1TRHA

Two conformational states of candida rugosa lipase
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
b'APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title Two conformational states of Candida rugosa lipase.
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase(carboxylic esterase)
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trhA00
3WK6A 1MTZA 3MGAA 3RK4A 3A2LA 1SFRA 4Q3LA 1CUFA 4E46A 2WHPA 1A7UA 4GLBA 1OXMA 4YASA 1L7RA 4Y2QA 2O2IA 4X97A 2YXPX 1R1DA 4ZREA 4H7DA 2I3ZA 4N8DA 1ZD3A 2H7YA 4ZV9A 3DJYA 4Q34A 2XMQA 5ALHA 3I2FA 1BS9A 2RHTA 2G4LA 4IHAA 2WUEA 3I28A 4BATA 2OGSA 4TVKA 3I6ZA 1EK2A 1RYYA 3BDIA 1C4XA 4FNGA 2ZJ7A 1ZOIA 4H35A 5FOQA 2QUAA 4I4CA 4KE8A 3W9UA 2AJDA 1VZ2A 3AILA 4BRSA 4QWWA 3L1IA 3IULA 3WA6A 3DLTA 1HBJA 2XQIA 3C6ZA 4EY5A 2PSDA 1MU0A 3V1MA 3E0XA 2XQKA 1WPRA 4BZWA 1Z68A 3I2IA 5ALWA 3G9TA 2LIPA 4I19A 2Z5GA 4HRXA 1TQHA 4WY5A 4G4IA 4BZZA 1XZJA 5KBYA 4MEAA 4N8SA 3SX4A 5CH8A 1BN6A 1QIDA 2X76A 5JANA 3OM8A 5CMLA 5JZ9A 4KJXA 2BGNA 4C01A 3O0DA 3VISA 1R3DA 1ZGCA 4H0CA 2YH2A 1VXOA 2Y1KA 1G42A 4QLAA 2HHAA 2NW6A 5DTIA 2HU8A 2V9ZA 4CCWA 2WU3A 3C5WP 3DQZA 1ZICA 3AIMA 2W22A 1YSCA 1W52X 2QRUA 3FCXA 2BGRA 1N1MA 2HRRA 3EF3A 4M0EA 4BB0A 3WKEA 1EDEA 1CV2A 2XMDA 3GROA 3QM1A 4B82A 1KU6A 3WLAA 3F8SA 5ALMA 5KWIA 1VJ5A 5JD6A 1EX9A 2G5PA 1MT3A 5FKJA 2WFLA 2PKYX 3F67A 3L1JA 5BOVA 1YR2A 2AJCA 2QVBA 4BVKA 3DL4A 4RGYA 3WWOA 1PFQA 4QZVA 1UXOA 1CUJA 3W06A 2AJBA 2VT6A 2WG0A 5CT5A 1A88A 2OGTA 4QEKA 5ISMA 4Y9SA 5CBKA 5DYTA 1SCQA 2HA3A 1MJ5A 2WLSA 3HI4A 2WIDA 3H17A 1U2EA 4GW3A 4PO3X 4K6GA 2I03A 2DHDA 3MUNA 2XQGA 4NMWA 1T2NA 4IQ4A 4GWLA 1UK6A 3ZLUA 5C8ZA 1QIFA 2C7BA 4PV7A 4FOLA 3C6XA 3LIPA 4CCYB 5A7HA 4OB8A 2JGKA 5HK8A 1SCKA 5ALIA 4KE9A 2WUFA 5IVDA 1MO2A 1WM1A 5ALOA 2XDWA 3ESDA 3W05A 1Q0RA 4LKOA 1LPSA 2WFMA 1ODCA 1CUCA 4MJ3A 2HA6A 3G0DA 1B6GA 1EVQA 2WSLA 2XUJA 4BTLA 4JYPA 2G5TA 2VATA 3K9BA 5ALZA 5LYYA 3WKCA 1KU0A 1DQZA 1JMYA 4C88A 3AZPA 4CCYA 1H2ZA 4IH4A 1IZ8A 3DEAA 3RM3A 4U2DA 3SC2A 3FSGD 3LLCA 3O4GA 4FBLA 1CUSA 1BROA 4BC0A 1LZKA 3PFCA 5DLPA 3H04A 3FYUA 1CQWA 1D07A 4OD0A 4EY4A 1THTA 2GBIA 2OAGA 3IVMA 3PICA 1E3QA 4OUKX 5LZ2A 4QE3A 2XUIA 1ODTC 3UUFA 3AZQA 1P0QA 5CW2A 4KRXA 4QLOA 1VZ3A 1CUBA 3IB3A 1UKAA 4OU5A 2QJWA 4C4YA 3BIXA 2BKLA 2QTBA 3OURA 1F8UA 2CBGA 1S8OA 1UK7A 3BJMA 3G0GA 4OB7A 1TK3A 1FFDA 3H1BA 3ESCA 5EIHA 3YASA 5HQ3B 3O9VA 2QOEA 2JGMA 5CT8A 2GBCA 3E1GA 1CUHA 4DSAA 2YYSA 4CIAA 2O2HA 1GGVA 4FNMA 4DYHA 4PW0A 7YASA 1XRNA 2D5LA 4X92A 5AK6A 4LXGA 3FLEA 5CT6A 1MX5A 3WL7A 1ZI6A 4Y2TA 4FLEA 5A62A 4FKBA 3H2KA 1PJAA 2H7XA 1GKKA 3D59A 2QM0A 4MQLA 3I2HA 5JZSA 1BE0A 3QPDA 1ZJ5A 4ARBA 1TRHA 2DQYA 2JGLA 1RP1A 1FJ2A 2H1IA 1XLWA 2HRQA 4DMKA 5SYMA 2PSEA 3NUZA 4X91A 5JAPA 4M0FA 3V48A 1ZJ4A 4A5SA 4BE4A 3DNMA 2OPHA 1MAHA 3I6YA 4V2IA 4WY8A 3B5EA 5JD4A 2DSNA 2XUDA 2ZYRA 1LPNA 1DWOA 4UFNA 4Y2YA 4UUQA 5D3KA 1I6WA 2C4HA 2CB9A 3FYTA 4LHEA 1GZ7A 4JEIA 2GBFA 3IBTA 3ESBA 4L9AA 3T4UA 5AI4A 3STVA 1AC5A 1IUOA 3DYVA 3WYDA 3A2NA 3D0KA 4EA6A 1X2BA 3BF8A 3FLBA 3GBSA 1TCAA 3R3YA 5HF5A 4BCBA 5HFAA 1J07A 3C5VA 5AICA 3CN7A 3D2BA 4B0PA 4X71A 1R4ZA 4X93A 2QZPA 1DWPA 3QMWA 4G9GA 3QPAA 1Q84A 2OXEA 2H9YA 4X95A 5ALKA 2D0DA 3BDVA 3ILSA 3KDAA 5T4FA 4DMFA 1N5RA 3PF9A 2WTNA 1H2YA 2DQZA 1VXRA 2XMBA 3VKFA 5HF6A 3OC0A 2WUDA 3R3XA 4AZ3A 2WUGA 2ECFA 3VJKA 4X94A 2PSHA 3HYSA 4K6KA 2ACKA 4B0OA 4CFSA 1CUAA 3U1TA 5EHXA 4UBNA 5CXUA 2V98A 3P2MA 4BTVA 2PX6A 4G1FA 5AKLA 5CH5A 2UZ0A 4L3WA 5AOAA 1XKLA 2WQZA 2BJHA 3D5EA 1A8QA 1XZAA 2HDWA 1XZEA 2JGFA 1CUYA 3HJUA 3KD2A 2QR5A 4ARAA 2QKYA 4QWMA 2HA7A 3QVMA 3RARA 4XVCA 5BWBA 4Y2PA 3MVEA 3Q8WA 1EXWA 2IIVA 1X70A 5LZ5A 3WKAA 4H7JA 5EIEA 1EB8A 4XWGA 4AO8A 4GECA 3WWPA 1UK9A 1MNAA 1YA4A 1UOPA 2C58A 4U2FA 1CUXA 1QFSA 2XUKA 4BAGA 3WK8A 1XZIA 1CIJA 4Y2XA 1CUGA 3I1YA 3B3QA 1NX9A 1XKTA 2OCIA 5AKYA 4WJLA 3AFIA 1EA5A 1MX1A 4PSDA 1QGED 1QIEA 1WB6A 3HABA 3S2ZA 4FLFA 3G7NA 2RIPA 4G8BA 5AKIA 1GQRA 1K63A 3AZOA 5ALQA 1LBSA 3IURA 3FYUC 1UKBA 3H2HA 1ZD2P 2XLCA 4NZZA 1QONA 3BL8A 1HQDA 4Y2JA 5AKHA 1MNQA 4C87A 2ZJFA 3O4HA 3RKSA 5AKJA 5HF9A 1XRQA 5AKKA 3WK7A 5ALLA 1AUOA 4HTAA 3V1NA 4WFKA 2E3JA 3IUMA 3PFBA 4YPVA 3I1IA 1JU3A 4X00A 1FSSA 1DINA 5JASA 5JAOA 2G63A 1FFBA 2WHRA 3DYIA 3IIIA 5AK4A 2GYUA 4KYVA 5D7BA 5T4HA 4RE5A 5JIBA 3HEAA 1XZMA 2PPLA 2VAXA 3R3WA 5AIAA 2BUBA 2J4FA 4J0DA 2DCMA 4AX4A 4MWTA 4EY7A 3C87A 3FAKA 5T4BA 3RLIA 3EQ8A 2WJ3A 4FBMA 3WWEA 2I3DA 1XQXA 2XB6A 2HA0A 5AKXA 4JH0A 3ZLTA 2WG1A 1UFOA 3EQ7A 4H7KA 5C81A 1LPPA 4UHEA 4W9RA 4W1SA 2WG2A 2XT0A 1NU6A 4G4GA 3C43A 4A16A 2EDCA 5D6OA 5ALEA 2BUAA 5IVKA 1EVEA 2R8BA 3ANTA 1CRLA 3D2AA 1UOOA 5JARA 4KEAA 4W63A 2QJRA 5CRIA 3BWXA 4BC1A 4B80A 4ZGBA 4HVTA 3NGMA 1XQWA 2WFLB 4WFJA 3R41A 1P0IA 1ISPA 5EGNA 4CIBA 2WFZA 3BF7A 2XUPA 1JI3A 4B84A 2PBLA 4Y2VA 3SK0A 3WL5A 2OAEA 5EI5A 4EY6A 3OG9A 3I2KA 2WHQA 4PSCA 3STTA 1GKLA 2VEOA 3FWHA 1BU8A 5ALUA 5A71A 5EHQA 2QXTA 2Y6VA 4IH1A 1ZGBA 3H1AA 4X3CA 1OCEA 1WCYA 4Y7DA 2FJPA 3R40A 3BJRA 3L1HA 1AGYA 2DR0A 2XQFA 4QDXA 2JBWA 5ALGA 4DLNA 2DFPA 3QBJA 2XMSA 1HL7A 1YCDA 4DSZA 4FTWA 