1TRHA

Two conformational states of candida rugosa lipase
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
b'APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
molecule tags Hydrolase(carboxylic esterase)
source organism Candida rugosa
publication title Two conformational states of Candida rugosa lipase.
pubmed rcsb
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trhA00
3OG9A 2CBGA 5FKJA 1DINA 1HPLA 1CRLA 5BWCA 2QUBA 2WG0A 1CVLA 4N8DA 4B80A 4MWTA 5AOBA 5HK8A 2ZSHA 1H2WA 4OSEA 4E15A 1UXOA 5ALRA 1A88A 3RARA 2RGUA 2DCMA 1IUOA 1J1IA 3VISA 5AI6A 1F0PA 1K8QA 4BCBA 5HFNA 1R9MA 1MX5A 2VQ6A 3RM3A 1ZD3A 2OXEA 4X97A 3ZI7A 4W63A 3E3AA 2D5LA 4FHZA 1L7RA 3AILA 3H1AA 1CLEA 3WK4A 2PSHA 4Y2XA 1CUAA 1EVQA 4E46A 2XLBA 2O2GA 4FTWA 1CUBA 2RIPA 1F6WA 1WB6A 4CG3A 1DT3A 4EBBA 1HDEA 2YYSA 4NMWA 2EEPA 4DMKA 2HIHA 3H1BA 3KWFA 1XZHA 3RKSA 4X90A 1IUPA 1MO2A 4K6HA 4J7AA 4OYLA 4BVJA 5KREA 5LLSA 5AK4A 2ONCA 2YH2A 4AZ0A 5LIPA 1YB7A 2WFMA 4LIPD 3IUMA 1ACLA 4B9AA 3FOBA 1VZ2A 4A5SA 3H2KA 1GT6A 4DYHA 2C0PA 3MVEA 3QYJA 4UBMA 2WIFA 2PPLA 1N5RA 3VVLA 4MXDA 3WZLA 2QS9A 3C6XA 4QWWA 4KJXA 3FYUB 5AIAA 5IKXA 4W1SA 1C7IA 4CCWA 1BN6A 1QJ4A 3BL8A 3FSGA 1O6GA 3G02A 4Y2YA 1MAAA 1UZAA 2Y6VA 1JJIA 2CUTA 1TK3A 1Y37A 3QBJA 4X6YA 2OQVA 2WU3A 3BIWA 3H2GA 4RE6A 5ALJA 2JGEA 4OYYA 1P0QA 1EHYA 5HZGA 4B0PA 4C6HA 2ZYHA 3QPAA 1LGYA 4PSUA 1W52X 1WCYA 2XUOA 3N2ZB 1NX9A 3I2HA 1D07A 3V48A 4DMCA 1EDEA 2Z3ZA 1ORWA 4QDXA 5CH8A 3PUIA 2O7VA 4JUIA 3O9MA 4LXHA 4ZWNA 2D0DA 5ALQA 3AZPA 3AJAA 3H2JA 1AMNA 2JF0A 3B3QA 1N8SA 4U2BA 4KE7A 1R50A 4G9EA 2HL6A 4X3CA 2WTNA 1ODCA 3F9CA 4H7JA 1KU6A 3PFCA 2J4CA 2QUAA 1FFAA 2AJLI 1XLWA 5ALPA 1CUXA 1ZJ5A 5CT5A 1E89A 3E4DA 4L9AA 4ARAA 1AURA 4BE9A 3PDCA 2WFLA 4ITVA 2X8BA 1DWOA 4W9RA 3DJYA 1HKHA 4CIBA 1SCQA 3AUKA 5FUMA 2GBFA 1GQRA 4P92A 3D2AA 1QFSA 2OAGA 1LZLA 4OB7A 5AI4A 5E2IA 1XRMA 3FVTA 2OCLA 4WCVA 4BATA 4F60A 4IH1A 4I4CA 3C6ZA 3FAKA 4H7FA 2HA6A 4Y2PA 3S8YA 2XUAA 1CUCA 3SC2A 4XWGA 5BWBA 5AM1A 2HU7A 3FNBA 1J2EA 2W22A 3IDAA 3I1IA 5HKAA 2C58A 1JU3A 5JYCA 5ALUA 4C4YA 3QZUA 3DQZA 3C6BA 3C5WP 3EQ8A 4AB1A 4BC1A 5ALHA 3JWEA 4ZV9A 3FLBA 2XMSA 4X92A 4XX1A 3DOIA 4K2AA 3X3HA 1EINA 4J0DA 1BN7A 2XUGA 5AK3A 4CG2A 5I9IA 2OGZA 5CURA 2DHDA 5SYMA 3E1GA 3WQHA 3K6KA 2O2IA 1LPMA 1RP1A 5ALGA 1E3QA 2WSLA 4FNGA 3OC0A 4H7EA 2PX6A 2BKLA 2IX9A 1CQWA 2Y6UA 5AK6A 2VF2A 4INZA 1W6RA 2GBIA 3PF9A 5AKHA 1BU8A 2XQJA 1SOMA 2WU4A 4ZREA 3GROA 4YX9A 5BOVA 4EA6A 2AJCA 3ZPXA 3WKBA 5ALFA 2G63A 3UUFA 5AJHA 1H2XA 1XRLA 2H7XA 3I2JA 3KWJA 3H17A 3D3NA 4BAGA 3O0DA 1LLFA 4UHEA 2PVSA 3D2BA 1QIGA 5E4TA 4UBNA 4K6KA 3TGLA 4GW3A 1QO9A 2GZRA 3LIPA 3EBLA 3PI6A 2B4KA 1MN6A 3WL8A 4H7DA 4M0MA 4G9GA 1ACJA 4MQMA 1VZ3A 3SX4A 3HI4A 3WL6A 1FFBA 1IUNA 3KD2A 2B61A 3FLAA 4QLOA 2WUGA 3F8SA 5ALOA 4DTCA 4WJLA 2H7CA 3V1MA 5DYYA 2BUAA 4X95A 2I3ZA 1UOPA 4Y7DA 1GPKA 4LHEA 5AI5A 4DM7A 4BVLA 4QWMA 4KYVA 4J0CA 2Y2VA 3HEAA 1XLVA 4BRSA 1QIDA 4KE6A 1MU0A 2V96A 1XZLA 2JEYA 1E66A 1L7QA 1ZD5A 3R41A 4TGLA 1CFJA 2FX5A 4U2GA 2PM8A 3CXUA 1LNSA 3L1HA 2WG2A 1IZ7A 1HBJA 4WFJA 2QJRA 1W1IA 4ZXFA 3C5VA 1R1DA 5CT6A 2YXPX 1CUWA 2H9YA 3A2MA 4AN0A 2NW6A 2CKMA 4FWBA 1C7JA 3T4UA 4EY7A 5SYNA 3TRDA 5JD4A 1W76A 3WWCA 4G8DA 5ALTA 4K5QA 2LIPA 5FXMA 4HZGA 3EIOA 5C8XA 3KSRA 5C7YA 3WWPA 2OG1A 3G9UA 2O2HA 3F96A 2HU8A 2Z8XA 1GPLA 1SCIA 2K2QB 3C8HA 4WDQA 3A70A 3S2ZA 3ZV7A 5JALA 2WHRA 4RGYA 4J3JA 5CH5A 1VE7A 2OCKA 3OOSA 3B5EA 1B41A 5FRDA 3B12A 2ZYIA 5CT9A 5I7UA 1ZGCA 3P2MA 4X7BA 3DS8A 4AMZA 5LKAA 5CXXA 5D7BA 3FSGD 3H2IA 5AM5A 1LPAB 3GFFA 1USWA 3AIKA 3KOOA 5DWDA 3QM1A 3I2KA 4B81A 2XB6A 3DKKA 2B20A 4Y2SA 2FJPA 2VAXA 1GZ7A 4C4ZA 4B6GA 4XVCA 2JGMA 2PUJA 5HFAA 2H7YA 3WYNA 3G0CA 4KRYA 1FSSA 2WTMA 1DX4A 3WK9A 1UK7A 1CUUA 3W9BA 1R3DA 4MQLA 2QM0A 1WPRA 4H7HA 5JAOA 1MTZA 5IVKA 5K3AA 4UBIA 1YAJA 2XMQA 2BGRA 1ODTC 1NU6A 2CB9A 3HSSA 4DSZA 1TCCA 3WMRA 4AMYA 2XMCA 5ALNA 2WFZA 1THGA 3IUNA 3WK6A 1LBTA 1R9NA 3I6MA 7YASA 1BCSA 1DWPA 1JT2A 3STYA 4Z49A 2ZSIA 4J0HA 1JMYA 4CCYA 1CIJA 4DLNA 2GBGA 2W6CX 3O4IA 5AK5A 1JJBA 2QZPA 1Y7IA 5E4JA 4H18A 2CMFA 3LS2A 3FWHA 5A7GA 2AJDA 1QONA 3STUA 3DYIA 5LZ4A 1Q84A 3H19A 1EH5A 4BTLA 2XUKA 5T4EA 4P93A 5AH0A 2V9ZA 3I2FA 4FFVA 5A7FA 1QE3A 4J0GA 4F5ZA 2PSEA 1ZIYA 4UBOA 3C70A 3G9ZA 3GZJA 1N1MA 4J03A 3RK4A 2DHCA 2WIJA 3I6YA 1JFRA 4DMHA 2GYWA 2XQGA 2CZQA 1XQYA 1ZJ4A 4U2DA 2C7BA 1BROA 1EVEA 4WY5A 5AM4A 5ALWA 5FPPA 3BJRA 1RYYA 2XUPA 3QMVA 4HRYA 1XKLA 2X5XA 3AZQA 3A6ZA 1CUIA 4Q3OA 3M3DA 4YASA 4UFNA 2JGIA 4QEKA 4QDZA 1VJ5A 3OTQA 3DKRA 2HM7A 3O95A 5LZ2A 1QGED 2VT7A 3Q0TA 3WK5A 2HDWA 2HU5A 3Q8WA 2BFNA 4BC0A 5AKJA 4ETWA 3BF7A 4BP8A 1AKNA 2B9VA 3D0KA 1UOQA 3QMMA 1RWQA 3DL4A 5JZ9A 4FMPA 3ANTA 1Y7HA 4DGQA 3KDAA 4AO7A 4S0XA 3W9UA 3HXKA 2XQFA 1YASA 4BCDA 3F67A 1C4XA 1XZDA 4AX4A 4YPVA 3ANSA 4J0IA 3FYUA 3IVMA 3HLKA 4NVRA 1GKLA 4CFSA 1P0PA 4B7ZA 1P0MA 3ESDA 2PKYX 1LPOA 1K5PA 3GELA 3I2IA 4UUQA 2GYVA 2G5PA 1TIBA 3A2LA 2WLSA 4DMFA 1GGVA 4G8CA 5A71A 1T2NA 3WJ2A 4A23A 3SK0A 5CTAA 1YA8A 3AINA 1XQWA 4X93A 3FLEA 5DLPA 4FDMA 5K3CA 4C87A 3HC7A 2BUBA 1QO7A 3IA2A 1VXOA 1ORVA 