1TRHA

Two conformational states of candida rugosa lipase
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two conformational states of Candida rugosa lipase.
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase(carboxylic esterase)
molecule keywords LIPASE
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1993-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trhA00
2BAGA 1W76A 4KJXA 1UOOA 3RARA 4FDMA 4KYVA 4QDZA 5FPPA 1YCDA 2O2IA 2QOEA 3A70A 4B0OA 1XRMA 1CUBA 3PF9A 3MGAA 4OB8A 4J0GA 5FUMA 1YASA 5ALNA 5K3CA 2HRQA 5JAOA 5EHQA 3FYUA 3DCNA 1XZAA 4X3CA 1FFDA 1CUEA 2JGJA 5AK6A 3I1YA 5K3EA 3WJ1A 5C81A 1EK1A 2J3DA 3DD5A 3QMVA 4BVLA 2XQJA 3H2HA 2CZQA 3GBSA 1B6GA 4MEBA 4HVTA 3GUUA 1N8SA 1ORWA 2Y1KA 3ANSA 4DNOA 1WB4A 3DYVA 4Y2TA 5ALYA 3C8HA 4H7DA 2PUHA 4KRXA 3AIKA 4XIIA 2D5LA 3R3UA 3OC0A 1A88A 5LIPA 4TVKA 2HA0A 3WMRA 3AJAA 4DNQA 1CUUA 4IH4A 1TAHA 2CEKA 4LHEA 3FWHA 1UK7A 4UHHA 4X94A 1HQDA 3QPDA 2BUBA 3ED1A 1U2EA 2BGRA 3EQ7A 1L7AA 3SWWA 5C8XA 5FKJA 3QPCA 4OYYA 5A2GA 2Z3ZA 3D2AA 3G0BA 1ZIYA 2ACKA 2VF2A 1OXMA 3DJYA 4G9EA 4C01A 3VDXA 1CUCA 2QXUA 4DMHA 5T4HA 1ZGBA 2ECFA 5A7FA 4Q3KA 1DT5A 3X3HA 2XUFA 4AMYA 5JAHA 5DYWA 4EHBA 5JALA 1EB8A 3V1LA 1IZ8A 2GBIA 2WHQA 2WU3A 3B12A 3O4JA 2W6CX 3CN7A 1ACLA 5ALOA 4KE6A 3LS2A 2WHPA 3M3DA 2XUDA 3I2FA 5IKXA 4Q05A 2PKYX 1UOPA 5T4FA 1XKTA 2WUEA 2V98A 3M81A 1L7QA 5ESRA 1FFAA 4ZV7A 2PU7A 5ALHA 1S8OA 4FNMA 4PNZA 4GBGA 5LZ5A 3D59A 1N5RA 3P2MA 2BJHA 1W75A 4QLAA 4Y2PA 1CPYA 1UK6A 2XMRA 5ALZA 1KU6A 2HA4A 5DTIA 4OCZA 4DYHA 4ARBA 4G8CA 1AZWA 2ONCA 2I3ZA 4E15A 4AN1A 1XRRA 4B85A 2VT7A 3SX4A 1E66A 1ZI9A 4DLNA 5K3FA 4RE5A 1XQXA 1GQRA 2H7XA 1ODCA 5AJHA 3IIIA 5SYMA 2WFMA 1TKRA 3FYUC 3LP5A 2BFNA 1AC5A 1THTA 1WCYA 3JYHA 4INZA 4HS9A 2WQZA 3WZLA 4DTCA 4YX9A 5LZ4A 1WB5A 4DM7A 4DIUA 2XLBA 1X2EA 1P0PA 1GT6A 4K5QA 1H2WA 1YSCA 1ZIXA 3V1KA 5LKRA 3AFIA 4N8SA 1U4NA 4QDUA 2WTMA 1P0IA 3F8SA 4BC1A 4QEKA 1MJ5A 1AURA 1BEEA 1GKKA 4I3FA 4CFSA 1WM1A 3ICWA 3G9ZA 4Y2UA 4KE8A 1DQZA 3WYNA 5FDFA 1TK3A 3C6BA 4MXDA 1EHYA 4UBNA 4P08A 3HZOA 4BCCA 3I28A 2OCLA 4Q3LA 3RLIA 1KEZA 3W05A 3WKBA 4F0JA 4E11A 2WJ4A 1XZHA 3R3YA 4X90A 4NS4A 4Y2YA 3WIBA 4Y2JA 3R40A 4B84A 4WFJA 4B0PA 1XKLA 1AUOA 3DKKA 4C4XA 4FFVA 4TPKA 1XZIA 5AK4A 3KWFA 4X6UA 2QM0A 5DWDA 1YB6A 4U2FA 3I2KA 1W6RA 1CUFA 2WTNA 5AI9A 2VAVA 1XZCA 1MX9A 1XZKA 3ZPXA 1ZD5A 2WFZA 1R50A 2E3JA 5AKKA 4UHCA 3PFBA 3WK5A 4ITVA 5AKJA 1DT3A 3K2IA 4LXIA 2PPLA 2ORYA 5E4TA 4Z49A 3QM1A 3I2GA 2OQIA 3U1TA 1WHSA 5AI6A 3W9UA 3A2MA 3RK4A 3WK4A 3HSSA 3CCCA 3NOXA 1WPRA 3JW8A 5YASA 1BRTA 3W9BA 3DYIA 3HEAA 4QA9A 1K6EA 4C88A 3PICA 1BCSA 2HA5A 1N5MA 2J4CA 1CLEA 1QZ3A 2RHWA 3NGMA 5LP1A 3M83A 4BB0A 1G66A 2GZRA 1XQWA 2PL5A 1TQHA 5JIBA 2VA9A 3K6KA 4H7EA 5HZGA 3WWOA 3T52A 4K2AA 4B82A 4EY4A 1E3QA 4W1RA 3FVRA 4IQ4A 1CVLA 3S2ZA 4EA6A 7YASA 4FKBA 5JZSA 3QMMA 4BAUA 1K63A 4HXFB 1D07A 4Y2SA 3WL5A 2WFLB 5AI8A 2DQZA 3WYDA 2JGKA 4I19A 1ZICA 3WWCA 1LBTA 2CBGA 4O08A 3H2KA 1EVEA 1ZJ4A 3R3WA 4KR0A 4H77A 4J0CA 4Y2RA 2V9ZA 1VXOA 1PJAA 1U8EA 5CBKA 2VEOA 5ALEA 5AP9A 3C6XA 4X85A 4UFOA 5ALSA 4L0CA 3N2ZB 3FCXA 1CUGA 4BCDA 2JGEA 3ZI7A 1YB7A 2PUJA 4UBJA 3O9MA 2B4KA 2XUGA 1H23A 3MVEA 1GXSA 4FOLA 2B9VA 5ALTA 5LZ9A 4HXEB 2NW6A 1HPLA 5A71A 2OCIA 1MO2A 2RIPA 4U2DA 2ZYHA 4WFIA 3I1IA 3G8YA 3C6YA 2RHTA 2JBWA 4XVCA 4P92A 3F98A 4DMFA 3KOOA 1XFDA 5AIAA 1MNQA 1BU8A 3E4DA 4K6HA 1QE3A 1YS1X 4JEIA 3QBJA 1FSSA 1HLGA 5AKLA 4UBOA 2EEPA 3VVLA 4DNPA 3WWDA 1QOZA 1R3DA 3ESCA 4IH9A 1BEZA 2HFKA 5HQ3B 2AJBA 3STTA 2DFPA 3IDAA 4H7IA 4H18A 2JGIA 4ZRDA 1ZI6A 2Y2UA 5AKEA 4ZI5A 3QYJA 3G0GA 5K5EA 3WLAA 3IA2A 4MWTA 1VOTA 4MJ3A 5CH3A 1GPLA 3ESAA 1SFRA 4LYDA 4J0KA 1XROA 3FSGD 3WWPA 1IUPA 4OUKX 4G1FA 4B9EA 4UHBA 4P93A 1ZD2P 5ALJA 3QH4A 3S8YA 1FFEA 1KU0A 5ALLA 2HA7A 5CH5A 3GA7A 5EIHA 4J3JA 4EY7A 3ILSA 3O9VA 3TJMA 3ZLTA 1DX4A 4JNCA 2FX5A 3PDCA 3WA7A 2DQYA 3FCYA 3R3XA 1W4LA 2XQIA 3STVA 2QRUA 2I78A 3E3AA 4ZWNA 1A7UA 2FJ0A 3AZQA 3D2CA 1CUSA 5AKGA 5T4EA 2RGUA 5HKBA 3H1BA 5CTAA 2BUCA 2O2HA 4BE9A 3WQHA 3BDIA 1K5PA 3DQZA 2ZYSA 5AM2A 2XMSA 1E8MA 1VKHA 2X76A 3B5EA 3UMJA 1CUJA 3T4UA 1AMNA 1VA4A 1RYYA 4Y2VA 2XQGA 5ALVA 3BWXA 4UFNA 3HI4A 1EX9A 5DNWA 1CR6A 3BXPA 2LIPA 2QS9A 3VVMA 4ARAA 5AI4A 5ALIA 3M82A 3FBWA 5FXMA 1R88A 3C6ZA 1QFMA 2ZSIA 1HL7A 1JU4A 3I6YA 2HA3A 3VISA 2QKYA 5JD4A 4M0FA 4OU5A 1ZI8A 4X6YA 1E8NA 1GPKA 4BTVA 2DHDA 4XX1A 3C5WP 4Q82A 2GYVA 3L1JA 4BVKA 3FAKA 4BP9A 1QTRA 4UPDA 3H2GA 4JH0A 1YA4A 5T4BA 4BE4A 1QIHA 2JGLA 2PU5A 4UHEA 1CRLA 3QVMA 3FVTA 2PM8A 1EK2A 3I2JA 3C87A 2JEZA 4GWLA 4AO8A 3IBTA 4KEAA 1VZ3A 4HXGA 1VE6A 1CUYA 4OB7A 4V2IA 4QWMA 2XUPA 1TIBA 3DOHA 3AINA 1Y37A 5D6OA 5K3AA 4UBIA 4Y7DA 3BL8A 5K3DA 1LZKA 4M0MA 5LZ7A 3PUIA 3H2IA 4S0XA 2WIFA 5K3BA 3DL7A 2O7VA 4E14A 4B6GA 2Q0XA 4A16A 1TCBA 5C7YA 5DTJA 1O6FA 4H7KA 3SK0A 4GEGA 1BCRA 1Y7IA 2CMFA 1IUNA 1Q83A 2PSEA 3I6MA 4QNNA 3W06A 2PSFA 3UUEA 2ZYRA 2QZPA 5JD5A 4EZIA 5ALRA 4F60A 4X71A 2XT0A 5CXUA 1J07A 1LNSA 4WDQA 3EIOA 5D3KA 3B3QA 4FLEA 1G4HA 2BCEA 1X70A 2VAXA 1Z68A 5BV7A 4W1QA 3FOBA 2WIGA 3O4GA 2D0DA 1CQWA 5E4JA 3FLAA 2ZSHA 