1TRKA

Refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Refined structure of transketolase from Saccharomyces cerevisiae at 2.0 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase(ketone residues)
molecule keywords TRANSKETOLASE
total genus 246
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trkA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trkA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trkA01
4GM0A 2E6KA 5DEIA 1DTWB 1UMCA 1ZPDA 2Y0PA 4KXWA 1UPBA 2BP7A 3LQ4A 2WVHA 5HGXA 2VBFA 1OLUB 1TKCA 2JI8A 4JUAA 5ERXA 2UZAA 5EXDA 1V1MB 4FEGA 3ZHRA 5HJEA 1T9DA 3F6BX 1ITZA 1YHYA 5EJ4A 5K6RA 1V11B 1OLSB 1W85B 4JUCA 2XT9A 2W93A 4MPJA 2BFCA 2JI9A 2IHUA 2PDAA 2JLCA 2BFDB 1OZGA 2VK8A 3EXG1 4JU8A 3L84A 1L8AA 1POWA 5AHKA 4JU9A 2BFBA 3DUFA 1Q6ZA 3IAEA 5I4IA 2BFFA 3LQ1A 4MPPA 2C3OA 1WCIB 1TKBA 3JU3A 2R8OA 5EJ7A 1GPUA 2Q5LA 4RJKA 1PYDA 2V3WA 2BFEB 4GG1A 4ZP1A 2BEVA 2JIBA 4D5GA 2XT6A 1YNOA 1QS0B 3HWX1 1X7YB 1NGSA 1RP7A 3UPTA 1UMDA 1X7YA 1QS0A 3EXHB 1X80A 2IHTA 3EY9A 4K9MA 1V5EA 2JGDB 5ERYA 1UMBB 2Q5QA 4MZXA 5K2OA 2BFEA 2Q29A 4COKA 2UZ1B 3M7IA 1YHZA 2YICA 3EXIB 4K9PA 2PGNA 3EXFA 5EJ6A 3LPLA 1PI3A 2IHVA 1NI4A 3IAFA 4JUDX 3DUFB 2C3YA 3DVAA 1IK6A 2EZ9A 4JUBA 1U5BB 2C3PA 3DV0A 4Q9DA 5ESDA 1T9BA 2BFDA 2VBGA 4K9QA 3AHIA 3KOMA 1V16B 1X7ZB 5FEMA 1OLSA 5I5GA 2G28A 1V11A 1W85A 2Q28A 2Q5JA 4GPEA 4RJJA 1V1MA 3ZHTA 3AHJA 2PANA 2BP7B 2C3MA 1N0HA 3ZHQA 1OZHA 1T9CA 2EZ8A 3M6LA 4K9OA 1UMCB 1DTWA 1OZFA 1Y9DA 4JD5A 1V16A 1V5FA 1X7ZA 3AHGA 1BFDA 2BEUB 3RIMA 2PGOA 2VBIA 5IMSA 1JSCA 5EJMA 1W88B 2EZTA 5EJ9A 3DV0B 1U5BA 3DVAB 1X7WB 1NI4B 3AI7A 1UPAA 2Q27A 2J9FB 3EXFB 4C7XA 1AY0A 1V1RA 2DJIA 2FN3A 2NXWA 2UZ1A 2VK4A 2YIDA 2WVGA 3EXIA 3EXEA 3FSJX 3D7KA 3OE1A 4JUFA 4K9LA 3AHCA 1UMBA 2JGDA 4XEUA 1YI1A 1X80B 4KXXA 3EXHA 4WBXC 4KGDA 1UMDB 4MPRA 3EXHC 5C4IA 1Z8NA 3UK1A 2JI7A 3EA4A 2OZLA 3FLMA 2BEVB 2G25A 1MCZA 1B0PA 4FEEA 2O1SA 1OLXB 2X7JA 4GM4A 1WCIA 1X7XB 3HWWA 5DGTA 2QTAA 3ZHUA 2BFFB 5EXEA 2C42A 2BFBB 1QGDA 1YD7A 2EZ4A 3M49A 1UM9B 1YBHA 1UM9A 5EJAA 4D5EA 4MQ5A 2BFCB 5K3SA 2O1XA 4GP9A 2IEAA 4GM1A 3EYAA 5I51A 1X7XA 2AG1A 5HHTA 3HYLA 2Q5OA 2R8PA 2VJYA 2FWNA 3AHHA 1OLXA 5EJ8A 3F6EX 1OLUA 2C3UA 3MOSA 3E9YA 1UPCA 2OZLB 3EXG2 2AG0A 2C31A 2JLAA 3ZHVA 4KXUA 3ZHSA 1TRKA 5DGDA 4K9KA 3LQ2A 3M34A 2G67A 4C7VA 5I5EA 2QTCA 1QPBA 2WVAA 4RJIA 5HYVA 5EJ5A 1T9AA 3EXEB 3AHEA 4QPZA 2BEWB 4K9NA 3AHDA 1V1RB 1PO7A 1TKAA 2J9FA 1PVDA 3AHFA 2JI6A 5K6TA 1X7WA 2VK1A 3FZNA 3OOYA 2BEWA 2EZUA 2R5NA 2XTAA 1YI0A 1W88A 1POXA 1OVMA 4QELA 1V5GA 1KEKA 1R9JA 2BEUA 4QQ8A 4KXYA 4KXVA