4HTAA 4LYEA 5DTIA 1VLQA 2EDCA 1WB4A 4JYMA 2QT9A 2VEOA 1U2EA 1BRTA 2OCIA 3DD5A 3WI7A 2ZYRA 4UBJA 4X94A 2OGTA 1IMJA 5DNUA 2VJAA 5K3FA 4BTVA 3G9XA 3EQ7A 1K6EA 4Y2RA 3G0DA 5ALVA 4KE8A 1UFOA 2XMDA 1OILA 4MWSA 4GXNA 5AO9A 5AKXA 1XZIA 3WYDA 5FLKA 2WFLB 3CN9A 3D2CA 2R11A 3FCYA 2OLEA 1X70A 2WKWA 3M82A 5EIHA 4ARBA 1QIMA 1EDDA 5CT8A 3STWA 3WK8A 2ACEA 3K9BA 1BCRA 1HL7A 1BS9A 4UHFA 4F0JA 3IULA 3IURA 5FPQA 1QOZA 1BE0A 2VSQA 4G4IA 1CUGA 3AIOA 4W1QA 1UK8A 4QDTA 2OQIA 4Q34A 2OAEA 5EIAA 4G5XA 3WIBA 2WUDA 3NOXA 3WWDA 3LCRA 4U2FA 3CN7A 4HRXA 1QIHA 2HA3A 5ALKA 3V9AA 5T4HA 1XZAA 3D4LA 1CUSA 2VJCA 1VKHA 3QMWA 5C8ZA 3OPMA 1EXWA 4N8EA 3ESAA 2RONA 3HYSA 2G4LA 2OCGA 4PSDA 1XZBA 3WWOA 2WHQA 5HQ3A 1P0IA 4AO6A 3WKCA 3ICVA 3AZOA 1PV1A 1N5MA 4GECA 1MJ5A 4BAUA 4O08A 4FLEA 5ALYA 4BB0A 1DU4A 1XQXA 2XMRA 4JEIA 5AKIA 2XT0A 3DNMA 1DX6A 1JKMA 2DHEA 5J3JA 3V1NA 4GI1A 4BE4A 1AQLA 2BGNA 5LZ5A 5AKGA 1B6GA 2E3JA 1QIEA 5K3FB 1TCBA 2ROQA 1J06A 3M83A 4B9EA 4ZI5A 3WZMA 2XMGA 2J3DA 1ZICA 4L3WA 2QJWA 5AKLA 4OU5A 4OPMA 4AN1A 3OURA 1J07A 2VJBA 4JH0A 5AOAA 2PUHA 1DT5A 4P08A 1DWQA 3HABA 5FDFA 4OD0A 2AXEA 3N0TA 2IITA 4N5HX 3ESCA 3VJKA 3I28A 3ZLTA 2RHWA 4IH9A 5D3ZA 4CIAA 3WIOA 3ICWA 1TCAA 3R3XA 1Q83A 5FP0A 1WHTA 4OB6A 5A7HA 3H0CA 4CG1A 4K6GA 2WUFA 5K5EA 5AI9A 2G5TA 1ODSA 2BAGA 4ZRDA 2C5FA 3FBWA 2P8SA 5FV4A 2Y2UA 3BJMA 2J4FA 4HAIA 4X00A 2XMBA 3WLAA 3GBSA 4PF1A 1ZI9A 2HA2A 1XQVA 4PW0A 1FJ2A 2I03A 1ZD2P 1ZGBA 5LZ7A 4RPCA 3JW8A 2DR0A 3O4JA 4KAJA 3OM8A 2XUDA 1ZOIA 1E8MA 5EGNA 5LYYA 5IVIA 1KU0A 1XRQA 3V1LA 1A8SA 3NGMA 3W06A 2XQIA 4FFWA 5HQ3B 2JIDA 4RNCA 3SWWA 2XUQA 4H77A 2WHPB 1LPPA 1VXRA 4V2IA 1T4MA 2QMQA 4OB8A 2PSFA 3V1KA 4W1PA 4G4GA 4J0KA 1LPNA 3QH4A 1LPBB 2HHAA 1X2BA 3NWOA 3QPDA 4U2EA 2R8BA 4Y2TA 3H04A 5AM0A 1Z68A 1CUHA 3HJUA 4E11A 3ILSA 4BCCA 5EI5A 2PU7A 4HS9A 5AKYA 3W05A 5AM3A 1GPNA 3BF8A 4PSCA 1EDBA 3ZLUA 4GEGA 2VT6A 3C6YA 2QKYA 2BJHA 3C45A 5BV7A 1DTEA 4FLMA 1FFCA 5DJ5A 1Q0ZA 2CJPA 1QFMA 3R3WA 3DCNA 4QDUA 3E0XA 1CV2A 4DIUA 3WJ1A 1LZKA 3R40A 3UUEA 2QXUA 3STXA 5JANA 1FFEA 2XUHA 4CI9A 1MNQA 4L72A 4AZ3A 3DYVA 4FBLA 3O4HA 5I8PA 5KWIA 4QDOA 3TEJA 2YASA 1YAHA 5ISMA 1UKAA 1VA5A 5AIBA 5CXUA 1U65A 4UHCA 1H23A 1U8EA 3QITA 3W2TA 2WJ4A 2WJ6A 5EHXA 4G4JA 3CCBA 1EX9A 4BYMA 5AI0A 1QTRA 5LZ9A 3MGAA 3FYUC 1LPSA 1W4LA 5AOCA 4U2CA 4EY6A 4C4XA 5IVDA 1KEZA 4BAZA 2XDWA 5C8VA 3DDUA 4X91A 5IVHA 2ACKA 5K3BA 4X85A 4LXIA 5ALSA 1XZJA 4JNCA 1NU8A 2XUJA 5JD5A 4IO0A 4Y2JA 1AGYA 1YSCA 4IQ4A 4B85A 3BE8A 2BCEA 5JZSA 4HVTA 2AJBA 2JGFA 4PV7A 4IHAA 3O9VA 3PICA 1DQYA 4H0CA 4H35A 4MJ3A 1WPXA 3UMJA 3R3YA 5HCUA 4I19A 3PF8A 4IH4A 3VJLA 3GA7A 1L7AA 5T4FA 3G0IA 1H2YA 4KAAA 4FLFA 3ZLVA 2C0QA 4PQEA 1AZWA 1EB9A 4C88A 1EK1A 2WIDA 3BWXA 3TJMA 4FBMA 1UT6A 2Z5GA 3G0GA 1BEEA 2ZYSA 3C43A 1YS1X 2XLCA 1CQZA 1UK6A 4KRXA 2VATA 3QPCA 4HXGA 3WKAA 3R3VA 2XUIA 5AKKA 5K3EA 1JU4A 2DFPA 1QZ3A 3AIMA 1QTIA 5JD6A 2ZJ6A 1EI9A 1CUFA 5ALDA 5AKZA 1OCEA 5DTJA 5AICA 3FVRA 4DNOA 2C4HA 4GHWA 4WY8A 4BDSA 3RLIA 5KWJA 5A62A 3DLTA 4J0JA 4F21A 3PFBA 2HFKA 3G0BA 5YASA 4HXFB 3DL7A 5AI8A 3BDVA 1A8UA 4EUSA 2DQYA 2OPHA 3ED1A 3G9TA 5HKBA 4D9JA 2JBWA 4Y9SA 3JYHA 1ISPA 2VA9A 1XKTA 2RHTA 2FUKA 3BXPA 4M0FA 4KR0A 2GBCA 1EK2A 4GDMA 2VJDA 1CPYA 1ZI6A 5JAHA 3C8DA 1CUYA 2XQKA 4ZV7A 3ESBA 2QR5A 3BIXA 4Q05A 3VKFA 2ZJ7A 1XROA 5AM2A 4YK7A 2J3QA 1JJFA 2XE4A 1WB5A 4RE5A 3L1JA 5CMLA 1XRNA 4EY8A 4G8BA 1XZKA 4N8SA 1EB8A 3VDXA 2QVBA 1XZGA 3WWEA 2JEZA 1XLUA 3G8YA 4PO3X 4WFKA 3IUJA 5C81A 4NS4A 2VAVA 4A16A 4UBLA 1MPXA 3H18A 4EHBA 2RAUA 3U0VA 4L0CA 3R3UA 1GQSA 1EA5A 3PUHA 5A2GA 3T52A 1UWCA 3IBTA 5AKEA 3IB3A 4B82A 2QOEA 1XRRA 4UBKA 5ESRA 2FJ0A 4EY4A 2JGLA 4FOLA 4XJVA 3IIIA 1G4HA 5JASA 2JGKA 1CUJA 3WK7A 1CUVA 5EHNA 4Q82A 1XZMA 1ZD4A 4Q1VA 4EZIA 3WA7A 1I6WA 5JARA 1ZI8A 2CEKA 3U1TA 4HXEB 2X76A 2WIGA 1PJAA 4FKBA 4KAFA 2GYUA 2ECFA 4OCZA 3BDIA 5E4YA 5DNVA 1M33A 2QTBA 5EIEA 1E8DA 5F4ZA 4W1RA 3EQ9A 3H2HA 1AUOA 2ZVDA 3G7NA 5JAPA 5H3HA 4QNNA 4H7IA 3A2NA 1CUZA 4TVKA 1HLGA 3KXPA 3C87A 2ES4A 2VTVA 4UHBA 5JZBA 3D7RA 5ALMA 5EHQA 1E8NA 1VE6A 4GWLA 1G66A 3R3ZA 2WQZA 1CUEA 3DEAA 4BBZA 3QVMA 4LXGA 2WILA 3VVMA 4JYPA 4X6XA 1E5TA 2Z3WA 1H22A 3GUUA 3R0VA 1G5FA 4BZZA 3HZOA 3WL5A 1K4YA 4TPKA 5AHXA 1JMKC 2O7RA 1XFDA 4N5IX 4UHHA 5ALLA 4KE9A 4QZVA 1WHSA 5ALIA 5JADA 2HA7A 2XI4A 1F8UA 3M81A 2HADA 1IVYA 2QXTA 1A7UA 4M0EA 2WIKA 1OXMA 1YCDA 1QIKA 1PFQA 4DSAA 2DSNA 1A8QA 4BRZA 4UHDA 1UK9A 1MNAA 4OUKX 5DNWA 3WKEA 4ROTA 1MX9A 3AFIA 5EHZA 4UFOA 1R4ZA 4DNFA 4XIIA 4Y2QA 1O6FA 4QE3A 3NUZA 3LP5A 4LYDA 1MAHA 1U4NA 4OU4A 2PL5A 2I3DA 1R88A 4P9NA 3WL7A 2OGSA 3HACA 3PE6A 4WDRA 2WG1A 1CUDA 5JAUA 1LBSA 4E14A 3STTA 4KACA 3F98A 5LP1A 4AXBA 4C01A 5KBYA 5LKRA 1WOMA 1K63A 5HK9A 5K3DA 2Y1KA 1AC5A 1G42A 2WJ3A 5D6OA 2PBLA 4BDTA 4ZGBA 5DYTA 4MEAA 2V97A 5JIBA 1YA4A 2WM2A 1BEZA 1CR6A 1XZCA 2JGJA 2HA4A 1SFRA 1F0NA 1IZ8A 5ALXA 1YR2A 1SC9A 1FFDA 1TQHA 2C5GA 3YASA 5HF9A 1SCKA 4PNZA 3IUQA 2RI6A 3WKDA 2PSJA 5CRIA 4I3FA 4X71A 2HRRA 1MX1A 2ZJFA 2AJ8A 3O4GA 4CCYB 5JATA 4UPDA 4DNQA 4QA9A 2BUCA 3D59A 3FYTA 2XUFA 2IIVA 2PSDA 1XZFA 1YB6A 4GLBA 4BVKA 