLA 4W1RA 3ED1A 3O4JA 3OG9A 3W05A 2HA7A 4X85A 5F4ZA 2Y1KA 4BCCA 1EVEA 4DNQA 1JU4A 2QM0A 1NU8A 5FUMA 1LPBB 4KJXA 2WKWA 3V9AA 2GZSA 1W75A 1VOTA 3KSRA 3LLCA 2GYWA 5A6VA 2GYVA 5I9IA 1ORWA 4OUKX 5ALKA 2R8BA 1PV1A 2C58A 4JUIA 1J2EA 1G4HA 2QT9A 4AMZA 2XMSA 4UBLA 4DMFA 1CV2A 1GPLA 4A23A 4HS9A 4K6HA 4UBNA 4WFIA 4BVKA 5ALFA 1CUVA 4QDTA 3WA7A 1K5PA 4BE4A 4EY5A 1UK7A 3QITA 3ESCA 3MGAA 4J0GA 4QZVA 4H7DA 2XE4A 4FFWA 5AKEA 4XWGA 1CUIA 5HCUA 1WB6A 1HDEA 2AJ8A 5H3HA 3DLTA 1MTZA 2XUIA 4C4YA 3M81A 1ZJ4A 2XUQA 5FPPA 1O6GA 3FYTA 4NMWA 2R11A 1M33A 3GA7A 3QBJA 4Q3LA 4C6HA 5C81A 3TGLA 3IUQA 3WJ2A 2J3DA 4UHBA 3QH4A 1XZFA 2WFMA 5IH7A 4H35A 5EIEA 3C43A 4UFNA 4J7AA 3FLEA 1WHTA 1MAHA 3FWHA 3F96A 3R3VA 5BV7A 3BXPA 5C8VA 2PSFA 1SFRA 5HF5A 5EHZA 5EI5A 1Q0RA 2AXEA 4B9EA 3DD5A 1A8UA 1VZ2A 3C45A 5EHQA 3IIIA 2AJLI 3QMWA 2HA5A 4ITVA 1I6WA 2OCKA 5DNUA 1QO7A 3B12A 1Y37A 3DOHA 5D3KA 2WG0A 5EHXA 2CEKA 2PX6A 4OB6A 1ZI6A 5AI0A 5A7HA 1S8OA 4Y2SA 1B41A 3WKAA 2ORYA 2XUAA 5AKZA 5JAHA 4CCYA 5IKXA 1BROA 2WM2A 5AI5A 1UKAA 1DWOA 3OTQA 4DNPA 3D2AA 5LZ5A 1BEEA 4FNGA 1QIMA 3VISA 3HZOA 2RAUA 3FSGD 3AILA 2XUFA 4MWTA 2VJBA 1ETHA 1ZI9A 4N8SA 2BJHA 4DGQA 2RGUA 3RK4A 5ALPA 4ZRDA 1XQYA 1IMJA 1WHSA 1DQYA 4H7EA 4HAIA 5IVKA 4BTVA 3FAKA 3C87A 2CMFA 2XLCA 1AGYA 5CBKA 2GBFA 2QVBA 4LIPD 2JBWA 4Q3KA 2GBCA 4HXGA 1CVLA 1ZGCA 1VA5A 2WUGA 3KDAA 2BGNA 2QS9A 3DL4A 3N2ZB 1D07A 2RHTA 1UK9A 1JMKC 4G8BA 3H0CA 1WCYA 1RP1A 2PSDA 4P08A 2VJDA 5HQ3B 3LIIA 5EHNA 1G42A 2VT6A 1ODCA 3QM1A 2Y2UA 2HFKA 1Z68A 3PFBA 1FFCA 1CLEA 2ROQA 4KE9A 2PU5A 5DTIA 4BZZA 3BJMA 4J0HA 3M82A 3UUFA 5AKYA 1P0PA 1JJIA 4BYMA 3DCNA 4OU4A 4BCBA 1R50A 1LNSA 2PPLA 4ZI5A 3WL5A 4MWSA 2PSHA 1FFBA 4N8EA 1UK8A 4HRYA 4EY8A 2QOEA 2C5GA 1YA4A 4X95A 5K3DA 4LYDA 3RLIA 2Z5GA 4AB1A 2WUEA 4I4CA 4FDMA 2HL6A 5T4EA 1Q84A 5AOAA 3HJUA 1XRPA 3QPDA 2GBGA 3FVRA 4V2IA 2VTVA 4FKBA 1CPYA 1CR6A 2JIDA 1BE0A 1F0NA 3LCRA 5HK8A 1QIJA 2HA0A 4A16A 4X90A 1TCBA 3R40A 1DU4A 4G8CA 4BAZA 2BUCA 1UKCA 5LZ7A 5LIPA 2XUDA 2CUTA 1UT6A 5SYMA 4LYEA 4F5ZA 1LLFA 2JGMA 4U2DA 5IVHA 2GYUA 3AIKA 5AKXA 2OGSA 3BJRA 3W9UA 4WDRA 2JGIA 4Y2JA 2X5XA 5AKHA 4X6UA 5FKJA 3BF8A 3WK5A 1FFEA 5EIHA 2JEYA 4AO7A 1JJBA 2WTMA 4OCZA 2QTBA 3FYUB 5AOBA 4H77A 1AUOA 4EHBA 1LGYA 2ZYHA 3G0IA 1MO2A 2VATA 4YK7A 1XZAA 2HRRA 1DX6A 1HBJA 4JEIA 3W2TA 3IURA 2JEZA 4RNCA 4X92A 4HZGA 4XJVA 3WQHA 2IX9A 4OYYA 3NWOA 2C0PA 3K6KA 5CH8A 1BRTA 2HADA 3I1IA 1GKLA 5AI8A 1E66A 4ZV7A 2G63A 5K3EA 3DOIA 4GHWA 3D4LA 4PSDA 2ONCA 4UBIA 1F0PA 3IA2A 5DNVA 4BTLA 5HQ3A 4INZA 1LPAB 4H7HA 2WJ4A 3GZJA 3WKBA 3STVA 3WJ1A 4AN0A 1U65A 3STUA 1LPNA 2PVSA 3H2JA 1H2XA 1VZ3A 3VJKA 5AM1A 5DYWA 5AH0A 4GBGA 2OCIA 2ZVDA 1ZJ5A 2G5PA 1CUBA 3WMRA 5CXXA 2PUHA 4Q34A 2WFZA 1BEZA 4UHCA 4X00A 2H9YA 5JD4A 2VAXA 4GECA 4OB8A 2DHCA 4LHEA 1GGVA 2OLEA 4AX4A 5HF8A 3WK8A 1UZAA 2O2HA 4UBKA 3FLAA 2OAGA 4CIBA 1UOOA 5CTAA 4BE9A 1MNAA 1QO9A 1L7AA 3R0VA 4GXNA 4G4GA 1E8NA 1CUEA 2OAEA 1G66A 1SCQA 1CUFA 4JYMA 2XQKA 5JATA 5LZ8A 4OPMA 1JI3A 4AQDA 3MUOA 2BUAA 5HKAA 1W52X 3LP5A 1EK1A 5LKAA 3K2IA 3HXKA 1QFSA 3WI7A 1VXOA 5ALXA 4NVRA 3H2IA 3FLBA 1C7JA 1NX9A 5JIBA 5E4TA 1GKKA 4GI1A 4L72A 1ZD3A 5FRDA 1CUYA 1CUXA 2XUKA 2WIGA 1CUDA 1WPRA 1EDDA 3H1BA 5AI4A 4UHHA 2Y6UA 3BIWA 5DTJA 3I1YA 4E15A 2V9ZA 4KAAA 3CCBA 1Y7IA 4BDSA 2C4HA 1THTA 2E3JA 4BP8A 2O7VA 4X3CA 3DNMA 3FYUA 1NU6A 4DSZA 3IVMA 1XRLA 3DS8A 2ZJ6A 4F21A 3BDIA 4DMHA 3FBWA 5KBYA 3K9BA 3PF9A 4E11A 1KEZA 4FBMA 1VLQA 1ZIYA 4PNZA 2P8SA 4H7KA 3EF3A 3R41A 3HLKA 1LPPA 2X8BA 1EVQA 3G0GA 1AURA 4QEKA 2WUDA 1XZCA 2V97A 5AK5A 4CCYB 1EHYA 3GBSA 2BKLA 1WM1A 1P0MA 3ANSA 1K6EA 2XUOA 4FLFA 4QLAA 5E2IA 2J4CA 5KREA 4ZGBA 4RGYA 1A7UA 4GLBA 3WKCA 3AZOA 4G5XA 4OD0A 5HZGA 4KR0A 4Y7DA 3LS2A 2HA2A 4DMCA 1DQZA 1CFJA 4DIUA 4AZ0A 4MEBA 1BCRA 2C0QA 4DMKA 3L1JA 2WILA 4H7JA 5K3FA 1DT3A 1N5RA 2HIHA 4HTAA 4B81A 4CI9A 4QDXA 3SWWA 1J1IA 3HEAA 1WOMA 2WHPB 5D6OA 2XLBA 1DWQA 4WFJA 2W22A 4IH9A 2DQYA 3WZMA 1H23A 3A70A 5T4HA 3F67A 4G4IA 4C4XA 1JU3A 1XROA 1FSSA 1CQZA 3F8SA 4KYVA 5JALA 5FXMA 4FMPA 1XZIA 2D5LA 4TVKA 4BAGA 4F60A 3WK6A 5CT5A 3C6YA 4UBMA 1MAAA 4IHAA 2GZRA 1QONA 3I6YA 2WHQA 2PKYX 4AXBA 2WG1A 3H17A 1MT3A 1JKMA 3G9UA 4Q3OA 2HFJA 2X76A 1N8SA 1TQHA 3PUHA 4EB0A 4G9GA 1DWPA 5LKRA 4BVLA 5A62A 4PV7A 5AKGA 5CMLA 5FDFA 2JGFA 4O08A 4CCWA 1QIHA 4UHDA 2PU7A 3SK0A 4IH4A 1R1DA 3A6ZA 3D59A 1BU8A 2BGRA 4AO6A 5JZSA 3PDCA 3WK4A 1ODSA 3D7RA 3D0KA 3HRHA 4B0PA 1G5FA 4CG2A 2ZSHA 2ECFA 1JT2A 2DHDA 2HM7A 4U2BA 2OGZA 3W9BA 2WIJA 2JGJA 4EA6A 3WIBA 2XUJA 2XDWA 4CG1A 1JFRA 3I28A 3PUIA 5K5EA 5ALZA 3QPCA 3IUNA 4U2EA 4Y2QA 1PJAA 2DR0A 3YASA 