3QZUA 5LLSA 5AI5A 2ACEA 5CT4A 3RM3A 2C0PA 5HFNA 2Z3WA 5ALXA 1ETHA 3G9TA 2J3QA 4DSZA 4BTLA 3KWJA 1EI9A 3G02A 4W9RA 3UUFA 3HXKA 5AKHA 3D5EA 4DSAA 1VA5A 1LPBB 3V1NA 1CEXA 5H3HA 2HU7A 3KD2A 4K6KA 4PO3X 3TEJA 3LIPA 3F67A 1LPMA 3EQ8A 3TGLA 5FRDA 1XZEA 3R0VA 2PX6A 4LKOA 2C7BA 3DS8A 5LZ2A 1EA5A 4D9JA 2VQ6A 3ZWQA 2HIHA 3L1HA 3HLKA 4GI1A 1EINA 5BWCA 4XJVA 3F96A 1XQYA 3EF3A 4KE9A 1SCKA 5HF6A 5KBYA 5AKXA 4CG3A 1QIKA 1J2EA 3WI7A 2W22A 1R9NA 5HCUA 4Y2XA 5IVIA 4LYEA 3BE8A 3PFCA 1WPXA 1XZDA 5AICA 2HL6A 3VJLA 4AN0A 4AZ0A 1LPAB 3FLBA 4C89A 5EHZA 3BF8A 3OM8A 1E8DA 3STWA 1C4XA 5CRIA 4QDXA 2QR5A 1LZLA 4L3WA 2JIDA 4BCBA 1UKAA 1USWA 2BKLA 1UK8A 4U2CA 2OCGA 3N0TA 4NMWA 3IUJA 1I6WA 1QO9A 1XZFA 5KREA 5CXXA 2WFLA 5AM3A 1MX5A 2V96A 2IIVA 1CQZA 1ZGCA 3D4LA 1F0PA 2ZVDA 4WDRA 2PSDA 3AIOA 4PW0A 1B41A 2QTBA 3L1IA 4GDMA 2DSNA 2I3DA 4FFWA 3WK9A 1AKNA 4MQLA 4WY8A 3BIXA 1F0NA 4X91A 2OXEA 5A7HA 5IH7A 4DMCA 5JATA 4CCWA 1X2BA 3ANTA 5JASA 3YASA 4OB6A 1BS9A 1LPSA 4KAJA 1UKBA 2OGSA 4G8DA 5HQ3A 1CUZA 5CMLA 1N1MA 2PVSA 2Z8ZA 4UBLA 1RWQA 2WIJA 2XUHA 4ZV9A 1T2NA 5HF5A 2CKMA 5EI5A 4BYMA 4CIBA 5FLKA 1SCIA 2PBLA 4A5SA 4PSDA 1CUVA 3OURA 3BIWA 5AKYA 6YASA 4IO0A 3VXKA 3FYUB 1VE7A 4G5XA 3WL8A 1Y7HA 2WU4A 2H7YA 5AM0A 4EB0A 4WCVA 5JAUA 1JMYA 4J0DA 4MEAA 1CUXA 3O95A 4QWWA 1TRHA 1XZJA 4FNGA 5I7UA 1UFOA 1SOMA 2O7RA 2JGFA 3IUNA 1SCQA 4AQDA 4L72A 3PUHA 2WUGA 5HK9A 1OCEA 1JI3A 3AZOA 3TRDA 3R41A 1MTZA 1LPPA 2HDWA 2WJ6A 3G7NA 1CFJA 5JAPA 4YK7A 1J06A 4EY6A 4OYLA 1K8QA 2OAGA 1QJ4A 1NX9A 3H1AA 2YXPX 3LCRA 3H19A 3HACA 4N8DA 2C58A 1K4YA 3C70A 2RAUA 2YYSA 1C7JA 4W1PA 3ZV7A 1L7RA 4AZ3A 4A23A 4C6HA 1GQSA 2OG1A 1DU4A 1QIMA 2QMQA 4IH1A 4LXGA 4CCYB 4WY5A 3IURA 3A2NA 3H17A 4AMZA 5FOQA 1QLWA 2XUKA 4RPCA 5AOCA 3W04A 1THGA 3OG9A 1R9MA 5D7BA 2OLEA 4FHZA 5ALDA 3WKEA 3MUNA 1W52X 2WILA 3NWOA 4G8BA 4KRYA 4X00A 3BDVA 4BRZA 1H2XA 1NU8A 4ZREA 5KWJA 2VT6A 3C5VA 1HKHA 3D7RA 1BROA 2J4FA 3GROA 3WKCA 5AOAA 2JEYA 3HABA 4JYPA 1XRLA 5EFZA 4FMPA 3WIOA 1QIJA 1XZLA 2QT9A 4AO6A 4PF1A 2DCMA 1CV2A 2RONA 1JFRA 1JMKC 1JU3A 5LKAA 2O2GA 5CT5A 1NU6A 2DHEA 4G4GA 2XUAA 1GPNA 1DWQA 4L9AA 4KAFA 4OU4A 2OCKA 3AUKA 5LZ8A 3STXA 2AJCA 3ZLUA 5CT8A 3WK6A 5JADA 2WG1A 4U2GA 1XZMA 1A8SA 2C0QA 4XWGA 3V1MA 4U2EA 2Z5GA 4KAAA 3DLTA 4IHAA 4ROTA 2Z8XA 1HDEA 3AILA 5HK8A 1JT2A 3O4HA 4Q34A 2HFJA 1M33A 4HAIA 5ALQA 2VATA 2WJ3A 3G0DA 1UXOA 4K6GA 4UBMA 4FBLA 4RNCA 3PI6A 5EHNA 2R11A 1LLFA 4X92A 4AX4A 3K9BA 1P0QA 1Q84A 1CUWA 3GELA 1FFCA 5DYYA 1ODTC 5FP0A 4QLOA 5DNUA 1QIFA 2ZYIA 1DQYA 3CCBA 4PV7A 5JZBA 2WIKA 4GLBA 1CUIA 1EDDA 4PQEA 2R8BA 5AO9A 1AX9A 2XQFA 4H7FA 3F9CA 2JGMA 1GKLA 4FLFA 2OQVA 5FPQA 4BVJA 3FNBA 1YAJA 3ICVA 4BDTA 1QGED 5EGNA 2Y2VA 4HTAA 1Q0ZA 4AO7A 3C8DA 3RKSA 1H2YA 2UZ0A 1WB6A 4BAGA 3FYTA 4B81A 4UFPA 4MYDA 5K3FB 1F8UA 3C45A 4X7BA 2HRRA 4UHFA 1JJBA 2VJBA 3DKRA 1JJFA 4BDSA 3O0DA 5DJ5A 1J1IA 5ALKA 4BZZA 5ISMA 3FLEA 3VKFA 2DHCA 5AHXA 2WUDA 3DNMA 3G0IA 3DEAA 4JYMA 3V48A 4KACA 5I8PA 1UWCA 2I03A 5IVHA 1AGYA 2XMDA 1HBJA 2HM7A 4RE6A 2B61A 1ORVA 2X5XA 4X93A 2HU5A 3DOIA 2XI4A 2CJPA 1XZGA 1LGYA 4UUQA 3STUA 1OILA 4MQMA 4U2BA 3AZPA 3STYA 4N5IX 2CUTA 5CT9A 5JYCA 4W1SA 5C8ZA 5CURA 2JF0A 2WIDA 2HA6A 1ISPA 2ZJ7A 1PFQA 3SC2A 5SYNA 3IUQA 4AB1A 3H0CA 5JD6A 2AJDA 2OGZA 3D2BA 4BC0A 4DMKA 4Y2QA 3WK7A 3Q0TA 1QIIA 5A7GA 5EIEA 4G4IA 1ODSA 5AH0A 5ALPA 1VLQA 1QIDA 5ALWA 5AKZA 1DWOA 3LIIA 5AI0A 1IMJA 3LLCA 3HC7A 4G4JA 3PF8A 4M0EA 3WA6A 4J7AA 1ZOIA 1E5TA 3F97A 4AXBA 1CUDA 2VJCA 2B20A 2XLCA 1UKCA 4OD0A 5J3JA 2QUBA 1JJIA 1MNAA 5HFAA 5AM5A 2XMCA 5JZ9A 4J0JA 4HRYA 4B9AA 1BN7A 3D3NA 3JWEA 4NZZA 3WJ2A 3DDUA 1FJ2A 2Y6UA 3H04A 4J0HA 3I2IA 4E46A 2PSJA 2XDWA 4H35A 4DGQA 4G9GA 3ESBA 1UT6A 3V9AA 1MX1A 2QVBA 2V97A 1XLWA 1H22A 1XRQA 1P0MA 4H7HA 2GYUA 4N5HX 3CXUA 5AOBA 2ROQA 1W1IA 3OPMA 4Q1VA 3H2JA 1CUAA 1EXWA 1O6GA 3I2HA 1UZAA 1JKMA 1YA8A 5C8VA 2FJPA 2WG0A 4F21A 1TCAA 4OPMA 1EVQA 5AK5A 3PE6A 1QO7A 3AIMA 1IZ7A 5A6VA 1IVYA 4QDTA 2WUFA 3WK8A 4MWSA 4BZWA 5BWBA 2XQKA 2HHAA 4LXHA 4JUIA 2HA2A 3OOSA 4HZGA 2VTVA 3H18A 3BF7A 3D0KA 4BBZA 4X6XA 4C4YA 3U0VA 1R1DA 3WWEA 5CW2A 1ZD4A 1PV1A 3VJMA 1A8UA 4PSUA 1A8QA 2EDAA 2VJDA 4GW3A 3FSGA 2ZJ6A 5EIAA 1XZBA 1DX6A 1UOQA 2WHPB 5BOVA 5E2IA 1QONA 1MAAA 2QXTA 2GBFA 5JARA 4WJLA 4YASA 4EUSA 1CUHA 2AJLI 2QJWA 3A2LA 4ZGBA 2WLSA 5AIBA 2WKWA 4EY8A 4TGLA 4CI9A 2WSLA 1R4ZA 3I6ZA 4BRSA 4BAZA 1VXRA 5AK3A 1XRPA 1MAHA 2YH2A 4X97A 5I9IA 4BATA 2EDCA 4NVRA 1UK9A 3QITA 3E1GA 4DNFA 2H1IA 1EDEA 2GBGA 4LIPD 2G5PA 4EBBA 2XUJA 3KSRA 1Q0RA 3C43A 3KXPA 1BN6A 3GZJA 1BE0A 4CG1A 5LYYA 2CB9A 3WL7A 3VJKA 3HJUA 2XE4A 1WHTA 2G4LA 3E0XA 1VZ2A 4FBMA 4CCYA 2HU8A 1EDBA 4KE7A 5AKIA 2WG2A 4F5ZA 2G63A 3ESDA 4ZXFA 2XUIA 1ZJ5A 1QFSA 3IVMA 5D3ZA 1H2ZA 4FLMA 5EHXA 2XUOA 2P8SA 2VJAA 5DLPA 1ACJA 3QPAA 1QIEA 2OAEA 5DYTA 2AJ8A 4QE3A 1FFBA 5ALGA 3EQ9A 3IUMA 2HADA 1MT3A 4PSCA 4J0IA 2G5TA 4B80A 1EH5A 2ZJFA 1MN6A 4FWBA 1IUOA 2FUKA 4CG2A 1YS2X 1DTEA 2VSQA 4GXNA 4OSEA 1YAHA 3W2TA 2AXEA 2DR0A 5KWIA 5HKAA 2WM2A 4MYSA 2C4HA 2BGNA 4HRXA 5AM1A 3WL6A 5CH8A 1YR2A 3G9UA 4BP8A 3BJRA 2GBCA 5IVDA 3WKAA 2C5FA 2X8BA 1U65A 3HYSA 4W63A 2H7CA 4N8EA 5F4ZA 3R3ZA 4J03A 3QMWA 1CIJA 1VJ5A 1XRNA 3DL4A 3HRHA 4B7ZA 1LPNA 2YASA 5ALUA 5ALMA 2XMZA 4GECA 1LPOA 4RGYA 2GZSA 2QUAA 3WZMA 5HF8A 4QZVA 5E4YA 1ZD3A 3Q8WA 4UBKA 1G5FA 3G0CA 1QTIA 4P9NA 5A62A 5CT6A 1RP1A 1SC9A 2XB6A 3WKDA 3EBLA 2H9YA 4YPVA 4UHDA 2Y6VA 5FV4A 2XMGA 4C87A 4B83A 3O4IA 1AQLA 1GZ7A 4WFKA 1DWPA 4I4CA 3R3VA 1G42A 2XMBA 4FTWA 3GFFA 2WHRA 2OPHA 1TCCA 1DINA 1F6WA 4QDOA 5ALFA 2RI6A 4X95A 4Q3OA 1MU0A 3ZLVA 5AM4A 1QIGA 3BJMA 2XUQA 4GHWA 1E89A 2QJRA 5JANA 1MPXA 2IX9A 1T4MA 3CN9A 3NUZA 1XQVA 4CIAA 5IVKA 2PSHA 3OTQA 3MUOA 2K2QB 4H0CA 3KDAA 2IITA 2XMQA 2BUAA 5DNVA 4EY5A 1EB9A 1XLVA 4C4ZA 3IB3A 2GYWA 3A6ZA 1GGVA 5HF9A 4H7JA 1C7IA 2OGTA 2ES4A 2C5GA 4Y9SA 4ETWA 1WOMA 3IULA 1LBSA 1XLUA 3G9XA