5A6VA 1QLWA 5AP9A 1S8OA 5CBKA 5CT4A 1GXSA 5ALZA 4Y2VA 2UZ0A 4B0OA 1ZIXA 2Z8ZA 5T4BA 3STVA 4EB0A 5HF6A 1HQDA 2XMZA 4LKOA 3ZWQA 1ETHA 2V98A 3K2IA 5D3KA 5DYWA 4QLAA 1TAHA 3VXKA 1WM1A 5HF5A 4AQDA 1AX9A 4MYSA 1YS2X 3I6ZA 3WA6A 3EF3A 3FCXA 4BZWA 1TKRA 5EFZA 4DNPA 1CEXA 3LLCA 3MUNA 4FNMA 4EY5A 4WFIA 3D5EA 5IH7A 4Q3KA 4B83A 1QIJA 3F97A 4UFPA 1QIIA 1TRHA 1VOTA 3MUOA 2PU5A 2HFJA 1Q0RA 4BP9A 4MEBA 1THTA 2WUEA 5CH3A 1UKBA 3HRHA 4Q3LA 3W04A 2EDAA 3I1YA 3I2GA 1MT3A 4X6UA 4G1FA 1JI3A 1UOOA 5ALEA 1GKKA 4C89A 4B84A 2Q0XA 5CW2A 2GZSA 4KEAA 2HRQA 1X2EA 1DQZA 4Y2UA 3DOHA 2H1IA 1W75A 3VJMA 1H2ZA 4H7KA 2QRUA 5HF8A 2ORYA 1XRPA 1QIFA 4NZZA 1UKCA 2HA5A 5FOQA 3LIIA 1XZEA 6YASA 3CCCA 4MYDA 2WHPA 4AO8A 1VA4A 3L1IA 2I78A 2HA0A 4GBGA 2DQZA 5LZ8A
chains in the Genus database with same CATH superfamily
4O0LA 4ZVMA 4CMIA 2FFRA 2GSDA 3BICA 1KARA 5FKJA 3OD5A 5IMBA 3UFBA 1HPLA 2H2GA 2P2ZA 2VWPA 2NSJA 3TNDA 5HJ2A 1MJHA 1CVLA 2D5BA 4NNOA 4JT8A 5CDUA 3IXQA 2RAFA 2ZZKA 3QLTA 5M29A 2XB4A 3K1AB 5AOBA 1Q21A 5EXTA 2GJKA 4MRRA 5HK8A 2ZSHA 3C4JA 2XSZA 3M1AA 3MWJA 5CCDA 3WDLA 2APJA 3PDUA 1E9BA 4LDAA 1KPGA 3Q1KA 3OMLA 1UXOA 2DBQA 3PCXA 2SKEA 5ALRA 1EBUA 4CIDA 1A88A 3RARA 1P5RA 5DMXA 3TI9A 3WQSB 3OEED 5FUYA 4B6FA 3L7IA 4F4HA 1J1IA 3M3HA 4S0ZA 4YECA 4M3NA 1F0PA 3PVZA 5TQ2A 5JMOA 4AQYB 1TM4E 2B1GA 1JRLA 1W2WB 2IEIA 1WO8A 2C92A 3KYBA 4FE3A 5FBHA 3CLSD 4V2UA 5BW6B 4N9WA 4YJ2B 1FS5A 2CJWB 1MABB 1PK8A 3MMXA 4J1TA 4KLNA 1DRUA 4ZVOA 4CF3A 1UZUA 3H1AA 4K88A 2IUFA 4H31A 2NSHA 4CN8A 2HZ7A 3RVPA 1CLEA 2QG4A 1W5FA 4G84A 3IAS1 5C18A 1NUQA 1V3TA 2YZ2A 3C4QA 3NDIA 1M2OA 2PTHA 4CEIA 5JU6A 2C2OA 1G5HA 2CNOA 2XVYA 4E46A 3D8SA 4U3JB 4FWIB 1B6SA 1GTG1 3FTFA 2C3YA 2FV8A 2OYCA 1DJQA 4PGFA 1C4KA 4MP8A 5I5GA 1DOHA 3RVJA 2XA9A 3GQBB 3QK7A 1AB6A 3R24A 2D4HA 3A6LA 4P34A 4NARA 5EPUA 2HPZA 1NQXA 2PUDA 3JQ8A 1PL0A 1E6KA 1ZHFA 2FFHA 1LNZA 4QXRA 1WSBA 3THWB 1GFIA 3HJTA 2VUSA 1T3TA 5FV7A 1RXVA 4YVFA 4CGZA 3L8CA 3N86A 1GOTA 1VLVA 2PA0A 1RACA 2AMVA 2YYSA 2EEPA 3G0OA 4BGIA 1VGVA 2X8AA 1YUNA 4R8SA 1XZHA 1MDFA 1PP4A 4Z0TA 3TPFA 4HDRB 4B09A 2ZJAA 1FUKA 1RM3A 5DXAA 3ILHA 4HSEA 3SZLA 4B2PA 4DE5A 5IH3A 2HCBA 4XCVA 5KREA 1IL0A 2ZDGA 3CT4A 5LLSA 1E9FA 2ZI3A 4J4HA 1OFVA 1YB7A 4TS9A 5L3SA 1ODJA 1IRIA 1GVHA 1KZ9A 1XCLA 3HB5X 3H87A 4PHFA 4Z1MD 4HQ6A 2UUBB 4UVDA 2WUWE 3A11A 3FOBA 4ILEA 5FEMA 4EPWA 4A5SA 1JA9A 1E5QA 1JDSA 1GT6A 1M2KA 1G20E 3BGDA 2ZT6A 3L7JA 2I7DA 2C0PA 1YKSA 2EBHX 2VHYA 3P9ZA 4C0XA 4CUKA 2JLCA 1L4HA 2AW3A 2NNWB 2ZBUA 3O8DA 1J0DA 1GZ3A 1U28C 1JXQA 1JDUA 3EXAA 3F3MA 1FSFA 3FSJX 2ODBA 2B82A 3H8VA 5CM8B 3D8RA 4MXDA 4Z9YA 4NHEA 2CWDA 3AR9A 3C6XA 5DGHA 4QWWA 3V7FA 3A32A 3B1JA 2TYSB 3CJQA 2WAYA 3BFJA 5F3RA 2P9ZA 5JBNA 4HYYA 5IT4A 2OO5C 2G9VA 4XDZA 1BN6A 1PWEA 3KYDB 4BJ6A 4E2XA 1GGKA 3AL3A 1S6YA 3RIMA 1SEVA 3M6IA 5BR1A 4DREA 1U0GA 1QG6A 5E6RB 1ZH4A 5CFRA 3AEKA 3K2BA 2IJGX 4FEGA 1MAAA 4MYCA 1UZAA 4MRSA 3BIFA 4BNFA 2JFHA 3PENA 1NN1A 4QUBA 3C16C 4XVQA 4Z7NB 1TK3A 1OD6A 1P2VA 2VDKB 2V7EA 1QG4A 3QVGA 3T7EA 4B76A 5CA1A 2HTEA 2HCTA 2BFDA 1COZA 2E85A 4RK6A 2D6FA 3TCNA 3BCSA 5BVGB 1M73E 5ALJA 3MRTA 2WAXA 1OXKB 1WIWA 2DERA 2ZSAA 5BRAA 2HUPA 1SXJD 5JWRA 4CM4A 3REGA 1N7IA 1SHKA 4XCQA 3KVYA 3L0IB 3H42B 3QPAA 1GITA 4PSUA 2XKBA 4OP1A 3MD0A 2ZTSA 4I46A 1CQIB 3NNDA 2QAJA 4Z4CA 1G21A 3N2ZB 5HMMA 3OUUA 4MV4A 5JSFA 2N1BA 3T7DA 3KB2A 1W5BA 4UNPA 4WCFA 1K0UA 2Y3IA 3ZUPA 1D07A 5TQ0B 1YQQA 1I5OA 2DP4E 2YY7A 1LW7A 1ZNXA 1RAGA 2HK6A 3EEQA 3GZ4A 1FS6A 2YQZA 3NHRA 4XAQA 1YJ5A 3M4XA 4HQ0A 3I62A 1ZJZA 2GETA 2J3IA 3IS3A 1S2LA 4G1CA 3GT0A 3RBAA 1Z7EA 2OSVA 3LVRE 2RHCA 2X7XA 3DWIA 2C5LA 3GAFA 2I1WA 2QL7A 3A4VA 1XKQA 5CH8A 3TSAA 5IAOA 3PD0A 4M55A 3HXOA 3FOEC 4HLQB 4L5YA 5JSQA 1QJCA 4TQAA 2P4QA 1YL5A 4TVOA 5DLEA 2BEUB 1K9SA 1L6RA 5TT1A 1R18A 1USIA 3BIJA 3DE2X 5DNYB 3LX5A 2BTOA 1DJNA 3BB1A 1G8YA 3DZ8A 4C2UA 1Q6ZA 1B8VA 1QVAA 2D0DA 3R6GA 4N3AA 4F11A 4DY4A 4BNWA 4ZCLA 5F2OA 2BGGA 2W2LD 4GVXA 3UMBA 3AJAA 3GUCA 4EB6B 3H2JA 2PGAA 5DCWA 2JATA 5P21A 1TC2A 1ZGGA 2P0EA 2VAMA 3BN3A 4QYIA 1N6RA 1RAAA 4N5LA 4DTCA 3GJ3A 1PJ4A 2E4ZA 3PNOA 1N8SA 1CY4A 1A9RA 1PT7A 3F1LA 1OVMA 5E4FA 1EUCA 2V7PA 3K09A 3PUVA 3SPXA 1IOWA 3U3JA 5FLEX 4GI2A 2X0NA 2AMYA 4JT4A 1HDRA 1KGDA 3H11B 2A84A 2MYPA 4QLBA 4C2AA 2UVPB 1YBHA 2CXQA 4ER0A 2PMCA 1SJ9A 3PFCA 3MJCA 2H2AA 2C94A 2J4CA 4BUZA 3RAGA 1UM9B 1JDJA 1P4JA 3RUEA 1PD1A 1R6AA 1XLWA 2ZTUA 1VBNA 3C3YA 5J4VA 4IYRA 1JIKA 4I4NA 2YDXA 1F2TB 2VDJA 3G0HA 2WHEA 2PKEA 3HDTA 2HX1A 4JUDX 3ZUGA 3PP8A 5K8TA 4O6VA 1E89A 4B46A 2XIQA 5HKKA 3NBAA 1CY1A 4L9AA 2XGMA 1SG9A 3OCXA 4ARAA 3RNOA 3RUDA 2FR8C 2Q5EA 1CY2A 4NICA 1YZTA 3EA0A 4PIMA 5NULA 3CLTD 3DBRB 3D8HA 2FPGB 4EGJA 1PEKE 3CISA 2OV6A 3H99A 4ML3A 3WOVA 1WL8A 1GCUA 5CIQA 5B58T 2IZ0A 2WU0A 4OX9B 1DWOA 5K8CA 1EAYA 2FRDC 10MHA 2GT1A 1V1MB 5AW0A 4RMIA 1E1QA 4LNUA 2A3RA 4OOFA 4W9RA 5T6MA 5HW0A 3DJYA 1IG0A 3AHHA 3V5NA 3QQPA 3R0ZA 1DC6A 3VO9A 1DRVA 1Z4QA 4MVCA 5J5CA 3RUPA 1BWPA 2GN9A 1I5RA 2RH4A 3V33A 1D2GA 3F2VA 3ZVNA 3FNHA 2HXSA 4L0DA 5H82A 3REFA 2JH8A 1MV8A 2RB4A 4YJ3B 3GG2A 1QFSA 3VH4A 1SR8A 4BP3A 