1QIDA 1CUUA 1VE7A 3H04A 4LXGA 3IDAA 5ALLA 2PSJA 2JGKA 5ALGA 2WU4A 4X94A 1YASA 3O4IA 1MX1A 4KRXA 2HRQA 2XQGA 4XX1A 4KE8A 5FP0A 4WCVA 3D2CA 4S0XA 2PM8A 2HDWA 1XZLA 1QIEA 3KOOA 4MQMA 3A2NA 3KWFA 2DCMA 3S8YA 4J0KA 1HPLA 4AN1A 4Z49A 1HL7A 4OU5A 4G8DA 3AJAA 4BAUA 4Y2VA 5LZ4A 2GBIA 4B85A 5EGNA 2CKMA 5EIAA 2WHPA 1HQDA 3QMVA 3STTA 1VKHA 3DYIA 2OCGA 2G5TA 3WWCA 1XZKA 3HYSA 1FFAA 2I3DA 4BBZA 3G02A 4QDZA 5BWCA 3L1HA 2Q0XA 4PSUA 5HFNA 2XMZA 2J3QA 4KE7A 2CJPA 1ODTC 4I19A 5ESRA 4U2CA 4E14A 4IO0A 4NS4A 5JZBA 4XVCA 4J0DA 2AJBA 3L1IA 3ANTA 2BFNA 1HKHA 1SCIA 3TRDA 4ZWNA 5A2GA 3F9CA 3R3WA 5AP9A 5AICA 1MX5A 1CUWA 5AIBA 1GPKA 2OQVA 4P9NA 5BWBA 1MN6A 1J07A 5HKBA 4PF1A 1H22A 3CN7A 2WLSA 2XT0A 1MU0A 4HVTA 4QNNA 5FV4A 2DFPA 5AM5A 1XFDA 1W76A 1H2ZA 4BZWA 3D2BA 2O2GA 2QZPA 5DLPA 4N5IX 1CEXA 1EX9A 1Y7HA 3WL8A 3STXA 1L7QA 4W1SA 5AKKA 2BCEA 1RYYA 5E4JA 4PW0A 3V1LA 4Y2UA 3IUJA 3WL6A 1SC9A 3IBTA 4BVJA 5ALVA 1W6RA 3MVEA 1TRHA 4IH1A 4F0JA 1DT5A 2WIFA 3ZWQA 4X71A 5HK9A 3AIOA 1USWA 2ZYRA 3Q8WA 1AX9A 3E1GA 2VAVA 4X93A 5CXUA 5ISMA 1R88A 2QXUA 1JJFA 1XLWA 2VJAA 5EFZA 4DNOA 3T4UA 2J4FA 5ALYA 3E3AA 4ROTA 2ZYIA 1GPNA 4UHEA 1YCDA 3MUNA 1XQXA 1GZ7A 2VSQA 1H2WA 4OSEA 2QR5A 3T52A 5BOVA 1TKRA 5CH5A 1EB8A 3QVMA 2PUJA 3WWPA 1YS2X 1FFDA 4PSCA 3M3DA 4J0JA 3TJMA 3ZPXA 3GELA 4BB0A 4UHFA 5CT6A 4UUQA 5IVDA 4PO3X 2WSLA 4G9EA 2OG1A 1EI9A 3A2MA 3V48A 2Y2VA 4QDUA 5LLSA 3DKKA 3QPAA 3VJMA 4DTCA 2HU8A 1Q83A 3HACA 1F6WA 3HC7A 1A8SA 3UUEA 1TK3A 3HABA 4NZZA 4MYDA 2CZQA 4Y2RA 1U2EA 5D3ZA 2QRUA 4MQLA 5HF9A 4QLOA 1QLWA 2RI6A 1U4NA 4LXIA 1QTIA 3O95A 5K3FB 1YAJA 2LIPA 4EY6A 5T4BA 4EY4A 4WY8A 4H0CA 1XZJA 3U1TA 4K6KA 3HI4A 4X97A 4ZV9A 1SCKA 3STYA 1ISPA 1QIFA 3N0TA 3G9XA 4RPCA 2QKYA 1K8QA 5JAUA 4FLMA 1IUPA 4B83A 4EUSA 3GUUA 4K2AA 3JYHA 2BUBA 1VJ5A 1QTRA 4EY7A 1RWQA 4DLNA 5C8XA 3C6ZA 4L3WA 3WWEA 3SC2A 2YXPX 5JASA 2PBLA 4QWWA 3H18A 1EXWA 4CIAA 5KWJA 1MPXA 5AK6A 5AM3A 5K3BA 4GEGA 2WUFA 5AM2A 1LZKA 5ALEA 1QGED 1E5TA 2O2IA 1EH5A 2RONA 3H2KA 4J03A 4EZIA 4KAFA 4AMYA 1F8UA 3STWA 2HA3A 4FLEA 1CUCA 2OGTA 5ALWA 1QE3A 5DYYA 3H1AA 1LBSA 1W4LA 4B82A 2EDCA 4J0IA 1K63A 5DNWA 2NW6A 1CUSA 2XMBA 4LKOA 2H7XA 3CN9A 2H7CA 2B9VA 3FCXA 5AIAA 3EQ7A 1XQWA 5AJHA 1XRRA 2UZ0A 2JF0A 3O4GA 5CT8A 1XLUA 3WYDA 3E4DA 5LYYA 2VA9A 5JZ9A 3ZLVA 2XUGA 4JNCA 1EB9A 1FJ2A 3EIOA 1CIJA 1EDEA 3R3ZA 5ALDA 3GROA 4E46A 4X7BA
chains in the Genus database with same CATH superfamily
2HT6A 1MJ5A 1WXEA 1LTQA 1M0SA 2P6PA 5AKLA 5F9HA 3AKZA 5E6RB 5KNBH 1DJQA 2NTVA 4NE2A 3UCXA 4QTZA 1X19A 4X7MA 4YJ3B 1SH7A 3H9BA 1G0NA 1Q16A 2VWQA 1KVSA 3NDJA 1KZGB 1W2HA 4LC9A 4POAA 1QZTA 3T4XA 1CUZA 2ZJFA 4MUHA 4F38A 5A1TA 2REOA 2REQA 3ANNA 4DBZA 1DOZA 3ZXSA 4ZOQI 4RKFA 2CNNA 3L7IA 5AK4A 3QVKA 4BNJA 2OCXA 3R23A 4MQEA 4PZ0A 4UREA 2SICE 1QDEA 2YY5A 5K9ZA 1QPBA 4JH0A 3AONB 2FEPA 3CZQA 1H1LA 4GX0A 5CXQA 3U3MA 4ZCIA 1US8B 3F6EX 5KSPA 4GSKA 1GNRA 4KQ9A 4N6OA 5AHKA 4RJTA 1T5IA 3AINA 1NF8A 4CT0A 4O3FA 1NLZA 8ABPA 3GCDA 3LXUX 1XCLA 3VU3A 4AZSA 2PXCA 4D56A 2VJPA 5EP4A 2OWEA 5BW5A 3WICA 4BN5A 2PX5A 3SN6A 2I2WA 4WDQA 1S1MA 2EOAA 2WEKA 1YR1A 2I3ZA 2P0EA 2YZ7A 4QODA 4B40A 4PBRA 3QLUC 1E59A 4EI9A 1KOJA 1NXWA 2GD1O 5ARDA 2AV6A 2JCBA 2GJAA 4DQVA 2ID7A 2DUNA 4FSDA 3R4CA 4MR9B 1XJ0A 4ZDWA 4E11A 1SD2A 1W93A 1U4SA 1COWD 2FSVA 5LU8A 2C8KA 2ZETA 2IEDA 3EPRA 4UDNA 4QGAA 4XDGA 2JA2A 3EIEA 4KQKA 2GTIA 5TQVA 3P94A 4Q4CA 5JCOC 5KNCH 5G53C 1TDJA 4BXOB 1VM6A 1BDBA 4NFSA 5EXSA 4TWAA 1XKTA 1EAYA 2C57A 3HO6A 5F35A 2ZB3A 3S0JA 3LT5A 1EUZA 1DIRA 2QRKA 4MI1A 3PR3A 2R8RA 3BSFA 4BQIA 4G86A 2BY4A 2ZEJA 3NOXA 4NE9A 4JAVC 3X2FA 1EVKA 1FTSA 4BMDA 4LTNA 2VI5A 3I3SR 3W3ZB 1G8JA 3I8XA 4RLHA 4XSVA 3WGOA 4BV2A 1NVGA 5EWJB 1PHPA 3GQBA 3CMCO 3D6NB 4N01A 2Q3FA 1IH8A 1IM5A 1G2QA 1SCBA 5C7LO 4WSOA 2WD7B 3IPAA 3DLPX 4HBZA 1GZ6A 3VX4A 5E9WA 1PX2A 1T1RA 2F67A 4HQOA 4XVUA 2CMHA 4MGYR 4BMSA 3S8EA 2WFLA 1YNOA 1WV1A 4AZTA 5F51A 5MGBA 4C3ZA 3I30X 4L2IB 4B7ZA 2QY6A 4CDRA 3K1JA 4WJLA 4X3OA 4MWOA 2C42A 4O4IB 5FUQA 2ZJBA 3BTUA 4H6PA 1EEHA 3ORHA 2ZRQA 3ND8A 4UE3S 1RP7A 3K4QA 3THXA 2AOUB 2YV1A 3N8NA 4TVOA 3SD7A 2ODNA 4QTXA 4Q01A 4FN5A 4L07A 1Y5NA 2YW2A 3OIFA 5AVXA 2OBNA 3TVYA 4D9EA 4KDCA 3NIDB 1X1CA 2JFGA 4YA6A 2IEZA 4KKVA 4U6QA 3C24A 5BO5A 5THKA 3WAGA 1VCHA 3DL2A 4GX2A 1C8LA 4DM3A 1I7SB 2Q5CA 3VZDA 5TIIA 3PENA 1UKEA 4GZMA 3WFZA 3I2KA 4UVGA 3GFQA 5K1ZA 2ON6A 1QFYA 2VS1A 4HGYA 1B8NA 4X45A 1Z0AA 3OCYA 4OEHA 3BIXA 1HE2A 3J7TA 4Q4JA 3PDWA 3KYCA 3X1JA 3LHKA 2XYQA 4I66A 3WLLA 4CHGA 3RKSA 5K0FA 3VDXA 2HZ7A 2BC9A 2HUPA 2MYUA 4HPJB 4BKPA 1JTFA 1ZD2P 1JSCA 2JCVA 4TWJA 5KQLA 4GXTA 