chains in the Genus database with same CATH superfamily
5E2AA 1XQXA 2F67A 1ODLA 1VMAA 4YAEA 3AJDA 3SS9X 3PE4A 1R6VA 2JFFA 2O8EB 4LZJA 3U19A 1JXQA 5HP4A 3R1IA 2GAAA 3GVHA 5CPBA 1EUYA 2P79A 1Z7BA 1ZVJA 4Y0VA 2BR3A 2JJQA 3KUCA 4X9XA 3AY6A 3NWPA 4PLZA 1PUIA 3V2GA 3GXOA 2Q50A 2I29A 3AR3A 3DCNA 5DM1A 4C0AC 4F8JA 2F62A 3FXAA 4G5RA 3CO5A 1WSWA 3LUGA 2GAOA 2RHBA 4BKUA 1Y4DE 1Z4OA 3FYCA 3G2KA 4IINA 1U04A 1FXUA 1J2RA 3B9PA 5FQOA 5FWDA 3TOCA 3TQFA 2GO1A 1ZX1A 2CJYA 4HG2A 5K0LA 3QTLA 1I2DA 2XTNA 4DM3A 4PBTA 3ZCTA 4BBZA 4ZAZA 1C7JA 5K2OA 3EY9A 3DZ8A 1ZZGA 2M6LA 2A35A 2FPPA 4NAHA 1X1SA 2Y0DA 4QPNA 3OE4A 1IY2A 2PFSA 3VUFA 1ULBA 3BCUA 3KQMA 1F8XA 4YLEA 4B3CA 4MKFA 1PQWA 1WCXA 3ZGNA 1E5TA 5TIIA 1ND5A 1LEHA 3EC1A 2MINA 4YAGA 3WISA 2GH1A 3U4DA 4Q4DA 1KRWA 1OYYA 3MAGA 4PZDA 2XUFA 2OGWA 3ZHTA 5HKKA 3W5AA 4RY8A 1LC0A 3EIHA 4HGRA 5LP6B 1H2AS 1TTHA 2RH9B 1K5PA 4Z3KA 1NBMA 2ZU0C 3FY4A 3D0KA 1J0CA 1G4UR 3T12A 1L4UA 1R0SA 3AF1A 4YJ3A 1P1BA 1YTUA 1ZS9A 1K6EA 1EK2A 2D1TA 3ND8A 2Z30A 1HG0A 1T4CA 4UDNA 2BI8A 5ALEA 1ISMA 2ZYVX 2ONKA 2V7GA 3BX1A 1J5PA 4LTMA 5DT9A 2R62A 2XTJA 1AXGA 2ORYA 1GFIA 3FLEA 4KO1S 4MO9A 4R1TA 4F92B 1I2BA 2I6SA 3PJFA 4RTRA 2IYAA 2FJUA 4K6FA 2WWHA 1M5RA 1SEVA 3DLIA 2PG3A 2PWZA 4YRPA 1J09A 1E2DA 2CVOA 3DDUA 4EY8A 4BJ5A 4ZEWA 3D3QA 2Q5EA 1RBMA 2GZMA 3L8CA 5CYFA 5AI4A 2Q4RA 3PVCA 2AOWA 3M49A 4TWZA 5DB4A 1L6IA 2GYUA 4HSGA 3IODA 1UOEA 1W0JA 2AE1A 5EWJB 1YS6A 1VB3A 3IJEB 4CLOB 1QKJA 1QAQA 2X8WA 3M2PA 4L5YA 3JALA 2Q8QA 1EWVA 2G5PA 3NKVA 4FJ2A 5AJYA 1VIVA 1UKVY 3TZQA 3KKMA 3ZHSA 1QNFA 1FDWA 1BYIA 2GCOB 2V6GA 4NCBA 4NLLA 1XZNA 4Y9SA 2W2LD 2F1IA 1KERA 4R8VA 5JAQA 5ADWA 2W2XA 1O95C 1NJ6A 5AVSA 3C6YA 1RWPA 3IMEA 1FVFA 3N59A 2QD3A 4N49A 4TROA 4DMCA 3HXOA 5E3JA 3JQ8A 2YXBA 2LCQA 4PFSA 7ADHA 1HE2A 3T7DA 4FR5A 3SR3A 4Z4EA 2VCHA 2O3RA 4QLAA 1ZU4A 5JXGA 5D2CA 1U3DA 3GFOA 1ZNYA 3HXTA 1YDWA 3IEUA 3ZHBA 4C87A 2X0DA 1IBCA 1YF3A 3K2IA 3USES 4BIIA 1K92A 1SAYA 3QP9A 4TRNA 4E7OA 1MHTA 2I71A 5EKTA 4O2AB 3E61A 1RJGA 4JXJA 4BMDA 4PZPA 1OU4A 3LDGA 4L27A 3WV5A 4DCCA 1PL8A 3LKZA 6ADHA 1R6DA 2QY6A 4MPJA 4B84A 3HKBA 4DBVO 4EJ6A 2M6SA 2X6QA 3ASUA 4B2YA 5TLSA 5DFAA 1R12A 5HMLA 3EDQA 5MN4A 4C7KA 3PKIA 3W3ZB 4P33A 4O4IB 5KUTA 1EA5A 1GHTA 3OC6A 4G1CA 2Q45A 2DZDA 1U9IA 4JK3A 4ZP1A 4YAUA 4I6GA 1PW5A 3DMPA 2XCLA 1VG0B 3W8NA 1P33A 5KU1A 1TUBB 2ZUCA 