1SCIA 4DNFA 4G9EA 1JMKC 2PSFA 2RHWA 4KAAA 3FVRA 3G9XA 1BEEA 5AM1A 2QMQA 4JNCA 3WL8A 3WMRA 4OPMA 2B20A 3HC7A 1XZDA 1G4HA 3STWA 4WDQA 1Y7IA 4HXFB 1XRLA 2V97A 3LCRA 4GEGA 1E5TA 2WM2A 3F9CA 4AXBA 5AI6A 1MPXA 2OQIA 2GBGA 5HKBA 1AMNA 4Q82A 4UHCA 2VSQA 4AN0A 1W1IA 5JAHA 4XIIA 1LPMA 2JEYA 4ZI5A 1KEZA 5K3CA 2P8SA 2X5XA 3MUOA 4LXIA 1K5PA 3CXUA 3QYJA 4DMHA 4H7EA 4X85A 4BP8A 2OCLA 5AP9A 3F97A 3FYUB 3IUQA 3ZV7A 3GFFA 3PUIA 2WILA 4UBOA 2WIGA 4X6XA 3Q0TA 5JYCA 1U8EA 1WOMA 4C4XA 2C0QA 3FLAA 1DT3A 3WL6A 3WKDA 4MEBA 1H23A 2PUJA 4G8CA 1AURA 3DOIA 3N2ZB 3WK9A 4UHBA 3HZOA 4UBLA 3STXA 1YAJA 5LZ7A 4J0CA 1CQZA 1H2WA 4U2EA 1USWA 4ITVA 1YS2X 3FVTA 4EUSA 4ZRDA 1W75A 3FBWA 5CT4A 3WZMA 5AM5A 5JD5A 4H7IA 1DWQA 1XRPA 2ONCA 4PQEA 3C6BA 2IX9A 3CCCA 1EB9A 4QA9A 4CG2A 3PI6A 1GPKA 1GT6A 3ANSA 1ORWA 3T52A 3QH4A 3A6ZA 1A8SA 5FP0A 1XRRA 2ZYIA 4UBIA 3W04A 1WPXA 3O4IA 1W4LA 4HS9A 2VTVA 2RONA 2O7RA 1LPAB 4P93A 1BCRA 5LZ9A 5DTJA 1JT2A 2Y6UA 4AMZA 5I8PA 2Z8XA 2HU7A 3X3HA 1ZIXA 4KAJA 3M83A 3WA7A 1UOQA 1F6WA 5ALFA 4U2CA 4YK7A 3QMMA 4BE9A 2OG1A 5CURA 4GHWA 1EK1A 2WJ6A 3D7RA 1XLVA 2H7CA 1L7AA 3H2IA 3UUEA 1BEZA 1HDEA 1AQLA 2FX5A 2AJ8A 4HXGA 3D2CA 3EQ9A 5ALRA 2XUQA 5ALXA 2RGUA 3OTQA 2EEPA 1G5FA 5DWDA 3VDXA 5D3ZA 2XUAA 3EIOA 5LP1A 4KE7A 1LPOA 3ESAA 4FFWA 5AKZA 2JEZA 3KWFA 4G8DA 3S8YA 4DNOA 5DNUA 5FPQA 4MYDA 5K5EA 3KOOA 3UMJA 2DHCA 5LZ4A 1UT6A 2CEKA 4N8EA 1IVYA 3H18A 3D4LA 2XUFA 1Y7HA 2I78A 5IKXA 4B7ZA 1BCSA 1VA4A 5J3JA 2CMFA 2BFNA 2ACEA 4QDOA 5AOBA 3K6KA 2HA4A 3C8DA 2PU5A 4FDMA 5CH3A 5ALNA 4BAUA 5FUMA 4BCDA 3U0VA 3WJ2A 5CTAA 4HXEB 1R9MA 1HLGA 4UBJA 1LZLA 3G9ZA 1A8UA 4H7HA 1EINA 1Q0ZA 1TCBA 3IUNA 2PSJA 1R88A 2FUKA 3IUJA 5EHZA 2CJPA 5K3EA 3DL7A 1E66A 4UFOA 1LBTA 2HL6A 3NOXA 4XJVA 1EDBA 3M82A 1GXSA 3F98A 1QTRA 5E4YA 2JGEA 2JIDA 1XZGA 3AINA 3WWDA 5ALSA 1GPLA 4Q3KA 1H22A 5DYWA 5AI5A 4FFVA 1CUUA 4AN1A 3FSGA 3G0IA 4Q3OA 1JFRA 3E4DA 4B6GA 3BE8A 1TKRA 1J1IA 1F0PA 1VLQA 2B9VA 1O6GA 1XZFA 2Q0XA 2R11A 2VJBA 3C70A 4BRZA 3E3AA 2J4CA 1HPLA 2XE4A 1EH5A 3H19A 2YASA 4J0GA 4Z49A 4WDRA 2X8BA 1EI9A 1PV1A 3OOSA 1RWQA 3DS8A 2VA9A 2CKMA 3G0CA 3TEJA 3VXKA 3CCBA 3HRHA 4P9NA 3WZLA 4C4ZA 4GXNA 1WHSA 4AQDA 1CUZA 3GUUA 4OYYA 5HKAA 3GA7A 3VJMA 5ALTA 3H2JA 1JJBA 3I6MA 3O95A 4L0CA 4K5QA 4AMYA 5FLKA 3WYNA 3PE6A 1UKCA 3W9BA 1DT5A 1TCCA 2PU7A 1VE7A 3AIKA 5AK3A 1BN7A 4DGQA 1CFJA 4AB1A 3WK5A 4FLMA 2VAVA 5AOCA 1XRMA 2DHEA 5A7FA 3N0TA 1K8QA 5I7UA 4EY8A 2GYVA 1QIKA 3FNBA 2OQVA 1ACJA 2HM7A 3O9MA 2ORYA 5C8XA 1QLWA 1DX6A 3FOBA 5HK9A 4KE6A 3ZWQA 1P0MA 1GQSA 2XMRA 4H7FA 2HA2A 4P92A 4PF1A 3VVMA 5FXMA 4A23A 1YB6A 4G4JA 3R0VA 5AH0A 1LNSA 1QO9A 5IVIA 3ZLVA 4W1QA 4H18A 3TRDA 3A70A 2WJ4A 4X6YA 1Q83A 3QZUA 5AI8A 1IMJA 1VA5A 2OCGA 1YAHA 1J2EA 2XQJA 4Y2UA 3AJAA 2WU4A 2J3DA 1JU4A 3DOHA 4B81A 4OSEA 4GI1A 1J06A 1DX4A 2AJLI 4BVLA 4Q05A 1MAAA 1SC9A 2C5GA 2HFKA 4NS4A 4DM7A 1CUIA 4MWSA 5H3HA 4DNQA 1QIIA 2QXUA 3LIIA 1XQYA 2Z3ZA 1DU4A 4UHHA 4W1PA 3VVLA 1SOMA 1XZKA 3G8YA 4EB0A 2B61A 4KRYA 5K3BA 4F0JA 1L7QA 3R3VA 3QPCA 1N5MA 2K2QB 1IUPA 5YASA 5A2GA 3LS2A 3HSSA 2WIFA 3H0CA 3D3NA 4Y2SA 1ACLA 3OPMA 4ETWA 3W2TA 5EHNA 1FFAA 4OCZA 1F0NA 1CVLA 4IO0A 4BDTA 4UHFA 5IVHA 2VJDA 1WB4A 3A2MA 2RI6A 4AO6A 1CUDA 3NWOA 3G02A 2QS9A 1AZWA 1JJFA 4XX1A 1YASA 4EBBA 5I9IA 5DNWA 3GZJA 2WKWA 4GBGA 1WB5A 1XQVA 3PUHA 4E11A 3STYA 1VKHA 5FV4A 4U2GA 1CEXA 4N5HX 4J0IA 3V1LA 2WIJA 5JADA 1ODSA 3KSRA 1ORVA 4LYEA 3WI7A 2OLEA 4N5IX 2VF2A 1QFMA 4BDSA 5E4TA 3M3DA 2XLBA 6YASA 4CG1A 1T4MA 1UK8A 3AIOA 1UZAA 1C7JA 1U65A 4FWBA 1ETHA 2VJAA 2WIKA 2V96A 4UPDA 4BCCA 5DYYA 3PF8A 5E4JA 4J0JA 1QO7A 2VT7A 5AHXA 4J0HA 2BUCA 4X6UA 4CI9A 4TGLA 1ZI8A 3C45A 2JGJA 2XMGA 3BXPA 4PSUA 3TJMA 4GDMA 3WJ1A 4MXDA 2C5FA 4KAFA 1BRTA 3FCYA 1WHTA 4J0KA 1FFCA 1K6EA 3JW8A 5ALJA 4RE6A 1NU8A 4L72A 1HKHA 4M0MA 1CUWA 2Y2VA 1XZHA 5K3FB 4MQMA 4QDZA 4RPCA 1XROA 2W6CX 1IUNA 1XZBA 4O08A 1O6FA 3JYHA 3WKBA 4EZIA 5BV7A 3I2JA 1QIHA 2CZQA 4DMCA 1U4NA 3DCNA 4AO7A 1X2EA 1DQYA 4Q1VA 3JWEA 3VJLA 5LIPA 3DDUA 5JAUA 3V1KA 5IH7A 4HRYA 3STUA 2OGZA 4UFPA 2QUBA 3DKKA 1B41A 5ALVA 5ALPA 5K3FA 3IA2A 4OB6A 3HXKA 5AKEA 1G66A 4C89A 5KREA 1C7IA 5CT9A 5KWJA 4RNCA 2XUOA 4F21A 2XUHA 2Z8ZA 2XI4A 4LXHA 2ZYSA 1VOTA 5AM3A 2GZRA 4QDUA 5JALA 2WTMA 4F60A 4EHBA 1W76A 3HACA 1IZ7A 1ZD5A 4MYSA 4X7BA 5ALDA 2ZVDA 5BWCA 4J3JA 1EDDA 3PDCA 4P08A 4I3FA 4ZWNA 1VE6A 1H2XA 5C8VA 5CXXA 3WIOA 1ZD4A 2XMZA 4B9EA 2J3QA 4FMPA 4ROTA 2EDAA 2XUGA 1LLFA 1TIBA 2C0PA 2Y2UA 2HU5A 4E15A 2PL5A 1XLUA 1Y37A 3TGLA 4JYMA 4LYDA 1ZI9A 3BIWA 3ED1A 5AIBA 1XFDA 4BBZA 4NVRA 1XZCA 1CUVA 4H77A 4IH9A 3DD5A 1CR6A 4UHDA 4AZ0A 4J03A 5EIAA 4ZXFA 4INZA 1MN6A 1TAHA 3CN9A 3LP5A 3WQHA 3AUKA 4OU4A 4BP9A 5HQ3A 1M33A 5JATA 3KXPA 4WCVA 1R50A 5AM4A 1EHYA 2ROQA 4UBMA 5AO9A 3G0BA 1CPYA 4K6HA 3QMVA 5A7GA 3ZPXA 3QITA 4C6HA 5K3DA 5LKAA 2XMCA 1XZLA 5HZGA 5E2IA 4E14A 2JF0A 2OCKA 4W1RA 2VJCA 4FHZA 3M81A 5LLSA 4KR0A 1MX9A 3SWWA 2IITA 5DNVA 4QDTA 5DJ5A 1QZ3A 5EFZA 5AKGA 4DIUA 2RAUA 3R3ZA 4BYMA 1P0PA 5ALYA 1FFEA 1AKNA 1CUEA 3R3UA 4S0XA 1E89A 4PNZA 4G5XA 1LGYA 1W6RA 4F5ZA 1N8SA 3ICWA 3WWCA 4U2BA 4OYLA 4K2AA 1QJ4A 2PVSA 1LPBB 2PUHA 5AM0A 1E8DA 1YA8A 2Z3WA 4J7AA 4QNNA 2HIHA 2HADA 1ZIYA 4BAZA 4KACA 2VQ6A 2BCEA 2ZSHA 3O4JA 4WFIA 4B83A 2GZSA 2HA5A 4D9JA 4LIPD 2HFJA 2B4KA 5F4ZA 3C8HA 1JKMA 1QOZA 1THGA 2BAGA 1E8NA 5SYNA 4ZV7A 5HFNA 2AXEA 1YS1X 2O7VA 1E8MA 3I2GA 2ZYHA 4X90A 5HF8A 3G9UA 3ZI7A 3F96A 1QIGA 3K2IA 5LKRA 3B12A 4Y2RA 2ZJ6A 4JUIA 4YX9A 4HAIA 3HLKA 3EBLA 1OILA 5A6VA 1UWCA 1GPNA 2O2GA 1JJIA 5K3AA 5HCUA 2CUTA 1QTIA 2PM8A 5FDFA 5FRDA 5AI9A 5AK5A 5AI0A 4CG3A 4DNPA 3WIBA 1QIMA 4TPKA 1DTEA 1QE3A 3DKRA 4DTCA 5LZ8A 4HZGA 2GYWA 2FJ0A 3C6YA 5FPPA 2WHPB 5T4EA 3H2GA 5AM2A 3V9AA 3ICVA 4UBKA 2QT9A 4B9AA 5AJHA 2JGIA 4B85A 1CLEA 5JZBA 2ZSIA 2ES4A 1QIJA 1K4YA 1R9NA 3KWJA 1AX9A 3IDAA 5ESRA 1YB7A 5C7YA 4BVJA 3GELA 3WK4A