chains in the Genus database with same CATH superfamily
3FKJA 1JALA 2BAGA 2P7IA 3HLTA 3REGA 1PEAA 5G0VA 3WE7A 1UH5A 4C21A 1UOOA 3O8QA 4YV0A 3Q7PA 2BBOA 5JNSA 3HU1A 1S2LA 4MKZA 5DN9A 4B8YA 2Z4TA 4BO8A 2WICA 3DMDA 3OOJA 1U6KA 1NXWA 1DG3A 2IS6A 1BQ3A 1W87A 2V7QA 2QOEA 3THRA 1Y5LA 3ZIUA 4B0OA 3CKMA 5CITA 3MJHA 2DBRA 1XRMA 2Y92A 2ZITA 4K05A 4HLUA 4NYMQ 3K0SA 3NTUA 1HFKA 2B69A 3FJ1A 1CUBA 1VG9B 3HK2A 4B3GA 1KGDA 3FFWA 2AQ8A 1RMQA 2FN3A 2AOXA 4JT4A 1JXMA 3EVBA 1L4HA 3E53A 3KLOA 4I1PA 3PF9A 3PFGA 1SY7A 1UXIA 4HDOB 2NIPA 3OSUA 4B43A 5TEVA 4H7PA 1ONNA 4W8GA 2HRQA 2QMHA 5C5EA 1UEJA 4Q4HB 1LVHA 4WIAA 2QPLA 3SEAA 1N8KA 1YBVA 4LX0A 2JGDB 3BGWA 3WGNA 1GPDG 2CNOA 3BMNA 4BV2A 3MCUA 3ZS9A 5HG0A 1H2HA 3DOUA 3OCZA 2JGJA 4NCHA 3TM4A 4W5QA 3GEMA 5EIBD 2A9OA 3I1YA 1GCAA 4IOKA 5IFLA 1PK8A 3P9QA 3WOVA 4ED9A 4IQGA 5G0TA 5B53A 1YJBA 5ARDA 1IHPA 4ESOA 1T5LA 5CDUA 2IH2A 1XEAA 4NIMA 3IEPA 3VPAA 5KNCH 3P27A 2EX0A 3C7KA 1SXJB 3WLNA 3LSTA 3QMVA 3VR4A 2BHNA 3BGVA 3TS1A 3L0BA 2CZQA 1GTVA 1JQKA 1D1SA 4MEBA 4JCOA 2BI7A 4DCOA 4GPTA 4Z4HA 4Z4GA 3VDMA 2AUMA 3KWMA 4HK4A 1RW4A 5CJJA 5FUWA 2Q2QA 4KLNA 1NVMB 3VBCA 3D6NB 4LQ4A 2QL7A 5AVXA 3TN7A 1M6VB 2HOQA 3ANSA 3ETLA 3K5PA 1HDZA 2NU8A 4FINA 1NUHA 3SZUA 1WB4A 4MW5A 3LUCA 3W06A 3KE9A 3UY4A 2G1JA 3UJ6A 2W6QA 2R6DA 2YMPA 5ALYA 1L1RA 3P1JA 2XSZA 1KK1A 1YD7A 1YU6A 4CT5A 2EZ4A 3JWPA 4LOAA 2NT3A 2GBLA 5TPWA 8MHTA 2PUHA 1XP5A 4B6PA 9ABPA 2AI3A 2G08A 1EUDA 5GV8A 4A2CA 5KNDD 2R1TB 2ZSEA 3TZBA 2Q5OA 1NXTA 1NBMA 1JEYB 3FM9A 2P0AA 3EAFA 2CLIB 3P45A 4H08A 1JFFB 1ECGA 1NVVQ 4OHPA 4QQ8A 4TVKA 4NV0A 4EG7A 1WBBA 3DL0A 3OZ7A 1ZN9A 4DNQA 1V8PA 4W7HA 4OP1A 1HKUA 1TAHA 3FWHA 3TL2A 2AV6A 3V7NA 2V5AA 3JZIA 3FTDA 4LSWA 1XL0A 5TC4A 2ZXFA 1B0ZA 3OLVA 4XUGB 4EJ6A 4EJFA 1P2DA 5H68A 4E08A 2WJHA 4AZ0B 2BUBA 5KDDA 3QTLA 1SVMA 1USKA 4Y1EA 1VPDA 3X2FA 3O3OB 5I7AA 3WNQA 3U7JA 4M0LA 3CEMA 3JSXA 3IKLA 3IO3A 5C8XA 3MMPA 3L77A 3D2AA 4LHYA 3G0BA 2FX3A 4HNSA 1M9NA 1VBKA 1ZW6A 4E7OA 3L4KA 3WIVA 3K8YA 2ZP1A 4JR1A 2BHTA 4WECA 2VYFA 3V5NA 1Q0UA 2ZEJA 5COBA 2YXNA 2NXNA 1R8QA 4IICA 1S8AA 1Z06A 2XCUA 3FGOA 3VTAA 5EXDA 5IDQA 1NWHA 3DV2A 2AFIA 4F2HA 3EPHA 3FB4A 4R7TA 1Z26A 2LE0A 3AY3A 2YIDA 2EYUA 3D6MA 2C20A 1GRNA 2MINA 2Q5HA 4ZARA 1UBJS 3Q6NA 1U0EA 1DT5A 4J0QA 1E0AA 3PLAE 2A0XA 2JFFA 5TE9A 4AI6A 1ISMA 2QQGA 1K4KA 2OM2A 3WFIA 1KOJA 2ZAYA 2EWVA 4YRLA 2CKDA 1E2DA 3SS9X 5IJ0A 5GM1A 2A1TR 1KS2A 1RLTA 2RI0A 4KGXA 3I92A 4M8KA 5BNIA 2BFCB 5DO9A 3LBFA 2ZCJA 1V7CA 4XFJA 1BEUB 1DJLA 1CNFA 1H05A 1KGSA 2BDTA 2C9DA 2O48X 2OV1A 1EFHA 1XFAA 2XNHA 3W78A 1R37A 1MO6A 5IYZB 4EELA 1REQA 2ZRFA 1UAGA 4ZQEA 1I4OA 3CVVA 2PKXA 4RTMA 1LK7A 1YZNA 1MB4A 1ADJA 3GAZA 5KNLA 2PK3A 3QBEA 3UNXA 4ZKDA 3Q0IA 1ELOA 1ESNA 1KK3A 1K08A 1XELA 4GOOD 5ALOA 4JI6B 5G1OA 3ML1A 3WICA 4F6RA 2O2DA 3GT7A 4L74A 2DR2A 2WF6A 3ZE9A 5K7SA 1SUAA 1T9HA 1XMXA 1QKKA 1L4MA 1PYDA 1X77A 2Q2VA 3PDIB 1V9LA 5KWVA 1MLDA 1ZAYA 4MCJA 1WXFA 2J5RA 2W4QA 4ZAZA 1XN4A 2MMCA 3DE2X 1OVMA 1XKTA 4NH4A 3M81A 1JEOA 2HRBA 2ZRLA 2ZYWX 3O2SB 5E8JA 1TLLA 3K9NA 1UJBA 3NWJA 5LA6A 5L3ZA 2J48A 4BLVA 3OFND 1T1RA 4GBGA 5JH7A 2C3OA 5JYEA 3EQ6A 3N39C 1CS4C 3EFOB 1HO3A 5BNFA 3TLYA 3IAXA 2A0YA 4L2IA 5A9SA 2YZ2A 4WASA 3CR8A 3IHWA 2JBHA 4IY1A 2QN2A 1Z4LA 4ZPXA 3QSYA 3BWYA 3VZDA 2C82A 2Z1DA 1HXHA 1Z0UA 1XYVA 2AC7A 3GAAA 4NCXA 4QLAA 1IXZA 2C31A 2XMRA 3EW7A 5TMDA 3WO0A 2IS2A 3IOCA 4UHKA 2VWHA 4MV4A 4ZVTA 1Z2CA 2QB5A 1Y6ZA 3HP4A 4P33A 1NKSA 4OCZA 4DYHA 3F4KA 4FOOA 3LT0A 2JJYA 1L5ZA 4N3NA 3EUEA 5EZSA 1AZWA 2ONCA 3D1LA 3E8XA 4RVCA 4YJFB 3L6BA 4GMHA 4NCJA 4E15A 2B3TA 4AJ1A 2EL7A 4AQYB 1K7CA 1RRKA 1N0HA 3K4QA 1NE2A 1GPUA 3T3PB 3W8EA 1CJKC 5BRAA 4GKJB 2YTZA 2N1BA 3DVRX 2RHOA 1VJ1A 4C76A 4GICA 4EY3A 4LRSB 2D06A 1Z5NA 2HCTA 4I6JA 4Q4JB 1Z13A 3FYHA 3WFZA 4ARIA 2EJBA 3VZCA 4ROSA 1F51E 4TWBA 2QTRA 4NYIQ 3IVCA 3K6JA 5KX5F 3AUTA 4YMHA 2GN4A 4Q18A 1T9GR 3HKDA 3UJAA 3RAGA 1L5QA 1NQXA 5IP5A 3M4ZA 4LHSA 2XZOA 3S27A 1O5OA 5HJ5A 4FMBB 3V46A 2QAGA 3ORHA 1M6HA 1TZJA 1EP9A 4TT3A 3UK6A 1L1QA 3BL5A 3D6AA 3TKAA 1QQ7A 4D02A 3OQMA 3OPYA 3TH5A 4YX9A 3TZKA 1TYCA 3MYYA 1WB5A 1WRBA 2OD2A 1ADYA 3DE4X 4YJ3A 1KVUA 1NVBA 2HO4A 2JAHA 2OY0A 3HKEA 1NQAO 4DABA 4EYEA 1HFWA 4GC9A 1WOYA 3PGJA 5CP8A 4BVEA 4CL0A 4LWOA 4H16A 3E22A 1ECLA 1NLZA 4IDHA 1KNXA 2EF0A 4A36A 3DV9A 4LDRA 4P3XA 1XJWA 1RJFA 