5EJ6A 3IKMB 3AZOA 4LNUB 4L4UA 4MJ7A 2G06A 3TOZA 4K46A 3HQ4O 2D2FA 2AX4A 3M7IA 4X8HA 1BGWA 4KRYA 3QVJA 2BBOA 2PT6A 5H7XA 1T5LA 1V71A 1EVQA 1C9EA 2RG7A 3QFCA 4A9AA 4CMCA 4RBNA 4LZOA 3F7NA 2EJBA 1WUKS 1NIPA 3KM0A 3K7EA 4HVTA 1TEHA 1XV5A 4MUNA 4N8DA 1UBKS 5IVIA 2QBYA 3PR3A 4CG3A 2OSVA 2FHSA 2HHCA 1ADJA 2X0JA 3KR0A 2Z57A 4ENPA 3NTLA 3D1VA 4NFSA 3V1TC 3DLAA 2UZ4A 2PMFA 3GEGA 4QDUA 3NKLA 5CFLA 5DXJA 5IDQA 4AP9A 2PGOA 4TTIA 4KE8A 4LWPA 5IS2A 5J3JA 1QGOA 2FNAA 3TLAA 3OQ6A 3BIJA 3FNIA 2YVUA 1B76A 1I14A 1X7WB 1Y1QA 4HSEA 3GCZA 2EDAA 3EC2A 1SCDA 3TRDA 1FLAA 1W4CA 3DJYA 3G2NA 3IT0A 4LNUA 4XIFA 5DNWA 1DT3A 5BV8A 3WMFA 4X41A 1GFWA 2HW8A 2F55A 3QQ5A 3B1ZA 4BUCA 5L45A 3SF8B 3KUUA 5IZCA 1ZAYA 4GD3Q 2X7JA 4BGUA 1M8FA 4AG3A 3H2ZA 1NQ5A 4CLOA 5P21A 5LJLA 4LV6A 2XUPA 2HNBA 3EQ2A 1CUDA 4EVSA 3CH5A 1SCUA 3VHRA 4OHYA 1HORA 1V26A 2P8SA 1L9KA 2QUBA 2IUTA 1O7JA 4M7PA 1TNDA 1XJCA 1U81A 3GCDA 3MD0A 1FTYA 4M87A 4MQ5A 4TWAA 4UARA 3W3AD 1JR4A 5FPQA 3A2LA 2C1EA 2XNCA 4CEHB 1NP3A 4ZO6A 1WDWB 4EA7A 5CDSA 2PGIA 1MJFA 4G1FA 1KAMA 2PUJA 2HRRA 2HRBA 2R8YA 3U4IA 4UBMA 2HCFA 3NAMA 1OWPA 2G1PA 2HF7A 3IP8A 3LUJA 4NAUA 3IXLA 3BE4A 1EX6A 5SY6A 3K92A 3C14C 2WICA 3DNFA 4UHJA 2QV7A 3W6NA 1OMOA 1W8IA 1QHHB 2RHWA 4OCZA 1MOQA 1KJWA 1M2KA 2BI7A 3TINA 1N5LA 3PUYA 4DKXA 2UV8A 1IHOA 2ORED 2CVFA 1MP0A 4JHLA 1OAAA 2FSSA 4YRTA 5ANRB 3S2UA 2J9ZB 4WA8A 1DRKA 2BEUA 3EH1A 4H1WA 1DTWB 3IIIA 2YIMA 2WA1A 3IR7A 1ZBDA 3ETGA 4LVOA 3AEZA 2EW1A 1NSTA 4KOEC 3COPA 1P7WA 4KXNA 5IMBA 3UCXA 1US8B 5JRDS 2GXAA 1GGMA 5DNDA 3L1HA 5LQAA 1X3LA 2JH3A 5HVNA 5KTNA 3ADDA 5AJXA 4YMIA 2M9MA 3LD9A 2P9ZA 5EP2A 4MITA 3U49A 2ZS8A 4BO2A 3IHWA 4ND7A 2JW5A 2XA9A 3QMWA 4RHFA 4A03A 3RNLA 5D7NA 1Y8CA 4YRJA 1RKXA 2CNDA 4ZAVA 5LA6F 5CVJA 3NKFA 2O8BB 2CXUA 2I62A 1JQBA 2B35A 1X19A 3OD1A 2GA9A 4EB0A 3IV6A 2IDZA 1G5HA 1S1CA 4GPBA 4K7JA 5KTSA 3DE6X 1JBKA 1M8KA 3C1UA 4KSBA 4ZTBA 2YOFA 4EHJA 4QEZA 1S2LA 4GMXA 2JCXA 4UHFA 3CZAA 2AFIE 3TK1A 4HT3B 2KM1A 4PC1A 3VU9A 3PGJA 2CKDA 1WU8A 3F6YA 3IE2A 4GWLA 3KETA 4DLSA 4B5KA 4HNAA 4C0BA 2A9PA 4WINA 4BKMA 3VAAA 2RBGA 3UCEA 4BMYA 4QYSA 1XJ5A 4RK1A 1KQ3A 1HT0A 1N2EA 1Y1PA 3E9QA 4LMBA 1XZLA 4J3FA 4QDJA 4I1OA 4C4TA 4HV4A 4M0CA 3H4MA 4WASA 3CBQA 5CMLA 3EJWA 4BZWA 3QMPA 2QAGB 4EUNA 4YQZA 4UUQA 3JWEA 1IMJA 5EWLA 2WKRA 2ZANA 1NF2A 1PLKA 2M6RA 3NV9A 1E3SA 1XT6A 3E03A 4XB2A 2FPKA 3I1JA 1C0KA 5E9WA 1YMQA 1DUVG 3PE3A 3ENWA 3RYHB 3B2EA 3R9XB 1A8QA 3TSZA 5TMBA 4C7OA 4G0NA 3WYGA 1U8UA 2RGGA 