chains in the Genus database with same CATH superfamily
3NEPX 3HBAA 3T3MB 2PD3A 1VMKA 4AW9A 4WD3A 4DDUA 4UE6A 2XT9A 1S9HA 2IYYA 2WB4A 5F7ZA 5DXAA 3IP6A 4BB9A 5EWJB 1G2QA 2JLXA 1NWCA 2P9BA 4LE2A 5AJVB 4GOLD 2CKDA 2GTHA 4TS1A 1Y8ZA 4IJ5A 1J6UA 3C3MA 1SBQA 5EQJB 4LHYA 1CIPA 2BFEA 5C31A 4QAJA 5JQGA 2O2IA 1USKA 5HMLA 1A50B 1RLTA 2C5BA 2EZUA 3U4DA 2ZIEA 3HDJA 2K5UA 1V96A 1K06A 3LHFA 5FF9A 3RS2A 2JLQA 2I3ZA 4C7XA 3FCEA 4F04A 2XBMA 1X15A 2BEKA 2ZAMA 2HSGA 4B87A 4N8DA 1ZD3A 2V03A 5F1PA 3KUCA 3IJPA 4CDGA 4JI5B 2ZWOA 1JL3A 3M1LA 1GCGA 4CEIA 1CXZA 4Y9DA 4DLZA 3D6NB 3N2LA 4IHAA 4BNJA 5AW4A 2PE5A 1ICIA 1E5VA 3I28A 1X9HA 2ZLBA 3BFKA 4JSTA 1WMAA 2P5SA 3WB1A 3ZXIA 3BJZA 3U3ZA 3URMA 4DWOA 5KNBA 5EWJA 2B8EA 5LFAA 3I6ZA 2QQEA 4LJRA 5D5QA 3E81A 4QJIA 5FJIA 4F4DA 2CLFB 3FCAA 3OLVA 2CDBA 1GVHA 4WWHA 2AFIB 4FNGA 1C4XA 4Y6SA 3ND6A 1T8UA 4DCCA 1QF9A 2OT3B 2ZJ7A 3KOXA 3D0RA 3BJEA 3UPDA 2I7VA 2HBRA 3H9QA 2HK8A 2QUAA 3VSAA 2GPBA 4PICA 1VZ2A 4JFRA 5F77A 3AILA 1RBZA 1V8PA 2HCJB 4WLNA 2VRWA 2WSIA 3W6NA 3ZY4A 5JCZA 5TPZD 2WJPA 2XWSA 2JIZD 2IZZA 1X92A 2PGLA 1XALA 4OP1A 4RIHA 1T8SA 3BD6A 4EY5A 4LF5B 2V4MA 3V1MA 3E0XA 2FGJA 3SEZA 2XCSB 2Z0MA 3DE2X 1UBSB 3FETA 3TOZA 4BZWA 3HA7A 2RGRA 1V39A 1Z68A 2FQYA 1XLTA 3I8OA 5KWVA 3I2IA 3G9TA 4XWWA 1VIAA 1QVZA 2AZDA 2N3ZA 2JRCA 2X8AA 2Z5GA 3IX7A 2YC2C 4JOCA 3DP9A 1UPXA 1XU9A 3UUGA 1GQYA 5DGXA 4DIEA 2LIVA 3M1AA 3V8BA 3W6ZA 5GINE 2VYNA 4MGEA 1SB8A 3G5LA 2HX1A 2PBRA 2KJQA 3TTTA 4XDZA 3NOOA 4DT1B 3ZV6A 2AFIA 2MSWA 3WIVA 1FUUA 2NU6B 2VH2A 3VH4A 2EGUA 3R5XA 1EAYA 4P2GA 3OM8A 1IN5A 4UQPA 4CE6A 3NJRA 4IS2A 1GYPA 2ZDGA 2BF7A 3AFOA 2B1JA 3F46A 3OP1A 2IZOA 4O5AA 5CFMA 3HSKA 5KJ6A 1VHLA 1KC3A 4KJXA 4CMAA 1NKSA 4WL0A 1DZ3A 1XL0A 3LA8A 2JDIA 4YWJA 3O0DA 1K7FB 2H63A 1Y6GA 1XWIA 1ZGCA 3LQRA 4NSNA 3ZJ5A 2A8YA 3GEBA 2IXFA 4F3YA 2YTZA 3LUGA 1E4VA 3RHTA 2VI5A 4HY3A 4DWJA 5AD1A 5ICMA 1ND6A 2QYOA 2Y1KA 5LUBA 4NEGA 2WT8A 1CFZA 4QLAA 3QEJA 3LV8A 3W5HA 5DM60 1CB7A 1UPFA 3WYBA 4AIRA 3AR8A 5DTIA 1XELA 5DFAA 1VECA 4U7PB 5A5FA 1MABB 1Y7LA 4AY3A 1TFUA 3A9UA 3TYXA 4LJKA 2WPDA 5LQRA 3C1AA 5B6PA 3TMYA 1KJZA 2N1BA 4OQNA 2V9ZA 4CCWA 4DT1A 4EYOA 3OTIA 1R8XA 3V7FA 4Z7JA 4XM0A 2NU6A 3C5WP 4IGFA 3C24A 4R16A 3DQZA 3TCXB 1KR2A 1ZMTA 4H6PA 4ZFNA 3WYFA 4B34A 3FHJA 2FW1A 3QA3E 4X60A 2HSEA 4XVHA 3VJRA 3A37A 1ZICA 3CJQA 3KV3O 3MLBA 2B6HA 1Q3HA 1FFHA 2OHGA 4I7EA 4NX2A 5B58C 4X65B 2CUZA 3T9DA 1YSCA 1DUVG 2RAVA 1HDYA 2VP0A 3CISA 3KZOA 2QRUA 1BGVA 1J2RA 4F2WA 1UDAA 4D8UA 2JAUA 1AHNA 1GPYA 2BC9A 4QOFA 1N1MA 5A5VA 4UEOA 521PA 5HZHA 2A0YA 4KDEA 3IPLA 1JW9B 4LQ4A 2PT6A 2JAHA 2BD0A 2XMDA 2VKQA 1TEZA 4XOUA 1XQ1A 1ZEMA 1E1YA 3QPUA 1UXIA 4BO8A 3QM1A 1GLGA 4FYKA 5EERA 4AECA 4I50F 1KU6A 1MABA 4B82A 1NN5A 2PUEA 2BBTA 2PEYA 1O77A 2J0QA 4WZAB 2CB0A 4I99A 4MUBA 1ZZEA 5KVCA 5ABPA 2UUPA 3ICPA 1Z06A 3GRCA 4P3PA 3K0BA 3E8MA 1B74A 3BA1A 1U9JA 3B1WA 5K03A 5KWIA 2I1QA 4DC0A 4V1CI 3MUFA 1R0ZA 5CEJA 1EX9A 2G5PA 3HKEA 2J7KA 3NT4A 4FGJA 4GZLA 2NZ2A 2CVFA 1OOEA 4FMDB 2VWPA 3E9MA 1T3HA 5FKJA 1RXVA 5M34A 1ZGZA 5HG0A 3RNOA 4ZTZB 1Y3AA 1OASA 2OYCA 1CZKA 2TECE 1TTTA 1H2FA 2IV7A 2RKWA 1GV0A 1SO8A 2XJ9A 3I37X 2JCGA 4LDNA 6NULA 4HN4B 2RGEA 3DKIA 2ZJ8A 2QVBA 2XNKA 3LO5A 3S5UA 3V97A 4BVKA 1YR3A 4YCDA 7REQB 1Y1QA 2BJWA 4UMVA 2I54A 4JLJA 4KUHA 5KDLA 1VHWA 3G5UA 4TOIA 4NOKA 4FJ1A 2ADFA 4D8TA 5AW3A 1VCHA 2PKEA 3B1VA 4R1TA 4PXYA 1KFJB 2AJBA 2EKLA 2G71A 2WG0A 3TK1A 5CT5A 4DQUA 3KKLA 3EW9A 3UB3A 5CG2A 3RSGA 1TM7E 2HTEA 4Q3BA 1MAWA 1Q77A 4LN1A 1R6BX 2OGTA 4QEKA 1YONA 2D4HA 5EP3A 4MUAA 5LA6F 4BGVA 4EYGA 3IJ5A 4Y9SA 3T1OA 3E7PA 1U6KA 3P9QA 4DG9A 1MJ5A 3JQDA 1SOWA 3L1KA 5H82A 5LMNB 1KOFA 4UC0A 4RLQA 2RHJA 2XMPA 1GPDG 1PR9A 3L92A 4O2AB 4F2DA 1B1CA 1LS6A 1JLMA 4YUWA 5BMVB 5BSGA 5C52B 5BOSA 4X20B 3HB4X 1FDOA 2VJYA 3H4VA 3MUNA 1FLDA 3GFVA 4PN3A 1I36A 3SU8A 3RWOA 2H8GA 3B89A 4EF6A 5F23A 2EU8A 4BU0A 4C07A 1M7GA 3HUUA 5DU2A 5KPJA 4Q19A 1UK6A 2OKGA 1TJ3A 1ODJA 1ZN8A 4FIZA 4YJ3B 5AFSA 1U9IA 2H0AA 5F3RA 5MDHA 1G3UA 1RTKA 5U9CA 4R41A 4BJ6A 1QSGA 1XTQA 5CP8A 4EA7A 3OT1A 1N0UA 1L4YA 2AZXA 2GXUA 5BNZA 1N6LA 4CQNA 3V1UA 3K4HA 1WSWA 2C1XA 4NBUA 4O4JB 1OTHA 3LRXA 5JECA 1QE0A 4PE5B 3BFPA 3I12A 1KERA 1SCKA 5H4GA 2CNLA 2G83A 4GEKA 3I3OA 3HUFA 2HN9A 1LDMA 2B35A 3D3EA 3H11B 1A2OA 2I8LA 3O2NA 3QIAA 3QVJA 4PHFA 3SZMA 1JU9A 1WIWA 1MO2A 3D81A 