5CLQA 1MP0A 1N2OA 2BI8A 2MTBA 3C5WP 2QG4A 5DLQC 4CL3A 1AHNA 1Z6AA 2P35A 3AK4A 3DO8A 4FS3A 5KTTA 4E07A 3NHZA 2A9VA 3WO0A 3UAOA 2WQZA 1FTQA 2D8AA 3HCEA 4R01A 2TECE 5TSDA 2Y1EA 4US0R 1G5TA 2FKNA 5EXEA 3ZIUA 3JQGB 1QF9A 4KFRA 4LCBA 3WWOA 1ZLXA 3SS7X 3V4PB 3Q41A 5CDSA 2C9ZA 2QW1A 4G4SO 3P0JA 4DLAA 4E5MA 5A03A 4XQ9A 1MW9X 2GPBA 4Y2YA 4XD2A 1K5HA 4KACA 4MP3A 3SBEA 3E15A 4BRSA 1A4XA 3LDUA 2B98A 4KQIA 4D42A 4GPZA 2EIHA 3CZAA 4XIFA 1WD5A 2FW8A 3B85A 3EEQA 1U31A 4YIHA 1DINA 2CHGA 3FVWA 1P9OA 2CHUA 1FNNA 3AHJA 1UXIA 3LFUA 3O8OB 3QKRB 4FGWA 1YL7A 3HR8A 1DKPA 3L0OA 3MG9A 4Z51A 1D2HA 4YUAA 5LNK1 1QJ4A 3C5CA 5E95A 1NLUA 5DIFA 3E35A 1BN7A 3OPNA 1GAWA 1Q19A 4DWJA 4EL5A 3O93A 5I8PA 1JTEA 1XDBA 3WLMA 3C8HA 5HG0A 3OD5A 2Q5EA 3LZ6A 4UAJA 4NBLA 3HM9A 1F5SA 1CUHA 2H4HA 4JC0A 1LPOA 3HHPA 1YBFA 1MABB 4K9RA 4NR0A 4QA9A 4U2FA 4YJFB 5FUBA 3MM4A 1PU2A 1PN3A 2WTNA 4TWZA 2XRZA 3AU8A 4OHYA 3V7UA 2L0XA 5CURA 2O4UX 4JL6A 3PD1A 5DHSA 1ZD1A 4W4TA 3FYHA 4DEXA 1Y3DE 1NVKA 3AETA 1SQGA 2RGEA 2WWXA 4BBAA 4ZYUA 2NADA 1DCTA 5H4GA 5TT1A 2W2XA 2H1SA 2CEAA 2IHJA 4IFBA 5EMNA 3SEFA 3D0OA 3RFFA 1BVUA 4HH4A 4O5OA 2VEOA 3M33A 3FCSB 4TLDA 2WU3A 4D0LB 3OFKA 5MHTA 4NYIQ 2O0MA 3IMGA 4L0CA 5CXSA 4M1MA 4ARSA 1TKCA 4RF5A 4TSRA 1MQ9A 3G0DA 4LDAA 5ABPA 5FLXA 1RABA 2ZUBA 2YN0A 3L41A 2MSDB 3AR2A 3QMMA 4I1SA 3MMSA 1XELA 5CM2Z 4ZQEA 1KZ1A 4D8VA 3QBDA 3Q3IA 2C29D 2TMKA 5J59A 1CU1A 2J9ZB 4UTRA 2SKEA 1A5SB 2VHZA 2JFXA 5CAEB 1L4UA 2PWAA 2ACVA 3RVRA 3T7IA 1WA5A 3ZHCA 4DHEA 3IRVA 2Q0HA 2DQZA 2EWMA 4KPYA 4MK4A 5I9LA 2ZTHA 4MSUA 1G3MA 1Z8DA 1OGYA 4XUDA 5EZYA 1O7JA 3CB4A 3H19A 4F1JA 1O4VA 5H4HA 2W6NA 5EIWA 4A91A 2PDAA 4CKCA 4CIWA 2P1DA 3TH5A 5C2JB 1BMQA 3BWCA 4UUAA 1D2GA 4CDMA 5KYXA 3IOMA 1FMJA 3WBBA 4LZWA 1TQDA 1VKZA 1BKSB 3EJWA 3NGMA 1XF1A 4LXYA 4MV0A 4NPAA 3AFOA 3OTWA 5E9AA 1VIYA 4EBBA 4HVCA 5LQKA 3ND9A 3VOTA 3ZU6A 1E1CA 2BKEA 1NHWA 2VH1A 1IIBA 1TMGE 1WU7A 1DC3A 3A6KA 1FFXA 3O9ZA 4WBXC 3RUPA 5TQ0B 4MUFA 5FOUA 4M6WA 3PHJA 3QYJA 2V98A 3O0TA 1X1DA 1ZOIA 4I1UA 4K9SA 5JJBA 5L4SA 4QUAA 5EP1A 2M98A 3E2MA 3Q72A 4M46A 3HCBA 1O87A 4JZKA 1CJBA 3UGJA 1YR7A 4HD8A 1E3LA 1Z88A 2YJ4A 3A7EA 2H29A 1VJTA 5JEDA 4OXIA 1FF9A 3E1SA 4B8WA 1MQ8B 2HJSA 3C6BA 5LFAA 5B7PA 5JNWA 1DAMA 5KOJB 1Y7TA 2B5WA 4OMCA 1LQ2A 1RWKA 3KCQA 2DB3A 2JGEA 1AB5A 3VSDA 3KQQA 4I1IA 3EZYA 3ACCA 2OK8A 3BBLA 5EQTA 2WT9A 5LZ9A 3AR4A 1AMNA 2ISCA 3NHJA 1ZD4A 1RYBA 2ZCUA 3JQ9A 1QHIA 1DOHA 3MRVA 3WK9A 2WB2A 2X0KA 3I05A 1EWRA 1TYEB 1ESNA 2WHYA 3LLUA 3OAAA 1AO0A 1QG0A 4CEHA 3SVZA 4RIFA 5FI1B 3EASA 2FSIA 4R5HA 4ND7A 5THXA 3AJ8A 2QORA 3MJCA 5F2OA 3GLFE 4QRIA 2Z58A 2ZBFA 2FW7A 4ZAXA 5AUQA 3VTZA 4BRZA 4TV9B 2XUPA 3LBAA 3I2IA 5DSTA 2YNMD 4EG5A 1B7GO 4F06A 4BLUA 3TKLA 4QQ8A 4K6GA 2O5VA 5K0JA 3I58A 3IV6A 4DM7A 4N0MA 3WL7A 3KT6A 1TIBA 4E3WA 4NV0A 5KIAA 1E7YA 2HA6A 2Q6TA 1K6JA 2F55A 4JBHA 3P4XA 3TOZA 5HOEA 3CCFA 4M9CA 3E0XA 3VNAA 1YBHA 5CVUA 4KQXA 1J0AA 2KSQA 1SIBE 5FPHA 4ZYZA 4OQDA 2AQIA 2Q49A 3KXPA 2R47A 4PC2A 4DIBA 3D4NA 3MHPA 4IFEA 3PJRA 2CXXA 5T64A 1IVSA 4XUCA 1NSFA 5KJ6A 4B74A 3OE7D 1CYDA 3A6LA 4J29A 4UMFA 2AJCA 4YBZA 5HKKD 1VBNA 3N0WA 4ZVUA 4C01A 2IUEA 2FUKA 4NJEA 3FBTA 1EA5A 2CB9A 2FMHA 1DAIA 2C8JA 2EFHB 3KZXA 3ND7A 3AHEA 3V34A 5AOCA 4CETA 1XD2B 1VP3A 4R6WA 4X6YA 1ZL2A 3ZTWA 2WVAA 3GBVA 2I8CA 1Z7WA 2FK8A 1A5BB 5HIIA 4U6SA 5MN5A 2PLRA 4KO2S 1VXRA 4FINA 4LV5B 4R2JA 3NIBA 5DLYA 3PQ7A 4KIWA 3ADPA 4P22A 5MDHA 2Q3DA 1E7MA 2OXRA 2VNHA 1DDOA 1V6SA 1XRQA 2GWRA 3BGSA 4KAXA 4ZQHA 5EJFA 1LVGA 3PICA 5KYVA 3EUEA 2OL4A 2P27A 1UZUA 1TAHA 3KHTA 5JSKA 4OAOA 2QJOA 4Z7OB 5CCEA 4DTIA 1KRWA 4F4DA 2GA9A 3QUBA 2ZVQX 3D3WB 4XX0B 5AM0A 1C50A 4FXOA 2OZVA 4ZKDA 5CFZA 1U1FA 2ZJOA 3DD1A 3QVVA 1UOPA 4UAUA 3S2FA 3ZVLA 3HKEA 3K0KA 4F11A 3F97A 4M1QA 5C7YA 3OQIA 1SUPA 121PA 2L69A 1WSAA 1YRQA 4LSMA 2UYCA 2EFDB 4W6QA 1M6VA 2W2VA 1WG8A 3L8MA 3U17A 1JHZA 5AHWA 1X3LA 4JBLA 1RYFA 2YWCA 2OCLA 1P5ZB 4UUMA 2J31A 5BV0A 1KAEA 1VE6A 1YWGO 1L7DA 1Z28A 4MGZR 4UBJA 4WHMA 2EW2A 4YAOA 1OFIA 1GGNA 3OCVA 3PI6A 3VYWA 2DRIA 3K0CA 3H4TA 4BE7B 2XZTA 1WX1A 3C3WA 3GJ0A 2VDNB 3VOAA 4KBYA 1YU6A 3MELA 4MGKR 2C2HA 3C3XA 2HQRA 5COAA 5B7QA 3HYNA 5FBRB 4QATA 4WNIA 3UH0A 3UVEA 4A6EA 1A69A 1G21B 2RIRA 2XNDA 3GK3A 3NI2A 5JNLA 4Y2PA 5T3YA 3AUFA 4ZVNA 1X80B 1YRWA 4F45A 1JTVA 4OXYA 4CMHA 4U2GA 3EEOA 1BX0A 1BDIA 2FWIA 3B3QA 3SIPA 2PRZA 1JDZA 3TVDA 4TMXA 3MJTA 3BWXA 4ZOLF 3PXGA 3TJZA 4B6GA 3IOEA 4DJDC 1ECPA 4ESHA 5EZ6B 3T95A 2OT3B 4RV5A 4YP0A 5GGXA 1Q21A 3QV1A 3E0QA 2JFBA 3RVQA 3EQ8A 4GR9A 3WMFA 1BYIA 1Q20A 4CMGA 5JWOA 2FPOA 3C97A 3EG5A 3L7MA 4ZTZB 2JFHA 5E6SB 