5EZ5A 2PMEA 3PXAA 3TW8A 2EEZA 4L51A 4DCOA 3GLIA 3GEDA 5FFNA 2R2GA 4I9FA 3K1JA 3QG1A 4KEAA 2FGKA 3V8PA 2GPJA 4X3PA 1N7JA 4QC2A 2HM7A 4K8RB 3LPAA 1YZFA 3IERA 1OC4A 3EZ9A 1NJSA 2HBYA 1XTRA 4I46A 1P1CA 4MHOA 1AVTA 2VO1A 3Q5EA 4HDAA 4KQKA 4S3MA 3KJQA 1XKXA 3HH8A 2O3QA 2XDQB 4S1OA 1HG1A 1XL0A 4FLFA 1BJRE 2BH9A 4YJHB 3B5IA 5LXTF 1DEAA 2QL5A 1TQ8A 3HKCB 1Y42X 1CDDA 3D7LA 4G0XA 4DILA 3TNJA 3DEAA 1SHLA 3GU3A 4OD0A 4YTEA 2JH9A 2V7UA 3D3EA 3KLOA 4PX2A 2H1RA 3BKXA 1T6YA 1IWOA 4MYCA 5SZJA 5BMVA 3R0XA 3KQNA 3DE7X 1MEOA 2VDWA 1NVVQ 3RHFA 3IEXA 4ZDKA 2X3YA 4KLAA 4UBNA 4CM3A 4JI2B 5EQFA 3QEJA 4AWAA 2XW6A 2Z6VA 4PLWA 3W78A 4DOMA 5ICGA 5CXXA 2B3DA 3HKEB 1JBEA 4URUR 3ZI4A 1HNZB 1H69A 1Z56C 3M0EA 3LT2A 2EARA 2PCLA 3VVCA 3VVLA 4BNZA 5IJ0B 4DREA 1A3CA 7YASA 2DULA 1LK7A 4RVGA 4I4IA 4DR7B 3AL2A 3DYBA 3IR5A 4KQ1A 4ARVA 2R6JA 4DJFC 4EJ0A 2GFIA 2PX0A 4RMIA 1N5RA 3WIUA 3RKSA 4R7ZA 2OXEA 3RGWS 1NBWB 1RZ3A 3UTDA 4IXTA 1KXJA 1MG5A 3U17A 7MDHA 1H23A 2R2AA 2XAAA 4M3NA 4OQFA 1M2WA 4M8KA 3ZHCA 5BT9A 4GWKA 4Y2UA 4TL7A 1WZ2A 3ORRA 5HBRA 2IF2A 2XZLA 1VCHA 5IULC 3ZG6A 2BZSA 5FUYA 4Q01A 2Q3EA 4LDAA 3HMQA 4TZKA 4XQCA 5GVSA 1K7EB 3RBXA 1NF3A 4FFNA 4Y1GA 4IOKA 5I9IA 2O7QA 4N7BA 3SBOA 1IN4A 1AHNA 1QFMA 1SEPA 3A9RA 3GAAA 1N9KA 5EP1A 1G6HA 5HILA 4DR4B 2JVJA 3KPWA 3HB4X 2G77B 3WGYA 1AF7A 1YJ8A 1A8PA 1P0IA 5AFSA 1R0LA 2UKDA 1E6EA 3EGIA 4OHOA 4TM8A 1SRRA 1AGXA 1YS4A 3K1AA 5ECGC 2FSVC 4EG6A 5K3AA 2Q6TA 3KOMA 3LE8A 1WTAA 2O8DB 1WP9A 2E4ZA 1AO0A 1I6MA 4FT4A 5JVDB 4HD8A 3O73A 3NPMA 4O5AA 2Z83A 3LVFO 5IYZF 5HK9A 4OHVA 4BNNA 1ONBA 1PR9A 3E7XA 2WY2D 4PV7A 4Z7NB 2W6IA 2HJHA 2AW5A 4HDNA 3EC7A 3D4BA 4LYFA 4XD2A 1JHQA 3PNYA 1UFKA 2OEPA 4RQTA 5DHRA 2CHVA 3VHLB 4ZT4A 1V45E 1OIWA 1Y6GA 2ZYTX 2UYGA 5AM3A 2NU8B 1QTQA 2Y9PB 3ZCRA 5LBTA 5IC6A 5CDYA 5JH7B 3K20A 3HK2A 2B94A 4TMFA 1PR4A 4UQOA 2HF8A 2ZYWX 3N2KB 3O8NA 1PNRA 2E2WA 4LOKA 1PNVA 4JJGA 1MH9A 2XTZA 4NDNE 3OEHD 4S2EA 4P98A 1G8FA 3EXHC 4B40A 3DCIA 3LP8A 5LYJA 3N76A 4ZDJA 2X3UA 3BFPA 3E0QA 3MWEA 4M1KA 3CZ9A 5ITWA 1TVCA 3V1MA 2X40A 3WLOA 1DXHA 2WA2A 3ZUGA 3N0WA 4XRGA 1A96A 5D5QA 3VOTA 2YXNA 1H2HA 2IPXA 1QGDA 3IDAA 3QFRA 4RD2A 4YA6A 1YDHA 3H75A 3VU3A 2P62A 3QVMA 3OT4A 4FTWA 4K28A 3OX2A 3T4UA 3KG2A 3CN9A 1QR6A 1A9QA 4XSGA 4F38A 1NQOA 1I1NA 3FBWA 3CM0A 4IDNA 3WLJA 3ZJ5A 3PPXA 1MT0A 2AG0A 3VNRA 2QMHA 2XMRA 1B43A 5TF0A 1C9JA 4MKRA 3U4GA 1I80A 1UWKA 4K9KA 2X8LA 5A7FA 4X1OA 4UUPA 1D0VA 4G8CA 3QW2A 4IHAA 4CIBA 4PG6A 4BEWA 4JJ7A 1FLDA 