4GSKA 2B0JA 1ZIXA 1K6IA 3NFYA 2IEZA 1U4NA 4ZOBA 5GZ3A 1SIOA 2F3UA 4OAPA 5D5HA 3F8SA 2QN9A 5MF6A 4QEKA 4DCSA 4TTRA 1FUIA 4P82A 1F0YA 3KHUA 1II0A 5LQRA 2CB0A 1BEEA 3MSXA 4FQ8A 3CA8A 4JLPA 1U98A 4JENA 3AR4A 4HN2A 2W2KB 4URUR 3G9ZA 2D5CA 4MMYB 4L4YA 1L7OA 1F2TA 2FFJA 3MTGA 5K8JB 3W6UA 5LDDC 2P2ZA 3TG2A 1C7ZA 1D4FA 1WIWA 4CBVA 3ROKA 5JO0A 2AFRA 2WP0A 3FVQA 4KE8A 1DQZA 1YQ9A 1EU1A 3O8OA 3SJZA 4XH9B 1C1XA 3NBAA 2VTBB 5FJIA 4BFWA 1T35A 1L2TA 1W8IA 1F60A 2JJ1A 1EHYA 4MXDA 4TV8B 1D2GA 4FGSA 4G5YA 2LW7A 1VCIA 4YPFA 4Z3KA 1HGXA 1G2QA 1DXQA 1Y5IA 1ZH8A 3MTIA 4MDYA 2YMMA 4BU0A 4EEZA 2O8BB 2A78A 1W46A 3A3KA 1Y3HA 3W05A 2XDAA 2GPBA 5DMXA 1TA4A 5KVAA 3B36A 4MR9A 1WXIA 1F2DA 3WGJA 3WKBA 4E13A 3VR4H 1J8MF 4LOLA 2BF7A 1R18A 3B48A 1XE3A 1P1CA 2ATXA 4E11A 3UK1A 2HHCA 4F0JA 4YT8A 3R3YA 1FC0A 1SVNA 1P4JA 2QP4A 4MDHA 3KU1A 3HJBA 2BOVA 3P9PA 1LDYA 4PCAA 5DM70 4AKSA 1L1FA 2WZCA 4P4UA 3DUFA 4BVFA 1J97A 1C8BA 3CF2A 4XDGA 4DSNA 5BNTA 1N6RA 3FB1A 4IIXA 4CKEA 5HX7A 4RTSA 1AUOA 1SQ0A 2WKRA 3OY7A 4HG2A 4M36A 5F52A 1XD9A 4JWTA 2FMFA 5K01A 4WGGA 1ZRMA 3DDSA 3O7MA 5CX1B 5EWMB 1XZIA 3A06A 3HP7A 5BN5A 3ZGYA 5BVGA 2VNSA 1HNWB 5BYBA 5E0OA 2WF7A 4IEFB 3FFAA 4C4PA 2P35A 4G6ZA 1QV7A 4JYCA 4ZVKA 1CJBA 2HJRA 2NYRA 5DWDA 1D6MA 1W29A 3NHAA 2GN9A 4JQOA 1EFVA 2QD2A 4J2TA 1TFUA 1NW5A 2FSIA 1W6RA 2HMWA 3H4VA 1CUFA 1O94C 4TMWA 1US8B 3DOFA 1XZCA 4IDEA 3KCNA 1XZKA 1CY8A 2Y1CA 3CWQA 3ZPXA 4FFSA 1JG3A 1EWRA 4KMOA 1N77A 2C78A 4E1VA 2SHKA 3GLRA 3HG7A 2Z1NA 3NKFA 1NNSA 2ZDHA 3LK7A 5JSKA 5CYOA 5AKKA 4JP2A 1JWBB 4JYAB 3GK3A 3GLKA 5BUCA 3IMGA 2Q46A 3TW0A 1T9KA 3IAFA 3W79A 1JDBC 1HY3A 2ZG6A 4MHOA 4ONEA 4EJSB 4MVJP 4FX2A 2OFWA 4ITVA 3ZWVA 3DWGA 1MDFA 3WAGA 5E0KB 2F1OA 3SSAA 2CDAA 4OHBA 3K2IA 5DYIA 4ZU3A 2BRUC 3DPSA 4LXIA 5KO2A 1D5WA 3L40A 1SUFA 5E4TA 4ZVNA 3GC6A 1ADGA 3KKKA 3HHEA 4DJAA 4AJLA 3KVOA 1WCXA 4YHBA 4LCBA 4KREA 1N78A 4DDMA 1K4MA 3WB0A 4EF4A 4TWIA 1IWBB 1WW2A 1IN4A 3L6RA 3Q12A 4IP0A 2P2NA 3KUKA 4QTTB 5A2QA 4NMHA 4ZEVA 2DPMA 3TYXA 1J09A 1KJQA 3X44A 2V03A 2BEWA 4WXHA 2CV0A 1YDGA 5GV7A 4NZPA 3RNLA 1P9WA 1K5DA 3S8EA 1I7LA 1UPUA 4FFRA 1SXQA 2BFFB 2C98A 4FEAA 1NA5A 2QPAA 4CCAA 2JAXA 3G5TA 4C88A 3DYBA 2IOFA 3MTAA 4MP3A 4TYPA 2ZUCA 4DHEA 1NLUA 4P2GA 5G02A 3ZLBA 1JWAB 3KOXA 3KKLA 1CLEA 3ONEA 1QZ3A 2D8AA 5HOQA 4EUEA 3VTZA 3WS7A 2FZCA 3N6XA 1G66A 2GZRA 4QRIA 2GHTA 4DANA 2B9EA 2EAUA 2BFOA 1ES9A 5DT2A 4EYGA 4RJTA 2A1UA 4OKNA 4LYGA 3ZV6A 2FFAA 3GJ3A 1T5HX 3L5KA 4HQRA 3AM3A 3AJEA 2G04A 4Q93A 5JIBA 4RTRA 3K6KA 3VKGA 2LRHA 5DP2A 3WWOA 4TYYA 2ZI5A 3T52A 4IDDA 4EY4A 3JQBC 1MJGM 2QEQA 3OEYA 4W1RA 5FWDA 3EXHB 5KCZA 1M0TA 2B7CA 1WF6A 2PZKA 4OBEA 1QDEA 4NAVA 2VTDA 3QMMA 3AJRA 1E4EA 3PKIA 3GLIE 3BYZA 1CKEA 5LYJA 3TWOA 1B8NA 3QVLA 4MA0A 1PV4A 4DLZA 1DC6A 1OE0A 3I32A 1OWNA 2ZBEA 4ZZ0A 4G0NA 3WYDA 3QYAA 2A88A 1THMA 2HF9A 4IDBA 1LBTA 4MK4A 4YRPA 2EFYA 1VYTA 1ZOOA 1EWYA 1SK8A 1ZGZA 4JJFA 4PLYA 3RVQA 4CQMB 1TTQB 2P5UA 2X1HA 3ORYA 3DH0A 4JQCA 4KV7A 2JLXA 1U3CA 1VXOA 5HCIA 1XX6A 5EP1A 2O8DB 1TU3A 5BSFA 2ZE5A 5AQEA 3UF0A 5EOVA 1LQUA 1U8EA 2XQVA 4MV3A 2XMPA 3ST7A 4Z7JA 5CBKA 5HKKA 3PX2A 2VEOA 4I4NA 2PMWB 2BGKA 2QTHA 4WNAB 1OREA 1VDMA 1W5TA 3EXHC 5IFKA 5DRTA 1Y7LA 3EXAA 3IPXA 2FPGA 3EEFA 3F5MA 4QREA 3QRWA 5KOJB 3B9PA 1GFZA 2FI1A 3G2KA 2V7VA 5AP9A 4I9FA 5ESXA 1IUKA 1E6EA 2XYQA 4IIUA 2G9RA 2DETA 3NHJA 4LJLA 4RK5A 2MSLA 3IAS6 4OHFA 4UNQA 5B1SA 3V8PA 4J07A 4RV9A 5CB4F 1E3JA 1HTWA 1XU4A 1DV2A 2COEA 1YI1A 1TM2A 4WVLA 2DXIA 4G23A 1FY2A 1MJGA 3HCFA 2FSHA 4YJHA 3K09C 4HYQA 3FCXA 3CZAA 2F1IA 4JAVC 2GH1A 3GVIA 3LY9A 3ZC3A 3PXDA 4HL6A 3VZSA 4UBJA 2PUJA 3W3ZB 4DYVA 2XUGA 4MRVA 4EI7A 2JJ1D 1KAGA 1H23A 3BE5A 3GCXA 4GNRA 4HNAA 4ZA2A 4HQ6A 3SFTA 1UMBB 3RYFA 5KYNA 3MVEA 2HWUA 3G2PA 2MSCB 1E3TA 4FOLA 2NTVA 3OEHA 3VKVA 2X42A 2HNBA 2Z3VA 3Q8MA 3ZNNA 5F7OA 1HPLA 1Z83A 3JZFA 4S2UA 3LC0A 1BKYA 3CPJB 3C41J 2DE0X 3MINB 5B58C 2HMAA 2QUHA 2FDCA 1ZGHA 2JRLA 3KT6A 1O08A 1GJRA 2XEXA 4H3SA 5C4GB 4WFIA 1T9BA 1WS6A 3SBOA 3PIDA 1B0AA 3I1IA 3OLWA 2R8RA 3CX6A 2IYQA 3EGXB 4FYMA 3ELYA 4H4DA 1OFGA 4I1OA 1QC5A 2O0KA 2Z5FA 3RYHA 1RWXA 5HBRA 3SCZA 1DBPA 4RD0A 1E3SA 2OP0A 1C0KA 1MOSA 4WCFC 3OICA 5ERYA 1V45E 4KIWA 4DMUB 5JDIA 2FW0A 3EOZA 3O3CA 5FWYA 1JDBB 2ZI6A 2ZRJA 4DMFA 1AQIA 2B3DA 2C8VA 1T10A 3PU6A 3NGLA 4HO1X 1U3TA 3FI9A 5KQRA 3MGBA 2VP3A 5GM2A 3VI4B 2HHHB 4OATA 1KH2A 4IUYA 4ILEA 4Y2HA 3W5IA 1XXHA 4ZC8A 3EZ2A 3KZOA 3MBIA 4ZO7A 3EEBA 2FW6A 3EB9A 2UAGA 1KE1A 1QE3A 1G8HA 1YS1X 2A5FA 4PSKA 3QF7A 2WJPA 5CNKA 2ZCVA 1HLGA 3O03A 4EHDA 4MQFB 2ZS7A 4TUYB 3VVCA 4UBOA 1IU9A 1R6BX 3CSSA 1BX0A 5H4HA 4ZQHA 3UH0A 4DNPA 2G1PA 1GZVA 1WQ4A 1TM3E 4R8KA 3WV4A 2QTMA 1QOZA 1ZW1A 1R3DA 4GR5A 1DQNA 1GRVA 1ZXXA 2WF8A 4IH9A 3EFHA 5J23A 3OZWA 4BTEA 1V3VA 2JCYA 1SQGA 2G0NA 2DFPA 2IPXA 2VN8A 4NCIA 4QDKA 5TPWB 1AG9A 2FYTA 4FGZA 1RM4A 1LI5A 3BAFA 2CGEA 1SCUA 4H7IA 1JILA 4HEJA 4CTOA 2WTXA 2IEBA 3FBGA 4I9NA 2M9MA 4X45A 4D8VA 4R6WA 3PG5A 4KKVA 2EFCB 4UD6A 2CHVA 1WXEA 1L5SA 3TEFA 2Y2UA 5AHWA 4DDKA 1OH8A 1D1TA 4HH0A 1H4TA 3DBHA 3QVXA 3VNUA 2BGMA 1BS1A 1Q3KA 1YB5A 4G63A 1JHAA 2PX3A 