3IHTA 2GF0A 1S8AA 4KEAA 5DM0A 3SF8B 4QM6A 2NU6A 3BN3A 2YYSA 3KSUA 1QHHB 2H1WA 2D5AA 2Q1XA 5GIOE 4EFMA 3S55A 1JR2A 3TM4A 4RZXA 3QZUA 5J58A 1W36D 4R69A 2RSLA 1UBFA 3OCUA 4DV7B 2GN4A 2HMSA 2PH7A 3SIWA 1QVVA 3ROTA 4EG3A 3UMMA 4TUYA 5FEUA 4B0OA 1H42A 2QW8A 4IG9A 4C7VA 5BRJA 2FI1A 4I36A 1UDRA 5TY0A 1II0A 4ZYLA 5HP4A 4JYAB 1IK4A 3DBVO 2WB4A 2QUBA 3G9ZA 5DVZA 2FFQA 3P9QA 1PWXA 2ZUSA 4DUYB 2YVQA 1ZK0A 2EHDA 5DNEA 4UFOA 4B8YA 1QCDA 5IC5A 1IJFA 1KNQA 3TXXA 4QO8A 4CMAA 4G0MA 2IT1A 2EW8A 1YJAA 4A4DA 4PRZA 1N2IA 1DFGA 1KWKA 4LDZA 5DTQA 5B2ZA 3VR2A 2H1HA 2JBHA 4KMOA 5A2QA 2FPXA 1BH6A 4EB6A 1HX7A 2GFIA 2ZB2A 3RQIA 1JILA 5BVGB 4QBFA 3VNRA 2XQIA 1N5IA 2DPXA 4HJRA 3GXOA 1R66A 2I1QA 2RCYA 3ZC3A 4D9BA 3L7DA 3BMQB 2XNCA 4RY8A 1ZAYA 2ZSEA 4QOGA 3OLWA 1LWOA 5IC6A 1Q1AA 2WV9A 4NV1A 1QQTA 5DE3A 5ALIA 2YDYA 2BEWA 4R1SA 2RGGA 3KC2A 1A76A 5IRCD 1OJLA 1KYTA 4LYFA 2Z8ZA 1Z6XA 2R6HA 4OQ4A 3RVPA 4DZTA 2LXNA 3DM5A 1H2YA 2OLJA 4W5QA 5TB5A 2JS7A 1JPUA 4IR7A 1P7VA 3GEMA 4CMIB 3A58B 3B7PA 2C7RA 1FZTA 1EVLA 2C9MA 1Y1RA 3CZ4A 3DJYA 4PTLA 1JE0A 2Y1LA 1R0WA 1SC3A 1Q11A 4MKXA 5CM8B 3M4YA 5AJWA 3TPZA 2AKYA 3PUWA 2ORVA 5GONB 5JFOA 3QTTA 3NM4A 1M6NA 1H93A 1SZDA 1YRBA 2PV7A 2VP0A 4J7CA 1CJVC 4N5HX 3A36A 3DEYX 4BFCA 1JG3A 4ESEA 4CLRA 1RKBA 3FPKA 1FDSA 4RL6A 3VVBA 4K9OA 3BZWA 4WBSA 3FSGA 1XVLA 2O3UA 2XCIA 1RLUA 3O3NB 4M0KA 1NE7A 2W2OA 1JR3A 1NNSA 2ZI3A 3PVZA 4QOSA 4R5MA 1ONSA 3ZDFA 2OXEA 3LKVA 1RVDA 2YOGA 1JKIA 3R20A 4MR8A 1VKOA 1FRQA 1E2LA 1ZMBA 2PGOA 3RSOA 2QRQA 4ETWA 2EKLA 4P7FA 1VJGA 5H68A 4ZP1A 5INTA 3IP7A 1EDBA 4LMRA 4QQKA 5I7WA 5IT0A 4ZFNA 3UMJA 2QMQA 3SC4A 3KRTA 1H5QA 3HJAA 4K88A 4XJSA 4ECEA 1MDFA 3UOAB 1W96A 1RYZA 3PNLA 2ODBA 4FYKA 4WJZA 5LXTB 3M6UA 5ER6A 3H83A 1V9CA 1E3EA 1U2RA 1E2HA 2E9SA 2YVUA 4OFZA 4P4UA 4PE5B 5BNFA 1H3EA 3VVLA 3K05A 4J49A 3HNPA 4C9BA 1U7ZA 1Z2EA 4HXFB 5LA6B 4WE3A 2ZROA 5LCXA 5A3SA 5LNK6 2VTEA 3GT3A 3KJQA 1A9OA 4C76A 1FW6A 3B5EA 4JYZA 5JC1A 1GCAA 3IR5A 1IK6A 1D4FA 3MWJA 1TJ5A 3NH9A 2W2TA 2HMAA 1DEKA 1Z47A 1CZNA 1NSYA 1R18A 5BW6B 1JMYA 3SX2A 5CH3A 2VRWA 3IXQA 1Z4IA 3I8OA 3K0HA 3ROKA 3PEEA 4D9IA 5EE9A 5KYUB 2WNHA 1XCJA 2HK7A 1IY1A 1FK8A 1ORVA 1SVOA 3HBFA 3L8CA 4GBED 2NMVA 4O4LA 3GLIE 4PPNA 1N5LA 2HXGA 1PK7A 1MXFA 3LFTA 2JFWA 3QEJA 5FHRA 4EF4A 4QVKA 4I3GA 1X2BA 2O1SA 5BQFA 2BL4A 3IAEA 4A9AA 7GPBA 3WGUA 3BHNA 2AZMA 3LW7A 3RS5A 2WVGA 1W94A 2OBXA 4RF2A 4DNFA 1UJNA 2HCTA 1FX1A 5EJ9A 5SYAA 1ECCA 1U8FO 4ZU6X 3DTYA 1DXYA 4FZ5A 4NJOA 1FNSA 5KNDH 1YZTA 3RC2A 2O8FA 3UK0A 1G5RA 5EJ8A 5JAMA 3IO3A 2AFIB 2FG5A 1P4RA 1YIAA 3OFVA 4EDFA 1UDXA 5IZ4A 4OUDA 3W9YA 1TJ4A 1N1GA 2AC7A 5E1DA 1LTKA 5TQ2A 4L8YA 4JT2A 3AP3A 3IQGX 1BXGB 4MKHA 2R7NA 4B2PA 4G36A 1ISIA 5IXJA 5JANA 2D2VA 4RA6B 4V0SA 3UMSA 2LBPA 1XZGA 3ZWMA 3BXXA 1XD9A 2WJ6A 5SY9A 2QUKA 3OCWA 4MW9A 5EN4A 4NYJQ 5SY6A 3H5LA 1SOAA 4H3KB 1SQ0A 1J0DA 4A8TA 4DLZA 1V4BA 2YBDA 4PC1A 3WAJA 2YZ2A 4DR2B 3E23A 2OPHA 1SC4A 1K9SA 3MCUA 4J8PA 3VUFA 4MRAA 1LS1A 5CRIA 4WXYB 2AL7A 3F7MA 5EJGA 3EZ6A 5LQDA 4WZBA 2R7LA 5JVDA 5CX4A 3FOFC 3ASVA 4NJMA 1PR3A 5HKKA 4L22A 1J99A 1O58A 2YH2A 4L8FA 5AW0A 3FNBA 1Z4QA 3SDZA 1ZH6A 3COSA 3VNSA 1HYGA 3OM9A 2DBZA 4QQNA 3GFBA 4UULA 3U7EB 2Z1DA 3MCVA 1OCEA 2BEUA 3HY3A 4ZAWA 3U81A 3DKVA 1MQAA 2X0FA 1VHDA 1U2PA 4HUQA 1T2UA 4X91A 5B2FA 2QI9C 4WTOA 2VHWA 1KAGA 4BIMA 1OFUA 3ZHVA 5I8WA 1VRVA 1PJ8A 5TC4A 4MYSA 1F5NA 4Y30A 4F3TA 1XU4A 4Z9XA 1ZISA 2WPDA 3QNMA 1QVRA 2IYWA 4NYJR 5ENVA 4IXDA 1HFEL 1ZRSA 2MHCA 3OHMA 3WV4A 3EXEB 2C95A 2FLKA 1ML4A 1OI4A 4NPHA 5DW0A 5EJMA 1LI5A 1A50B 2YQ4A 3AXSA 1QRTA 2ZS7A 1C14A 4LZPA 2RHLA 3ESDA 3GEPA 1U9JA 4ZD6A 3GV0A 4QG3A 5JSZA 1LQUA 3VBCA 1DDIA 1OR8A 1QAMA 2EARA 2F64A 4UCQA 2O3QA 3DKRA 3ZYZA 4BLPA 4UFPA 1MB3A 3QU2A 3AXTA 1XZDA 1X70A 3NFRA 4BEBA 3TBHA 2XQVA 5DNCA 1KXJA 2JGLA 1NIPA 1NRJB 1N2EA 1U2GA 2UYQA 2UAGA 4P35A 3RTEA 4JP8A 3AUJB 3ZGZA 1H8HA 3SQWA 1E63A 2Q5FA 3O4JA 2PGXA 2WF8A 3UJ8A 1YQXA 3OG9A 1M5RA 1N32B 1NJ1A 1NVEA 1VL2A 1NLMA 3BWVA 3EOBI 3T8YA 4TTRA 5B2EA 2WTXA 3FPJA 3L18A 4X85A 2ZPAA 1N1EA 1Z75A 2XH8A 2FZWA 1JDUA 5A9RA 1HC7A 1NUTA 4DLLA 2IIPA 4OIFA 2QM0A 3MT7A 4FYXA 4IDNA 3TL2A 3FHTA 4HWKA 1QHGA 4A0RA 3WNCA 1GADO 2GZSA 3KHSA 1IOWA 2AFHE 2HMWA 1SIUA 2P9CA 5DM1A 2GUGA 3KSRA 4JLWA 2QT0A 2FUG1 1E5VA 3QMPA 2FJUA 2GYWA 3FKJA 4O63O 5A6VA 3U7FB 2AR7A 1JDJA 1ORWA 4M9QA 1ZP6A 4KGVA 5GY7A 1GP2A 2R8BA 4J2HA 1ZK2A 2AUMA 3SS8A 1KMHA 2IRWA 1DIAA 2NYUA 4FZJA 3VAZA 3K73O 2PX0A 2X7JA 1T2EA 4DXDA 3M4NA 1IPFA 1KJWA 2HSJA 2HY7A 1RAAA 1ZS9A 3DO5A 1G5PA 3LCCA 4JUAA 1R16A 3QEOA 4QOEA 2I71A 3GEGA 3DM9B 3UMRA 2XCQA 3SKYA 2G8LA 