4IFBA 2FWRA 2JFOA 3HPQA 3L7CA 2PPLA 2GZ1A 4QYIB 1K6MA 2YIVX 3AEUA 4PRLA 1O97C 1J0AA 1RQ2A 1FUKA 3K8ZA 4KRXA 2WFLA 4ZWNA 3PXGA 4EF6A 1Y6RA 2YHBA 3PEWA 2ROQA 1EI9A 3LXUX 4KR9A 1Y3AA 2CD7A 1I6LA 3FOBA 4JYZA 2CJWB 2DFDA 1HTTA 4LX0A 1MORA 1V4VA 5B1EA 2OT3B 3GA7A 3TTUA 4OHKA 1BMDA 1CJMA 3GHHA 3TFWA 2YW9A 2BI4A 3MW8A 4MVJH 4CDNA 2HLNA 5JWHA 1IVNA 4HNGA 5JR3A 5ECYA 3ZV3A 5KEIA 1OJ7A 4GKVA 1N1MA 2XE4A 4WZBA 4GZ3A 1N2HA 5T6MA 1N32B 2PS1A 3EEYA 4CM6A 2PXXA 4EKNB 1DP4A 1XZIA 1GKIA 2XMCA 1CP2A 2Z0MA 1SXJD 2VNAA 4QT0A 1ISRA 3WDKA 2DH6A 2VZ9A 4UE6A 5LC1A 3PXCX 5AVVA 2VDJA 2VF5X 3RASA 5ESXA 4EGQA 4RNCA 2GN2A 4C01A 3S2YA 5E7JA 4ALLA 4PYOA 4GI5A 1G19A 4XX0A 1I30A 1T34A 2HCTA 4TTJA 3NHSA 5EOVA 3TPZA 1UAGA 3ZWDA 3BK1A 3BXPA 3PUHA 4G5GA 1Z8DA 4A8JC 4DE5A 3H6HA 3TTXA 3AHIA 2NTJA 3DWEX 3ASZA 4NENB 3NI2A 3ANNA 1GZ5A 4PSCA 4RJJA 3BORA 3ZPXA 4D3FA 4G4IA 1JFVA 4ACAA 2OAQ1 2VJBA 2DECA 2BBTA 3S8YA 4BO5A 3CX4A 1EE2A 1E2QA 1F60A 2NYAA 4Q16A 1M73E 1GTMA 3R8XA 2WTAA 1ODKA 4KQFA 1MQ9A 2QKYA 2B8TA 4NMHA 4Z2AA 4FFPA 5C2JB 1JSCA 1FSPA 2YXDA 1WXQA 4KACA 4MKXA 1Q3HA 1XMXA 5B1DA 4CTOA 3CE6A 3UG7A 2VF4X 1RKQA 3WGKA 4Q39A 4AXXA 1NL3A 5KJCA 2Y1WA 1K1EA 4S35A 1MT3A 1OGYA 1ZN7A 4CYMA 3WAJA 3A1FA 1GA4A 1UBEA 1V48A 1MDBA 3IILA 4I3GA 3L04A 5D6NA 1VA5A 3S68A 1PJ8A 1EAMA 3PD0A 1S7GA 3QYPA 2C2GA 4ZOAA 1PV2A 3LUBA 1O6GA 3BD8A 4ZKDA 2PSSA 2FDRA 3NWBA 4W8OA 1UQTA 4D82A 2NP7A 4GLOA 2MWMA 2XDQA 3T34A 3N0XA 4OVKA 1M2JA 3BWVA 1P4GA 3I2FA 3H1FA 2QT1A 1JDNA 4TS9A 2E3JA 5LJIA 4B4OA 4CPDA 4R40A 5DM2A 4CCAA 2EATA 2XAUA 4K8OA 4LRQA 4P1ZA 3JWJA 4S0XA 5HF9A 4UEQA 5BNFA 3RVKA 3WFIA 4GSLA 2XD4A 1XWWA 2BN4A 3NANA 4IR7A 4LCJA 4Q9IA 4AIIA 4P3YA 1KHHA 3K9GA 2VIIA 3P45A 1H4VB 4C6RA 3Q41A 1DXOA 3S3TA 3ES9A 5A4MS 1Y7LA 5AXAA 1P0PA 3GUVA 3OOYA 3TCNA 1J00A 2V3VA 4R1LA 5ALWA 4E2ZA 1QAOA 1R8YA 2MSKA 2N46A 2KPOA 2FE1A 4PYRA 4WN9A 1WLSA 2HLHA 2V9CA 2WOJA 3VR0A 3X44A 3KO8A 2VF8A 4V1CI 1UL1X 4YLYA 3I6QA 5AJUA 1HKHA 3MT8A 1KK1A 4KXWA 1ZIYA 1V8ZA 1HFJA 2G82A 2CYBA 3BDIA 4M0LA 3TLZA 4FB5A 3OZAA 4JUAA 2VAXA 4L2IB 1VLQA 1IBSA 1JLHA 4UC0A 1NHGA 5B7PA 4PLTA 5JADA 1E1KA 3DLBA 1Z0KA 1ZJ5A 2YMLA 1XZBA 3FF1A 1KZYC 3L0ZA 5A5FA 1CLUA 3OZSA 4MINA 1V8BA 4EGSA 3E5MA 3OP4A 2YHSA 2LRHA 2B3TA 1JQKA 1X1QA 2CL0X 4Y6OA 2XWQA 3C8UA 3O3OB 1GU7A 4KLZA 3ZD9A 4PYQA 3HFRA 2YXPX 1X1DA 2QRKA 3K16A 4EWLA 1DB3A 5HRAA 5FPPA 2VP6A 2PD6A 3VGPA 2A9JA 1C30A 3WOVA 1BU5A 3E9EA 721PA 3LX4A 1F2UB 3OH8A 3PNOA 4Q7JB 1C3JA 1M9NA 