1SN7A 4AAYA 2QX7A 4Z7QB 3GJ8A 5KINB 5AI4A 3DHEA 3H8JA 1FVFA 2W9XA 3BD8A 3F90A 3GO4A 2OCLA 5E2IA 4BATA 2I4RA 5A1TA 2W0SA 3MD9A 4K8RB 4CI0B 2AC4A 2IHJA 1TVKA 2DTXA 4LXXA 4I4CA 5F2KA 3UHJA 1H1LA 4ER5A 5ENZA 4JV5B 2ONKA 3L5OA 1V8BA 1QF9A 1TYEB 1QWSA 3EVNA 4H7FA 4MGHA 3UOAB 2MSEB 4NU5A 4EO9A 4Y2PA 5I7OA 3BCRA 4CEJB 4C2BA 3E5MA 4JCOA 1JP7A 1N0VC 1OFHA 3O5AA 4AG6A 1YR6A 1R10A 3GLHE 4GMKA 1N0UA 521PA 1T8PA 1V11B 3ZGNA 2GF9A 1E2PA 4CDGA 3PWTA 3VR5A 3WYGA 3D64A 1E1RA 3N2GB 4F46A 2D4AA 3MIZA 3JATB 2PLRA 2ZBPA 4XWGA 4CQJA 3AIIA 4DB4A 2I8CA 3M6LA 1EQ2A 3SLGA 2R96A 3D7LA 5K0JA 2NSLA 4KC0A 1QPGA 3Q2KA 5D5PA 2Y1GA 3I1IA 2GM4A 2XPCA 4QOGA 3V1TC 1F60A 1FP6A 1KK1A 3HWSA 3AT1A 3ZG6A 3HP1A 3IAUA 2Z56A 3AEQB 4FX2A 5DBGA 3WLIA 5DU2A 3ND7A 4FQ8A 4REOA 3TB4A 1KJYA 1UADA 2GAFA 3AH8A 3JQ9C 3LECA 2WHYA 4J16A 1Q0QA 4RHEA 4A6EA 2ERCA 3QZUA 3DQZA 2PPVA 1EU1A 1HETA 1XN4A 5EJ7A 1XO1A 3HYNA 3MWGA 2EF0A 1ZW6A 2INGX 2VJLA 5ALHA 4NBVA 3COZA 3MJRA 1QGDA 1XCBA 3FTQA 1SCNE 2HXYA 1OWOA 1XEXA 2E4AA 4AURA 3ELYA 2VQFB 1J25A 4Y0VA 2P9YA 3I09A 4MQ6A 4PGMA 4WXRA 3X3HA 4EG4A 2PHZA 3D0RA 5CA0A 3GLFA 3UPUA 4LI0A 3B5JA 1F0YA 5EWLB 5AXBA 5J2TA 5AK3A 4OREX 3L01A 3B6KA 3CX6A 3GPCA 5DB4A 2J5BA 1FUYB 5CURA 4Y98A 2WC1A 1DQRA 5SYMA 2RBEA 4W5TA 1P1FA 2I76A 2PH3A 2Q3HA 4BWYA 6REQB 4YCLA 3K6KA 5LDHA 1P3JA 2O2IA 3ABSB 4IIFA 4JGIA 4O2BF 2O8CA 1SRQA 3QWIA 1MC5A 4DCUA 4FNGA 1LRJA 2Z0MA 2BELA 2PX6A 1U31A 4RTLA 2G5CA 4PM4A 4FYHA 3T5TA 4DLRA 1CQWA 4Q4DA 1SUWA 2E37A 5JROA 1GTSA 2AQKA 2ZWVA 3K15A 4XUDA 2VF2A 2HJWA 2EKBA 4IGFA 1YB1A 2FPSA 4W6QA 1KDVA 1PYGA 2DWQA 1YS9A 2O8CB 3DJFA 1DWUA 1NBMD 1N8KA 3THXB 2O1WA 4EP1A 1J2YA 1ZIDA 3PF9A 3DZGA 3H7AA 4IKOA 1SKQA 5J59A 1ILEA 4GS5A 5GONF 1SOMA 3DKIA 2HY7A 4O29A 3C5EA 3CZ5A 1H0HA 3DHNA 5KTKA 5KSYA 3AOEC 1ADJA 1JDZA 2BHLA 3WKBA 2VPIA 4MR8B 5AJHA 4EDFA 1H2XA 1KI6A 4R2XA 5E1DA 2O7QA 1VYHA 1WXGA 2R87A 4KXNA 4P22A 1X14A 4P80A 3GFRA 3VC2A 2AUNA 3ZD6A 5KNBD 2E6KA 2NLOA 4FEAA 1ISMA 4KPUA 3RH0A 5D2CA 3RJMA 3EPJA 3U4DA 1TAUA 3D3NA 2VPTA 3G2OA 4LZNA 4NAUA 3U7JA 1LLFA 2PYZA 3BKWA 1NQ5A 2A30A 5FO1A 5G2OA 3Q6MA 1ZUHA 4X8HA 4Q3BA 4V1CB 1QIGA 1YRLA 4UBNA 4JLKA 3I45A 3KZXA 2QN6A 4K6KA 1K68A 1R0SA 3BD7A 3GJSA 5HE9A 1NMYA 5A9RA 1AA6A 3WHKA 2PGNA 2XVXA 4XA8A 2G8LA 3NNSA 1AV7A 2JFVA 3MWDA 4JXJA 3EBLA 2EL7A 1RZVA 1Z6TA 3OC6A 3I52A 4G6ZA 1GM5A 4EEXA 4Z8YA 3P9YA 4POOA 3LHIA 4ABTA 1JFTA 4RKQA 4QTTB 4QFMA 1AQ6A 4MQMA 3FPHA 1PYDA 3WAGA 1M8JA 1ZJ6A 2RIRA 3KD2A 5J63A 4QLOA 1NJ8A 1Z4PX 1Y8RA 3I4CA 4F9EA 1YWGO 3VC3A 1H1LB 3Q0IA 4TRJA 2IP2A 2MCFA 3WB0A 3IAS6 3QY9A 4BHTA 4F85A 5I5EA 3V1MA 3AVXA 2HLDD 1BD4A 4RGQA 3R8XA 3TM4A 2I6FA 1KDPA 1GPKA 3CRZA 2JLAA 3U4IA 3PGJA 4HB3A 2AN5A 4IQGA 4MQ5A 4RULA 2NT3A 4GOXA 4A7PA 3RSFA 4DIFA 1CF4A 5D3QA 3ZWCA 1L7OA 1F4PA 2FZ5A 5CFOA 2PQ2A 5LQDA 3T1HB 2V5VA 2AWOA 4KMMA 2YQ4A 3WXMA 1FUIA 3WNQA 3GGJA 3UC9A 1LV8A 3QY0A 2SKCA 2ZB2A 1NYQA 3WLHA 1RQ7A 4HDKA 4LHVA 4RK7A 2IP4A 1MU0A 2CV1A 2FEWB 4LSGA 1XZLA 1ZCBA 4UDXX 5SY4A 4PXYA 2ZUDA 5TMEA 4AWBA 4E3WA 4LGVA 1MTOA 1ISIA 4ESEA 3IYLW 3OICA 5K8VA 3EIXA 1BX0A 4TXLA 2ODPA 5LQSA 4E5KA 2YL2A 4E5DA 4YAGA 3UCEA 5KPJA 2OLJA 3BS4A 3NVMB 5MDHA 1DAPA 4BU0A 4RZIA 4MLDA 1ESCA 1E1CA 1I4OA 3CWCA 3K4QA 1N2XA 3P9IA 1EAMA 3I9V1 2ZSFA 4OXNA 3KJNA 4FZJA 2NZ8A 4AF6A 2WFAA 3L1HA 1QDLB 2WG2A 2ZYGA 4HX2A 2ECQA 1F2TA 2WDZA 2X2EA 3FPJA 4KQGA 1DRJA 4NH4A 4TTPA 3W5HA 1MEEA 2GCOA 2XXJA 3OO1A 1S1CA 3P2IA 1G5QA 1XCJA 3MAAC 4DCVA 2VJYA 4TV8A 2XNDD 1R1DA 3X1KA 1SKYE 1Q57A 2UAGA 2YJTD 1D1PA 1FPQA 3CLUD 4UNSA 3TFWA 3QOXA 4WNCA 5L7WA 3KRTA 2PLFA 2NW6A 2YHUA 2OA0A 1DUSA 4FWBA 5ILOA 4MQBA 2MDTA 1I8TA 1P6UA 4GGOA 1MJGA 1T6YA 3CLSC 4EQZA 3GVHA 3K09C 3H11A 1BXRB 4S1PA 4ENUA 3I32A 5DHQA 5LMNB 2GJAA 3IMCA 4HK4A 3D6HA 3KQSA 4J1TC 3LUPA 1XPUA 2H29A 3UUGA 3ZCSA 1D03A 1XTPA 3BEDA 5SYNA 3TRDA 1TTQB 1U0RA 2AKYA 4LZWA 3FJOA 4YGXB 5ALTA 3NTRA 4L95C 2GILA 3JYLA 3QEMA 4JVLA 2PBZA 4ZOLA 4BRWA 4XFJA 5IDXA 4R8MA 5ELXA 5C7YA 4NMMA 1E4VA 1F51E 4QJ3A 3K9LA 3BH0A 5L3QB 1T24A 3ROPA 1J21A 3AHIA 5KNLA 4G0OA 2P30A 4CU5A 1GPLA 2R00A 4ZGWA 5F7JA 2K2QB 4PS0A 3NBQA 3JVUA 3K96A 3QEJA 2BEUA 4E12A 4FJ0A 1SKAA 3CT6A 1TKBA 1FY2A 1WDTA 2P0YA 3A70A 4OJYA 3A05A 3S2ZA 1UBGA 1WRBA 3TMAA 3UHOA 5IAGA 3RYIB 1QOQB 1DARA 1FNBA 2IYOA 1C4OA 2VCEA 1LKZA 3IHTA 2ATIA 4DLXA 1D6NA 2Q8NA 1EE1A 1Y80A 3KXLA 4OBWA 2ZJZA 4AJKA 1LDBA 3GGGA 4CJXA 3OAAA 2F59A 2B0CA 4JFAA 3KTAA 2GF0A 3G5LA 4I2NA 4PZZA 2WTAA 2ZUEA 1BCRB 5TQ0A 1FTNA 2L69A 3C1UA 4X7BA 3QKIA 5DK4A 4RK4A 3LFHA 3LVFO 4PG5A 4OXYA 3VZDA 3G2NA 2J6BA 5KTOA 2A5YB 3DO8A 2X5OA 4DIKA 1SHTX 5AM5A 4L75A 3BC1A 3WX0A 2I6TA 1E1QD 1M6VB 2C8VA 4C7VA 3AEQA 3LF1A 1RKXA 5CFLA 4OAOA 5KU1A 2HC9A 2AUTA 5DWDA 1AS3A 2D62A 5KSZA 3D6VA 5B4TA 4NIMA 1PZMA 2W00A 3K16A 2BRUA 4XYMA 4Y2SA 1WZIA 2BSQA 5FQOA 2FJPA 4FQ7A 3RB8A 3H16A 4AMUA 3ZD9A 2ZQ5A 1L7VC 1P1KA 4Z53A 2X1HA 3H9QA 3QJ5A 3A3NA 3LUFA 3P26A 2JGMA 2FOLA 2CSUA 2LW7A 2PUJA 3BTVA 4IXWA 3RGWS 2H7YA 3IEPA 4BEBA 3WYNA 1V43A 5K3OA 3U3ZA 5LQMA 1LRKA 1FSSA 2WTMA 3D4OA 1N33B 1T3ZA 2GB4A 4XWAA 1OJ7A 4PEVA 3HGMA 2LP4Y 2YCBA 1CUUA 