1UJ2A 4P36A 3PYLA 1D0VA 4HAVA 4LTNA 4RK6A 5HA5A 3WYAA 5C3MA 5HTOA 2G9QA 1EUYA 2P4UA 1NT2A 2B1JA 4CQJA 4EHAA 1SFRA 3WGTA 1WQ3A 1K6MA 3QJ5A 4ZCQA 2FRDC 1E4OA 1DAPA 2BISA 1UDBA 1C8VB 4OUKX 4QPCA 1EFAA 1XU7A 3RVKA 1YKFA 2NYVA 4C3UA 1QQ5A 4EARA 4CKZA 1Y4AE 3OIGA 2Z09A 3CB2A 1T3GA 4JJ7A 5P21A 2QWXA 4MR8B 2I6TA 1ZD2P 3E5MA 4D81A 2QN1A 3F6CA 3LW8A 3SBDA 1UF9A 4HWPA 1QMGA 4FHGA 4OHZA 1KO1A 3S8YA 2FCRA 4KRFA 2Q1TA 1WZCA 3OPXA 5ED0A 2G4VA 3WBKA 2HCBA 3O75A 2C4WA 2XVXA 1CB7A 3RVBA 1IY2A 4H1UA 4H1TA 1ZU5A 4KW7A 1XMIA 2DECA 3CU5A 5J2TF 4O8CA 5ALLA 2GPYA 2OCXA 3HPRA 3P2KA 5TQJA 3RV4A 3PQ5A 3WBJA 2IZZA 2WR8A 3W4IA 4CM4B 4G85A 4WOCA 2DFNA 2I8AA 3MOGA 5EKSA 3UV3A 4DBVO 4EY7A 1ZKMA 3TJMA 3OOWA 4K9LA 4TXMA 3PFFA 1Y6RA 4R2IA 4ZCTA 4S04A 1KI2A 4H6WA 2AW3A 2ODEA 4R9RA 5IAKA 1MIOB 4JZKA 4RZQA 3VRHA 5K20A 4EFLA 1OTXA 1CJSA 5AW1A 5LU8A 3O1LA 3D4IA 1P7WA 3BFXA 3PQDA 3E3AA 4ZI3A 2YN4A 5IT0A 5GZ1A 2WJAA 4ALIA 4TXHA 2Z2KA 3A6PC 2FJ0A 4NYMR 3PC8C 4DB2A 3JR3A 5J2UF 1M6NA 4GX2A 3RJMA 1C3XA 1RQGA 3ONVA 3P7MA 3FPSA 4J7XA 4AJOA 1E1MA 1TCVA 4JSYA 4EATA 5KDOA 1SPXA 4WH0A 5DOZA 4LKRA 2V1UA 3WQHA 1JYSA 1L5RA 1V4NA 2ZYSA 3I8XA 4AZ3B 1I8TA 1SHLA 1H9CA 4UJ5A 3AB3A 5E7QA 2WA1A 2XCOA 3GL9A 3L7LA 4KXNA 5HE9A 2WRZA 3B5EA 1IAQA 5T64A 3HN7A 4ZOAA 4EBFA 4D3YA 5I7EA 3H5AA 3AF5A 1VL1A 4WBNB 3W2HA 3MM4A 1AMNA 3O4RA 1G4UR 1KFCB 3U5TA 1SXJC 3CZ9A 4P31A 3VMMA 3L1UA 4R2MA 4IRXA 1IYZA 2PJDA 2PQMA 1E79A 5ER6A 2TMKA 1T9GS 3RANA 4DVJA 1YS9A 4RL4A 4UFNA 1BH6A 3HI4A 3KYIB 4L4XA 2Y4NA 1SOVA 5DNWA 1ZNZA 3VMFA 4B3BA 2H1HA 8ATCA 3C14C 4ND4A 5E7JA 3EFOA 3BWVA 3BHJA 4IRUB 4N3GA 4JU8A 1GXSB 2K7FA 2YRFA 4QOFA 2Y3IA 4K6FA 3B1YA 4U3JA 2A0WA 4MQ6A 1E1KA 3DZKA 2OXTA 1GLGA 3PLRA 1G55A 1JIVA 3BMOA 1O6CA 2A5LA 3M82A 3Q5GA 1AJEA 1R88A 3QUAA 2GRUA 3C6ZA 4OKSA 1BD3A 1OXXK 3TINA 2AR7A 3TLJA 4OI1A 3HJRA 1IY9A 2JCVA 3KJEA 3KPVA 5ELLA 4M6WB 3VYRB 3PNQA 2AXPA 2EGUA 2OBNA 1E58A 1PFVA 3AFMA 1L5GB 5J58A 5IH3A 4P80A 5CNIA 3NEJA 3OE1A 2NSLA 4FCVA 2CJWA 2TSYB 4GBMA 1JAIA 4QPJC 4KGVA 4XIJA 1QSGA 4I5GA 4JVNA 4FIZA 1E2LA 1GKYA 2QKYA 4KXLA 4AS3A 5KNDH 1KI7A 3S2YA 4BX8A 1H6AA 4MWOA 4C78A 1Z5ZA 1X7XA 2Y0DA 3QFHA 4JJ4A 4I5EA 1E0JA 4LZPA 1MH9A 1RMTA 2WD9A 2P5TB 1V71A 4XX1A 1QYDA 4ABYA 1PZXA 2AG5A 2J6BA 2QRKA 1HYGA 4W9NC 1N7JA 1V95A 3IPYA 5EXPA 1LI4A 2ZZKA 3S1AB 5CDYA 2GFQA 4JVLA 4R0NA 1XDZA 2POCA 4PLVA 1YH3A 4C6TA 1KH3A 3TTYA 4WKBA 4DSUA 4AQ7A 2XNDD 4F4DA 1W4CA 4WBSA 3SQNA 2FWJA 3CT6A 2CVOA 2DFDA 4NDNE 4UPDA 3JVUA 2O8EA 5T4BA 2WVGA 3ZWBA 2JGLA 1GRQA 4AKHA 1YT5A 1XL1A 4M89A 4BLOA 4X64B 2PU5A 2O7NA 4ERNA 3P9XA 1EHIA 1G1MA 1DDIA 1X1SA 2W6JD 2PM8A 3OT5A 1F8YA 3LQ4A 3WQQA 2R1ZA 1XTQA 3SR0A 4DCTA 1CZNA 4RULA 2PIDA 1N0VC 1G17A 2NXCA 1TYBE 2WAYA 3CZMA 2NZXA 1LJUA 1RLIA 1V8DA 2FQXA 5JECA 3FMIA 4TXJA 4FDAA 1DEXA 1W94A 3QW2A 4G0PA 4KEAA 4E5KA 5D84A 3CLUC 1WPQA 4K46A 3WQBA 2WJYA 2Q5EA 5CA0B 2ON6A 3ZR4B 3ZJ5A 1X1TA 5KSZA 2BM9A 2FF5A 3F7MA 2WZBA 3DOHA 1SZJG 1LA2A 1Y37A 4TT3D 1EXVA 4MB6A 3WYFA 4P5EA 5JG7A 1EVJA 3GLVA 4OOEA 1VKJA 1N1DA 1C3VA 1OXTA 1K66A 2GNPA 2ZYGA 2CZCA 3JD0A 4W6QA 5A0FA 2J1LA 4DV7B 3JZDA 2W6MA 3A9RA 2OXCA 3PIIA 3IBFA 1LZKA 1FUYB 2ZBQA 3NASA 1PHRA 5LZ7A 1IN7A 3N2IA 3UMMA 4CKBB 2OCDA 4CM3A 2BZ1A 2WVAA 1F5SA 2QAGB 2IY7A 2WIFA 5JAMA 3V97A 2CDCA 1T5OA 3EAQA 3JWIA 3L4BC 3BMNB 3RSZA 4BE7B 3CR7A 1KDZA 1K5HA 2X0NA 3HDVA 2O7VA 3OZAA 1X8LA 3OPYB 5BW8A 5CLFA 1Z7BA 3LT5A 3WRVA 4V0MA 4I5FA 4LE2A 4M46A 4M1WA 4BNLA 3IQEA 1GCIA 1GUBA 3GNLA 3NLLA 4WN3A 1GWNA 5KKNB 3PNBA 1KWGA 4OHUA 4EKEA 2IRWA 1SKQA 1R27A 4QX6A 5JE8A 1FX1A 5AYVA 1KI1A 2VUHB 1I01A 1Q7TA 3WB1A 1PDWA 3R0ZA 4GEGA 4DLPA 5KQMA 2KM1A 4P3KA 4PZZA 4JXKA 4N82A 1PQPA 3W4KA 5HIIA 4NKRA 4G4SO 2CMFA 1IUNA 3L6CA 4KDEA 4N9WA 3I83A 1Q7BA 3W2FA 2QSYA 2NTYC 5SY6A 2N3ZA 4F86A 4ARCA 4NE7A 1NN1A 2BDEA 4HGRA 5TT1A 1U02A 1Q1GA 3QPUA 4QNNA 3TSOA 2QJFA 4Z4CA 5LBUA 1B73A 2W6ZA 2PSFA 4OAOA 4DRXB 3GLFA 2HC9A 2GFIA 1Z47A 5ALRA 3IHKA 3LQQA 1FPQA 3MS2A 2BFBB 4FMCF 4FOTA 1XZQA 4OFBA 4W7IA 1CY7A 3TO5A 2XT0A 3BSFA 5CXUA 2ZZMA 1E1LA 4F06A 4EHNA 5BSGA 4FVTA 3EIOA 2KBFA 1NR1A 5I01A 2GHRA 4FLEA 1JRLA 4PGAA 1JEQB 1G4HA 1HQCA 1EJBA 1ML4A 4H3HB 6LDHA 4NU0A 3ZQKA 4JBLA 3FOWA 4MS4B 1G5RA 4ARZA 3ORSA 2BZGA 1GQYA 2Z5VA 3LLVA 2HLDA 4BV9A 2IUYA 2WIGA 3O4GA 1RLUA 2IEAA 3GHYA 2RBGA 4OO3A 5E4JA 3K15A 4OQ4A 5T8KC 4RESA 3PEWA 3HO1A 2C5AA 1XDUA 1FDTA 3QZUA 2C2XA 1KPHA 4HNGA 1U6IA 2AD1A 1ZAKA 2H17A 3MS4A 2ACEA 2C61A 4BNGA 1NT4A 1E79D 3FIUA 2C0PA 2YN0A 4PPFA 4NABA 3IQHX 2D59A 5IDYA 2GDJA 1DEKA 2H1FA 1U0FA 3A1TA 1EAYA 1H1LB 4W5OA 2C2KA 4XD2A 2KB0A 1UQUA 2OENG 1QBKC 3MNFA 3RRMA 2ECKA 3RG8A 3D64A 3LOPA 5BPHA 4D96A 2PUAA 4RC9A 1UC4B 5DBEX 4LYYA 4UOQA 3DZCA 4NYJQ 4L0QA 1AKRA 1TOAA 4OI4A 5HM8A 4BQIA 3HMKA 1KI6A 4D25A 5DU2A 3HXKA 4GVLA 2W9XA 4HWSA 3D5EA 3FVWA 4OQNA 4M53A 5CJ2A 5AW6A 2TS1A 1HDOA 2WZDA 5AXAA 1CC1S 1LPBB 2GAAA 3GP3A 3PPWA 4YA6A 5EE1A 4I1IA 5IJAA 2PMEA 1H2FA 4A73A 4IGFA 1XCOA 4AU1A 1BMDA 4HTFB 4U7HA 4BNMA 2HU7A 5GGYA 5HP4A 3EXEA 4DM7A 3N05A 4QGFA 4I14A 2EC5A 4HAUA 3SMQA 1CR2A 3KG2A 3TEJA 2CLCX 4RTOA 2NSJA 1RRCA 1M6EX 