5HTKA 1LW7A 3KPYA 1O54A 1XQ1A 1PF7E 1Z6AA 2ZQZA 4IG4A 3UC9A 1BHQ1 2I1WA 1U5BB 1RI1A 2RGAA 4X1YA 2H7YA 3X1DA 1FP4A 1RVV1 1CDOA 1NKTA 2HF2A 2RHGB 1BRTA 5F7OA 1DAOA 4C05A 3SPXA 1GUDA 1DBWA 1UJNA 4WXRA 1VKOA 2ADOA 1D5CA 4NCXA 2QRLA 3CBGA 3LYHA 2XCRB 3W5BA 1WVIA 4HN4B 1G59A 1S0UA 4GT1A 2BGKA 4CHTA 3GC6A 5HCNA 1XWIA 3ND7A 5AVWA 2QX9A 4GR5A 2QT0A 1Q17A 4IHJB 3RC1A 2J45A 1FC0A 3AZPA 2C5AA 3BVPA 3RKUA 4CKYA 1MX5A 3D7KA 5EE9A 5AQEA 5AVKA 1K7XB 1UQRA 5IWCA 2IPMA 3EXHA 4D97A 3VZBA 1GADO 3AKZA 1D1TA 1WF3A 2Y4OA 2YZKA 1GG8A 1Z7EA 1H93A 4ZVQA 3R5HA 4KZPA 3OHSX 3RAGA 2ZJ7A 3RRYA 1GV0A 3PC2A 3Q5GA 4K86A 1TTQB 1ULTA 2NUAB 4MH0R 2GAFA 4N18A 2R7KA 3SSAA 4CKEA 4YT2A 3VTAA 5KVSA 1M1ZA 4Y9DA 3UJ9A 5U4XA 2B4RO 2D00A 1LI7A 1EGHA 1FNMA 3LHDA 2C2WA 1S8FA 1GD1O 1SM4A 2YRXA 1RQRA 5BR4A 3UMMA 3Q0TA 5CM9C 5JCPA 1XVVA 2XMBA 2Y6VA 1YB1A 4Z49A 4TVSA 2ZITA 3Q7IA 3BTSA 4MHSA 1SIUA 4RHYA 3DFKA 1E3IA 4G5OA 3GRVA 5DIFA 1E0KA 4D3YA 1ISSA 4X6YA 1UP4A 2J67A 2SICE 2WW8A 3PDJA 5GV8A 3M6AA 4AS3A 4MWTA 5LSAA 3AJ8A 3H5WA 5HKAA 2PX4A 2G4CA 3ZDBA 1XFAA 1WBBA 2IE0A 4LDJA 4F04A 4AROA 4MYHA 3KJFA 3U1VA 3LQFA 1M5UA 1T8SA 4I9UA 5HDQA 4XD7D 4EPXA 4B5LA 5JFOA 3E18A 2CUKA 2E87A 2W71A 1K89A 1OV6A 1ULUA 4ARCA 2TS1A 2FHPA 4CDMA 2F9LA 5BNWA 4P32A 4B3XA 4C6TA 2ABWA 3ZH2A 3KNZA 3TG8A 1OYVA 2ODAA 4UJ3A 3RSCA 5FDFA 2D7DA 4PHHA 3L07A 2JVKA 2YYYA 1GUFA 2HV9A 4KI0A 1RBYA 1GY8A 2I5PO 3H11A 3TXYA 4CN8A 5HS4A 2HIMA 3R7WA 2XUJA 5L40A 1VL2A 2UYQA 2YNMC 2JZOA 2H1SA 1GPUA 1TVEA 4DV0B 2P5YA 3WC4A 2RSLA 4KTVE 3BFVA 1UK6A 5F2OA 1YFKA 2LCFA 1VLJA 3DE3X 3HCOA 1GRNA 3KT0A 4D81A 1U1DA 1YVUA 4JYAB 3B1KA 2H4JA 2F1KA 3R7AA 5HIJA 4IILA 1KFEB 4Y6PA 1QC5A 2QTHA 3N6VA 4YJDA 1QRSA 1R0WA 4BWGA 1MGOA 3IVCA 1G3UA 1P6UA 1NZDA 2PU7A 1BOFA 1PRYA 5TQ2B 4OI1A 3QRWA 1NR7A 2IYYA 1V7PC 5TGDA 2CNNA 3EA5A 3K2EA 4KFSA 4Q1CA 2XYQA 4EARA 3V97A 2FUG6 1TYCA 4MCAA 1O0SA 3U5TA 1GAWA 1VE6A 4KAAA 3T5BA 3OTHA 1N5DA 2JHAA 2P9TA 3BREA 3M6LA 3T3GA 4BVAA 4C3ZA 1OC2A 3B1WA 4HZGA 4ESOA 4MVJG 1IQRA 3GJTA 3IP5A 2WBLC 1Y9ZA 1MF7A 3GF4A 4KAXA 2AJDA 4D0RA 4XOUA 1ATZA 3B3GA 1W88B 2X4DA 4M89A 2P9JA 4C04A 1VYVA 3DVAB 1I4TD 3AJRA 2B4TO 3GLTA 3KLMX 4TUYF 1UPAA 1YA4A 4WVFA 3HYTA 4MVYA 3SC6A 5C5IA 1H4SA 4CTNA 4J2HA 4QU5A 3Q7PA 1UPUA 3MA0A 3U6BA 1QFZA 3VO9A 5K05A 5FKJA 4N76A 1IZ8A 2B30A 3A1TA 3W2GA 4WBXC 5L3QA 4LF4B 1H0HA 3N2ZB 3T0FA 3CUVA 3FPFA 1H2ZA 3PQDA 4FYWA 3R5SA 1CNEA 3DBVO 3I0NA 3U3MA 3DULA 2R6AA 3M1IA 4RVDA 1LDMA 1Z88A 1SC4A 1E0JA 