1P33A 1XMIA 4Z9XA 5JSUA 3ZWXA 2XDWA 1US8A 3AGPA 1QRUA 5F98A 4G26A 1LPSA 2QGZA 2QW8A 3KJZA 5JS8A 4D79A 2IELA 4MW6A 4OHUA 4X20A 3TD6A 3VGJA 1FJHA 1FU8A 3OLCX 4DQXA 1CRPA 1H2RS 4KG7A 3UJ7A 2HA6A 2J3KA 5IYZB 5G0WA 1QGUB 3CU5A 3UTDA 1VMEA 1DEXA 1D2NA 2XH8A 1GGKA 1XG5A 4N0QA 4ZODA 1JE0A 2XUJA 4BTLA 5AXAA 5IDQA 1JFTA 2G5TA 2VATA 3NVAA 5ALZA 3ZU3A 2R6ZA 5LYYA 3PQEA 4A4DA 1L4HA 4GL2A 1KU0A 2FPRA 4QGHA 3U7FB 1YC5A 2C97A 5LR6A 3A1DA 2VVTA 2G9ZA 1UBKS 2A5FA 2FFAA 2VUIB 3II6X 3GFBA 4RF5A 5JSHA 5A02A 1FX0A 3AERA 3E3LA 2PRYA 4F6RB 2QM8A 3GBVA 4IH4A 3RJ5A 3ZWAA 4EECA 4EJ0A 1IZ8A 1T2FA 1A9SA 2R96A 3BYZA 1ZOLA 3O6VA 1NAHA 1RW4A 1X3LA 1EBUA 3A58B 3H11A 2LCIA 3RM3A 2AW3A 3NC1C 1OAOA 3WX0A 1ZXLA 4GI5A 3L6OO 1GG2A 1RI3A 3NM4A 5A04A 1LNZA 3GJ5A 5DNDA 3LLCA 3TZQA 2GWRA 2OBYA 3AF3A 4FBLA 1Z2CA 5FWDA 4PYKA 2AG0A 1LZKA 2CVOA 5ICCA 1D6SA 1ZAKA 1PFWA 3GLGB 3GIWA 4PGFA 1M1NB 2F3SA 4OD0A 3ZCRA 1CR0A 1THTA 1QGUA 2IYZA 1KQ3A 1L4FA 4QECA 2C1EA 3PICA 4ZN6A 4KUGA 3LC2O 2QUJA 5F1OA 3BEDA 2ZBDA 3DE1X 3NFYA 3KR2A 3FRJA 4UNRA 3KUKA 3AF6A 2GTIA 1JR6A 2C4WA 4QELA 2A9VA 1ODTC 2OB2A 1ISIA 1XOIA 2AEJA 3EIUA 2Q5CA 2ZSDA 3MT8A 3GRVA 3FKSA 5HGJA 3ULKA 3GJ0A 4OXNA 3AZQA 3FTFA 1S3SA 2EGHA 4GMKA 1DKMA 4AP5A 4RW0A 5CW2A 3RIHA 5K0ZA 4QLOA 1F3OA 1NVUQ 2AN4A 4WZAE 1J25A 1CUBA 2XNDD 3L0DA 2CVHA 5F9FA 2B94A 3A3KA 1UKAA 5KQLA 2Q2OA 3OH8A 4RKWA 3OURA 4GC5A 4E70A 1F8UA 2I8CA 3CWZA 2LWIA 1SCBA 2E4ZA 2WWXA 4TX1A 3U4CA 4DSNA 4GM0A 4TRMA 5AW2A 5E3HA 1I13A 2OXFA 1J2YA 4FKZA 4HDMA 1M3SA 4OB7A 3R0JA 2B5VA 4ZA2A 1R7RA 2ZI7A 1N2OA 1ZL0A 2B8TA 2Q62A 5HQ3B 3ZDYB 1WD5A 2TMDA 3ANMA 3O9VA 4X1IB 3MELA 1O94D 3E82A 4Z51A 1V3UA 3IP8A 2B4TO 3AY6A 1M1NA 3GLGA 1U28A 5D3MB 4RCZA 2CXXA 2SHKA 3B5JA 3E1GA 1W49A 5B6IA 4GAEA 2P30A 4L8GA 5TV2A 3VNVA 1Q6ZA 2D8MA 3ZR4B 2BMEA 1Y6JA 2ZTVA 3QYAA 4UDOA 1TB4A 2ATXA 3DBOB 3H5TA 3WGZA 4TM7A 4J6EA 2H2AA 2JLUA 3U44A 1BGWA 1XRNA 2D5LA 4IUBS 4P34A 1KDOA 5E9WA 4LXGA 2Q4RA 5TE9A 1NRWA 5CT6A 4WOBA 5IAKA 3CGGA 1MX5A 1B2RA 2R4QA 2RSLA 3HCDA 4P2BA 3SBOA 3EMVA 4IAOA 1ZI6A 2QU7A 1TZCA 1MDBA 1N6OA 3CTPA 3ETJA 4FLEA 4L5YA 4MVXA 4PZ9A 5CLLA 3K73O 1WCIA 3CRMA 3QFRA 1QG2A 4FKBA 1FFWA 3SR4A 1VI5A 3W1WA 3RS9A 1PJAA 1QV9A 5E38A 2FZ5A 4L9RA 3R5TA 4X7RA 2ZB3A 2NACA 4YRJA 4EJ2A 4KLAA 1KF0A 4QUAA 1U3FA 3NCTA 3GRFA 4V0LA 2J67A 4B7UA 3P0JA 4QTTB 2MDTA 1A95A 4YQZA 3UMMA 2IK8A 2BGIA 3KKKA 3OPQA 3IEVA 1M34A 2J32A 4J7XA 4KWTA 4EHLA 1R5OA 2QP4A 2VZLA 4X1IA 1N2BA 2VBGA 1FJ2A 3D6JA 1ULBA 4OFZA 4RZ2A 4YMHA 1KEUA 3UICA 3VR4A 1XLWA 2W2OA 5K4GA 4UTXA 3OPYB 4WRRA 2PZBA 1OF1A 3KX2A 3N53A 1KZ6A 5TQVA 2HRQA 4DMKA 4Q4AA 2PSEA 3MMXA 4H1WA 1S7GA 1UADA 3MMPA 4J91A 3KHSA 2Y27A 1CQIA 1ZY2A 4YRBA 4X3OA 4ENVA 4YXFA 1C29B 3LT5A 4BQNA 1DG1G 1X9GA 3NCHA 4CIDA 4MS4B 3LBIA 4ZJPA 1B4DA 4P4GA 4PZPA 1O8BA 4US1R 4A5SA 1IBLB 4NCBA 4LJ9A 4KQMA 3CO5A 3WYEA 4NBRA 4XXHA 2OPHA 3LQ2A 3AHDA 3SF8A 4EF4A 2FUNB 3I6YA 2JD1A 4TT3D 3MAAC 2X0EA 1E2LA 2DSNA 3R0IA 1KBOA 3WYGA 4AI6A 1LPNA 4I3HA 3M9LA 1PGNA 3OCWA 4UUQA 3WHIA 4AP6A 3LL7A 1HDXA 3O4RA 5FAXA 2QM3A 3CLVA 1B14A 1CZUA 2IYWA 2NO0A 1JEAA 3CH6A 3FYTA 2R8YA 3JWGA 4AMVA 1XD8A 1JWLA 2YNMC 4J1SA 2BL4A 4UUMA 4DLBA 2JLWA 2FW8A 4DABA 5KHAA 2IF2A 1W4ZA 2A0UA 2EFCB 3LVFO 3T4UA 2C61A 3CVUA 1QGAA 5AI4A 2P3SA 3STVA 3V2GA 5A3RA 1CZHA 3Q8KA 1IEVA 5JNSA 1NQUA 4C7MA 3OPYA 4CM9A 3RAPR 5ANRB 2E37A 1QOPB 2D1SA 2ENUA 3T4XA 4L27A 5LD2C 3KELA 3VPHA 3R3YA 4YV1A 1E9VA 4TMFA 4YPOA 1NGSA 4BCBA 4KQJA 2D0PB 4AS1A 5HFAA 4OAPA 1I6MA 1J07A 3H7AA 3SNHA 3NORA 2FPUA 3OAAA 4AULA 1XVTA 3EULA 1OI2A 3O2QB 4CKZA 4HH1A 1N3LA 4B0PA 5JYEA 2JC3A 1F48A 1H65A 5EIBC 1VLJA 2XNSA 3CB4A 4BFLA 3DVRX 1W2HA 1KZ7B 3AF1A 5I5EA 1JBEA 5EE0A 2MOKA 4N3NA 3ZE2B 1H2BA 1CEYA 4HKTA 5FUYA 1I2AA 4FYHA 4BGIA 3M5CA 1F06A 3QG5A 4E7PA 4ZARA 5FOWA 5B1EA 3QPAA 1ORTA 4EFMA 2XYPA 5EZ5A 4YJDA 5A4IS 4UMDA 2FUG1 2EW1A 2BISA 1Q84A 4AJOA 4RD4A 1H05A 1DKQA 2OXEA 1DRJA 4WECA 5DLYA 1U1EA 4OFWA 5DV9A 3V7YA 4AP9A 4F4UA 1LD3A 1BXZA 1FS4A 2ZTHA 1BJKA 3TN7A 2DE0X 3OO0A 3BDVA 2D5IA 5B7QA 4G86A 5JMPA 4FW9A 1JFSA 1J1UA 5AHWA 2ZT6A 1A9ZA 1KQGA 4KDFA 4ARCA 1UQTA 5E7JA 4KFRA 4LC1A 2A35A 5FHQA 3UV3A 3I1FA 1IHYA 4MCJA 1GQFA 1XEAA 5IX8A 2C82A 2CBZA 3FRIA 1E6WA 4KFUA 5A05A 3JQRA 3VZCA 3BZWA 2BFOA 2M2IA 3EOZA 3JX9A 1F9EA 1XPRA 1UT8A 3LDGA 2XMBA 5JO0A 2PLAA 5DHPA 3OO1A 3MTIA 3HWRA 4FPXA 2E48A 3JVIA 3PSAA 2PMEA 3SYRA 4RSMA 3NEJA 1URPA 4LXTA 5TGZA 1UH5A 4RQTA 3D8BA 2FB9A 3KQUA 1YHYA 4NK4A 1F17A 3GZNB 3LECA 1A7JA 1XXHA 4FHFA 4ILKA 3QLVA 2CZCA 2PSHA 2JANA 1CF4A 1NVXQ 2J41A 4CFSA 1D1SA 3EQZA 4Y7CA 3SJUA 1P19A 5IKPA 1GEGA 4NFSA 3R7AA 4GX2A 5JJCA 1D03A 4GRAA 4FCCA 3ROQA 2RKOA 4BBJA 1H4QA 3AF2A 3I04A 4HFRA 1O3YA 2V98A 1W581 3LUPA 3CSSA 4HO1X 4MMYB 5CXSA 3JPWA 3KAQA 1GV1A 1QWOA 1YZTA 3F6BX 1A9RA 5L3ZA 5TMBA 1SG9A 1P61B 2GN6A 3H9UA 2AMLA 1A9XB 2MMCA 2X86A 3ENWA 3MINA 4FSXA 5AJYA 3VZDA 4BBAA 5I9NA 1PG0A 2Q3DA 3O5AA 1UP4A 4JQZA 3E6AA 3BRWD 1QG6A 4Z7QB 3QBDA 3Q7IA 3D5EA 4X1KB 3G13A 5DBOA 3WB9A 1EVIA 2OUIA 1IG3A 1XZAA 4LTMA 2O8CA 2X9QA 3UMRA 1M54A 2Q6IA 5JI2E 1QQ7A 4POOA 2X15A 3B8EA 4R7ZA 