2OV1A 2ZR0A 4RMJA 4ZO9A 5EP4A 4DLAA 3W9BA 4ER6A 1HKUA 4X44A 5EKTA 1WPRA 1E1RD 2B7LA 2Z1MA 4Q3CA 3FIJA 5TX7A 4MQ4A 1Y42X 1EFPB 2EU8A 3HCCA 4X9XA 3TAXA 4UBIA 3DZKA 3GDFA 3V2IA 1Q0LA 2BGRA 2AQ8A 2C9ZA 5HPYB 1NU6A 4MB0A 5JWHA 2CB9A 2X6RA 3SQDA 2JK0A 2ZTLA 1GO2A 4YV2A 1SHJA 1ECLA 4MAAA 3QW2A 3WMRA 1E2IA 2C83A 2RHLA 1UC8A 2XMCA 1VHLA 2COUA 1EG2A 4R9RA 5ALNA 5FNZA 3TR6A 1ZUNA 3OIUA 2EZUA 3V3KA 3G2LA 2C9MA 1BCSA 7YASA 5KYUB 3RT1A 2QW8A 1G60A 4IVNA 2WT9A 4F9FA 2DLCX 3U6BA 1JT2A 2P7HA 3STYA 4TT3D 2NO7A 1IHDA 2ZSIA 4YT5A 1JR3E 4Z49A 2Q2OA 1G2OA 1GQOA 2Q21A 5EJFA 4GWGA 3KZKA 3H5NA 4B3GA 2GBGA 5CB4B 1WU8A 2FLVA 4EUHA 3UICA 1PR6A 3OLYA 3TLZA 5FCDA 4B4OA 3L7KA 4ZQBA 4GWKA 5E4JA 1B8NA 1NLUA 1EGVB 5T67A 1EK5A 3GVXA 1CG6A 3EZ2A 3AFOA 3FWHA 1SVMA 2AJDA 2OL4A 1QONA 1NAHA 2G1UA 3OIWA 3STUA 3ANNA 3B3AA 3RUHA 3WMGA 3AVUA 3IIKA 1JDVA 4UE2A 4QU9A 3ST7A 3H19A 2ZJ8A 1SVSA 2J33A 2AD5A 5E7QA 1PR1A 2Z09A 2Z2IA 4Q4AA 4BTLA 1GPWB 4AI6A 5GM2A 4LY3A 2Q5HA 4AULA 4U8HA 2ZIXA 3C8MA 5EJMA 4UD2A 4DUPA 2AMLA 1IK6A 4GNRA 4YV1A 2HV9A 1JQ5A 2GAOA 4KVAA 1OLUB 3MTJA 4GUAA 2PD3A 1IE3A 1M2OB 2WWTA 3T35A 1ZIYA 4CEIB 2REBA 4UBOA 1U4SA 1PE0A 3MQ4A 1A1VA 3GWGA 2HBYA 1P5HA 4RSGA 4DA4A 3I6YA 2I91A 2EW2A 2VHEA 4DMHA 2CJWA 1NF8A 1UDBA 2JIRA 4NV1A 4ALJA 4LZZA 1CS0B 6NULA 2Q0HA 1M8FA 2A0UA 4BV8A 3N0WA 2FGKA 4RIIA 4ZZ3A 4IUYA 3HKCB 4R54A 2J9YB 3BH6A 3NHFA 4IIDA 1NBWB 4Q9LA 3M2PA 3UMRA 3AF1A 4WN9A 3O3OB 3OE7D 1XQ9A 3LDAA 3UAZA 4B43A 3MPOA 4DBLE 1NUPA 2YYAA 5B1HA 2YWCA 1MB0A 2YMPA 1GAQA 4U2DA 4QO7A 4J3FA 2OBLA 2Z4RA 5EZ5A 2AG0A 2C7BA 1I9CA 5AUPB 1B2RA 1C7RA 2HNAA 5TS3A 3TTWA 1QSGA 1L5RA 5AM4A 5KKNB 1ST3A 2QLLA 2ENUA 2DHQA 2E6UX 4WADA 4D3SA 4U7TB 4RM3A 1T0BA 4XSGA 4C4AA 1RLJA 1V3UA 3EZLA 2QTGA 1X8JA 3RE1A 5IKMA 2YWRA 2BRUC 3LDGA 1A1SA 3OETA 3QWAA 3J80A 4GMHA 3T6KA 5KYXB 4OJQA 2AKEA 3M34A 4Q3OA 4YONB 3BMNA 3FOAA 5CYPA 2IYEA 2BVNA 1JB9A 4LXUA 2RGCA 1RYDA 4E7PA 1YD7A 4NATA 3P97A 3ADOA 3U37A 4AMBA 3OTQA 5CW1A 4ZZ1A 4S24A 2GNPA 2HM7A 3HPRA 2H4ZA 1QGED 3NGXA 2NQ8A 1A82A 1SZPA 4FCVA 4PZUA 2HDWA 1WETA 1BIFA 2ZS7A 3S2EA 1TA4A 2ZP1A 4R2KA 1YE5A 1UMKA 1ML4A 2BFNA 1O9HA 3QYFA 4K46A 3TBHA 3VR0A 4ETWA 1EXNA 5ICCA 4XYEA 4KH1A 3FVWA 4UASA 4JLVA 3BTSA 3IDFA 2AZ4A 1U3DA 3EGWA 4AM8A 4BP8A 1BE8A 4OMCA 1PKEA 5KTTA 1JXOA 2I66A 2B9VA 3A14A 1J9ZA 3D0KA 1GV0A 2A3NA 2CMDA 4ZDJA 1L4FA 4YCNA 2V59A 1YU6A 3RC2A 1F4LA 1JQAA 1U7PA 3OWHA 3GDGA 5KX5A 5JXIA 4Q1BA 3ZQ4A 1Y7HA 2XCOA 2Y9MB 2OXIA 1XVUA 4AO7A 2X3UA 1TAGA 4DGQA 2GNAA 3EWSA 4EHAA 2XQFA 1MRZA 1S7GA 3DV9A 3KYDA 4IDFA 3ML1A 1LH0A 4KUHA 1OAOA 2ESRA 3HKEA 2PD4A 3F67A 2FE4A 3GJZA 4N4AA 4YFYA 2H51A 1DGQA 2CLCX 4YPVA 5DI3A 3MMZA 3FYUA 1HDXA 2OXTA 1J4AA 2HZBA 3M9XA 3V8MA 4BLUA 2G9RA 3NAMA 4ECAA 1VIYA 1AE1A 2ZIXB 4P5PA 1M5UA 4CFSA 4LF8B 4Z4FA 2IOYA 2IYAA 2RGBA 4N3BA 1P0PA 2WAAA 3CF4A 3N58A 1YGYA 4B7ZA 4BGDA 1P0MA 1P1HA 3MBKA 4QPZA 5F9FA 3AERA 3TZLA 1U63A 3BQNB 2VXOA 5GIOE 2VSOA 4DDWA 2X4GA 3CH6A 3FWNA 3GNSA 4P4LA 3RS7A 2W6QA 2YFYA 1HEIA 3DE4X 1YZVA 3PJGA 4QFDA 1BOFA 4OYHA 2UYQA 4F4JA 3T3MB 1TADA 8ADHA 3NHKA 3ZE9A 1KYZA 4BTEA 3QKSA 5H1YA 3EVEA 4U7JA 2D2IA 1RKUA 3TLYA 2VZ9A 2Y05A 4Y6RA 2EERA 3NJRA 3IE0A 1JE0A 8AT1A 4J4TA 2B2CA 4YMLA 2HHJA 2B8EA 4JMPA 4OKIA 1ZUD1 2PUAA 2V1UA 2FZKA 2ZUTA 1YDEA 3ZWWA 1UBOS 3EG9B 1ISJA 2OFFA 4QELA 1XQWA 1EQUA 3MT8A 3QU4A 3OECA 5IUKC 3W1EA 3FLEA 1Q7TA 3E15A 1XNJA 5DLPA 5IJAA 4EJSB 4F38A 3E9ZA 4FDMA 4Q1AA 2UYCA 3AV3A 1SHZA 3V1YA 3RS9A 3SZRA 5FLYA 3WS7A 4E09A 1LS1A 2IGBA 1NJ6A 1ZU4A 3IFSA 2VQ3A 2P4EA 5AVRA 4N7RA 1KJZA 3U3MA 4D9GA 4LYEA 1N0WA 2IPAB 2QD1A 3QEKA 4HDNA 4Z6KA 3IAEA 3OBIA 2DFKB 1PJLA 3E35A 4KXLA 4M8NE 4U3JA 5KAMA 3CZQA 4TM7A 5DWQA 4D6YA 3OIVA 2GCGA 2VEOA 2O14A 1U2EA 1BRTA 2ZDHA 1TMYA 3IOYA 2F8SA 1A77A 3NVDA 4GSYA 1RVV1 1FYWA 1Y7LA 2OGTA 3ENZA 4X94A 5FNVA 3SXUB 1QV7A 3GU3A 1MABA 5EQDA 1YRBA 4KODA 5A03A 5HG0A 4NENA 4YRNA 4MGYR 1Z4LA 2QR3A 4LN1A 5BNWA 3F5QA 4DC9A 1SU7A 2D7CA 1H3FA 1ML3A 3Q7TA 5KDOA 3EQ7A 1E2BA 3W7AA 3X1WA 1WVGA 5F52A 5A5VA 3C5CA 3ACDA 4V0NA 4A92A 2O8DA 2AC7A 5JS1A 4KO8A 1OC4A 2B8TA 4MUJA 4YQEA 1UFOA 2D1SA 2Y0EA 1HK7A 3EGDB 4MWSA 1Z5GA 2FI1A 2P41A 4PRLA 4XUEA 5AKXA 3WGIA 2ZJ0A 3IQIX 1ES9A 3HLYA 1RZUA 2A58A 2C1EA 2VSXA 2NTVA 3MQFA 3OPXA 3I42A 1FDTA 2NVWA 2X0DA 3E1KA 4TTVA 3H5LA 2CK3D 2YRXA 4FGSA 4RGBA 1QIMA 4GLFA 4ZVKA 4PFKA 4C05A 3DAHA 5CT8A 2VDNB 2ZW9A 1L5VA 2A1IA 2P6NA 3SS9X 2IHTA 3CYFA 4CMIB 3FMFA 1FX0A 3IQZA 3FPGA 2DE0X 1EWVA 2LR0A 1BCRA 1BS9A 4UEQA 1USVA 4JT9A 4P7GA 1QZZA 2W2KB 3W2HA 4OA5A 4I9HA 4A73A 2DUUA 3UTCA 4C43A 1TGVA 4KAXA 4F0JA 2ODAA 3T1OA 1FLNA 1WY7A 3IULA 1T5LA 2TS1A 2QRQA 2VJOA 3JS5A 1IOZA 1EFTA 4HY3A 3IURA 5GWXA 4DQXA 1P18A 4AY2A 1LUAA 4KXYA 2ETVA 2QAIA 3KQWA 1BE0A 2NX2A 4EM6A 4WERA 3BTOA 1LK5A 3LGAA 3Q6NA 4YEDA 3HUEA 4BQOA 2IVZA 1NTRA 1KJ8A 2AXQA 3AIOA 3ROFA 2IWHA 1IFXA 3RVOA 1DPGA 1UK8A 4PHHA 1BGVA 3WGLA 1IQRA 5L4NA 3GEDA 4IJUA 4UAGA 2FYTA 2A88A 3RIXA 2E87A 3OJ0A 4RK0A 2GEDA 4JEHA 2OAEA 1G8PA 1GPMA 4TUYB 4RWEA 5CCEA 1M7HA 2CHVA 1Z4MA 2XBUA 4HKTA 4I5DA 3ZVLA 1NASA 3NKLA 3W4JA 1E3MA 5J47A 2LCQA 