2EJWA 5K0GA 3MTBA 3OKCA 4ND2A 5FRDA 3OZEA 2PX6A 4B4VA 3R0QA 5JAIA 2IEGA 4UCQA 4EITA 1N5IA 2YNMD 3K70B 1R6TA 4Z9YA 1V1MB 2QY9A 1EA5A 1RXCA 3VKUA 1PX2A 4AECA 3UENA 2GUWA 3ABRB 2GEDA 2ZS8A 5K4AA 3D4BA 5JRDS 1DFIA 2W2KA 2RJNA 4KFUA 4EJSA 1JQ5A 1K1EA 3BTUA 3NG1A 1EINA 1N8TA 4EYQA 5E6SA 1YHZA 3A9CA 3SSMA 5IKPA 3ZDAA 3EGXA 5E2BA 1Z8HA 4BFXA 1Z2DA 3PD7A 3B85A 1BAPA 3Q1KA 1I3NA 2IC5A 3R09A 4FOSA 4B5KA 3GT0A 2Q5JA 4RFSB 1D9XA 2Q29A 3L0ZA 4GRDA 4XX0B 1OXVA 5HF6A 2JKYA 1XMSA 2JIPA 2PUVA 4EVIA 1OFIA 1T43A 3NIGB 4TMZA 5J4LA 2EARA 4C06A 5I9NA 2YYAA 1VSTA 4IG9A 1UFRA 3PNSA 5FPYA 3FUTA 3KL4A 2O3UA 1EX1A 2IZ5A 2W22A 5IVIA 3DJFA 1QG2A 2SICE 2CXQA 4II3A 1JZSA 4C4AA 2PO7A 1IZZA 1FNSA 1PG5A 3K92A 2EP7A 2LIVA 3PFCA 4G07A 1FRNA 4XJXA 2NWQA 2QI9F 4WNYA 1XMJA 4QC2A 4ZEXA 1P5RA 2WY2D 4AN0A 1HLFA 2WZQA 4C03A 5EHZA 5T7BA 1CY6A 1CZRA 2YY6A 2CNBA 2HHJA 3FPLA 4YO7A 3UW1A 1E1NA 1DJMA 5EJAA 1X7WA 4RPJA 1DOZA 3BWCA 4IQ0A 3BF8A 2EKBA 3GEEA 3EOBI 3NOOA 3OM8A 4DCPA 2CXTA 2QDXA 1IWPB 4KV9A 2IWHA 3UAXA 1Z0DA 1E8DA 1YZLA 4ZP1A 1N2OA 2A1UB 4X9XA 1C4XA 3CONA 4WOBA 4TRMA 4V0ME 1U2QA 2YV3A 4M7WA 2RKOA 1LZLA 4JLOA 1D1QA 5GAJA 3VJRA 1RU3A 2BBWA 3D3QA 2WYWA 3MJRA 4BCBA 2G9NA 2YXDA 4U0KA 4CR6A 2AH5A 4F2PA 3VZQA 2NZJA 3IP1A 2V7XA 4CTKA 4L4UA 4GD3Q 3OM9A 4NESA 4NX2A 4FD2A 2V8BA 1Y8ZA 4CWAA 1NL3A 2X4LA 4OI2A 4M99A 2Q8NA 3SM3A 1TU4A 3DULA 4BLTA 3HBNA 1FVXA 3MGCA 1XALA 4R2XA 4JL5A 2GI4A 4GUDA 5D5QA 5HWSA 2IYYA 4DV6B 1UMCB 2FP4B 3KEQA 3CNHA 3QP9A 1VKOA 3UN1A 5MN6A 1KJ9A 4NBSA 3EZLA 4ER5A 2FQWA 3CUTA 1MX5A 4L4RA 3TNDA 1ZJZA 1BCRB 1NWCA 1OJLA 1DBWA 1CQZA 1U3DA 2X15A 3G17A 3OKPA 3TXYA 1Q0SA 3D4LA 3LRXA 5TQ0B 4DA6A 1F0PA 1WMAA 2BVNA 2FDRA 2ZXEA 3AR8A 3CLTD 3HI6A 1R0XA 2J9YB 4WCFA 3IEUA 4PW0A 3QIVA 3D9QX 4R8SA 2J5KA 2UZ1B 5EY5B 1O9GA 1FTWA 1YZHA 3A27A 4C20A 1DAGA 4GDMA 4WLEA 2PKQP 3LO8A 3P20A 4KKXB 1KMHA 2HIGA 3RABA 1X1EA 1PVVA 1Z4MA 1TC2A 3CRRA 3D4OA 5AVWA 3CWZA 5JPDA 1KVSA 3WK9A 2C9YA 4OH1A 4EEKA 2P2LA 3H8JA 1F0NA 1Q50A 3QVWA 1R4NA 2D2IA 1BJKA 2W7TA 3TBKA 4D0LB 3U6KA 3JQPA 1MABA 1XHLA 3HKEB 3U0BA 3ABQB 5ICEA 1X1AA 1UZNA 4FYXA 1VKNA 4PPGA 1NMYA 5IH7A 5F1OA 5JATA 4XGNA 1E2HA 1X2BA 4I08A 4KR9A 4JMLA 1CRZA 4OB6A 1E59A 2AN4A 1HRKA 2QTVB 4LJKA 2HLDD 1S6YA 1UKBA 3IR5A 3OQJA 4YONB 1I7SB 4OBXA 3L6OO 4ZMSA 5LP6C 2UYCA 4KSYA 5DT9A 2BP7B 4R1OA 1M34B 1P33A 1S2OA 3E7XA 3E9NA 1TUGA 5CMLA 3UMGA 4PHCA 1N1MA 4C1NA 3RNOA 4DB4A 3NM5A 2Z8ZA 4LRQA 1M2WA 1KP2A 3M4NA 5CVEA 4UEJA 1CJCA 1KSGA 3TTSA 4ZI7A 1TVMA 2WT4A 3VU0A 2BC9A 1OAAA 2RSLA 1LUAA 3H2YA 1JQLB 1BFDA 1QTQA 5EJ9A 3LI2A 1QHNA 1NXSA 4OQYA 4AICA 1A5SB 4C0WA 1BXRA 1VMIA 2PKWA 2ZRAA 2W0SA 2FR8A 1QDLB 5BT9A 2OFFA 2EXXA 3ZHSA 1Z7YA 2C7VA 4TTQA 2JGRA 2WK1A 3T3IA 4C6RA 4PYMA 1GL9B 5FR1A 2HJHA 1EA7A 1SCIA 4BKUA 3LP6A 3NRBA 1VC2A 1BFUA 2AFIE 4KU4A 1GNPA 2P0YA 3ZU5A 4COKA 1SVKA 1XXHB 2PZFA 1CUVA 3MGKA 3KKEA 4RGQA 4BFUA 3CGWA 1YI0A 2I2AA 1IHXA 1A04A 1EXNA 3CNLA 3HCDA 3KB1A 4NE9A 5L7YA 2QTWB 4HVTA 4QRDA 1GN9A 1AB6A 4IO0A 2NAFA 2YV2A 4PCLA 3KQUA 3GQBB 4JFAA 1NXVA 2QLFA 3FYUB 1VE7A 2ZYAA 3B6ZA 5JQGF 1L4UA 5C18A 2ZETA 1YCFA 1U7DA 2DQSA 2FPPB 2WU4A 3KXIA 2C97A 3ENNA 3UCFA 3E84A 1L5VA 3K9GA 3Q4GA 4W6ZA 3CR3C 2QVYX 4GPD1 3PC2A 4NU8X 4FN5A 1VKZA 4KXWA 4YC7A 3JWGA 4ZO6A 3W4JA 4F11A 4F9GA 4ZZ3A 3R75A 4WCVA 4ZGGA 2RKWA 4ZJYA 3G1UA 3P19A 2BKUA 3OJWA 4KQ1A 5CFLA 2F3QA 1T24A 2C2GA 2GK7A 3ILXA 1RJDA 1T9DA 4YT4A 2A59A 4KMMA 1VPVA 3QI7A 4FIDA 3KLNA 1CUXA 4MLZA 6REQA 4HSGA 2B5WA 3ZCRA 4D6XA 3BHMA 3ANNA 2B4YA 1SPBS 3FWKA 3G2IA 1JR3E 4QWWA 2H8KA 2ZWPA 3T99A 4CUZA 1FOEB 4GWKA 5CM8B 4RM2A 2BY4A 3SR4A 1FZTA 5DBOA 4NV1A 2EFJA 2RAFA 4HGPA 2X86A 3L1KA 4QFBA 1S9DA 2QQ5A 4WHMA 1VJGA 3PUHA 4L72A 1SR8A 4AQDA 5C9ZA 9MHTA 1PSZA 4LY3A 3CVXA 2ADMA 2WMNB 4UUPA 5CFMA 1OCEA 1TO1E 3R0XA 1PZGA 1BGXT 3RSCA 4CKYA 1N25A 2WTEA 3OEEA 4M0DA 2Z9DA 7MDHA 3TF5A 1U7UA 4KQCA 1AVTA 2PN1A 3IAAA 4DG8A 2AXQA 3NHFA 3JR7A 3R41A 4BNFA 4OX9Y 1CF2O 1LPPA 2NV2B 1GZUA 2BR5A 4MMXB 3ZXIA 4DCVA 4LN1A 1CT9A 3P9YA 3AHHA 1PDOA 1G21A 7AT1A 2G07A 3N3BC 2A92A 1HZZA 5GMOA 3TKYA 3ZBTA 3SEFA 5KTSA 2WJWA 1CR1A 2PT7A 4CIYA 4J29A 4G5FA 3C8MA 1Q1EA 3R3HA 4EY6A 2Z56A 1AGNA 1S1CA 3IAM1 1BQEA 5FWNA 3LLUA 4H2DA 1Q21A 2OAGA 1QJ4A 4ID3A 2XOKA 2LCFA 2YXPX 3ZJVA 3ZZ0A 2GXUA 4N8DA 1KYWA 1X13A 2EZTA 2IZ1A 3GJ5A 3GMSA 4IM7A 2QLLA 3AI7A 1OYYA 1PR6A 3CKYA 4N47A 3CX4A 2VAWA 1KE2A 5EJ2A 1K4YA 4L9RA 4D4JA 1FBNA 4AKTA 3TW8A 1SUIA 1KQPA 4XDZA 5HYVA 4IGIA 3BORA 1UBFA 4MW2A 3VU9A 2J09A 3GIDA 1TTTA 2CD9A 3ZV7A 2J0QA 4IJWA 3U7QB 4AZ3A 4C6HA 2XCQA 2ID9A 2IZ6A 1WZEA 3H3JA 2VDRB 3CZ5A 1U63A 1RLMA 1DU4A 1QIMA 4QHSA 2QAJA 4IH1A 4LXGA 4JLUA 4GI7A 4RETA 1PQWA 3ZCUA 2AHOA 1VHQA 2W71A 4R7GA 4CCYB 3HVUA 4AN4A 1P31A 4GSLA 4MV7A 5G0WA 3H17A 3BM5A 2DOKA 1P9LA 3BRWD 5DXJA 4PYNA 1GM5A 5FL3A 2VHVA 3QXJA 2AFHA 1OIXA 4JUAA 4FFPA 3W04A 2FPIA 1P3Y1 2ID7A 4Q02A 5U9CA 1KWKA 2VG8A 4J94A 2ORVA 1THGA 4QU5A 4BNDB 1T2DA 2PWAA 4QGAA 2CHFA 2C5EA 5I9MA 1BW9B 1SBNE 4ASUD 3PI7A 3NWOA 2J3HA 4G8BA 2YIJA 3AEUB 3BMCB 2ZSUA 4ND5A 3ADKA 1Z33A 3HXOA 2B5VA 1A4RA 3JPYA 2BIFA 1PWHA 2HMSA 