4X6UA 2IYEA 1QF6A 1I32A 1XZCA 3I2GA 3V34A 1ZGHA 1CIVA 1RYMA 3PXDA 3DF9A 3R6DA 1XMIA 3RYCB 1QGUB 5HNKA 1QO7A 3B1VA 1CS0B 2QVBA 2ZTSA 3BKWA 3EW9A 2VRCA 1GITA 2NSJA 5K0EA 1P9RA 2PYZA 4LK3A 1Z4IA 1AV7A 1JLMA 2H5JA 3PJGA 4ND6A 3WIVA 4OYLA 4ALIA 3NFYA 1EH5A 2J87A 5CLQA 2MCFA 1YZKA 1TC1A 4KH0A 5BN3B 4G0VA 5FUVA 1GU0A 3RVNA 1KDTA 1LQ2A 1U1EA 3CNLA 4G81A 5D85A 3VR6D 4BLUA 3EPKA 2X23A 3AJ9A 2E37A 2WYIA 1R9NA 5LXTB 4FHZA 2XGJA 5AI0A 3LFUA 1NW8A 4LHZA 5THKA 5DOZA 4U9HS 3FCUB 4GC5A 4BQSA 2BH2A 4H7KA 1S3SA 2VT2A 1RI2A 4B3BA 3LKBA 1BMTA 1RRVA 2Y66A 1G63A 3DMYA 5JMPA 3W7AA 2V7BA 3MWGA 2QXYA 3VSAA 1QIFA 3MYRA 2OY0A 3BJZA 3PUXA 3RC8A 2DKNA 4RULA 3SXUA 1LDEA 4KFUA 4QJIA 1RVDA 4ND3A 4QXPA 5KQSA 1QBKC 1TZMA 2IIPA 1KMCA 4L08A 2J4FA 5EZYB 4G23A 4QXRA 2VZ0A 5AW5A 1FVXA 2XOEA 3B3QA 5AVOA 5CDTA 4DADA 5CG2A 5DYTA 4TT3D 5KNDA 1BNCA 3AVVA 4PLVA 1BDJA 4L4YA 3KWMA 1R1DA 3O21A 1Q1QA 1HDEA 3NQ41 3ZE8A 3OHPA 3V7YA 2WWGA 2YJ3A 4EMBA 5CA0B 2P2LA 2AV6A 4RA9A 1L5KA 2HX1A 2QSJA 3V8EA 1UODA 3RVMA 4BC0A 1R0XA 3EF1A 1WZNA 3CH4B 3WJAA 3HDTA 1L4BA 2FR8A 3T94A 4G85A 4YCDA 5DW0A 1U8XX 4ZYZA 1EUDB 4PX5A 1DQZA 3GLIE 4Q9DA 4V3BA 3FKSD 1DMSA 1VGRA 3ORHA 4UM7A 1OPXA 3RHTA 1T25A 5FBHA 5MGNA 4X71A 4GOLD 1JXAA 5LCXA 3UAXA 3WWZA 3BICA 4W8HA 1QVVA 4J0CA 1MAAA 1GPJA 2ZSUA 2X2PA 1RJFA 4PS0A 1WETA 3ZH9B 1T2NA 4L75A 3EFEA 4MVJM 3UHOA 1QRUA 1WAMA 3ENKA 5JVDA 3M9LA 4WOPA 3BQMB 5HIAA 1IOZA 4EI9A 2YHIA 5SYAA 4IGKA 5BVHA 1N77A 2I6GA 4KR3A 1X42A 5GZ3A 3ISJA 3BQNB 4HGNA 3KOOA 3MUFA 4HRXA 4TQAA 3DA8A 3ZV4A 1SPXA 5H16A 3SFZA 1EHCA 2X8JA 2QYHA 4LY3A 2FQ1A 3IQDB 4AKTA 2XRFA 4TWRA 3GLFE 2HIHA 3U1BA 4DG8A 5TE9A 4EPRA 3R44A 3SZRA 4M38A 1FUUA 1UDRA 2JJ1A 1L7MA 3HDVA 4KLNA 3C1TA 1OXXK 3H19A 3IUEA 3H3JA 2P4HX 3EUEA 1SR8A 3DE1X 3D54D 2RDMA 1O4VA 3HN6A 5CVUA 4CDRA 3M5CA 3OT1B 4C3VA 1DWOA 3HDGA 2WJYA 2GDZA 3GOHA 3OZBA 1ZITA 3INRA 3A6HA 4A3SA 4F5WA 5K8TA 2VRNA 1MOZA 4RTOA 5I51A 2LP4Y 1SXGA 1OFTA 2VJYA 1E79D 2A9OA 1EAYA 2ZI9A 4EQ6B 1PZHA 4GEGA 1QFYA 4EYGA 5ALNA 2VTVA 4L9WA 4Y6LA 1NNEA 2HDNB 2XJ9A 5DGDA 4Z9BA 1F14A 3OE7D 4NBTA 2FMFA 4JQSA 4KWTA 4KK4A 5C8YA 4EUEA 3ORQA 2AZXA 2OXRA 2ZB4A 4HAIA 4R9NA 3QIAA 1U7HA 2CVQA 3LUFA 1QPGA 4YH1A 3QX3A 3ZKAA 3QU4A 4HK4A 3CLVA 4L5IA 3C98A 1NF8A 3PXEA 2BFMA 1HL7A 4O4HA 2QPOA 1QDLB 2ZRBA 1EFVA 1BD4A 2VPQA 5DM0A 3MXOA 3IP7A 5BWNA 5ETJA 1TIPA 5JJ5A 1L8LA 2FQXA 1LLDA 3IOMA 5H81A 5B57C 1LPBB 1U8EA 4DJ5X 5KKNB 2B69A 2QP4A 2QZSA 4M49A 5D3ZA 4FOTA 5AXDA 3SC4A 1ORHA 