1TMOA 2AV6A 1DIRA 1CUYA 3FN4A 4REOA 3WS7A 4ARAA 1ML3A 1N5DA 3CEHA 4UMFA 2JNWA 3LFUA 4KIJA 2HA7A 1CDOA 1ZHHA 2JIMA 3GZNA 4JYZA 4MKXA 1I7NA 3QVMA 3KKNA 1SZCA 3DMFA 3N2YA 5BWBA 3LX4A 3E9QA 1XMSA 4OQLA 1EXWA 2IIVA 2J9GA 2G40A 3HU5A 2H85A 3FI0A 1YQTA 4FFSA 2WUVA 4L8FA 4N3GA 1E1NA 1G4AE 3CRVA 1JYSA 3SEQA 2WQ6A 2QLMA 1P1JA 5LZ5A 3RK0A 3TQSA 3WKAA 3OPVA 5EJ8A 3A9WA 2YINC 4LF6B 5BWNA 4JVMA 1E3EA 3PJFA 1YJCA 3TLCA 2H1OA 5LXTF 3B78A 1HZZA 5HZKA 3L4KA 3NDPA 5MN5A 3DA8A 1LFDB 2Y1EA 3ZWVA 3GK3A 2DFKB 3ILHA 5L95A 1A9XA 2C58A 5U1PA 3F2VA 4KQGA 4YCCA 3O7MA 3U61B 1FTYA 2XHEA 4U2FA 1P2SA 4GXQA 3DMTA 3F9IA 4H27A 4X1KA 5IDXA 1C7RA 2AHOA 1DI0A 3QUAA 4YAOA 2IX3A 5A0TA 1CUXA 1QFSA 5DH9A 1YL5A 1XZIA 1VYUA 2IY9A 1CIJA 2QZZA 4Y2XA 1XNHA 1RTTA 2BDTA 1NOKA 1AA9A 3EUEA 3KFVA 2IH4A 1Q7TA 1N2EA 1BVUA 3NC4A 4JBNA 4F5DA 3KKPA 1XKTA 1MEJA 2QIOA 2FSIA 4J76A 5TX7A 5CB4F 1OC2A 1XAJA 2C2GA 3WAJA 5IN4A 1MX1A 1XDUA 3UB2A 1JSCA 1A4UA 1X1BA 3UT6A 2YOGA 3HABA 4KW7A 4TKMA 5EJ7A 2ONZA 4F45A 2Q5JA 2BPOA 1K5HA 3MWDB 1OVMA 3MWFA 3TL3A 3KT8A 1OLUA 5AKIA 1GQRA 1V8BA 3WOHA 1P1IA 1UDCA 2PS0A 3PGXA 2VOEA 3ZWCA 4MK4A 4NZMA 3TKAA 3EH2A 1LBSA 1EFRD 2OBFA 1R6XA 2PMKA 3G6KA 2PT9A 3UXEA 3H2HA 4CN9A 2P4SA 5EEHA 9GPBA 2AGVA 3BPSA 1FNCA 4OSOA 4A8JC 4O2BB 1U98A 4NZZA 2VJLA 4YFVA 1Z0KA 1A98A 4B3MB 1LK0A 1ABEA 1BX3A 2IYOA 3BTVA 5HF9A 2OV3A 2V7UA 3KL2A 3JQ8B 4N47A 4A15A 2C7QA 3AEUB 4JT4A 2GCIA 4OYRA 1AUOA 3N8KA 3EAFA 3KKEA 1NVEA 3ZZUA 5BWOA 1U63A 3RUEA 4M1EA 2Z30A 3SSOA 2X2FA 3DE5X 3KD3A 3PD7A 1YUMA 3OZGA 5JQGF 3THWB 1G5TA 4IR7A 4E2ZA 2FHPA 5THQA 1D2CA 5F2EA 3WE7A 3L0SA 4KU4A 5IJXA 1OVGA 2YV1A 4I6EA 1FYXA 3B9RA 3OPYI 4IBOA 2CXHA 1KI6B 4TSKA 1PZGA 4M1MA 1DINA 2QG6A 4X00A 2WWVD 4NXMB 2CD9A 4TL8A 5JAOA 1WDKA 1LV7A 1UANA 1C0KA 2G63A 3MZ0A 4PCVA 2OAQ1 4BMVA 2O8NA 1JA9A 3E3MA 1EX1A 2CD7A 3MWDA 4KK3A 3U3DA 2YZMA 4EDHA 4Y3UA 1FDRA 3DYIA 1RVDA 4WVFA 4HHEA 4CHGA 4LF9B 3DULA 3QKIA 4BN0A 2J6CA 3AF4A 4GMDA 4XM1A 3V2IA 2GESA 3QHQA 4RE5A 5JIBA 3PPVA 1BQ4A 4NCXA 1W35A 2ORWA 2YIMA 5EKUA 3I53A 4NIMA 4IFIA 4D6YA 4O2BA 1AXRA 3LBHA 4R2KA 4GRDA 1SBNE 2CNOA 3R3WA 1PT7A 3PENA 1RLMA 4CMJA 5JR3A 2OFFA 1SCUA 3ED5A 1BE6A 2JLBA 3RG8A 3G49A 3RTEA 3CO0S 4QFCA 1VQ1A 3DOEA 2PH3A 3GMIA 3JQ8A 3AEUA 3RFUA 2OA0A 2AOTA 1T0JB 1W87A 1BOOA 3WWYA 6LDHA 2B3DA 4I36A 4JOQA 4HP8A 1F14A 2R9VA 1QHEA 4Q16A 2GN0A 4Q9IA 1UJMA 1P4RA 3KZNA 3TZCA 1BOFA 4JI0B 1JP7A 3Q6IA 4OH1A 4CODB 4YV7A 1E0KA 3ZVNA 1FYEA 2Q9BA 3VGPA 1ZMXA 4EOGA 1X80A 3EIWA 3VR2A 1KI6A 1R0BA 2PMBA 4BLTA 4CMEA 3EQ7A 3PTZA 3RS4A 5LNK1 2FQQA 5CVCA 3HBNA 4B76A 2QTZA 1CE8B 3O4VA 4WLEA 2FSFA 5BNTA 1P6QA 1I9GA 2E9SA 3H87A 2MT9A 5LD2B 4ZI7A 1NU6A 2VBIA 1BKSB 2RGNA 3BGDA 3BGWA 3I9V1 4A7PA 1J7KA 4O4HB 2CZGA 3AEQB 4W8HA 4XSVA 4YDSA 4N9WA 4ZVMA 1N2CB 3PEWA 4KNYA 1Q1QA 2ATVA 2YX1A 1W5BA 1PEKE 4R5HA 4R8MA 1SRQA 2PX8A 4L08A 4L4ZA 4N3CA 5CCDA 3CVVA 3DW1X 5ALEA 2BUAA 2ZBFA 3AHFA 3X1KA 2Z57A 1E2GA 4I1VA 4TRRA 1KORA 3KPVA 2J0SA 1JIUA 1VP9A 4CKYA 3ZY6A 4J07A 2WWHA 4WE3A 3ZQUA 1UOOA 4NBVA 1WXHA 3FSEA 4KEAA 2YV5A 3HEMA 3VSBA 4EATA 1ENOA 3DTYA 4Q39A 4O8CA 4W63A 3A4LA 1HFKA 3FKSD 3H3JA 3BWXA 1PT5A 1R4AA 1NPDA 2W70A 3FTQA 3BQ9A 2WR8A 1NWHA 3ONEA 3SBEA 4HVTA 5JPCA 1YQEA 2F1IA 2F9FA 3PC4A 1NG1A 3O1LA 3FNEA 4PZUA 1T2DA 1CE8A 3IKJA 3ZD7A 3R41A 5IAEA 4HQOA 2ZB8A 5CW1A 5JEEA 2NUPA 3S2YA 1OFVA 3G2JA 1XZPA 3ZHUA 2D0OB 4M8SA 3UAVA 1P91A 2EKZA 1ZOPA 2AQKA 1NTOA 2H29A 2WP0A 5HKKD 1YKFA 3P2OA 3RYCB 4BNXA 3MLEA 2AI3A 3AEQA 1Q57A 5EP2A 3SK0A 2X19A 4LJLA 1GFSA 5CEFA 4MWCA 4IEIA 4WKCA 3UPTA 3IIKA 4ROSA 2JKZA 4EHAA 3NAGA 1FSFA 1NPTO 4JXJA 2VDMB 3HQ4O 4ZRMA 1UJ6A 2F1OA 4HWKA 5EI5A 1QGDA 3GG9A 5FO1A 3OG9A 4BEJA 4XR9A 4EY6A 1IN1A 2VT3A 2C94A 5IZCA 4MW2A 3ACDA 4LVOA 5M29A 5KJCA 4K9LA 1VLVA 4B3CA 4CVNA 3VFDA 3LZDA 5KJ1A 3M0EA 3KALA 1BU8A 5DP2A 1VRVA 5ALUA 2PZEA 1PR0A 4JBXA 1WX1A 1FSGA 2JIBA 2O1WA 3VNAA 5EHQA 3NWJA 2RB4A 3UV7A 4RO0A 2Y6VA 1X7DA 4H6XA 3MB8A 1ZGBA 3M5WA 3LCMA 4XEUA 5CFQA 1OCEA 2XCOA 3C7CB 3IQDB 5IANA 1P1CA 2FJPA 2H18A 3EEBA 4OUDB 1GITA 3SDBA 3DLHA 2HO5A 4RPKA 3SBXA 3WGVA 2W93A 2ZRGA 5CJ2A 2G7MC 5C1BA 1W47A 3R40A 2BZ0A 2W0SA 4JY7A 3BJRA 1IIRA 2MTBA 4PYOA 5G3YA 3P1JA 5BQOA 3NONA 4UATA 1TJ5A 3RYCA 3I04M 2JBWA 4GF5A 2VCYA 4RGQA 4DDKA 1D8TA 5ALGA 5FBLB 3CX6A 1E69A 2BFMA 1V5IA 1YT5A 2WZBA 3KR1A 4TLDA 3OIWA 3SIWA 3P19A 2XWJI 2V4ZA 1UBLS 1NUPA 1SUCA 2ZROA 3K94A 3ORQA 4HAVA 2JGDB 4HEA1 3S99A 1NXXA 1Q22A 1YCDA 2OPBA 1CJCA 1EE1A 4IGEA 4G23A 1P6UA 4IOJA 5FOTA 5BXYA 3H42B 2OV1A 3A05A 3GFSA 2V55B 1HL3A 3A06A 1RAFA 3PLRA 3S6JA 2GARA 4X44A 2GR9A 4U9UA 1ZVMA 2OP0A 4HDAA 3UB4A 2RHWA 3T3EA 4N03A 5F3WB 4KAAA 4XEHA 4JVSB 4ZT4A 3ZTYA 1YS9A 1NNEA 3FF1A 2O19A 4JNCA 4GYKA 1WRBA 3GDFA 3RHZA 4LSMA 3NS7A 4DLYA 2Y1FA 2YUTA 4EHJA 5CA1B 4JP8A 4GPEA 1R5NA 2HWUA 2B20A 2IHJA 1SUSA 3JCZA 3QKTA 1A9PA 4BL5A 1W8IA 1Y98A 1IWOA 2I22A 3K4QA 4IJ6A 3G2KA 2IBMA 4RPIA 3PWTA 1TQ6A 1XRLA 2V97A 1P7YA 4DLVA 4AQYB 4GEGA 1E5TA 1TQ2A 1XB2A 1F4PA 2XTAA 3D1JA 3NH9A 1C8LA 1UKEA 3I0NA 4R2MA 4B2IA 3RADC 1L7OA 7GPBA 1WBJB 1FLAA 2JGDA 1YJAA 1OH7A 5K0FA 1H6DA 