3ITDA 1DBIA 1CE8B 5IK2A 4K9DA 4TV8B 1JHOA 5DN9A 1E2GA 4MQBA 4AVYA 2CF6A 4NENB 3D5TA 4W7IA 4LWOA 4MVJF 4X84A 4Y9RA 4EUEA 1D1QA 4F96A 5KWVA 1O57A 4K6HA 4ZQFA 3A1VA 1ORTA 5CD9A 2QEQA 4JK3A 4IIJB 1CERA 4UE6A 3EVEA 3DWFA 3MRTA 3V2HA 3KKNA 3WA7A 1GA4A 1BDHA 1N2HA 4BE4A 2OZEA 4KO3S 3CLUD 3KZNA 2RBKA 4ZEMA 2XRMA 4B73A 3QITA 3Q5GA 1AUPA 2ET6A 3MGAA 4FYIA 5EMKA 1OI7A 1QP8A 1VLVA 2XCTB 4QZVA 4MR7A 3ZZ1A 2J9YB 1FBNA 2XE4A 3BICA 4FFWA 4X3PA 2Q6VA 3KALA 4NZYA 3N59A 4V3BA 3ZHRA 2B1RA 4IEFB 1P9WA 1RI4A 2V3CC 1CUIA 4IEIA 4QQRA 3C5HA 4Q39A 4JP1A 5HCUA 5JSUA 2AZXA 1SXJC 3OKFA 1KH3A 1IBRA 1BJRE 2G72A 3SEZA 3VA7A 3CX4A 5H3HA 1C3JA 3FA2A 4YI5A 2X3YA 1UPTA 1RD4A 4TLCA 4DJTA 3NCTA 1K08A 3DFUA 5B3JC 3PGLA 2DZDA 2YNMC 5D85A 1I2MA 3TLYA 1CY2A 2OXFA 4R9NA 2G5GX 4HHEA 1JMVA 2ZOSA 4KMSA 1C9NA 1HGXA 2J46A 5FPPA 3REFA 4BNHA 1O6GA 3F3KA 3DZ8A 2R11A 4NMWA 3G8AA 4NPCA 1M33A 1VGRA 1KO8A 1Z2AA 3Q3GE 3FROA 4V0RA 5A4FS 4GOND 1RFLA 2WZBA 3DE4X 5EWLA 2HXSA 1NNEA 4RV4A 5C81A 3O7WA 3V7NA 2PGDA 3WVNA 3WO1A 3REGA 3PKJA 4BGIA 4TS4A 3WGGA 1YD7A 3C1TA 1LY1A 1WCIB 2RKWA 1XZFA 2FP4A 2YWXA 3H5TA 3OUZA 1EU1A 2I9PA 3S99A 5DV9A 1AHPA 5KCMA 1W47A 3DT9A 1QCZA 1I5EA 3F5QA 2JANA 3RWBA 4EG8A 1FP4A 2H2IA 4J7AA 5FYDA 2R6CA 3RT7A 3SM9A 1RQ2A 5EIFA 2I6XA 4ZRMA 1L1FA 1WHTA 4CM5A 2O9JA 3NVDA 1HQCA 5B6PA 4S04A 3ZDEA 5G3YA 2GPSA 3V1TC 3EZXA 1GPMA 3KXDA 4FHFA 1NJ8A 4R1LA 2D00A 5IH3A 1YKSA 1K68A 3B1KA 4IQ0A 4RF4A 5G4KA 1LRJA 1UBJS 2EG5A 5F2KA 5BV7A 1LDGA 3BXPA 3PR2B 3ANXA 3TUZC 5HGJA 2E37A 3PHLA 3LC2O 1IHDA 4WA7A 2B2XA 3B48A 3JWHA 4HAVA 4JCCA 1UUFA 1N57A 1Z5ZA 4U7HA 4JUFA 3R7FA 1IUKA 1X14A 1KBQA 2ZFUA 4S3MA 4U7WA 4C7BA 4GT1A 2AXEA 2G6TA 3AF2A 3VHLB 4V03A 2QUJA 1NN3A 5M29A 4DRXB 4QUDA 5DM70 3IIIA 2PMFA 4MVJI 1OU0A 2FFAA 3OQNA 2B8TA 4EABA 3QSYA 5BNTA 3I9MA 2YWGA 3OZSA 2HA5A 4EB3A 3QX9A 1EFAA 4ITVA 3UBMA 1X9HA 2OCKA 1PWEA 2VZEA 4FNOA 5FORA 4JYBA 4DLSA 3IP8A 4JGGA 1WQ3A 4M49A 3G2KA 2EIXA 1Y37A 3B12A 3DVAB 4U3JB 2R00A 1U98A 4R84A 1O0SA 5FOSA 5NULA 5T8KA 3UC5A 1G9TA 4V0MA 4ARZA 5K0ZA 4LV8B 3PGJA 1VPEA 2X5NA 4IX9A 3WAKA 1SZJG 2JFZA 4OB6A 1P72A 1ZI6A 1YQQA 2HIAA 5FFFA 3M1IA 4FFRA 4BYGA 3JSAA 2FW0A 1UBCA 1GTSA 3GZNB 3HKCA 4Y2SA 2ZT6A 3BE4A 1LW7A 2AXQA 4R8SA 3H11B 3SXUA 3TW8A 3SFVA 3ZV6A 4RPHA 1QQBA 1TEXA 3E70C 5TJ9A 1V41E 4YQYA 1JP7A 4KOAA 1LBIA 1DIGA 2W2MA 3EAFA 3NPMA 2ZJZA 1AKEA 4OHRA 1G3RA 4E03A 1Y5RA 5EJ2A 5ERYA 2WJGA 3K9QO 4FOTA 5H0IA 4GBMA 2WM2A 5AI5A 3EXG1 1P1KA 5BSEA 2RE8A 3OTOB 1DWOA 4CDNA 4NHEA 1QX3A 3PPIA 4J91A 2FQ1A 4DNPA 5LZ5A 1BEEA 5ICSA 3LV8A 4JL8A 1PGNA 1AN0A 1ZVJA 4FNGA 4XWKA 2HGZA 3KJNA 3BGOS 4U7FA 2PZLA 2QMZA 3UANA 1E18A 4NBTA 2JIBA 2NX2A 2OG2A 2HDHA 3K9LA 4OGWA 2OXIA 4QUKA 4CLOB 1NVAA 3HZOA 5J2UA 3GG2A 3JQBA 4IMJB 2YMPA 2PZBA 4TMZA 5IS2A 1OAOA 1E58A 2BKAA 3OSUA 3Q88A 2E5FA 3FPSA 5IJ9A 4N47A 2BDTA 3IESA 2FVYA 4Y6SA 4UVDA 3PWKA 2R8YA 1V9SA 3MJVA 1WZNA 3T1QA 1JFSA 3DOUA 3Q7SA 3TVTA 4TMYA 1NF2A 3I9OA 3IMEA 4L4ZA 1DMRA 1OBFO 1ZCJA 4LJKA 1L5VA 1UFKA 2IGTA 2PQ0A 2ZWOA 3KT3A 3NORA 1D5WA 2B1JA 2I0FA 4I1VA 3LH5A 3RK4A 3ZKAA 3MT0A 4D97A 3SYLA 5KOYA 1XWIA 1L1QA 1INLA 4J9VA 4N41A 2A30A 2EJUA 1PZFA 3NIFB 1XQYA 2OB1A 3OY7A 4ND2A 4X0EA 1AKVA 3FOAA 1WHSA 1DQYA 5DULA 4H7EA 1WUYA 5CDYA 4P4LA 1NXTA 1O4WA 4QUJA 1BMFD 2QQEA 5KAPA 4G0ZA 5EWMB 3WS7A 4COOA 1GTMA 2CMFA 3HJRA 1A9ZA 3BL6A 1Y1LA 3LO5A 4F4CA 2CLSA 4YRMA 1ZFNA 2QVBA 4I5DA 3DTVA 4Q3KA 3SICE 4EJFA 2W2NA 2HCFA 4ED9A 4N76A 3DHVA 1GJRA 2QRPA 2DPYA 1QNLA 1MIOB 5D1HA 1BG6A 3UENA 2F1IA 2ZI5A 3PJEA 1PSDA 1WSWA 1P5RA 1WCYA 3KEFA 3DTNA 4DR7B 4ID9A 5HQTA 2PMDA 2NPFA 2R44A 3P2KA 1HE8B 3N3BC 4RNDB 2OXCA 5BORA 4Y1GA 4YR7A 1NQTA 3P2IA 1PR0A 3LCVB 5C7IO 3FMOB 4F2WA 4WXHA 1G42A 2ADMA 3ILVA 2A1UA 3ESYA 4R1QA 3TZCA 2XYHA 4EHIA 2VT6A 3CLRC 4BP1A 2F3QA 4IG4A 2F62A 4XW2A 3P0IA 3QA3E 4Z9YA 1Z68A 3FF1A 1J2RA 2ROQA 3UB3A 4AUMA 1Y1QA 1JFFB 2HCJB 3OWHA 2NTEA 2X0DA 4DG5A 4EUKA 1SD5A 4KSBA 4UEQA 1OYVA 1WNFA 3NHAA 2YFHA 1RCFA 4R6XA 5L3RA 1V11B 2IEBA 4TS9A 3RD5A 3PUXA 3V3TA 3GGDA 1NMEA 3G79A 1F7VA 1WBDA 1C80A 1TTHA 3TTTA 1N34B 4KXNA 3PP8A 5B30A 1T0UA 1EFTA 2IUFA 4M53A 2Q9AA 4H3HB 2XW6A 2C9OA 5C7OO 1P0PA 2ZJ4A 3BXZA 3UKDA 1S3GA 2RHDA 4RH0A 3DZKA 3VPAA 1LWNA 1ZVKA 3NAZA 4OHVA 5KTKA 1IWBB 2B82A 1M0TA 1E6EA 1OV4A 3VDRA 3OJFA 3DNPA 4FGUA 3VHXA 4D8WA 1ZJJA 3PK0A 3T3EA 2X6RA 3DJFA 3V6MA 2E5LB 3OEHD 2X2PA 3BCUA 3HYRA 4MKGA 3RC3A 1ZM7A 3K53A 2ZZKA 1SUCA 4YJHA 4EGAA 2X0EA 2DJ5A 2EC5A 1U7WA 2EZ8A 2XYRA 4KR6A 5DHTA 5BNZA 4CTKA 4LMAA 1FFBA 4W5WA 4Q1FA 3JR7A 4N8EA 3S4YA 1PW7A 1PS0A 1WNTA 4QNRA 3PB3A 3BD9A 3E9DA 4EY8A 1LV7A 