3KCQA 4FOPA 4E2ZA 4ENRA 4TKVA 3L7JA 1Z75A 3J7AC 2VT6A 1Z0SA 3DWIA 3D7RA 3HFGA 1V3QE 4WEQA 5HILA 1BROA 1NW8A 5JCXA 3RFVA 2ISQA 4IJMA 4UATA 3EPJA 3KHSA 2YIMA 1YHNA 3FKQA 4MS3A 3C3MA 4JT8A 2F4VB 3D8SA 3IMKA 5DHUA 4ZYUA 4KQJA 1FVHA 4HLDA 3LC1O 4LHVA 4FMPA 1L3CA 3GLHB 4X1IA 4TL8A 2JARA 1GFSA 3BA6A 3WHIA 2CV1A 3FTFA 1FTNA 1NDHA 3PTLA 4RD2A 2QT9A 3X1KA 3CUVA 3E15A 2ATCA 2JPDA 2P9YA 4L5AA 4R8LA 1CV2A 1N2GA 3WLEA 3A6KA 4YP7A 2FN8A 1P61B 3PQ3A 3WFJA 5LQNA 1U28C 5LKAA 1V3UA 5CT5A 4G4GA 2ZUSA 1U7ZA 4IJKA 1F7UA 4LJRA 2V6MA 1RD4A 2X8AA 3EE6A 3U7RA 2IPNA 2BFDA 3FIJA 1DWQA 4KAFA 1F0KA 4ZIRA 1NMSA 1PGPA 1XYGA 1V2GA 2QYSA 1AA6A 3E9EA 3EG9B 4EO9A 5JJLA 3GGCA 3WXMA 5CFNA 2M98A 3L7IA 4ER7A 4OH7A 5JNVA 1BOOA 5C4MA 3ZLUA 3TSWA 5CT8A 4TZ6A 3WK6A 5JADA 5D87A 5DRYA 1JLMA 3QEBZ 2JAUA 2ADFA 2ODBA 3C3CA 4U2GA 4A5OA 2JH3A 1T6BY 1XZMA 4HPXB 1LTHR 3N53A 1BWSA 2BELA 4KAAA 2GJ8A 2IUFA 3D8RA 3KJFA 4QJIA 5TV2A 5IU6A 5FDFA 1Q6YA 1S2MA 2AE1A 5CAEB 4F4UA 4IJ5A 5D7NA 3RYHB 2FPLA 2CHGA 4GOMD 1UFKA 3P2EA 1JT2A 2RBEA 2P6RA 4Q34A 1A9TA 2HFJA 1A9ZA 1HE8B 2DUJA 3IXLA 1IN8A 2YVLA 5FI1B 3KXLA 2IU0A 3SMVA 2PGAA 3IIKA 4HAIA 4EUKA 5D3MB 4BRWA 3JD2A 3GAFA 1S3IA 4UNIA 4N3AA 5KC9A 1A27A 3A3YA 2NX2A 3MAAC 4FT4A 4KYIB 4NBVA 4RNCA 3ECCA 1W49A 3PI6A 5E4FA 2VT3A 1GQQA 1O6ZA 1S89A 2R11A 4OMCA 4PLHA 4DS3A 5FLXA 2JBAB 2BEUB 5FOXA 3HU2A 4B48A 1G291 4ZAWA 2PFKA 4HX2A 1W73A 4MPJA 1P1RA 2BFEB 1F3OA 3EZ6A 3KS9A 1PG2A 2WD7A 5G0SA 4PHHA 4DA4A 3IAHA 1ODTC 2GSDA 1JLLB 5FP0A 3HKCA 2QLNA 3GX1A 2HMYB 3T95A 1T9AA 3LPLA 2QRVA 3HA5A 5BN3B 1Z07A 1ESMA 1NI3A 1RPAA 2PVCA 1GGFA 2QUKA 3BFPA 3O7WA 3PJFA 1S2GA 3ZQ4A 4DAOA 1T1SA 4R1MA 4YR7A 1P7CA 2IVZA 3T1HB 5AO9A 3G2MA 1ZMRA 2KQUA 1N2CA 4BJ3A 5DM4A 3BRCA 3C5HA 2VRBA 1W36D 1T26A 3IKJA 3P96A 2CHEA 1CS0B 1KL7A 4LJ9A 5C5IA 3TAUA 1HWYA 1PGOA 3CEAA 3L0YA 4HADA 4YH1A 5FPQA 2OQVA 4BVJA 3KQTA 3O1IC 1HDCA 2JFPA 1E7SA 2O2EA 2RGEA 1U1FA 1S7GA 4XB6B 1Q12A 3SXUA 2TMDA 2BTEA 2Y0PA 2Y2VA 2Y27A 3NZEA 3S1AA 5DULA 1G6OA 4HTAA 2MCFA 1UXJA 3UANA 4A26A 5CYGA 2PKQO 4IFEA 5DYGA 2G83A 2EKPA 2QM8A 2XYHA 2HTEA 3N7AA 3KOMA 3RAPR 4BMYA 4BAGA 4M8IA 2G28A 1PUIA 3N58A 1SBYA 2FX2A 5TMPA 2IKSA 2MYNA 2ZOSA 2J0UA 1X86B 3HA3A 4MYDA 4QUKA 5EWLA 2ZSDA 2IYOA 5K3FB 4FM9A 2LBPA 2HRRA 4NNPA 1RYZA 1ODLA 2PLRA 5F2KA 1O7JA 4V02A 3H11A 1YBHA 2Z6QA 3LVRE 5FH9A 4IL5A 1VFPA 1SUWA 3DKRA 3CNQS 1JJFA 4PYJA 2YV5A 1MB3A 4E2YA 2AZTA 2O8NA 3OFSA 2B2CA 2FE4A 1L5KA 3SC2B 3AKDA 3UWKA 3G85A 1H2BA 1SVWA 4ZV4A 3EZFA 1KZ7B 2EERA 1RQXA 1MUUA 2EX4A 2J9FA 2FP4A 4JYMA 4KXYA 5T6BA 5I8PA 3AF1A 2BMAA 4Q7LA 3I04A 1JE0A 2XADA 4TMVA 2E7ZA 5H80A 3H0KA 4ML3A 3SF0A 3U3RA 1OSNA 1M1ZA 1BSVA 2OVFA 2XMDA 2ZTLA 9ATCA 1QFYA 1A4XA 3JQAB 4DKXA 2NO5A 4DLTA 5FOUA 3OWOA 5EHGA 4OX9B 1XXHE 3B6EA 1YRWA 2BFWA 3QV1A 1PL7A 1SVOA 1YONA 1KEVA 2Q62A 2X5XA 5B2FA 1JT9A 2HDHA 2XI4A 1RPZA 3IYLW 3EXIB 5M04A 3DOCA 3OUTA 2VRNA 2VTEA 3LDGA 1LGYA 1UMDB 2F1HA 5IHPA 3STUA 3NIDB 3I0NA 4U2BA 4JOCA 2NTEA 3AR5A 4QELA 4E21A 4FB4A 5CA1A 2PGIA 4NPHA 1D09A 3HVKA 3A37A 4URFA 4L8GA 3ZV5A 2R5NA 3ZIAA 4ZT5A 2G1AA 3TVDA 3Q8LA 1G7TA 4V0QA 3ZHUA 1F3LA 4RJIA 1Z4KA 2ZJ7A 1G41A 1D6NA 1XDBA 3A11A 3FCAA 1D5CA 2LR0A 3IEKA 2VXOA 4I2VA 4JI4B 4GM4A 4YQEA 3NATA 1X94A 4AB1A 4CDMA 3TGPA 5JHHB 3UJNA 2RBKA 4F3YA 1LV7A 5JD6A 3AV3A 1P81A 4D1YA 2OGZA 4DMGA 2V6GA 2L0XA 5GQSA 3KETA 1O5IA 4NR0A 5BY2A 2AKAB 2PLAA 5A7GA 5JNUA 1MA3A 3DTTA 3DA8A 3SQLA 1T8WA 2JD0A 2WFAA 4O4HB 2DUWA 4ZCSA 4AUMA 5IBCA 2CK3A 3W1VA 5AKZA 4CGYA 2GZDA 1F4VA 4G01B 4MAAA 4P7KA 4CUJA 2IV7A 2LVBA 1GLVA 1VHJA 5DIFA 1U9IA 3J7TA 4O63O 4PZDA 3T5MA 2WWTA 2NLOA 1H4QA 4JC4A 2HWXA 2AOUA 3PR2B 2WMOB 3ZWWA 4TLLB 5IT5A 3E03A 3QE4A 1WUIS 5CX4A 4FFBA 3G6KA 2XRYA 4LPSA 1OBHA 5B7QA 3GLFB 4UTNA 1PR2A 3ECAA 4YQZA 2QQ0A 3R6LA 1RC8A 1E77A 2C57A 1DARA 4Z0NA 3QW4B 1CUDA 1N9ZA 5C8YB 5LNK6 1BA3A 5IDXA 1T1GA 4HEQA 4Q9IA 1SU8A 5B3AA 1U2PA 2QRHA 2WV9A 2XLCA 3QEMB 4KSCA 5FEUA 2H4XA 4L5IA 1SCDA 3QX9A 3GFPA 4EPYA 4LRXA 4L8FA 4LK2A 3GJ4A 4MVWA 1SHTX 2D3WA 3MWFA 3FSJX 4RNDB 4QG3A 3TSCA 3B1JA 3FHJA 3QVUA 5AM5A 2XMCA 4NENA 3JQFC 4J0JA 2BMWA 2P3LA 4B9AA 1EXDA 3CO0S 3L8YA 1K5GA 1C1HA 3OQOA 2E5LB 2CBZA 3JWEA 1FSGA 4FYKA 3UAYA 3A6JA 3GZTB 1FJ2A 3VH1A 3VH4A 4C0KA 1DJQA 3GRCA 3ENKA 3NGXA 2FKAA 1QJCA 1SU6A 1Q15A 1YL6A 1NVGA 2QTGA 3N3AC 4S1PA 2ZGVA 4YV2A 2YWBA 4D0RA 3P9NA 4S1WA 1O97D 2CNKA 1WEHA 4C6TB 1RR6A 4DLXA 3PEUA 4YV1A 2WC1A 4LWZA 3TEMA 2Y1FA 1CY1A 3AF0A 5DEIA 5A5EA 4HDNB 3OQNA 1UT6A 2P3SA 2PRJA 4D3ZA 1FDSA 1V0JA 2QVBA 1RKXA 2H29A 3VNQA 2W90A 1FDIA 2GDZA 3QIAA 3TLMA 4DIMA 1Z16A 1D4ZA 1FDWA 1T0PA 3HB7A 1B8VA 3HKBA 3JS5A 5AOBA 1OT5A 3C98A 3GZ4A 2IOFK 4HQ0A 5A5GA 3OPVA 2R2GA 3PE4A 2YRWA 3O26A 1M66A 1QWSA 2B8EA 1VPLA 4O25A 5FPKA 5JXWA 4Q1VA 4Q1BA 1V4VA 2IBMA 2V6IA 2UZIR 3GH1A 2BHSA 2O3RA 1TFRA 4TV8F 1U4OA 3BWDD 2NT4A 4B73A 1W2GA 4RXMA 2AWOA 3VNVA 2GK6A 3AHJA 3P52A 1SJ9A 2R00A 2Y68A 5BN1A 4BWYA 2IV3A 2H1VA 5DSTA 3MG9A 1PNOA 1YZ3A 1M7BA 3TKLA 1KAMA 621PA 2RJ3A 4BWFB 4M9CA 1TCAA 3JY6A 3RT7A 3CB4A 1EE9A 1QE0A 4LC1A 3IO5A 3CLRC 5TQ0A 1ARZA 4NZMA 4G1BA 4IVNA 3ZKAA 