1GGFA 4ZICA 4QFDA 2XE6A 3CLRC 4XQGA 2QAJA 1U3GA 1WXWA 3QNMA 1W1IA 1PG5A 3QEMA 4R40A 3Q3JB 1LPMA 5BNWA 3RYFB 1POXA 1PNOA 1Q15A 3OAAD 4OF4A 3F3KA 3C39A 4FMDF 5EE9A 5K3CA 2P8SA 2R87A 1A96A 1YDGA 4LXIA 4C6SA 2CMGA 2VZ0A 1LX7A 3CXUA 4RZ3A 6ABPA 2H59A 3TVYA 1CWUA 5CA1A 2BMAA 1E1RD 4MRPA 1NQXA 3OZTA 4MUXA 3RUPA 1BDIA 5TEWA 3H5VA 4MVJP 5KKAA 1MENA 3CUUA 2E6KA 4JROA 1RLIA 1ESCA 2QR3A 3AVUA 1UZLA 4P0PB 4A8JB 2EFGA 1N2CE 2WMNB 1GUAA 4LZOA 5A2QA 3EXFB 5AT1A 3FCOA 4UAUA 1S8AA 3DYBA 4RHXA 5EVCA 5EAIA 4C6TB 4B74A 3QKUA 1SD2A 4P7KA 3NBMA 4I4TB 5I3ZA 4WOJA 3PR3A 1VCIA 1U8EA 5K6TA 1DQPA 4KKXB 1RYDA 2HYIC 4P5EA 2EIXA 3Q9LA 2A7XA 1P4AA 3B3AA 2P0AA 4M8LA 4DQDA 4IIDA 3VDNB 1WB9A 3ZQKA 1UXHA 4MEBA 3I39X 3RAGA 3VR6D 3ZHCA 1JXOA 2PUJA 2WMDA 4M54A 1BIFA 3ROTA 1DC5A 1GZSA 1UEJA 1YOVB 3EG5A 3WB0A 4C76A 4G8CA 4PTYA 3DDWA 5IJ9A 5I51A 2Y68A 3INTA 1SVSA 3N2ZB 3COVA 4KYUA 1Z62A 2KWIA 4MUEA 4UBLA 3LKZA 2FEAA 3IOCA 1C80A 1QTNA 3UY4A 1ZH0A 3MM4A 1HI9A 2C3YA 4G0ZA 4JBHA 4MVJA 3F3SA 1KBZA 1M1YA 2OFPA 2GN1A 1H2WA 4HB3A 5GQSA 5LUAA 1I51A 4ZXPA 4CQMD 1YS2X 2ZI3A 2PFSA 3GRPA 3IOMA 3JAWB 4WN3A 4BO5A 3FVTA 4EB6B 2XZPA 2CHGA 3TIXB 1W75A 3FPCA 3MJSA 4BBPA 5AM5A 3OHSX 3MAJA 2BLLA 2VK4A 3NT2A 4C6TA 1T1GA 4CUJA 1NFQA 1T13A 3N59A 4G24A 1O0BA 3MTAA 1MEOA 4P3OA 4R1MA 4I4TA 2QVGA 1YZFA 3SS8A 1B0AA 2C3MA 3RI3A 1NRIA 4HVCA 1E3MA 1NATA 1G8YA 5BR7A 1XHLA 3EEFA 2PFGA 4GMFA 3TAXA 3TSWA 3T5AA 1O6ZA 3KYBA 2ONCA 1NBWB 3CX4A 5EZYB 1XVVA 2IX9A 3ECAA 3WQRA 2YBEA 2H4FA 4QA9A 5T5QA 1AMUA 1Y8AA 3A1CA 4UM9B 2D54A 3QUBA 7ABPA 3Q6NA 4DIFA 5CLHA 4UXHA 1JDZA 1GPKA 1BU5A 1PEDA 1ORWA 4L6CA 1QYIA 3WQQA 1YOVA 4D99A 5I7SA 2Y1WA 2VHVA 5KNDD 3E5MA 1JQEA 1XRRA 2FZGA 2R1VA 2QTAA 4MI1A 4JLBA 1ISJA 4ZEWA 1IXRC 1Y5LA 5EXEA 3VHXA 1U8CB 2EW2A 5JS1A 1ULHA 3O4IA 3TSOA 2AG5A 1M5TA 2FEKA 1AKWA 2A59A 3PJGA 4TYMA 1W4LA 4D9IA 4NBWA 4G5RA 1FW6A 3BB1A 4DLSA 5HIMA 2VTVA 4OHPA 5LP6C 5E9AA 4U9HS 4XJXA 3N6VA 4LF4B 4HUTA 3JAWA 1W0KA 4DMUB 5I45A 4EB6A 1JG7A 2O7RA 1LPAB 2H5EA 2QGNA 3I9OA 3VA7A 3VH1A 3TNJA 3BXOA 3IHWA 2VWGA 2Z8XA 1PFUA 1KQFA 1AXEA 2X8WA 2H8KA 1E7RA 1ZIXA 4C0XA 3HS3A 4DA8A 1R6AA 3JAMA 4H3HB 2WAXA 3QWBA 2JHCA 2W8BB 2Q4TA 4MUYA 1HR0B 5CNMA 4KR7A 5ALFA 5EZYA 3ZQ4A 2Z9BA 1NNSA 2I67A 1VRWA 3C41J 4YK7A 2WU1A 4BMYA 4EK9A 2QRVB 1XCBA 2Q3FA 3B1XA 1AKVA 1X6VA 1XTIA 2DF8A 1WUHS 2RGWA 3G2NA 3PP8A 3Q2IA 3WLIA 4BE9A 3HLTA 1OE0A 2AVDA 2NNLD 2QTRA 5IABA 3W2EA 1EK1A 4DLPA 4U7WA 3D7RA 3IQZA 2ZJAA 1XLVA 2H7CA 1N57A 1WKVA 4GSLA 2AIRA 2EF0A 4NE2A 2ZR7A 1KO5A 4L5JA 5CCXA 4TTSA 4K9MA 4QYTA 2FWPA 4RYDA 5FPSA 3PV0A 5E6RA 1HYQA 4Z9YA 1EP2B 2Y9PB 5L45A 1NV8A 5D8DA 1YMVA 2EZ9A 2FX5A 3FMPB 3PQ8A 2QZ4A 1AQNA 1JT9A 4MI3A 5JNTA 2NAFA 4DR5B 3NNNA 3EQ9A 5ALXA 1XKQA 3LYUA 1A9OA 5DCWA 4Z4GA 1OV6A 2ZREA 4EUNA 4E5DA 4S0ZA 3QOXA 4RZHA 2Y8EA 1YR8A 3P26A 4WEQA 1FBNA 1ZMRA 2LNDA 5ED4A 1T0PA 3E7XA 3D1LA 2REBA 2Q1TA 3ET4A 5LP1A 2XIJA 1V3TA 1CIVA 1CK4A 2JFGA 1F8FA 3JZAA 3K7EA 3T9AA 5HR5A 3ESAA 1DCTA 1NW4A 5G4KB 1D04A 4WXPA 1N6KA 1Y4DE 3DHNA 4G07A 1YIOA 3KZMA 1LW6E 3NBXX 1U31A 3RTCA 3SG0A 5KVVA 4ZI3A 4N6OA 3S8YA 3SYTA 2C2MA 4FC6A 4AJLA 5AYVA 1I1QB 3AKEA 5F76A 4XIFA 3BWMA 2BKEA 3NIFB 4KSYA 2CCJA 2LZ0A 2ONJA 1TKBA 5FPQA 2GK4A 2ZCJA 1JTFA 3B1JA 3KOOA 1JIJA 1I32A 4QICA 3UMJA 4JLVA 4XPIB 2DHCA 5H7XA 3B1KA 5TJ9A 4DV6B 1PRYA 3TEFA 1XA0A 2CFRA 3FAZA 3ZWKA 2VUSA 3FNQA 4DVGA 2CEKA 4N8EA 1IVYA 4AKTA 2NUAB 3ISTA 1DDOA 4DZRA 4F93B 3QQ5A 1DWUA 1MB4A 3AU9A 5FBKA 3C48A 4DEXA 3N2EA 1HTBA 1M2KA 1J22A 4HRVA 4KSCA 1KYTA 1U7OA 2NO5A 3ROFA 1GSHA 3GLQA 3TB6A 4U0KA 2CMFA 5LM3A 1WBDA 2FR8A 1HURA 1U8AA 1XO1A 4D4MA 1G5PA 3K6KA 2V5VA 2HA4A 1FBTA 1U6JA 3DMGA 1L7NA 2H57A 3G3EA 2N46A 1RWNA 4NFHA 4CKBB 1WVIA 3HGMA 4IDAA 5AVUA 5CH3A 1RI1A 1PZHA 4U00A 4CYMA 3GJQA 3EA5A 4BAUA 3MMZA 3PIIA 1GPWB 3LT0A 1HGXA 1XIVA 3GJ6A 2FN7A 4G41A 4D26A 4E6EA 5G4KA 5CTAA 2VJKA 4M98A 3WLHA 4MGZR 1R9MA 4V3BA 2D00A 1HLGA 3GQVA 4MWGA 3VDQA 4F84A 3DP7A 2DTEA 3DVLA 3FNGA 4HTFA 4PPYA 4AAYA 2DHRA 5CM2Z 1AKQA 1A8UA 1R10A 4DDWA 3R0QA 3H1FA 1S2NA 1QHFA 4Q00A 1YVUA 1IDN1 2ATEA 3C6QA 1GIAA 1P5RA 3OZWA 1TCBA 3ELWA 4XPIA 5A0VA 1EFCA 3EIHA 4X84A 1M6NA 2FPSA 1UFQA 3TLEA 3V1TC 2NUAA 1ML4A 3E2MA 4Q5IA 2H2FA 3EEOA 3E1SA 1ODLA 3HBMA 3HVIA 5B55A 3D6HA 3KE9A 4C7OB 2NSHA 3O94A 1EEHA 1R3UA 4UFOA 4QOEA 4R1SA 5K2MA 3AB8A 1ZUWA 2Z6UA 4NZOA 1AKTA 2X4LA 2ZSBA 3ZE7A 1AGNA 1E4YA 5GJWC 5AHKA 4B5KA 4CKBA 3LXMA 4N7BA 3UMYA 1DHTA 5I7HA 3N28A 3ORYA 2C2WA 1KEVA 4P53A 2ESRA 3N0XA 5AESA 2XXAB 3PS9A 3EGDA 1N0HA 3OZIA 2XDAA 1MLDA 2GVNA 3GP3A 1WU7A 4MVJI 1V9LA 2ZYTX 1W34A 1JR4A 1DBPA 3MJCA 1TFRA 4LUCA 3GZ4A 1QTRA 4HXYA 3OJLA 2IWHA 2P75A 4JJ8A 4KMRA 3GYBA 4WJKB 4OQEA 4YXWA 4JCOA 5IWAB 4WKNA 2M6RA 2C5SA 2EX0A 3I8SA 1V6AA 1TM4E 1H22A 3ZBPA 1XPUA 4KYIB 3V46A 2I99A 4JLWA 3B7GA 2QUZA 4M7WA 2OL4A 4AN1A 3HDHA 4AF7A 5JDCC 3RPEA 4G25A 2J33A 1ZH8A 5ICFA 1EX6A 1PHPA 1TKRA 1TA9A 4UTZA 4LJAA 4J1QA 2OV6A 2ZI4A 1VFPA 3RGGA 3FPEA 1O6GA 1XZFA 8OHMA 1UDRA 2LDXA 1WXGA 4LXQA 2GAFA 1Z4NA 3QV2A 3DOOA 4XGKA 4AKGA 3LCJA 3WRVA 1ZSVA 4RZXA 5IMBA 4OBBA 1HNWB 2VP6A 2FPOA 