2ZB7A 1V37A 4Y1FA 2B2NA 4V0OA 4WK2B 2PH1A 1F2UA 2PGIA 3QYPA 3UG6A 2A9VA 3Q9NA 5E6SA 3CN7A 5JXHA 2WSMA 1DG1G 4I1UA 2UUAB 3IRVA 5JSKA 1SUFA 1N6NA 3G2MA 1AF7A 1E6EA 3HP4A 4OXIA 2JFFA 1MZPA 1M7BA 5ALKA 4CXMA 3IKMB 2GXQA 3FUVA 3P0IA 4WHMA 3V9AA 4AJOA 1XZAA 4DC0A 3ZBTA 2F9MA 4K40A 1CR4A 4N7MA 3O38A 1V96A 1RPAA 2AOUB 3KB8A 2PO7A 3LQ2A 3LUHA 2BZ0A 3QMWA 5KMGB 4BQEA 3JU3A 1UZMA 2W58A 4Q4JA 1B0PA 1GLNA 3JVVA 3ZDYB 2WWVD 3C3KA 3A6DA 3HNPA 4N8EA 3ESAA 1E69A 4RVDA 4A03A 3HYSA 5JCXA 1BXGA 1L1QA 1TZJA 2GCOB 2O52A 2V6MA 4CKEA 1Y6JA 3BXGA 3M1YA 4PSDA 3RIEA 1VLMA 1FTWA 1F20A 2ODTX 3SY8A 2DUMA 1P4AA 1LLQA 4QXPA 3VZBA 5HQ3A 2MYNA 1FDOA 3EXIA 4B40A 3VZCA 4HJRA 5GONA 3FKQA 2NV0A 3BK1A 3ZK7A 2GESA 3ICVA 2PZKA 1DQPA 1GGMA 2OSBA 4FONA 2BLNA 5JXWA 1U3WA 3ZE1B 1EP2B 1RHQA 4LWPA 4PRZA 3VR4D 4RTJA 3W7VA 2Z98A 2BPOA 3LC0A 3TFOA 2Q8PA 2IH5A 2RKWA 3L5KA 4ZAWA 4Y2HA 5IDQA 1PU2A 3UK6A 3WSTA 4IXDA 1X15A 3HKBB 3NC0C 1BC5A 2CFTA 3PU6A 4RCYA 4PNHA 1VP9A 5K3SA 1G7SA 3REQA 3I0MA 4O1IA 5IZCA 1FDUA 3CWZA 3K70C 2PX4A 4IHQA 4P86A 3V1NA 2E18A 4GI1A 1RAEA 3O93A 3LXUX 4QGFA 2BGNA 3D3KA 5LZ5A 3GLGA 5PGMA 3PHJA 1YQEA 4NC9A 3ZGXA 1L1EA 4XCXA 5FI3A 1NW4A 3HZRA 3HK2A 3BRSA 5CYOA 4EJ2A 1Z2PX 3AUUA 2H16A 3SC6A 2FA9A 3JZFA 1CF9A 4JR2A 1Q1EA 2ZREA 4EI8A 1IY2A 4B6RA 5D87A 3D5QA 3FETA 4DDMA 1YRYE 1RNLA 1FLVA 4FVTA 2RI0A 3OMWA 4NBKA 3TRFA 1K2VN 2J3DA 3HA3A 4E51A 2WD9A 3OBBA 5ER9A 3OKAA 3A04A 4L3WA 1MJFA 1N9KA 5DSTA 1VMEA 4ZHQA 6Q21A 3UGJA 2BKAA 2H4XA 2M98A 3KSZO 3NHUA 2WWYA 2HGZA 1P0FA 5LU9A 4X41A 1X94A 1X39A 3UK1A 3VNQA 4PZPA 4JR1A 4QUJA 4HN2A 1CE8B 5AOAA 5HZMA 1DEHA 1DT5A 4QARA 1EVLA 1ZCJA 1JLKA 2PZ8A 2I34A 3U1BA 1N2HA 1OW3B 2WSSD 2Y4OA 3ER6A 1NBOA 3HNOA 4XIGS 4EYSA 3AFMA 2IITA 2OB1A 3O9ZA 3ESCA 1RI4A 5D6NA 3VJKA 3D6JA 4JSYA 2ADFA 4BVFA 1AM4D 2NUTA 4IH9A 2PNFA 4HFRA 4IZIA 3WIOA 3K0AB 3KBOA 4ZT7A 4MTLA 3KB6A 2HYDA 3E48A 2A9KA 4MV9A 3ODGA 4MI9A 5HZHA 4DA0A 5EE0A 4U6QA 3R3XA 4P7FA 2X40A 4RZQA 1Q83A 4JXZA 4YJFA 5FP0A 1WHTA 5TARA 4PQFA 3I05A 2VPXA 3DCJA 2V3VA 3O1HB 2H54A 2WMOB 3QLVA 4OOEA 5KX5F 1T0UA 3PXUA 4RAQA 3TQIA 2IEDA 2WK1A 1RFLA 5K5EA 2AN4A 3AWIA 3R44A 3SFVA 5JR3A 4GI7A 3GR6A 4ZRDA 3U4QA 1C1XB 2VPWA 4BN5A 1E59A 2QL5A 3OVMA 4I5EA 5CFNA 3GPDG 2OZKA 3Q0EA 3UWDA 4EGAA 2R44A 4TKLA 5B1EA 3SBDA 3HE3A 4OXQA 2I8LA 1JEYA 3JD3A 4KIGA 3OOHA 1YVEI 3CLVA 2IYLD 4BN4A 3LWNA 3DO5A 4RHCA 1ISHA 3BJMA 2J4FA 3T7SA 1PL8A 3ZS9A 4IVRA 4NU0A 3ZJVA 4M46A 1WLYA 3JTEA 4JNKA 5AQEA 4G0WA 3AFNA 3BILA 2NO1A 4E2ZA 2XXAB 1XQ6A 2QHXA 1U0EA 5BN4B 3WXBA 2JVJA 5ICFA 3UQZA 1SUDA 4E5MA 4JBYA 3GDHA 1OYWA 4CKWB 3GLGB 3FJ1A 1KEVA 3QKRB 1POXA 3UUWA 2ZRIA 3UB3A 4HLUA 2CCJA 5CA0B 3SE0A 4XYBA 4AUNA 3K5WA 3QWBA 3E3OA 5LQKA 1E9SA 1OAKA 3GA0A 1KXJA 4PW0A 1L7BA 1FJ2A 4LMAA 4INPA 5A3RA 1C30A 5KQMA 4V24A 3OZCA 1JJVA 1EQAA 3A9CA 4DKXA 2ZYWX 3JW8A 2DR0A 4K1XA 4KAJA 1H4TA 1IB0A 3P9CA 4JJGA 1X92A 1E8MA 1KK2A 5EGNA 3WIVA 1E2HA 1OXBB 4QGSA 4EF6A 3E8XA 4NFSA 4YMTA 4XOUA 3NGMA 3OZUA 3HJBA 1I4DD 1HE2A 2FR1A 3EXEB 1B6RA 3OPYI 4RSHA 1Y6RA 1MB3A 4PC3A 4BRUA 5C80A 3V7NA 3SWWA 4NMHA 3VM6A 1Y3HA 4NZPA 4IEIA 4PX3A 4DLLA 5LJIA 4WCFC 3H5AA 5I4BA 4IMJB 3NTXA 1RWBA 3IMGA 3JATA 3H83A 4LGYA 3VR2A 5KJEA 3WP0A 3V1KA 3DAPA 4J0KA 2PAFA 3SLKA 1NFRA 3QH4A 1LPBB 2A8YA 2FPPB 1X0XA 2P3OA 3G8CA 4BNTA 4ZI7A 4CZ2A 2WVAA 4RELA 4MIYA 1V45E 1W93A 4HD8A 1UXJA 4XLLA 1N2GA 3OZVA 2QTTA 5GMOA 3RIHA 1GYPA 1CUHA 1RXUA 3HJUA 3C3EA 4ZI2A 2PU7A 5EI5A 5KCZA 1WPQA 2QBYA 1L5ZA 1SD2A 4LJSA 5ECGC 1EPUA 4ZVTA 1GPNA 5TR9A 3JALB 7REQB 1M2VB 2GK7A 4PSCA 3ZLUA 4X7PA 4ZEVA 4LF6B 3K0FB 3DXYA 4Y2GA 3OIDA 4R5MA 3ORQA 2XNKA 1OWMA 4X6LA 1LU9A 2HRDA 2PVCA 2DWUA 3KEFA 1WABA 4II3A 4RFSA 4I0WB 3NIGB 3V8NA 4OHMA 3WTBA 3ZWVA 2CVZA 1JHAA 3D4NA 2EGGA 1J1ZA 4J0FA 4KP7A 3WDSA 1QP0A 4FLMA 1DC4A 1L3BA 2FLKA 1FFCA 2R1UA 1KBZA 3Q3GE 3Q3EA 3T0IA 3ICCA 3N70A 4PAWA 4YBZA 2JGDA 1D1TA 2CJPA 2FW8A 1E3LA 4M9XA 3MPUA 5F9MA 5B53A 1XDWA 5U9CA 3OSUA 1Z6ZA 3SBOA 1X42A 2O20A 4K9PA 1PK7A 2HO4A 4DIUA 5JXGA 1SXHA 4CQMA 3WJ1A 1IAQA 2PT7A 4H3HB 4DANA 1WQ1R 1P2SA 3J81k 5CDFA 4E21A 3UUEA 2NAFA 2F48A 1EX1A 1D2CA 2I6XA 3QVXA 5LPNA 1F6BA 1C1DA 3L7NA 4P5DA 4YA6A 3ZGOA 5A4MS 5F23A 4EJ6A 1TO2E 3M4YA 2M2IA 4NBTA 2ZE8A 1U80A 1XAIA 3AVYA 3KZVA 1FFEA 3OO0A 4NR0A 4YHBA 1OKKD 4JJ6A 1JFFA 1T43A 4DAEA 4URUR 4F8JA 2XGOA 4TWZA 3F8TA 4E5PA 4FBLA 4BO4A 5KWIA 3FGZA 4XM0A 3TIXB 4DY6A 1OBOA 3KELA 1VCHA 4KQ1A 1J23A 3TEJA 3AYXB 4JLUA 4M0UA 4Q37A 2ZRAA 5F3WB 4MW0A 1YAHA 1WP9A 2H5EA 1T91A 1TK9A 4MWGA 5ISMA 1PEYA 5ES3A 1W5TA 4IOKA 4MW4A 1VA5A 3UV7A 2QRVB 5JMPA 4A91A 5AVYA 2O0HA 2YFKA 1YBAA 1OYYA 4DCPA 5CJ2A 2EKDA 2Y1DA 2W2VA 3AKDA 4EPRA 3B6EA 3QITA 3B48A 4QOFA 4ZZ2A 3TD6A 3TL6A 1U2QA 2X42A 4RZXA 4PC1A 5EHXA 1TJ5A 1A69A 4NENB 3FLMA 2IY8A 4RH1A 4LBZA 5FOUA 3V1UA 1EX9A 1WQ3A 2UVQA 1BNCA 2OPBA 4N82A 5EINA 2PN1A 3QVKA 4E94A 3MF4A 2D00A 1KI4A 2LD4A 4ZU3A 4E4RA 2V7WA 2VXYA 3B38A 4JBLA 1TU3A 2JIZA 3FYUC 4AWXA 4CN9A 3D1JA 5IG2A 4K9SA 4PSKA 3MRVA 3S1AA 3GYBA 1N2CB 4U2CA 1YUMA 2ACVA 4EA9A 3QX8A 4J0EA 3KNZA 2JZCA 3J7TA 3S99A 4KUGA 1U2ZA 3WSVA 3M6WA 3OP1A 1YS7A 