3QE4A 3GCZA 3O4VA 1PQYA 4X95A 4Z9FA 3RLIA 3UHFA 4IOKA 4RM3A 2VHUA 3MMZA 2DBRA 4C30A 3FMFA 3ZHXA 4B7UA 3IX7A 3FVVA 3TLEA 4LHSA 4UU0A 2HL6A 2VDLB 2I3AA 2J59A 3FOWA 4R3WA 2REBA 5AOAA 4I3HA 4L85A 2FZ4A 2G71A 4DBVO 4HN2A 4JJKA 5G4LA 3UQYS 2PZKA 3FVRA 1B3BA 1OJ7A 1E3JA 3CM0A 4ZK6A 3FJYA 2H2DA 2ZXUA 4G0WA 4V2IA 1XTPA 2VTVA 4FKBA 2XXAA 1Z26A 2JIDA 3ZEAA 2IYVA 2ZUUA 1BE0A 3FSJX 1IBSA 2G06A 5HK8A 1NQWA 1SVLA 4HEHA 2Y1FA 4A16A 4YRSA 3R40A 3EF1A 5CLJA 1A77A 2E4YA 3ZQ6A 2NNWB 3SHTA 2R7KA 3MTJA 2A5GA 1B43A 2A0UA 2XNHA 3R77A 4NBSA 1UKCA 2C97A 4QC2A 4OI2A 1KO7A 4HAUA 2R751 3G49A 4BNLA 2AN1A 4BBJA 5SYMA 2H1CA 2XDQB 4Q1AA 1A72A 4TKUB 5B36A 5KNBA 4LDQA 1EIWA 3DWIA 1TTPB 5FBQB 5M3BA 4WN9A 5AKXA 3JALB 5H3CA 2XZOA 1QKKA 4FOOA 2A4MA 2QZJA 3GRPA 1Z2NX 4ZALA 5LQRA 2R9VA 3G8DA 1XCMA 3QBVA 2WOOA 3CH6A 3HLYA 1QP7A 2AMVA 5JQGA 3PWSA 1FFEA 3LG2A 3E6AA 3KKOA 4XWYA 1SK9A 3GGPA 3OZBA 2HTEA 1NJ6A 4F8EA 2OCBA 2VFAA 3FCUB 2P2ZA 2XBLA 3KE8A 2HF2A 3K72B 1KPIA 3FYUB 5AOBA 2RHGB 2HF9A 2QYOA 1B8OA 1ID1A 3UXYA 2IELA 3QOXA 3DR3A 3WGMA 1S01A 4H3SA 1LGYA 1U9ZA 4RIEA 5FEMA 1GU7A 4EHJA 2GRAA 5BN4B 1WCXA 3ICPA 1WMFA 2OMKA 3AWIA 3N7AA 2VATA 4Z54A 3K2EA 4LNHA 2W4IA 4R2WA 4YK7A 1D4AA 3ZY4A 3PXDA 1I9CA 5K0LA 1AK9A 2QZZA 3CEAA 3NHBA 4OKIA 4B4UA 5J2TB 3QRWA 1HBJA 5KNCA 4JUCA 2HRCA 3QYPA 2GQ0A 4HXYA 1PR2A 1R6DA 2WV7A 2E1RA 3BSWA 5E6UB 4RNCA 3M6IA 4D41A 1NASA 1ZXXA 3AFGA 2BJWA 1XQ6A 3TAXA 1R5JA 3BAZA 3QXHA 3R0ZA 4MYTA 4DA8A 4MLPA 3VU9A 2J33A 5JISA 2D3WA 5FULA 3ZCVA 3BGVA 4D0RA 2VTKA 5EE5B 3O2SB 4ZZ0A 1XAIA 4GM1A 1P73A 2Y93A 5CH8A 2PJZA 3E2IA 3TB6A 1M0EA 1K3TA 2YW9A 2PGAA 3MGCA 1GYPA 5AI8A 4U5XA 1QQ6A 4HL6A 5GJWC 3TQSA 5K8IA 1I0ZA 5K3EA 3AW8A 4X6LA 2B35A 2CLOB 4BX3A 1NKSA 4PSDA 3D4LA 1XRJA 2ONCA 4P5PA 1RXWA 3KM0A 5A5VA 1R6TA 3INTA 1F0PA 3HE3A 4FDAA 4OYRA 4MKIA 5DYNA 3GNTA 2D2IA 2W4QA 3Q8MA 4YYEA 1F51E 2V8OA 3DVSX 3NDRA 1SXPA 3JQ7B 4GG1A 1L7PA 5GTDA 1KJ8A 3O3CA 3H6KA 1N2GA 2QGFA 3K5WA 2QQGA 4KH0A 1MJNA 2O8DB 4N5LA 2GCGA 1KK3A 2R2GA 4JVNA 1D0IA 4AN0A 5C8YF 2BFBA 1JFVA 3G6WA 1XPJA 2RK6A 1U65A 2ECOA 2R6GA 3FDFA 4H3VA 4WNAB 4ZAYA 5A6SB 3STUA 3RTGA 3JS5A 4BQNA 2JI8A 2FG6C 4RADA 5CLHA 4YHBA 3AHHA 2BMFA 3S1AA 3SEQA 1MX3A 1HH4A 1S6YA 3EVBA 2CWDA 3N07A 4KVAA 4X41A 1VHWA 4Q9HA 5I7RA 1K8YB 4CKEA 2NSYA 3LTNC 2HF8A 2O57A 3WG9A 2FCRA 3IIJA 1M2VB 2G5PA 1BFDA 1U4OA 2Q8PA 3T3NA 1DO2A 4Q34A 1HXHA 1AB6A 3S7TA 3URKA 2WFZA 4HYYA 4J16C 4UHCA 4A6XA 4CM6A 2J0EA 3H5WA 4H1TA 2A5FA 5HQ3B 2BYTA 4JGBA 2Z6UA 1YZVA 1Z18A 2IDMA 3CLUC 1JWBB 1E32A 1W1WA 2HNBA 3OZXA 3R6GA 3GLSA 4LHEA 4N54A 1EFLA 3KL2A 5CB8A 1YR6A 4IDBA 3DEZA 4R0VA 1XVIA 4RMGA 1L5WA 5HX7A 1DEOA 1E77A 1YB4A 2GD0A 4E5PA 2WE8A 2X8JA 4LGYA 5JPIA 3AF6A 1UZAA 3D8BA 3DB2A 5FCDA 1XNHA 5AW4A 1F8FA 1XTSA 5F3WB 3GOHA 4Z6KA 3T15A 3M8KA 2C1EA 3RCBA 4CIBA 2ZITA 5L95A 3VO8A 3M5DA 2WABA 2VCHA 1QO9A 4BE9A 2P9FA 2C4KA 4D9MA 2ZJ8A 5I7VA 3R0VA 4GXNA 4HX2A 4G4GA 3TIGA 3KQNA 4F92B 5AHRA 3WOVA 5JH7B 3DV0B 1MF7A 1UL1X 2O2ZA 4LS3A 4E2YA 1T9ZA 1NNLA 1SCQA 2QLNA 3P9CA 2ZM5A 1PBNA 3NBQA 1EQ2A 1RXEA 5AVTA 1GUDA 1ISMA 5BQXA 1HEIA 2MCFA 2P9BA 4AUNA 1MAVA 4K6OA 1IDOA 4NBVA 2QTRA 3UPTA 4EPWA 3ISTA 1KETA 1PQPA 2P9YA 3LL4A 4AQDA 2BUAA 5L3SA 1W52X 3LP5A 1ZOPA 2WKSA 5LKAA 1VDZA 2C5LA 5CA1F 4OTZA 5CDHA 2A9FA 1ADBA 1CW2B 1T9BA 2BF7A 4WL0A 5H7XA 1DBRA 4NVRA 2WWVD 3H2IA 3UAGA 2C7OA 4G2TA 4XDYA 5B6JA 2IQIA 2W2QA 2F1HA 4MVJD 1JDBC 1MC4A 4LBZA 4MKRA 4EI8A 1GKKA 4XPZA 3HNRA 2H2GA 5DXAA 2GZAA 1RI5A 4JI7B 4O4HB 3M7IA 1T24A 2ZRDA 4LE1A 3AQ4A 3RVNA 4FCCA 1SULA 3SZMA 3UIEA 1ZD3A 3KUKA 3A3OA 3S81A 5BYKA 1GDTA 5DHUA 4RYDA 1UBRS 4O5AA 2NUPB 1KQOA 1LX6A 1EZZA 1CUXA 4J0FA 5I4KA 1WPRA 4RKRA 3U26A 1O89A 5EL0A 4ZT6A 3QUTA 3HXLA 1FB5A 1EVIA 2VKTA 4TMVA 3W2EA 1OKKD 2G25A 3N76A 1EFPA 2E82A 1PLKA 2X0IA 3L8FA 3MJDA 4UCXA 5ERGB 3GOQA 1ZGGA 4FU0A 5CDGA 2WA1A 4ZT4A 2V9ZA 5BNIA 3CKYA 4I6EA 5B58T 3T5TA 1Y9JA 1NURA 3GCXA 4G1EB 3V4FA 9LDTA 5HM6A 1Y7IA 2C4HA 2WU1A 1G6HA 5BWMA 5D7NA 4W5RA 3RVDA 1B73A 1KEUA 2IEGA 1VLLA 2QD4A 2OD2A 3EPPA 4DSZA 1V3VA 3IP3A 4AFNA 2ZJ6A 1RNLA 2ZR0A 3OQJA 3BDIA 2CGEA 4YT5A 1HZJA 2V7UA 5KBYA 2DPMA 2JBAB 2VJNA 3K9BA 2DEUA 4B48A 2QR3A 4GOXA 4H0FA 1GFSA 2ATXA 3LP8A 3DA8A 4L15A 3O84A 4G01B 4RSMA 1F6DA 5ENDA 1DRJA 4DQ0A 2WYWA 4Q03A 4R0MA 3VZQA 1PJSA 2HPZA 4R1TA 3HLKA 1XQ9A 3EFOB 4IZOA 5DP1A 2X8BA 4YECA 3WGYA 2C83A 3MB8A 3WRXA 1EVQA 1ZCZA 2BW0A 4X66B 2YIDA 2I1VB 4UARA 3FWYA 3MTGA 1WZEA 3G0GA 5DNDA 1LSSA 1YB1A 4KVGA 4DUGA 3WFJA 1DS6A 4EHNA 5TMBA 3COYA 3U7QB 1U3CA 1XDSA 1FQOA 4GNKA 5CTJA 1N78A 2KBFA 5HJEA 4FZRA 4HAWA 3U4CA 3OX4A 4YWJA 