2XCLA 2XE4A 3TTVA 1TM1E 1RXYA 2J9ZB 1EH5A 1R6DA 2LPMA 2QE6A 2QUHA 3CY6A 5EIBD 1TE2A 2H2IA 3KOWA 3QE3A 3ZHQA 1V7QA 4W5NA 5F78A 3L7KA 2PRKA 3A32A 3ZDDA 1ZIOA 4LISA 1EI9A 1Q0QA 4PZCA 1MB3A 1N9GB 3IPCA 4CL8A 4N3BA 4BX0A 3COPA 1QC5B 2FQ1A 3KSBC 1YQWA 3NKFA 4PGAA 3LC7O 4F2GA 1TK9A 1OX6A 3VXKA 2D0IA 3HGTA 1KEEA 3K0FB 3ZQ6A 5HFJA 3TZEA 4Z2YA 3AWDA 1E5DA 4ZJZA 4YIHA 4KR9A 1XEXB 2UYGA 4ZQEA 2GEDA 2ZJ2A 4P9NA 3TAUA 2VQ3A 2W00A 2O2XA 5DCYA 3HJBA 2JI7A 4MVJM 4TTVA 4QO8A 1JV2B 3LTNC 3GY0A 1JHPA 3VZPA 3CNQS 1XMOB 3OIDA 3IKLA 3JR3A 3VC2A 1BWSA 2BDUA 2QD1A 3GLRA 3T9EA 2HT6A 1SHTX 3H5RA 4II3A 4DG5A 1CP2A 2Y71A 3UG6A 4B3SB 4C5AA 1DCKA 1Y9EA 3NV7A 4L0CA 5CGZA 1IHPA 1T3TA 1KDTA 1ZKMA 2IZ0A 3ETDA 2G04A 1SKYE 4QUIA 1E1CA 1YMQA 4Q9NA 1CNMA 5FV7A 3ZXXA 3G0HA 3EXG2 2BVNA 2WF6A 3GPLA 1GOTA 4KTTE 1ULTA 1YR6A 3OIVA 2OOKA 3IUBA 3IBSA 4I8IA 4N7JA 5FLKA 1BKDR 4J1TC 3E5RA 1WULS 1QV6A 4LK2A 1N9GA 4I0WB 3D2LA 4AYTA 4DYDA 4E2XA 3K92A 1UKCA 2C77A 3RC7A 3GLFB 3ZGZA 1QC5A 5LP6B 1SZPA 3KUDA 5DM2A 5GIPE 1DT5A 1U94A 3H2ZA 2Y0BA 3OWOA 2V7BA 2XDYA 4OJQA 4MEJA 1OUMA 13PKA 3V8MA 1DJPA 1QHHA 3WBJA 3FTEA 1BN7A 3L4JA 4NFLA 2FUG6 3NBAA 1EQ2A 4RSRA 4DGQA 4TYYA 1CFJA 2AB0A 3WK5A 1B8OA 3HFJA 1QK3A 1Z3IX 5JPDA 4RJIA 3A6DA 3UGTA 1PS9A 2CL7X 2B1GA 3UK0A 1C9NA 1NLMA 4YP9A 1AZSC 3JSXA 1JIIA 1E63A 2GA9A 3LYAA 5I7UA 1YU9A 4C3VA 2OP1A 1II8B 1XZ8A 3VSEA 1DQSA 1OWOA 3B6ZA 4LDJA 2GYVA 1J0DA 1VCMA 1QIKA 2XB4A 3D8HA 3S8EA 3CVYA 1AB6A 2ZPAA 4MS1A 2OQVA 3CZPA 5KVSA 3FUXA 3BXXA 1LK5A 2LVBA 4FYWA 1LSUA 2CNDA 5J2TB 2C7PA 5CVDA 1JG4A 3T7TA 4OOFA 5F33A 2JJ8A 4UEWA 3DMDA 4F4FA 4JELA 3AFMA 1DX6A 3GLFA 1HEYA 1N6HA 3FOBA 3R7WB 4IS3A 3F47A 4KRFA 1WQ1R 3UH0A 1L5KA 1T6XA 4KE6A 3BSWA 4DBVO 5HM6A 3EFBA 3WLTA 4K9PA 4UAGA 3IL2A 2A86A 3QEAZ 1QH9A 3ZD6A 4P92A 2RARA 2BHLA 2ZATA 4PF1A 3VVMA 1YB6A 5LWHA 5EXDA 4G4JA 3UXMA 2VP9A 2VDJA 4B6PA 3WMXA 3SLRA 4F86A 4LYYA 5EQDA 1MC5A 1TMYA 2BJVA 3ZZNA 1YQXA 2AC4A 2XHZA 3AHCA 3HB5X 5JAQA 4DJDC 3V4FA 4FYXA 2WJ4A 3LVQE 1DXOA 3N0WA 3BAZA 3QXJA 5DKFA 2MU1A 3M6VA 3GCZA 1QDEA 1W0JA 4LCBA 4R3UC 1E2KA 2MINA 1JQ3A 4DHWA 2XZLA 4L28A 1SXGA 4WCDA 2HD4A 5AI8A 2RAFA 3OA0A 4GICA 3V8VA 3HFSA 1HOTA 2Q8NA 2I6TA 3MFYA 3N6XA 3R23A 2GLUA 1NJ6A 4KV7A 5J2TA 4Y2UA 3AJAA 2VT2A 3IE2A 2Z2IA 3DEHA 4GC9A 4I1RA 5AW5A 1CR2A 4WASA 1Z18A 4U63A 5JS6A 3R7WA 3TVTA 3UJDA 1C8KA 3L8HA 3FYDA 4KOAA 4WOCA 1NQVA 5IM4A 1G16A 1OXXK 3I83A 1DX4A 1HRDA 1YO6A 2AJLI 2CJYA 2PX5A 4YP0A 4G0UA 1XYVA 2QLJA 4FE3A 3UJ6A 3PRKE 3GB9A 1GGEA 4O2BF 4L4SA 4UTPA 1QLHA 3LQ4A 1ZVQA 3HJGA 1AKYA 4NS4A 4TXJA 1IBCA 1CUIA 1P5ZB 4BQRA 2RJ3A 1AUVA 1R5BA 2SCUB 2CY0A 2MSEB 5B4UA 4P4UA 1TLTA 4YGYA 4LJSA 4MJ7A 5LQMA 2QJTA 1GAQA 4MLCA 1NY5A 1XQYA 4WNCA 3LT1A 1NVBA 5BT9A 1ZD1A 1QV7A 3M6XA 4P82A 1NF9A 4KO4S 4B31A 4EB0A 2YHIB 3G8YA 2B61A 3C3CA 5FUVA 4CMBA 5BQPA 5ES4B 3R6DA 2WEKA 3FOEC 3K6JA 2YFKA 4ARZB 1XD2B 3SVTA 2Q4DA 4ZU1X 1R0XA 5A2GA 5KYUB 2BM8A 5LOVB 1P2GA 4MKFA 1T1JA 1E6MA 2P2ZA 1IXSB 4HUJA 2FZKA 4ZI7F 2FWJA 5ILGA 3V80A 3GP5A 2O0JA 4G0NA 4GIBA 1ACLA 1ESEA 1L8XA 1TC1A 1GSAA 3AHIA 3I92A 4BVHA 4ZAXA 5ITVA 3FZGA 5AUNB 3W4JA 2Q9CA 4UNSA 4MICA 4CIXA 4HH4A 3E84A 1PS8A 1FFAA 4OCZA 1U1FA 4QU8A 1F0NA 2Z5FA 2WA1A 1O8CA 3CF0A 1IONA 4K9OA 4NBNA 2HJGA 1X9IA 2WAMA 3LF2A 3ROPA 3IAXA 4IO0A 4YI5A 4ZAYA 3ONWA 2HCTA 2CHVA 2ZYDA 2B4AA 1GQ2A 2VTEA 1G3MA 3M34A 3ZK7A 4Z0PA 5HKLA 4CF4A 4ZJUA 3DL2A 4UHFA 3PXCX 1LVUA 4CLDA 4DHEA 4Y9RA 4JHLA 4YRGA 5IVHA 3OA2A 3EZLA 4LJ8A 4RKFA 5ECGC 1YL6A 3KQMA 4AD8A 1E9AA 4IJVA 3WLLA 4EQZA 2WWYA 1JJFA 1LW7A 2CK3D 2FJUA 2QX8A 2YHIA 1YASA 3DEYX 1PT9A 1YRWA 3LXUX 4HDNA 4K3VA 4M37A 5IJZA 2K2WA 1YI8A 5I9IA 1SEPA 1NMEA 1Q0PA 2NO6A 2R00A 3A3NA 4MW9A 3AUFA 2BR4A 2HJVA 3BK7A 4G85A 1B73A 1WE2A 1Y8RB 4GBGA 4QXMA 4MPPA 1XD2A 5CA0B 2ZRIA 3FOZA 2FWRA 3PE4A 2EIHA 4ASUA 4TLEA 5DK6A 4DN6A 1VKHA 1U0NA 4YJFA 4WJZA 3GLFE 2OCYC 3ICQB 4U2GA 3D4PA 5D3QA 1T34A 2ATIA 3KR0A 1KYXA 2EEZA 5FA8A 5FJJA 3SOZA 3V1LA 4O4HF 5KU1A 5AVTA 5AJXA 4DFDA 4R51A 1EWTA 1Y89A 4IWNA 5EHGA 3U4IA 2QVCA 3GN1A 4BNZA 3WI7A 2FUCA 3UJ9A 4ALJA 1J0CA 3EPPA 1CRWG 4CIVA 1EQUA 1YH3A 2DUJA 1XVLA 4YT5A 5E4TA 3SIRA 1PNTA 2X8LA 1NYQA 3OMXA 4EFLA 1QMPA 2EYQA 2QENA 2R7NA 3R4CA 1OU4A 4GBJA 1T4MA 4MV9A 1AK9A 1LJUA 3RTGA 4MI9A 4Q37A 3WYCA 4ZIRB 4Q1DA 2LXNA 2ONKA 1JHVA 1VJRA 3KJIA 4GZ3A 5KIAA 3GT4A 1C7JA 1DC7A 1FIUA 2QB5A 4QPPA 4OQZA 2PJDA 1SA0B 4HWRA 3DVQX 1U2RA 1WHTB 2VJAA 3I0ZA 3K9GA 2YOFA 3IR6A 3RVJA 3UCFA 1U2DC 3SKYA 1YQQA 2I1WA 4UPDA 1RM3A 5M7EA 4L78A 2GEUA 2QMYA 5DYYA 5KWSA 1IYZA 1N1DA 3DR5A 5IAGA 4K6MA 2I0FA 3CM0A 3BGIA 4DCSA 2FX3A 4M1TA 2VT7A 3PQ2A 4Q7KA 2IUSA 1KXJA 3PVSA 2H5IA 4JIGA 1X87A 3BGOS 4BFYA 2P35A 2UVPB 1OXSC 3EW7A 4KWIA 2FEOA 2JCSA 4J43A 4KPGA 1I6KA 3UBTA 4XLTA 5MFPA 3HYRA 3A4TA 4A73A 1EVYA 1GSOA 2IGBA 4TQGA 3T4PA 3W8DA 2JGJA 4F1KA 1A7AA 3EEYA 1ZK4A 5H70A 3I58A 1U2TA 1DP4A 2BOVA 4TN1A 4FS8A 1SBTA 4Q02A 5JY6A 4FHEA 1IJFA 4P3YA 4ZIRA 3CZ4A 3ODPA 2PIAA 1O5IA 2WJIA 3I9JA 3PJDA 1I3KA 2J45A 1VHQA 1L8LA 3GT3A 3GV0A 1MD9A 4MA4A 4OATA 5E3JA 3WJ1A 4EW3A 2C5FA 1SA0A 4P0TA 4YGXB 1JFVA 3D5TA 