1KS2A 1G8AA 5ADHA 4L8GA 3ZZNA 4MJLA 3O7MA 5K03A 3DLIA 1NJGA 1LWNA 4X91A 1WR8A 3OE7A 3W5SA 5IVHA 3TKYA 1C7EA 1QUEA 5LA6F 5LD2B 1IEQA 2ISQA 2IYPA 5KTYA 2XZTA 2AR7A 4JX8A 5E7IA 4MHTA 3NWPA 5LOVF 5ALSA 1XZJA 4BX9A 3DSRA 5F7OA 2O19A 3PYXA 1NUTA 3P9SA 3KE8A 4IO0A 2I8AA 4F4FA 4K9OA 3LUGA 4DHEA 1II9A 1AGYA 1NZFA 2Y93A 1CQIA 1XTBA 2V4ZA 1CP2A 2YZNA 3KZ1E 4JWKA 4CM9D 1KVSA 2YRWA 1GNRA 3JQRA 3WDKA 2XWQA 2ZBQA 3UYKA 1L7DA 3CPJB 1XZPA 4WT7A 3ZHUA 5B6IA 2JLSA 4DMGA 5LZ2A 4XB2A 2QX8A 3MWLA 1XVTA 2NXCA 5FI5A 2BCEA 4Z2YA 2HEIA 5LMZA 5BUCA 2JHPA 3KCQA 3T8YA 3U4AA 4XFKA 5IM5A 1QR2A 4MW6A 3CE6A 2BBTA 3DW1X 3NX4A 4NJEB 3RW9A 4CLOB 4ZJUA 3PKIA 4LYHA 4CMAA 3SMVA 1XD9A 4YBRA 2A5DA 4RPIA 4ZOLF 5IFLA 1E2DA 2J0VA 2JGFA 4PV7A 3DBOB 4EI2A 2ILVA 3GJ4A 1BGWA 5DTMA 2Y0DA 3HXQA 1ZWKA 3PICA 2PNJA 4K1LA 3MTBA 3TQSA 4EHHA 5HUJA 2B5WA 3HY3A 4L07A 5IKPA 4WAUA 1OWLA 1L4GA 1WF3A 3EAQA 3BRWD 1N3IA 2A1TS 2ZAGA 3DLPX 2W2XA 3OIGA 3GP5A 2ZANA 3VJLA 1T4CB 4CT0A 2ZTHA 1KSHA 3MB8A 1QVVA 3ZZ0A 4KQJA 4F3TA 3IE1A 4JUFA 3FMIA 1NVUQ 1FTGA 2O4CA 2FOXA 3FPAA 2YIMA 4JDUA 1SXIA 3OMXA 2GD6A 3CRW1 5DM0A 3MLBA 4FR5A 5KYNA 1V71A 1NW7A 4EWLA 1Y1SA 4PLYA 3EZXA 1IYZA 2OHIA 2GFIA 1X7HA 1EB9A 3K8QA 2CNBA 3FA2A 5LM3A 1TM3E 2O0KA 1GPBA 3B7GA 1EK1A 1NMXA 3Q4GA 4XIYA 3ZK8A 4C88A 2W6NA 4OL9A 4YDRA 2V5UA 1Z06A 1JTVA 4FBMA 1T0JB 3O83A 4RV4A 3WGJA 1Q7RA 3E9CA 4U00A 2PA3A 2YINC 3CKYA 1TA9A 3I92A 4L8FA 4QULA 1NVVQ 1H85A 1HE8B 4F2PA 3MBIA 5L3SB 4ZA2A 2EARA 3KLPX 3BAFA 2R48A 2FHPA 2XZDA 3P27A 2NPFA 1DIAA 3V2HA 1FDVA 4AZ0B 3OOWA 3R3VA 4PBTA 4BEWA 5AKKA 3GGPA 1HFJA 4J2TA 4BP1A 1JU4A 2DFPA 4BEJA 2R47A 3UO8B 1U1FA 1QTIA 2OO3A 1B43A 1TLLA 1P5ZB 4Z8XA 3W78A 3WLPA 4EUKA 3MUEA 4MICA 2C04A 2QAGB 3OY7A 2K7FA 1TUEA 3LGSA 1W9HA 1K7SN 2H1CA 2IOQA 4HDOB 1U6KA 2QENA 4HDAA 1DKPA 1TFUA 4L6IA 5IFKA 4KLZA 3OQHA 3ITKA 2F17A 4N5DA 5AICA 2D3WA 5DSXA 4I4TB 5EVCA 3SYTA 3JZMA 4I3HA 4RESA 3QTTA 1IOVA 3T1YB 3VU9A 4GHWA 3MM4A 4WY8A 3GQBA 5I3CA 4N5NA 5K09A 1ECCA 4QU0A 2VF7A 1GFZA 4XGIA 5AVTA 4UCXA 5A62A 3EGVA 1ZVQA 2E49A 2BGJA 4CE6A 5LLDA 2R6R1 4IWYA 2BZSA 4OXKA 2BHSA 4EZEA 1RJGA 4FGWA 3JWIA 4CL8A 3PHBE 1OYOA 4BWGA 2PAAA 1I33A 1U9IA 4MUAA 2GZ3A 1URPA 3SC3A 3PFBA 4D96A 4EMTA 3D7NA 3GFOA 1M75A 4MMZB 1PR5A 4RA9B 1CS0A 3DMHA 5IHPA 2QDXA 1F2VA 3C3WA 1SOVA 1RAFA 5YASA 4KL8S 5FWNA 1RRCA 3ADPA 3Q3IA 2VNHA 3HCAA 3L1UA 3L4KA 1MH1A 3ZHRA 1B7GO 3W2IA 3VNUA 1VMKA 2XNSA 2AE2A 2O0JA 2OPHA 4A1OA 3AKYA 3KQOA 4TZ6A 4B2YA 1I7QB 1U1GA 1ZXXA 4JYBA 4R9UC 3K94A 2I67A 5FWYA 4FOPA 3JYHA 1ZZGA 3R5TA 1G2QA 4H4EA 5E1OA 1YI8A 3ZX4A 1E2QA 1XMVA 3C3MA 3CJRA 4MO2A 5AVVA 2QIPA 2YZKA 2FUKA 5E95A 2H57A 1ENZA 2CFOA 3BXPA 1NYLA 2X86A 3E2PA 4MRAA 3VTAA 1QZUA 1DCTA 2PGDA 5E2AA 3NHBA 1QRTA 4HN9A 4KTTE 4BLTA 2J9ZB 1NKSA 4YRGA 4DDUA 3UB2A 4NQZA 4BFXA 2DKOA 2C2KA 5JYDA 5AHWA 2WYVA 1Z56C 1VRCA 3C8DA 3MFQA 5DO9A 4ZOEA 3ITEA 3K9NA 4MI1A 3ESQA 1F8GA 3U5TA 1CUYA 1D9XA 2PMFA 3CBGA 3FTDA 1ZJWA 1QBGA 4BO9A 2FMKA 3EXFB 1GG5A 2QUHA 3B6MA 4IWNA 4YUZA 3VX3A 3PQDA 3SLRA 3HCEA 4LJ9A 2I6UA 2J3QA 3BQMB 5F3DA 3QUCA 4ZCPA 4DFDA 3FDJA 5C3UA 3L4BA 1ICIA 1VG9B 2EAUA 3LA6A 2CNWD 4IHJB 1PL6A 2I62A 1CLUA 1E99A 1YE8A 2QRNA 3LPMA 3N8DA 4P1ZA 4RHXA 4V0ME 5CMLA 3TTVA 4QICA 2KW5A 4BNZA 4EY8A 5FADA 1VMIA 3LX8A 4N8SA 3SEZA 1QHHB 1U9YA 2PEZA 3D02A 3X2EA 4D25A 2OC4A 3IAFA 3SHQA 3D7KA 1XZGA 1US8A 2F43A 3IAM6 3E5NA 3CRMA 3I9MA 4LF4B 2CDBA 2YJGA 1XK7A 1RCTE 1YIDA 2C2GA 4HXYA 1JFVA 2AXNA 3G49A 3IUJA 4PR0A 4BMPB 5K6RA 3H65A 3MN1A 1YRWA 1E9DA 3BL5A 4TXMA 1TM1E 3HL0A 1KAQA 5F5LA 5C81A 4DR7B 2Y92A 1B0ZA 4Z86A 5HXAA 2VAVA 4GBED 2HKIA 2PJZA 3IBGA 1M3SA 1Q15A 1X7YA 3LY7A 2FQWA 5D1NA 4TYPA 1UBTS 1G9XA 4EHBA 3EGIA 2G82A 1Q1BA 2NUAB 2IS6A 1GQSA 1VL6A 1WNFA 1Z8FA 3F9RA 3PUHA 5A2GA 1NUUA 5IF3A 2OD9A 5BV0A 3ZIAA 3ZE8A 1K8YB 4WOBA 3ZU2A 5LQJA 2H4YA 4YCDA 1H8HA 1PTJA 3KKKA 4ZEMA 5C35A 3Q11A 5CDYA 3K9WA 2W93A 1ICEA 3BWBA 3VOBA 1GZSA 3LBAA 1PAUA 1XRRA 4QBKA 3DFMA 1W59A 1S0UA 3MUFA 3MZ0A 2Q5OA 3QJYA 2ORIA 3RRFA 4ZU1X 2ZQYA 2NZXA 4EY4A 2FJ0A 1YDHA 1TT5A 1B0UA 2WJGA 1BW9A 2NTNA 5TGZA 1XTRA 3EXEA 4ONEA 1JVNA 4TL9A 1YQTA 4K6FA 4KR2A 3ZY6A 4DLKA 1G5RA 1K0FA 3IIIA 5F7XA 3HDGA 3FSEA 3HEBA 3NTUA 4TWBA 5E9WA 1ZNZA 2O2EA 5IYZB 3AUSA 1Z8DA 1U2RA 3LT5A 2JGNA 1CUJA 1FPMA 3WK7A 3VKHA 4HQLA 3VC1A 1Y3CE 3ZH9B 2UXBB 1A2BA 2BD0A 5EUCA 1NNUA 4OV6B 1UEXC 5C32A 1I2MA 1X6VA 1T35A 2DPMA 4OGKA 4V0MA 2JCSA 5L3ZA 4IOLA 4EZIA 3WA7A 3L0OA 2P6PA 4M0KA 4WZAB 5FWXA 4CLXA 4LHYA 2XE6A 3PFKA 3NHWA 1UJ5A 2NNLD 2ORVA 4FJ1A 3ND8A 1OXTA 1Y1KE 3GAZA 4C2TA 3RYIA 2X76A 4IFTA 3C97A 1F1BA 1QAOA 4L5CA 3BOSA 3UVEA 4C3OB 1JMVA 4CETA 3E9QA 3FKJA 3WHIA 1U1IA 3NFRA 1UKEA 2G9UA 3T9EA 2NYVA 1GRNA 3CKMA 3Q7PA 4OHOA 1XDZA 3P9PA 1EVKA 4P84A 3OZRA 5K0LA 3L8EA 3TO5A 2DOKA 4Z9AA 3R3HA 4HRAA 1GAJA 1KQPA 2KHZA 2XW6A 1B26A 3I0NA 5AJXA 1GTZA 4ZCSA 5T64A 1ESMA 2H11A 5FA5A 3WGOA 4DQKA 1RAHA 2X5JO 2H63A 4F5EA 1Z2CA 4HS4A 4B3IA 5ITVA 3KHUA 1TX4B 4QYXA 3UAOA 1DC3A 1QH8A 2AFHB 4QAJA 3SHTA 4DLUA 4L8YA 1IDN1 3EQ9A 3G2KA 2JG3A 1FSPA 5LNK1 2ZVDA 3W8NA 3X1MA 3GFPA 4E03A 5BT8A 4N0EA 5TQJA 