2B3DA 1QYVA 5K0BA 2BKLA 2G40A 2FZKA 3ONWA 3ZWVA 4ZHQA 4YTEA 1E3SA 3CF6R 5FFNA 1P0MA 2QAGB 5EKXA 3WQRA 4FLFA 2X4DA 2OV3A 4QLAA 1Z07A 3GUZA 4JQZA 2B25A 3V5NA 2V1UA 5FQNA 3E7XA 4QU5A 1KI6B 4PSVA 1BZYA 3WSWA 4ZGWA 3RYFB 2J4CA 3PQ4A 5HJ2A 2PX3A 4ZGBA 1SQSA 2YJ5A 1QYXA 4KQ6A 3GCWA 2ISSD 2LTAA 1C8KA 2HK9A 3OMLA 1A7UA 2GCOA 2X6QA 4G5SA 2WMOB 3LA6A 3RSSA 9ABPA 1RBMA 3JPWA 5IUNC 1E3DA 3DZIA 2Q7OE 3LS2A 2HA2A 1P19A 1D2AA 4ZIRB 3PQ2A 1CFJA 1TPYA 2PZJA 3VR3D 1H2AS 1K6XA 1V7CA 3DAGA 1HETA 4AZ0A 2FEMA 3GLHA 2Y0EA 1KNXA 3I9KA 3HJBA 2CLDX 1EVYA 1DFIA 1BCRA 2WJJA 1V2HE 2P77A 1SUIA 2AEMA 2PMCA 3KDPA 4IDGA 4JKYA 4NI5A 3L1JA 1PT9A 5G1PA 3T5DA 2FHPA 3KQWA 2BTEA 4KDEA 2YJZA 1G8FA 3PRHA 1TMKA 1J8MF 4H7JA 4JELA 1G2OA 1Q3KA 2R60A 2X8WA 3WLJA 4EDHA 2H2WA 3IVRA 3JZDA 1JXAA 4HAOA 3U2QA 4OG2A 5LQJA 4B81A 1PDWA 3Q3EA 5AUNB 4Q4HA 3EHDA 3NV9A 3QWAA 2XKBA 4ZU1X 1M67A 5KDDA 3JARB 3KD3A 1FFYA 1ODKA 1KH1A 4RA9B 1KKUA 3I34X 3CEMA 5AVOA 1G0OA 3PDHA 1LNZA 3JQAD 5JY1A 4WFJA 2W22A 2OSBA 3H2ZA 3MD0A 2WYHA 1KERA 3Q7TA 3WZMA 4LI0A 1R6UA 4OLJA 3RF7A 4C0AC 5KJCA 1ULUA 3D6HA 4BMVA 3F67A 2AF4C 4RWZA 4G4IA 4TZ0A 2ZS9A 1KHHA 2GSWA 4TYPA 4K0RA 4MB2A 4OL0A 4BEWA 5ADWA 1BDMA 2NTYC 3QWHA 1ILEA 4DDTA 3TX2A 4P2GA 2CLIB 1LRLA 3BRQA 3UT0A 3QVUA 1XDZA 4FD2A 1J8DA 1NFFA 1E1YA 5FNVA 4TVKA 2Y3IA 4GM4A 4GOLD 1N9GA 4EUNA 2H54A 5CX1A 1HNXB 3EDRA 4FILA 4I4NA 3TZEA 2HNKA 1KK2A 4RZHA 3RIEA 4IJ5A 3PRJA 1JQAA 3JAWB 4QXQA 4X1IA 1TVMA 1G6Q1 5J1SB 5M7EA 4Y9UA 4N6NA 4JXJA 2P62A 1EUCB 2C9YA 3RBVA 4CN8A 4IHAA 3T7AA 2EQ5A 1XOIA 1OAAA 2GZRA 2CMKA 2EKZA 3D31A 3ETEA 3IUBA 4PVCA 4AN4A 1NG1A 2ZJ3A 1QONA 2EP8A 4GYKA 2QL6A 2VDMB 1N9ZA 1XYVA 2WHQA 2PKYX 3PC3A 4IIVA 5F98A 1HT2E 5I5EA 3FHJA 2WG1A 3JTMA 2Y4OA 1P2SA 2C2GA 1HZZA 3F5MA 3H17A 4NCIA 3AI1A 2Y4NA 1JQKA 5A4AA 3RASA 3VNUA 2WBLC 4PTYA 2HFJA 2N1BA 3RS4A 3X1MA 4JJ7A 1TQHA 4AQYB 1ZM9A 4F4JA 5K8TA 2QL9A 5TQJA 3QUQA 2C98A 2GXQA 1DWPA 2W2PA 1LCIA 3GAMA 4Q02A 2HPAA 3ABRB 4MB6A 1TJ3A 3D7NA 4BVLA 2VDKB 1R12A 4ZPXA 4TXNA 3HS3A 5FHQA 4MV8A 5TVKA 2J4DA 5FDFA 2JGFA 3VR1A 1WF3A 5DCUA 4YCAA 1CDEA 2ODAA 5I7EA 1B14A 1MVNA 2G1PA 1POWA 3LPLA 3NW9A 4UHDA 4B17A 5HVNA 4ZT2A 1PTKA 2C07A 3P7MA 2QT1A 3ZDRA 2PU7A 3QF7A 4C1NA 2VBGA 1GPDG 5BWOA 4M1KA 2ZYAA 2CFOA 4FR5A 1TQ8A 3FAZA 1L6IA 4IDDA 4JQOA 3G82C 4MKFA 4Q1EA 4ZOBA 5CA0A 4A6PA 5I7HA 3A6ZA 3D59A 2NSLA 1M1NB 1BJKA 5F4BA 2W6IA 1TUBA 4URVR 2KQUA 4RSGA 2MINA 5FT9A 4AO6A 3WK4A 3RV3A 4MW6A 4JP5A 1V8ZA 3PR1A 4FKZA 2VLBA 3Q0IA 1QGUB 4G5GA 4CCAA 1E79A 1P3DA 2DKNA 1M8KA 1E1LA 4QXMA 5DISB 1W35A 1Z6YA 2GLXA 2CXPA 3RFUA 3ZD7A 3OEED 1X7GA 3IERA 3WYGA 2OGZA 1CF2O 3T99A 1AKUA 3W9BA 4L78A 3M6WA 2JGJA 3WIBA 5LZ2A 1PKXA 4V39A 3B53X 4RTQA 1T36A 1G7TA 2V5VA 2XDWA 2V6IA 4C0KA 5F3DA 4CG1A 1JFRA 3LY7A 3UHPA 4DR6B 2OCAA 3PUIA 4MUBA 4II7A 4D99A 2WSMA 4BX8A 2WSSA 5A5EA 4X20B 3RYIB 2CZGA 3M9WA 3R6LA 1SHLA 4OQZA 3U4IA 4U2EA 4GMGA 3Q0EA 2C99A 1QH9A 2I29A 2FPRA 4LV6A 4NZPA 3STHA 1UQTA 1QIDA 2EJCA 3S2SA 4C7XA 4LMPA 4ALNA 2UUAB 2V6BA 2FPGA 3U19A 4PZ9A 2J1LA 4DR4B 5LP6F 3ZW8A 4P4GA 3UJCA 2WMDA 2YYYA 3ANLA 2NYVA 2B4AA 4PQFA 3W6ZA 2C88A 5G0UA 1I32A 2H9AA 3MRXA 3D7KA 4H9GA 2JGKA 2L42A 1E4YA 1GPWB 3CEHA 1T15A 2WU4A 2XRFA 3DXFA 3HB9A 3ORQA 1U2DA 3O4IA 3L0DA 4MYCA 3ZWXA 2XGJA 5E6RA 5JYEA 3CR7A 3QLTA 4YJ3A 3DFFA 3EEIA 4IHJF 2F1JA 3HDTA 4RKEA 2HRQA 2QTCA 3KAKA 1UIMA 2ONYA 5LVAA 4PCAA 1TQ6A 2EZ9A 4URHA 2RI0A 5DCWA 2ADFA 1OX4B 3ZHOA 3AEKB 3OCXA 4KFTA 2ZIXA 1E3TA 4L4YA 2H92A 4S0XA 3K6SB 2NXJA 4QM7A 3EVFA 2Z98A 3HJHA 1XZLA 2ZAGA 3M6MD 2HQBA 2JRLA 2WP0A 3H3JA 4HAYA 4YXFA 2LKDA 2WPNA 1KVTA 3OKPA 1HFWA 2XNJA 2JI7A 2LP4Y 5EJEA 4EQZA 1T91A 3B6MA 3ESXA 4FMCF 3R0QA 3REQB 4ZPJA 3GDGA 4LBVA 5DXJA 1F0YA 1Z2DA 1X6VA 2WHXA 4KWCA 4OI0A 4A26A 1I80A 2NU8B 3EG9B 4BKMA 2V7QD 1HL7A 3GBPA 1NZFA 4YMGA 3ZU3A 3HEMA 1D09A 3HU3A 2YVAA 4F3NA 1T5DX 1TYZA 3X0DA 5LOVF 2B0JA 3HZZA 2F43B 3R7DA 1EE2A 3KEQA 3O94A 2GBIA 4LNAA 5LZ4A 2B8JA 2XTNA 2CCKA 2CKMA 4N7BA 2WHPA 1J8YF 5EGNA 5D6NA 3V3KA 1V6AA 3QMVA 2DVMA 5EXTA 3PNOA 4OJMX 4AYXA 1T2AA 1WMEA 2CSUA 1KJ9A 2WE7A 4A5OA 2G5TA 4CPDA 2BBWA 4N6GA 3L49A 4OHUA 1EJ2A 1WABA 3I53A 3LDFA 1GNSA 4BBZA 1P2TA 3G02A 4KQHA 4BXOA 2Q0XA 3TB4A 2BEKA 2DF8A 4PSUA 5HFNA 4N0PA 2V0NA 2FFJA 1Y34E 2A8YA 2YL2A 4O0MA 2C92A 2PMEA 2IVFA 4H2DA 4UQLA 4ESVA 2QA5A 4OYHA 3JQRA 3QBTA 4I19A 1TTTA 2YIJA 2F8MA 1CFZA 3BOSA 4BU1A 2QTZA 3ZZUA 2ZSUA 1J21A 2VHVA 1W30A 2GLUA 3KLOA 1P2DA 3L79A 1MTOA 2D1YA 2UZ1A 5EWJA 2BMEA 3W2FA 2KLBA 2Q27A 1RPJA 1XDGA 1XMVA 3NLLA 4KLRA 2WD7A 1ZBDA 3CZPA 2Y1OA 4LXXA 3QVLA 2AUNA 1H8ED 2OO5A 1F2UB 3LLMA 3CVXA 