3T0GA 1G6OA 3IHTA 1WHTA 4J0KA 4CLEA 2P9CA 1NU8A 1UQRA 3GC6A 2I4TA 1Q44A 3A9RA 3SZUA 2W11A 3PWZA 2VDKB 1U3CA 3AYZB 3K3PA 5L7WA 4OQXA 4LFCB 4RPCA 1HM5A 2CGEA 4YAFA 3VAAA 2BBOA 3ETLA 4OMUA 3VI3B 2UXDB 4LDAA 4ZVSA 5F64A 5GVRA 2W6CX 2JB9A 3DO5A 1ZCAA 4ZDWA 1DEKA 2B0CA 3WISA 5CD9A 2JCYA 3KQTA 2UVPA 3WGGA 3PXBA 5FD8A 1POWA 4PY2A 5P8WA 3C7TA 3THSA 3JD0A 5JJIA 1BQEA 1RZUA 3HGQA 1JRLA 3LU1A 5A1TA 3GJRA 3SHVA 3C3JA 4DIOA 1VBKA 1WP9A 4MS3B 1UUFA 3JQBA 4DMCA 1HG1A 2YWHA 4XB6B 2JI4A 2YXNA 4CV1A 3M6WA 3I1JA 2CT8A 3DCNA 2WD7B 3G9QA 4MRMB 4TMXA 1I2MA 3EWSA 4AO7A 3TOXA 3KE8A 4B4WA 9ABPA 2H5JA 3AOEC 3VJLA 1VJTA 4LAFA 2W48A 3GAAA 4YRDA 3M70A 3U7QB 5JAUA 4Q24A 3W2IA 4PC6A 3EN0A 4HAUA 1Z28A 3OFNA 4HRYA 4EX6A 5CA1F 1QCZA 2JFOA 2OGZA 1LB1B 4NDZA 3SJBA 3VUEA 5GJCA 3IA2A 2V7GA 2ZJOA 1SY7A 1FU7A 4QTYA 1P73A 2AWOA 2YBDA 5JNVA 2QSJA 4KXWA 5E95A 4IZ6A 3ZDZB 2VH1A 4E3WA 3FFWA 4OXRA 5CFOA 1ODIA 2FDRA 1A5BB 3IQHX 2ODEA 5B3AA 1KA9H 1YUNA 2WJVA 1BCRB 16PKA 2R751 4M21A 4M8NE 5KREA 1C7IA 4MWOA 2BI8A 2VFAA 2ZCVA 1QR6A 2J1LA 3TAHA 1KHHA 4BVFA 1YB5A 4MS3A 3C0KA 5D87A 2OC9A 4LGVA 2YHBA 5ITSA 2FMKA 3HNOA 3O74A 2X40A 2B2XA 3HO1A 4M3NA 4Q0MA 4OL9A 3NWEA 1Y5MA 1NN3A 2WD7A 5DBHX 3DZHA 3F6RA 4CM8B 2ZYSA 1RDFA 1OWPA 4HGZA 1I6LA 3CLRD 1D4ZA 2RHHA 4N5DA 2CFSA 4HEA6 1GPH1 2W7TA 4WV3A 3SS9X 3Q3HA 1ILEA 4RF4A 1RYNA 3HMKA 1NE7A 4I5DA 3HFRA 4CPDA 5KHOC 1IZ7A 2FWAA 4K6OA 2ZUWA 5PGMA 1ECGA 3KAPA 1ZD5A 5IT0A 4LSZA 4MVJF 1KIMA 4L73A 2RGYA 3ABSB 4GVXA 1D4FA 3GEGA 3R44A 3U4MA 1UBHS 4X7BA 5ALDA 3TX2A 1P4JA 3KJFA 3EGVA 1EDDA 4JNKA 4M9ZA 1XTTA 1E0SA 4ZO7A 4EX7A 3D8NA 4P08A 3OX4A 5ESWA 4A0SA 1RKXA 2P41A 4KX5A 3S1LA 4TT8A 4DBLC 2FFJA 4DG8A 1JA1A 1YDMA 2EBWA 4ZWNA 4EO9A 1B6RA 2IT1A 3KAJA 4I4TF 4CCAA 3RTAA 1G60A 3DBIA 4WXYB 4O0LA 2JG3A 1R4NB 2F9LA 5I9TA 2W90A 3PQ6A 4R7TA 2W6ZA 3E9DA 4RFSB 1SQSA 4MWBA 1Z7GA 5D00A 2XMZA 4QBFA 3OOWA 4B9EA 5BNFA 2O8VA 3EEQA 3U60B 1Y3HA 3VPDA 3V6MA 3ASUA 1OBFO 5TS3A 2E1RA 2H0QA 4ROTA 3DW3X 3N0RA 3BH6A 1X8JA 2E4YA 4WSOA 3QLJA 2QTTA 3TDMA 2GA8A 2H3EA 4I14A 1HNXB 5FA6A 1CS0B 4QASA 1TPZA 3DHYA 1BXKA 5WRFA 1ZBQA 3DOUA 4L8LA 1PQYA 2BH2A 3EC2A 3GNQA 3EBOA 2XTZA 3PQDA 2ETXA 2TS1A 3AV0B 2YFQA 3SFZA 4E15A 2PYDA 2ZDHA 4IYJA 2RH5A 1KVTA 1S9DA 2EQBA 5DO9A 1QHGA 1ONSA 3UJAA 3BIWA 1E3TA 1NN1A 4LDZA 3TVDA 3TUZC 4OXKA 5CCEA 4NVRA 2A1TR 2BGUA 1RI5A 1XZCA 3G2LA 3S70A 2H08A 1CUVA 4H77A 3AONB 4ARSA 4BLUA 3AF0A 2BFBA 2Q27A 4R5MA 4HX2A 3H3FA 1J56A 1ZRSA 2BR3A 1KS2A 1R4NA 4GFDA 3JYOA 1IRIA 3Q9SA 4MYUA 5B37A 4OLBA 1ZM9A 1MN6A 1OY1A 3HBFA 2G72A 3SQXA 5B3KA 2A57A 1P2BA 5EZYF 5FFNA 3AUKA 1T4GA 5F7OA 1QQAA 1Z9BA 1M33A 4L9WA 1U8ZA 2NGRA 5DASA 2WWFA 3C7AA 3HVHA 5JATA 1LXCA 3LT4A 3KEGA 2EX4A 1R50A 2HF2A 5T6BA 5IJWA 1EHYA 1NVTA 2J09A 3AUJB 1WV1A 3HV0A 5A6SB 3BICA 1CS0A 3PXGA 3SIPA 3ZE8A 4AXXA 6PFKA 2V0CA 3G0BA 4Z4IA 4LTNA 1W85B 5HSGA 4D4HA 5HEKA 3LP6A 4PPNA 1EJ6A 4WKBA 3EOBI 3O3CA 1KPIA 3LWDA 4C6HA 4I1PA 3OZRA 2XMCA 3DDZX 3DL0A 5ARDA 2N1MA 4RK5A 4IXMA 3ZV3A 2BEWA 1E0JA 5J5CA 4ESOA 2IIPA 1TQ4A 4HLUC 2VJCA 3MA0A 4YCJA 4YECA 1DMSA 1YZQA 5C34B 4ND4A 3BE6A 1P6XA 3RVKA 3UHJA 2IITA 1JNYA 3QG1A 3TSYA 2C57A 5DNVA 4QDTA 2CFOA 5DNCA 3DFMA 3U3KA 5DJ5A 5EFZA 3NYIA 5FBVB 3GEHA 3EFHA 3PR2B 3GRUA 2FPWA 2R68A 1MA0A 3HUDA 3V4ZA 1KVUA 1JLLA 3R3ZA 2WV9A 4TWBA 1GZHB 1Z26A 4LHWA 4RIGA 3OWHA 4BYMA 4DJAA 4GOMD 4S05A 2YQZA 4LTDA 1YNOA 1E6KA 1Y1SA 1AXGA 5DBEX 3SJ7A 3T7RA 2QTVB 4FNOA 5C3MA 1M6WA 3D8RA 3H4TA 4HADA 1GZVA 8ADHA 3FDJA 3F0TA 3WLEA 4NL4H 4TL9A 1EM6A 1M6YA 1TZBA 1F2VA 3AEYA 2ZE7A 3H4MA 3W2HA 4BO4A 1T8TA 3CF2A 4RX1A 4YDQA 1I4TD 3FIJA 4QGBA 1G3RA 2KW5A 3COZA 1C0EA 5DM1A 3LPMA 4F5ZA 4KUEA 5JE8A 4HNAB 2P6PA 3L40A 2RHMA 2ZWPA 3KB8A 4UULA 3TRFA 4EG7A 1QJ4A 3ZNOA 3R20A 3TOSA 5FUBA 3PPWA 2R8OA 1VKJA 1EZ4A 1YA8A 4DQLA 2Z3WA 2FQXA 3CW8X 4CGYA 3T5PA 1OV4A 2I7XA 2X0IA 3AETB 4J7CA 4ZQCB 1F12A 3PFKA 1KVQA 4QX6A 4KXLA 1QYCA 1ZRNA 1HOXA 4KACA 1QFZA 2BCEA 2VQ6A 2ZSHA 4YCSA 1TOAA 4ZHSA 1LWNA 4MO2A 4WUVA 2GZSA 2YFHA 1QS0B 1USVA 3CLKA 4LIPD 4LYGA 1UFVA 3PVCA 4RK0A 3LBAA 4M0UA 4W9NC 2XGSA 1QOZA 1TGVA 3LP8A 4IMJB 1COWA 1RP7A 1E8NA 2B83A 2QTVA 2W4MA 3C4VA 4N40A 4N3AA 4QQKA 5SYNA 3T3HA 5HFNA 2AD1A 4CIWA 5GJBA 4MDEA 1OIVA 1FTSA 2Z2YA 3NALA 3RWMB 1E8MA 1B6TA 5DP1A 2ZYHA 3O8CA 3KYJB 5HF8A 1LRJA 2C8KA 4WKPA 4B17A 3UJNA 1XEWY 2F43B 4FN4A 1EUCA 3ZU6A 1Q0LA 3BX1A 2X4DA 5KTTA 3VR6H 1MKYA 2QI9F 5FBWB 4HNAA 2ZJ6A 1SXIA 4JUIA 4KN6A 3AR5A 5JOQA 1WY5A 4AJIA 3HLKA 1NUHA 1UZMA 4I6JA 5A6VA 5BVHA 3MOSA 1OREA 2JW5A 2Z95A 2O2GA 2I6QA 4PZ0A 4FI3C 1NTRA 3AETA 3WDMA 2ZTMA 3PD1A 1B26A 3DV0B 5HCUA 3NVDA 2B8NA 1E2EA 4XSGA 5JCOC 1IE3A 4FCVA 1FQOA 1JILA 2V7VA 4J2OA 5FRDA 4NAVA 1P39A 1KY2A 3OZ7A 3TLKA 3ZOZA 3PGKA 5AK5A 4CTJA 2XKKA 5CLIA 1NOIA 1DKNA 2VIIA 1IBKB 3HJHA 3S7ZA 3WIBA 1E59A 1QS0A 2NTEA 3D8SA 3L43A 4DR2B 3TX6A 1R6VA 1BE8A 2FLVA 4YR9A 3EZFA 5L6MB 1ITZA 3GD7A 3LZ6A 1ZUNB 2YY7A 1QXSA 3LDAA 4GO1A 3TR6A 4IF6A 3UCEA 3VYRB 3ZCXA 3TRKA 5J4HA 4E1VA 2CMHA 3G8BA 4R68A 5K99A 3N39C 2ISQA 2CUNA 3OBBA 4BEVA 1BDBA 1JJ7A 1LJLA 4BQSA 3CWQA 3DKRA 4DTCA 3TE7A 3S40A