2VRCD 2NU8A 5JAPA 2BTQB 1SMKA 2Q6IA 3IV9A 5CH5A 1CIPA 3UFXA 4NCIA 4QKQA 4YMUA 2HQ1A 3DDZX 2ZT8A 4TVKA 3KXPA 4NWIA 5F78A 3C87A 1P5FA 2JFNA 5J2UB 3R9IA 3U4CA 3WIUA 3OLZA 4NHOA 3VHXB 3ZY2A 4EUNA 1E2UA 2GWHA 2QXYA 2X9VA 2FUG6 4OIFA 1SVUA 2DLDA 4WWHA 3GNTA 3M1LA 3HEMA 2XD4A 1Z2NX 3ZHSA 1OY1A 3VMMA 1VE6A 1JKJA 4YJHA 4GWLA 2IE0A 3OJEA 1YVUA 3R3ZA 2YWBA 2WQZA 1H8EA 3KLBA 1N78A 3DEAA 4I8DA 2VP5A 5DRYA 1SIUA 1SWWA 2QNRA 4BBZA 5H9WA 1OREA 1OJLA 5BSGA 4O4IB 3KU4A 4ZIRB 5KVAA 3T1TA 3N59A 3SHFA 1ZRNA 1Y82A 4O4JA 4C06A 1E5TA 2HEGA 2DFTA 2Z3WA 1AKTA 1H22A 1N7HA 3HN7A 5C5CA 1C1DB 1VKJA 1WXHA 1G5FA 2NG1A 4FB4A 3SQNA 3NT5A 5JDIA 1Y1PA 3F73A 1QFZA 4OKSA 1EJ2A 2N46A 2W6IA 3HZOA 4TLMB 3KJXA 4TPKA 3U26A 3CVVA 1U8TA 2FP3A 1Q74A 3AQIA 2O7RA 4Y6LA 4N5IX 1PG2A 1P33A 4HDKB 1LJUA 2MT9A 5FWYB 4Q3EA 5KDLA 3WQBA 2OZLB 3GHYA 4BMNA 1OTHA 3WYAA 4M7PA 4V03A 1FE8A 1M72A 1XB2A 3L7OA 3PDJA 2E7ZA 1W36C 4BLVA 1Z7GA 3IT3A 1Q50A 3ESYA 1NVFA 1U3UA 4DR1B 4BPBA 3WC4A 2ZE6A 1U98A 1IVYA 2QXTA 2HSDA 4FXOA 4WY2A 4CCSA 4M0EA 1ISSA 4BX0A 1OXMA 4CQLA 2AFIE 4PAMA 3GEMA 2JFQA 1YH3A 3DPSA 1RLOA 3QU2A 1PFQA 2ORWA 2DSNA 5JMTA 1G8HA 3G2PA 3QXCA 1G19A 1UK9A 3LBFA 3TW4A 2Q5CA 4XLZA 1YQ9A 2IW1A 2FMIA 2GZDA 2IYFA 4RHTA 1Z08A 4XB1A 1EWYA 1Y3IA 4QEZA 4O33A 1QLHA 3GFSA 2CWWA 3G23A 4UFOA 5EHZA 3TLKA 4UC0A 1UXIA 4IDNA 4RXMA 3MOSA 3UGQA 1K86A 5BRJA 4FFDA 2TRSB 4N6OA 1G9SA 1O6FA 4QE3A 5ADWA 2NO0A 3NUZA 3LP5A 4LFBB 3NATA 3MOGA 4K05A 2NO4A 2DLNA 4RMGA 3EB9A 1OIWA 2PL5A 2I3DA 1KHTA 2H5JA 1NYRA 2ORED 1UBRS 4RTMA 4FQ5A 4P9NA 3ZJ5A 5F1KA 4DXAA 3TL2A 5CEJA 1ZH8A 4LY9A 3WL7A 5K0TA 4MV1A 1PLLA 4G1EB 1U1DA 1EE2A 4GVPA 3LPDA 2CHQA 1ZL0A 1IU9A 4YRFA 1Y5RA 1ST2A 3DW3X 4IDGA 3V3TA 3ZHBA 4RZ3A 2P78A 5JAUA 2VIIA 1PQWA 2GXSA 4II2A 1QLJA 1W88A 4UE3S 5B37A 3RFCA 1KY3A 3JAMA 3OFSA 4RVNA 4A0RA 4RSRA 4WOCA 3U49A 2NVOA 1SBIA 3K9FC 3KEMA 1BMTA 1R12A 4PFJA 3F98A 4Q7JB 4TMZA 5F7ZA 3ZHYA 4AG3A 4E3ZA 5LP1A 1N32B 1P8AA 4NNPA 4WEQA 3OPQA 1JHYA 2ADOA 4QRHA 4O4HA 4EHKA 1NJSA 4JC8A 2NV2B 2PCLA 2R8ZA 4IGKA 4GZMA 1WOMA 3V8RA 4EMUA 2VH5R 5K3DA 4P3NA 4HWTA 1XDUA 2RGWA 5A0TA 3CO5A 1MOPA 2ZIFA 2BSAA 1FDSA 2C4VA 2FQXA 3KHSA 3T0GA 4XH9B 4M53A 2P35A 1T2DA 2C2YA 2DC1A 2O2ZA 1R0CA 3KV1A 1RYFA 1BDMA 3O2NA 2PBLA 1QTQA 1LI5A 1YZUA 2XGGA 5HIMA 3INRA 4YUVA 4GKVA 3KOWA 1OH7A 4PAOA 1XMJA 1CNFA 2HREA 3JQ7B 2IYNA 3QLVC 1D04A 2OQRA 3DVSX 4HNRA 4R1SA 1HA3A 5C1PA 1YA4A 1QRSA 1L9XA 1BEZA 1RWKA 1U90A 2BMDA 5IASA 4OATA 2FPIA 5E9AA 3HMQA 3TQOA 2HA4A 1SQ0A 1SFRA 1ENYA 3OY2A 1J0XO 1Q91A 1IZ8A 4IJQA 4L4ZA 5U4QA 1F3LA 3MRSA 3VYWA 2B4RO 2DETA 1FBTA 2QK4A 1T6NA 3AM4A 1CNEA 3SJUA 3ZVKA 5HS6A 3AF0A 4XSVA 1IWPB 1E61A 5E7MA 5HF9A 1SCKA 2CLMB 1EFHA 4IX1A 3QX7A 3D4BA 2W2KA 4EL5A 1I9GA 3ON5A 5CRIA 2GHIA 2UZIR 5L8VA 1MA0A 3HP7A 3S1SA 5BNIA 4M1OA 1Z5UA 2I2AA 4RD4A 3DKPA 3VSDA 4X65B 3M6XA 2IL1A 5A5DA 2ZJFA 1QK3A 5FYDA 3O4GA 2PRSA 3BMCB 2RCNA 1W44A 3BXXA 3OZTA 4EI9A 2PUGA 2BMVA 3VDNB 4OQEA 2C2ZA 4ZIRA 3C7TA 3FB1A 3JQCA 4DNQA 2QRPA 4KQWA 5KVCA 2C42A 3PX7A 1J90A 3VHXA 4M8LA 3R20A 4QQ8A 4LSZA 2BUCA 3NPMA 1Y8QB 1M2FA 1JBQA 4NEHB 3EY4A 1L5KA 1XZFA 5F64A 1YB6A 2PUEA 2Z1NA 1NNLA 3CUEF 4UHKA 1BD3A 2EIHA 4HNAA 4F7DA 5JS7A 4M1KA 1IIBA 5ETJA 2W6OA 1X9GA 3DMGA 1PL7A 1X3SA 3KUKA 3T5AA 1X7ZA 2DCUA 3DLCA 3VR3A 3O3MB 1CETA 5IM4F 4KXWA 2E1RA 3PZBA 3ROMA 3WMFA 3CFYA 5CBKA 3CEMA 3RVSA 3ZV6A 1U8CB 4H1WA 1TEZA 4LRYA 1QGUB 1FXWA 5KOYA 1W25A 1UXGA 4KX5A 2QB5A 4UUNA 3TRHA 1KC1A 3IAHA 2DRIA 4NEGA 5BXYA 4LJKA 1S4MA 1EG7A 1SUAA 1UDRA 1ZJYA 3S1AB 3JQAD 4FILA 4PO1A 1CW2B 3B51X 3C5HA 4LKOA 4DNXA 3QXHA 5JQWA 3JV7A 3CLRD 2GK3A 1ULTA 4WLVA 1ETHA 4GBJA 2WY2D 1TL7C 5ARBA 5AVKA 1W36B 5D3KA 2WSBA 2GJ4A 1FLAA 4QLAA 5IDWA 2GHTA 5IJ0A 1SC4A 2NQ2C 2FSIA 4JHLA 5M34A 1MVOA 2P1RA 4O1MA 3L0ZA 4BOYA 4Z9XA 1AS2A 4RU1A 4JOSA 4AQDA 3DPUA 2KWIA 3KJGA 2PJDA 4MYSA 4M36A 1BOOA 1PZFA 3WA6A 1SVIA 3AXTA 4I8XA 5KB3A 3UZUA 4LNUB 1YBMA 1CJSA 1S3SA 2BFOA 2VJPA 1J7KA 3IP5A 5EVJA 3TLEA 1DCFA 3FOZA 1FDIA 1ZZEA 2O57A 2WTUA 3DE7X 4F6RB 3H4VA 4UEWA 3MUNA 1H6BA 4FNMA 1EFDN 3R7NA 1W87A 3A8TA 4EKGA 4Q3KA 1PTJC 3OZIA 1T29A 2GEJA 2GD0A 1A5TA 1Q1QA 1J0EA 3F97A 3LCVB 1TUBB 4MP6A 4RQUA 3TNLA 2JIQA 5AUNB 3CTMA 5I51A 4QTZA 1GCIA 1LBQA 4EFDA 3Q88A 4H7PA 4P36A 3TSWA 2LWIA 5GONB 3VPAA 3RAPR 3GJYA 1QANA 3PNPA 1VHWA 4XD7A 3IBYA 2X0RA 3BYZA 1W85A 1NZDA 3WYBA 4BLPA 1MJGM 1QZXA 4E5UA 3VO2A 2HFJA 1I3KA 4LAFA 3FUCA 5K1ZA 1GR0A 2XCRB 3QX9A 4AYXA 4CQMB 1FFHA 3OUZA 3W8EA 5DN6A 3BUSA 4EUEA 5C1DA 1ND6A 1BA2A 2FZ4A 4PQYA 1RZRD 3KQVA 2WUEA 3EH2A 3IT1A 4IJ6A 5LC1A 4YUXA 3CMCO 4Q3LA 2O0MA 4UM5A 5FF9A 2EDAA 5CLJA 2J6IA 3TBFA 3UMGA 3GLIA 2REXB 3ZE2B 2NTJA 2RARA 3UJCA 1J39A 3K3PA 1Q12A 5CNIA 2VJMA 4NYMQ 5E1BA 3FRHA 5AWFC 1Z7BA 1ZL2A 5A4DA 1GYRA 3B20A 1ZESA 4LY0A 5DBEX 3K0FA 4IO1A 1GKKA 1OYVA 4NZMA 1BFKA 2HSWA 2YIDA 1E98A 3PX2A 4Y8VA 4ZC8A 1DB3A 1SBCA 2Y9PB 2A0YA 1P0CA 2JAWA 2VJMB 1KVQA 1RABA 4Y2UA 3DAOA 4G5YA 2DKNA 1PUIA 3SYRA 3DOHA 3PGVA 4V3CA 2F2TA 5LMCA 1ZYUA 1ZM9A 3ZZ1A 2QMUA 4L57A 4O4HB 3OCCA 2O8FA 3AP2A 1T3LA 4P38A 2CV2A 1Z28A 2IZ6A 1AKEA 2QRUA 4BS9A 2QN7A