5B4VA 1PZNA 1IZ7A 1DJNA 4KIJA 2Q5QA 5EC8A 1SHZA 3OMLA 4QDTA 4U8HA 5I4IA 5K8UA 1KVRA 3WK8A 3EZNA 3R0JA 5LSAA 4IO1A 2H11A 4LBZA 3W7VA 4QUBA 3LQRA 3EGIA 2ZBUA 3GRUA 1LRJA 3O38A 5EYPA 5EXEA 1E2PA 2HHAA 1Z0KA 4XX0A 1YHYA 3SQWA 1U4SA 1X7YB 2XWJI 5FBWB 3OOSA 2VR1A 4HZGA 2LWIA 3MTJA 1K89A 3F5FA 3VU8A 4X41A 3UIEA 1U04A 2FG7C 3BF7A 3LXXA 4YHHB 3X1JA 4EX6A 2I1LA 3ELWA 3PFNA 4GE3A 1YR8A 3Q85A 2I33A 3MJSA 1FA9A 3AR7A 4QOJA 1R00A 4B2LA 4DAEA 5K0ZA 1QQBA 3NNNA 3CF4G 3MWGA 3U0VA 3WGIA 3CTMA 1R1DA 1IN6A 3AVPA 4M8SA 3PPXA 1U7TA 1NJ8A 2GTPA 2VH2A 2OR3A 4WZBB 1W5AA 4AUNA 4CODB 1A8UA 1JKFA 4BEBA 3OJEA 4OQDA 3FSGA 1HT3A 3OCWA 1T6YA 2AEEA 5EIAA 3GDOA 4JL8A 1ZONA 4HMQA 4KP7A 4QUHA 1IMOA 3W8FA 5ITVA 1ZNWA 1GZ4A 1V96A 2RB4A 4XIGS 4L9WA 3GCZA 2P9JA 3EVAA 1PGJA 1QONA 2QXTA 7REQA 1A8IA 2JD1A 2VCHA 5KVVA 3BCSA 2AJLI 4MLPA 2GZ1A 1PR4A 3KJNA 3FWPA 4DJDC 4BFZA 4MVJE 1GU0A 1UDWA 1U8YA 1YQGA 3L06A 1TJPB 2RK4A 5L9AA 5ECYA 4TGLA 1TCUA 4K3UA 5IZCC 1KMCA 1E94E 1QFXA 3AB8A 3MD0A 3VOSA 4AUEA 1E9DA 1W85A 3OA2A 4CMHA 1VE9A 4NBRA 3A31A 3F2VA 4A6XA 2WWHA 4ZQCB 3GHHA 5B1YA 3DLIA 1UQTA 3E61A 1DXYA 3P0RA 1XI2A 2VLBA 3KX2A 4FS8A 5AK3A 2Z6VA 3TLZA 4C7XA 2OO5C 2WNSA 3WZ2A 1K68A 1MAHA 1OXBB 3CRVA 2AJTA 1SC3A 2WU0A 4X97A 1ZK4A 2B1GA 2Q27A 3PB3A 5ITZB 3GMTA 1E9FA 2PYIA 4MS3B 4G56A 3RSLA 5JMOA 3ROGA 3IKMB 3NNDA 5F76A 1PS0A 1WUHS 2HQ1A 4RSGA 1YRBA 1FRFS 3PUYA 4GYYA 5EPOA 3NEAA 1AXEA 1H3NA 4WESB 5BOSA 1QFJA 4OLAA 2XNDA 3OIYA 2JLZA 5CU7A 1N2EA 2PCJA 3N0RA 1P1HA 5JXIA 5FCDA 1PYGA 1EDEA 4LIPD 2G5PA 5CLIA 1DRJA 3RUEA 4OJQA 1DL5A 3V8QA 1SEVA 5JVDA 3G3EA 1SCAA 1BJTA 1L4KA 3GUYA 5D5PA 5KKCA 1Q0RA 2BBTA 1SELA 3E18A 3PSAA 4Y1FA 4J0FA 3N2NA 4GGMX 2W6JA 4UHJA 1ONPA 3F6SA 4BPRA 2ISCA 3RIMA 4N54A 2P6MA 5DBIA 3T3OA 3NTVA 3SC4A 2JIOA 4L27A 4CG1A 4UQLA 1YRAA 3LGAA 3O82A 4DV5B 4XZ3A 5LMUB 2CB9A 1LQTA 1RHRA 4FHFA 4MIOA 2FF7A 4H27A 4QBGB 3NWBA 3SICE 3VJKA 3HJUA 1U3WA 5A6SA 1ZBQA 1F6BA 2OHHA 3NAMA 4NMLA 3BG5A 1D04A 2P68A 3E0XA 1OGJA 5EQTA 2HU8A 3BGSA 3KALA 3FAZA 4E7PA 1X74A 5JS7A 1TK2A 4YRBA 2WG2A 5TS2A 2DX7A 1CZKA 4O4LB 2YQZA 4ND3A 1FXWA 1GDDA 3F49S 3JQ9C 1W88B 1Z29A 4JS0A 1UDAA 3IVMA 5KYWB 1MQSA 3QVJA 4QUAA 2QYHA 2UDPA 3I5AA 4S35A 5EIFA 4A2WA 3BGDA 4F38A 4Z3OA 2Q4BA 1E18A 3E5HA 2QPTA 2ID4A 4DGSA 4PZEA 5KMGA 2FMUA 2XOKD 4HCJA 2KSQA 2RARA 3DFKA 2WF9A 1AGRA 1E1YA 3G2QA 1YDEA 3ROTA 2AJ8A 3TQHA 2GESA 2I6XA 4Q4DA 1H4SA 1FFBA 1L5HB 3MWYW 1O97C 4J90A 1VPWA 3FDIA 3JQ7A 4TUYF 4V0RA 4B3XA 2I71A 4PQFA 3QPVA 3T7AA 4B71A 1DOHA 1T0BA 2ONZA 3L7DA 1OA1A 1AH2A 4J0IA 4GPIB 4A03A 1EH5A 3GT3A 3GGGA 4MUAA 4GLJA 1QR6A 1IUOA 2EWWA 4FWBA 4HDMB 1F6DA 3OX4A 1YS7A 3NTQA 5DMHA 1YS2X 3VSDA 4HDSB 1E9CA 4I4LA 3DUWA 4PQGA 4BO0A 4OJMX 3AGPA 2PS0A 4RFVA 1QYWA 4NECA 3O0TA 5FLEX 2NZ2A 3RVDA 5K0EA 1BHSA 3X0DA 4C7KA 3HO6A 5L4LA 3NBMA 3U49A 2CLOB 2LZ0A 2OV4A 3D2LA 4I36A 5FTJA 4BJ5A 1YMVA 2MSKA 3A1UA 3OT4A 4QVKA 2WM2A 4BLRA 1UIMA 2JW5A 2WYUA 3QELA 5C1DA 3P0EA 3EIXA 4F9EA 4FGWA 3RHZA 4MR9B 1OUMA 4MVJI 3T1TA 2E4XA 5AM1A 3WO1A 4F3NA 2NUPA 3GUZA 4QKQA 3EG9A 3GOHA 1JSCA 4IZIA 3RSFA 2HPAA 5EZYB 1YR2A 2XB9A 4HWKA 1ZGJA 1HE4A 4IXMA 3L04A 3D7LA 4RSHA 3QU9A 4V39A 6ADHA 5FUVA 3WKAA 3QKSB 2NU9A 3JALB 2I9KA 3EWAA 2H7CA 5F4ZA 3R3ZA 4EA7A 1NKTA 1VRCA 1VJ5A 5GIOE 4DM4A 1QH0A 2GLTA 5DLEA 4B7ZA 1XDDA 4NBKA 1SOAA 2YASA 2GKSA 4RK0A 1EX7A 4K6CA 3TPZA 1QGOA 4YXWA 4F4FA 2BE7A 1USUA 4RGYA 3NT4A 1NFRA 2XB2A 1N57A 1ZJWA 4D8TA 4P4LA 3GLHA 5HF8A 2EOAA 1KYZA 2OE2A 5E4YA 4C7JA 1NZJA 1ZD3A 1UPTA 4PICA 4PANA 5CTJA 1AXGA 5JWHA 1RT9A 3Q8WA 3ZGZA 2PZMA 2QT0A 4DV0B 4GBJA 1TJ3A 3TL6A 5T67A 2VTKA 1NVVR 3U48A 4BVBA 2J9FB 5K8VA 3A7EA 4LI0A 3AHGA 3L7KA 1U31A 2F67A 4DXHA 5ECWA 5CT6A 3EVGA 4FC7A 4G0MA 1Z8FA 4ZYXA 5A62A 2IH5A 2V9CA 1CW2B 4U02A 4UDYX 4P54A 2R8EA 2WWXA 2CXNA 1YR1A 4NBUA 4YPVA 4KPYA 1TM5E 3SY8A 1RBMA 1TO6A 3V4PB 5FV4A 2XMGA 4KX5A 2FZKA 4HD8A 4C87A 2JGNA 2A5GA 4B83A 1OZGA 3SP1A 4FSDA 4XYEA 5TLSA 4NARA 2AKYA 4N3BA 1P75A 5GJCA 5EJ5A 2BSAA 1U1CA 4ECAA 3EODA 2ALJA 4F3KA 3MT9A 4DT1B 4WZ6A 4MLDA 1H1DA 2O5VA 2R7NA 1TQ8A 3U4AA 3T34A 2EF1A 3AR6A 3HGQA 1LWOA 2JFQA 3UMSA 1P44A 2G7ZA 1D2NA 1C9YA 4DADA 3U4MA 5T6MA 5I8WA 3G7UA 4M88A 1LFDB 1NPTO 3GEGA 1EX6A 1MO4A 1DINA 4QDOA 5DTQA 4PNEA 3H84A 3ZE2B 2X0KA 1SHKA 4X95A 1MG5A 1MRSA 1WPGA 2BEWB 2WWIA 3H99A 4CJXA 4F71A 4BXOA 3L07A 2D7DA 2Z9CA 3U7FB 1Y63A 3AIIA 1E3LA 1J5XA 3FN4A 1FP1D 3H83A 2BH2A 2B4RO 4JDUA 1Y1QA 2XUQA 3UJ8A 4Q01A 4BEWA 1TLTA 2HYDA 3NHKA 1EG7A 3DMHA 4PFKA 1E2BA 2Z98A 3HL0A 4AMGA 1YVRA 2WB4A 1MPXA 2REBA 3PA8A 2VHUA 3TDMA 3T1YB 1WDLA 2NVBA 2IBSA 5KNCD 2IZOA 1S3FA 4CIAA 3KPWA 3KVYA 1W0CA 3BD8A 2YXBA 1C30A 2PD4A 3F3MA 4R8VA 5ARCA 3I62A 4ZHQA 1AO0A 2AEMA 1CIVA 5HKLA 1D8TA 1SH7A 4OJNA 4XR4A 1UJ5A 3D4PA 4H0CA 2JHCA 4M60A 3KDAA 3HVHA 3LBAA 5DK4A 3V8MA 5CVTA 2JLUA 2I8CA 1OI4A 5GJBA 5DNVA 5FNVF 4MUBA 1E6LA 3RF6A 1EB9A 2AVNA 3L0CA 1Q19A 2GYWA 3ZN2A 2KBEA 1FU7A 1QGDA 3DDWA 4RWZA 1R2QA 1GG5A 1LU9A 5JHGB 1J5EB 3OE5A 5CCEA 6PFKA 3SZLA 5KZMB 5AHKA 1ULTA 2FEPA 1UXGA 1YRLA 1A77A 1LXCA 3AUSA 3EZYA 3FWZA 3T3HA 3WHKA 4ETWA 3UAZA 1EZZA 1V16A