2QRJA 1NI5A 5AIBA 4J4HA 4JVMA 5KNDA 2WAOA 2ZDGA 1L3IA 3ONNA 5L7YA 3DT6A 5HQJA 6CHYA 4L2IA 3GNQA 3CW2A 1ZR2A 2UXCB 3DP9A 1J22A 1NI4B 2JKYA 4O4IA 1H2EA 3BORA 3JWJA 5B1HA 1APBA 1C7FA 3TF5A 2QQ5A 4PF1A 3NBZC 1DAHA 5AUOB 4L02A 1QKJA 2AOUA 2YN2A 4B34A 2I7XA 2WLSA 2XT0A 3A0RB 3A7DA 1HYHA 1JL3A 2AOVA 3V2GA 5A9SB 4LQDA 3BA1A 1VLMA 1G1MA 4ZCTA 4QNNA 5FWAA 2O07A 2JB9A 5C32A 4WZAE 1UXGA 1J97A 4PR3A 4X8OA 2DFPA 2GPJA 1TUEA 4XQCA 2CD7A 4WKOA 4ZVOA 1TEVA 1WXDA 1FYVA 4EAAA 3MAJA 3AVXA 3D3QA 1VSTA 4XE5A 2DSTA 3D4PA 1XTZA 3O8NA 3RUEA 4TWBA 2YZMA 1FP1D 3WLQA 1IXSB 1ZCBA 1CK4A 2YHSA 3UUWA 4Q9JA 4JJGA 3ROEA 2RK4A 1P5JA 2VOJA 1YE5A 2MYPA 4ZCPA 3UMFA 3QNWA 3G1TA 5EINA 1L7QA 3K2BA 2VQFB 2GN6A 3COZA 1DHRA 3Q9NA 4NU8X 3HCFA 2LUOA 1Y1SA 3EJ6A 4QBGB 3WISA 1RYYA 4I4TB 2VP2A 4DJAA 1V45E 2V45A 1SUFA 1E2IA 3B1JA 4RVHA 2RJ3A 4GMDA 4MNTA 3FFXA 1JLLB 4C7MA 3JQGA 1N7GA 5M5BA 5BV1A 3PJDA 2WWWA 3SOPA 3DL0A 2CNOA 4CGYA 4F0JA 2A78A 1D0VA 3IQZA 5SY4A 2V7EA 1W4AA 4RIHA 1KOLA 3KSAC 5AOVA 4AXXA 4IDHA 3C7TA 4PFJA 4D3XA 4BKQA 3OSZA 1DBWA 4YXWA 2YQ5A 3MTAA 4PLPA 2JGDB 3U4AA 4F9GA 3M2TA 2GNPA 4X71A 5HK9A 3V6LA 1T4GA 3JYQA 4DC0A 1CJCA 3C3YA 2UXDB 3UPUA 2YRXA 3PV0A 1Z73A 4M7RA 2Y71A 1QV6A 3P9ZA 2ONKA 1KI7A 4GYWA 4RETA 1JNYA 5IN4A 2EKBA 4L6IA 1I4LD 2VAVA 1DC8A 2NVOA 3O8OA 1J0XO 3QKRA 1D2RA 4RPGA 2I67A 4TM7A 4YV2A 5CXUA 1Z6GA 4N4AA 4HWGA 3OECA 3BQMB 3KIPA 4GPD1 3VYTB 5HSGA 1M74A 3TTVA 4D80A 4F9TA 4MUKA 4MGEA 4TT3A 3NNSA 1GEGA 1DKUA 2C2OA 2FF5A 2YTZA 4R8KA 2C84A 3R24A 4H4DA 2FSFA 5EKTA 3IT0A 3PA6A 5EFZA 2A92A 1WW8A 3UICA 4IRXA 2J4FA 3TQOA 1EEXB 4Y9DA 1A8IA 1IN5A 1QO0D 4UPVA 5ALYA 3QJGA 3C6MA 4QU0A 2ZJ5A 1GPNA 1E2QA 1MKYA 2RHMA 1YCDA 4FEEA 3ZIAD 4ZI7F 5LJIA 1VFPA 3D5QA 1NY5A 1GNTA 3AT1A 1WXIA 1XX6A 1ZGJA 2HWYA 3FIJA 3W8EA 2ZAIA 4BV3A 5B4TA 1H4QA 2Q07A 4BFWA 3FRJA 5D86A 3CO0S 3UJPA 3H5RA 3VKVA 3OFJA 4JI0B 2WWYA 1O9GA 3ZWCA 3B5JA 4TN1A 4CFZA 2QR5A 3T52A 1LUAA 1Z17A 1I2ZA 1TKRA 2QRLA 1EB8A 7AT1A 3QVMA 4IJQA 3NHMA 5EXPA 1JHPA 3NTOA 4PLHA 2DLDA 4LF6B 3MK31 2AVNA 4RCVA 3B8EA 1DXOA 1JVSA 1L7BA 1K8XB 1RVV1 2W8ZA 1TD9A 2BBTA 1U1EA 1BYUA 3ZPXA 3TJMA 1P7PA 4IRUB 4GQBA 2BPOA 3I5AA 2PS0A 3DAPA 5DCLA 4DJJA 3P2OA 4IFIA 2GRUA 4EG1A 4Q9AA 5CAEA 2YOHA 4J0EA 4PHGA 4KQGA 1PE0A 3LY9A 3WYBA 3DLHA 4MVJG 3UMGA 3FCOA 2YJTD 2ZTSA 3F8TA 4R54A 4B43A 4G9EA 4O3MA 3KPUA 4DCPA 3IAAA 1G6OA 1FSGA 2GN9A 4ZTBA 5ARBA 3A2MA 1T0HB 4GGOA 5GZ1A 1HT0A 4WKCA 1HE1C 2G17A 2Q4BA 4OREX 4V02A 3HP4A 2YY7A 3RRMA 1NJGA 4C4OA 4I55F 5LLSA 1WETA 2C31A 3VJMA 1RBZA 1UBOS 2IOQA 1K7FB 2PS1A 2WZDA 2Q41A 1IG0A 1U8TA 4DXHA 1GRNA 4BVGA 1Q83A 1PNOA 3LTEA 2Z56A 4B1FA 4KBGA 1JEQB 3OZUA 2D62A 4ZVSA 1O8CA 1L4FA 5TQ0A 2IKQA 3U80A 1A8SA 3TFQA 5C5EA 1G20E 3OH8A 4HUJA 4E32A 4TQ9A 3HABA 4BO4A 1C9YA 1YQGA 3DE5X 3N8DA 1SUAA 4K9MA 3DBIA 3WOHA 4E4RA 4PIMA 3KJFA 5JJLA 2FMFA 2QRUA 3L6BA 3OMXA 2HWXA 1BVYF 1J7JA 5HF9A 5A05A 1GITA 4E5SA 4EM6A 4QLOA 4EHHA 3EPKA 5EKSA 4RENA 1KI2A 3B70A 4XTRA 4GLOA 4P31A 3JVVA 1TZCA 4LXIA 4PX2A 1HWYA 3IAXA 4MQ5A 2VJMB 1GQYA 1OT3A 2Q2WA 2QG9A 2GESA 3KZMA 1FDRA 1XWFA 3L2OB 1BO6A 4PC6A 2X58A 4C03A 1I2DA 5H81A 2JLRA 4BGVA 1DJOA 4DPKA 4EARA 2ZUDA 4PYIA 2FFRA 3OI7A 4LOJA 5P21A 1L5HB 4EY4A 3F71A 4GP9A 5FWDA 1ZK4A 1ZOOA 1M83A 2EFYA 2P6UA 4YLYA 2ENWA 3GFPA 2ADOA 1XYGA 3CX8A 1AHHA 1WXFA 3FBGA 4K6KA 4R7TA 4PG4A 4RJ2A 4MGHA 2JIRA 2IYAA 2AI2A 1J8FA 5HBRA 5KO2A 2EYUA 4JI1B 5D3MB 3ONVA 4RANA 3KR9A 4OM8A 1FVHA 1SCKA 1OC4A 2J3MA 4AY3A 2G3YA 4NECA 4PNEA 1EP2B 4N49A 4E5DA 2PA0A 5K6TA 1CP2A 2H31A 4MCJA 4P32A 3AJEA 3CKKA 3B1ZA 1JR3E 2BN4A 3EZLA 2ZIWB 4UXHA 2I6UA 3PNPA 3G9XA 4Q7MB 4RY2A 3K0AB 2PKEA 2HBQA 4ZJUA 1NA5A 4ND4A 5C3UA 1K5GA 4PEVA 1K8QA 3MD9A 5DM4A 5JAUA 3O8RA 5LMUB 1FTNA 2W2LD 4B3XA 4X8LA 4FLMA 4DCGA 1N3YA 1JEEA 1ZN2A 2J30A 2BFDA 2B6HA 4AULA 1KEEA 4B83A 1NUHA 2Y0BA 4DQKA 5LM3A 1N36B 3DOCA 5JG7A 1ZX1A 4F8YA 1UZNA 1QTRA 2NUAB 2BONA 4YJ2F 2VDWB 2IYXA 4GVXA 5T7BA 1L8XA 2P2NA 2P9ZA 3I83A 3C6ZA 4LSZA 4L3WA 1VHLA 1Z08A 2FQXA 2QTWB 2DCUA 4YEDA 4Y1RA 1CJKC 1XD2A 3PVSA 4IUDS 4INOA 2HDOA 4NOKA 3IC5A 1U3VA 4OF4A 3O8BA 4PCLA 1NW8A 4LQ4A 2YFYA 5DKFA 3SZLA 2CNBA 2J45A 4OATA 4QWWA 4UHKA 3U16A 1XVTA 4LWZA 2V6JA 4Q7JB 3MJEA 2R8XA 1U7XA 3ZWAA 5JCJD 2D6FA 1AQUA 1M3SA 1M5UA 4KIFA 1NVWQ 2WUFA 3VO9A 5LDHA 1WKBA 4L73A 4Q15A 2BMDA 2ASVA 4I6GA 1E5TA 2G07A 4IVRA 2J6BA 1Z82A 3LJKA 3ND6A 4KB5A 4I5EA 2Q3LA 1P4HA 3AKEA 4J03A 1RU3A 2XT6A 3T61A 4EZIA 1NPYA 1J5PA 1OZHA 1KQPA 4XOUA 4LC1A 5JDCA 1RKQA 2C0CA 2CHEA 3EIFA 2D1FA 4KN5A 4XQEA 4KAFA 4HNAB 4NG4A 4AMYA 3FUVA 4GS5A 1F1BA 1JB1A 4QYIB 4CMEC 2PWBA 4QYSA