1VKJA 1Z0IA 4H18A 4UOZA 4QGFA 1NTRA 5B3LA 2P4QA 2ZWVA 1PEKE 3R0IA 4YJHA 2IHBA 1W581 1V7CA 4IIEA 4IZHA 2ASEA 2J3HA 5ALFA 1JWLA 1PGOA 1DZ3A 1CRQA 2EFEB 1M2GA 4G26A 1Y5MA 1DO0A 4M7OA 2NLOA 1N9GA 1R4ZA 2VL7A 3O2SB 4LZZA 2GVNA 5CRIA 2BEKA 1ZRNA 2HWKA 3PFNA 1UMDA 3NZEA 2Q0XA 5L3VA 1TZKA 2W2KB 4R8LA 1ADBA 4ESEA 3TF5A 3TLYA 4KWHA 3QBVA 5DIZA 3DZJA 3DUWA 4HNQA 3VVBA 2BC9A 2LWIA 4YUXA 2UZ1B 2J5BA 4X6LA 1JZTA 4BQEA 1QG4A 4Q47A 3LVBA 1TW3A 2NVOA 1PVVA 1L4HA 2P9EA 3LLSA 4GI3A 4ZREA 5EVCA 4UW9A 3VDRA 2GCGA 1N8NA 2BFDA 3W34A 3WXMA 4QGAA 3E7WA 5K51A 2QAGA 4I5GA 5DEOA 2XQVA 3UPUA 2IBMA 1T1IA 1TLTA 1A9XA 1WKVA 3UYKA 3HCAA 5EWMA 4NE7A 5DH9A 2V98A 4RLFA 3KYIB 4IDQA 1ECJA 3AW8A 4PPGA 4AUEA 5C5DA 1Z2AA 4P3PA 3HBFA 3TLGB 4UAUA 4AURA 3TUZC 1RHKA 3EGDB 3T7EA 1O1YA 1C1DB 1E1RA 4NYJR 4Y30A 3INYA 4RHCA 3U31A 5AHXA 3W6ZA 3H0CA 3MJSA 3OP1A 4IJKA 1XCPA 4TLEA 4QHSA 3UIEA 1Y5IA 4E51A 3Q3IA 1AM4D 5BSRA 1G64A 5AKZA 3KQQA 4C88A 2PRJA 1N1EA 2ZSEA 5H4GA 2FP4B 3GG9A 5J23A 2ZTUA 1H42A 1U2RA 1GCIA 4MR9A 5BWMA 1B3BA 1NBOA 3COVA 1BXZA 3OSZA 4ZDWA 4OSOA 5KQGA 3CVJA 3GUYA 1GKKA 1M6VA 3WQRA 4LOAA 3EVBA 4Q7QA 4AS1A 1N2JA 1UWCA 1VECA 1XAIA 3BOSA 2AJBA 2X7HA 3F5FA 4KBGA 4TZTA 5AKXA 4BTEA 2L19A 4M53A 4I55A 1XDWA 2XV1A 3H2YA 4L9SA 1L9XA 1UJ4A 7ABPA 1Y1KE 4ZTZB 1D2AA 2E9SA 5DSZA 1P4SA 1AH2A 4U00A 1EP1B 4TXNA 2PMBA 2ZG6A 1WB5A 2ZWAA 4NMWA 1RYFA 2FKAA 3CH7A 3HCRA 3K35A 1V8DA 1TUEA 3D43A 4I1IA 4CL8A 2QSUA 1MIOB 2R86A 1CE8A 1DKUA 2Q1WA 3OJCA 3N8NA 5EIFA 5EJGA 5LUBA 3MRVA 3DZDA 5LZ4A 4X3CA 2AUTA 1QRDA 1AS3A 2NP6A 4TWJA 1YJ5A 4LQLA 2MIIA 2AFHE 2XTAA 3F9CA 1WDMA 1QHHA 1ZHFA 4EF5A 1W36B 3AR2A 5I7UA 3RRXA 2MOKA 5DM60 5I9BA 4WK4B 1W8DA 1PGQA 2C95A 1DKOA 2VJNA 3WIOA 3COZA 3EZYA 3NEAA 1IJBA 5FPKA 3UUFA 1V1MB 4Y2XA 2J3DA 1PD1A 4IGIA 2AN9A 3A6PC 5IUKC 3MWKA 1P29A 3S29A 3PC3A 2HHLA 4CLRB 6GPBA 3CVYA 2CZCA 2P75A 5CIYA 3P19A 3GPLA 1DGQA 2B83A 2ISCA 3CNOA 3O8QA 3H4IA 4FHFA 4ENWA 1T3LA 1QC5B 5A05A 5DTMA 5J4LA 3I45A 1CY8A 5TPWA 2P35A 4OXIA 4WNAA 1V1JA 3KDSE 3H1GA 4MKZA 2PL3A 2DHQA 2QJWA 1SA0A 2V45A 2YDYA 3PGMA 4YMTA 4BOYA 3CHYA 2J4CA 3L7IA 4R1MA 4X8MA 3GVPA 5L7TA 1O8CA 4DDVA 4WBNB 2CLSA 4F6CA 4LXYA 4EA8A 2B6NA 2H0QA 2H59A 1KNQA 3CLRC 1BX3A 3E3LA 1WB6A 3JR7A 5DZSA 1JSXA 1E6KA 1LA2A 3DHWC 3PC4A 4HWPA 1MAHA 4JT9A 4INOA 4AICA 1S89A 2AEEA 2GMWA 3DAYA 2R6GA 5COQA 4PIMA 4ECAA 1KOJA 3HU1A 4JBXA 4FFWA 1T8PA 1QZZA 2JD2A 2D13A 4LXIA 1CD5A 3AI1A 4MO2A 3CZ5A 5E6SB 4E09A 3I4LA 2O05A 4RAOA 3G0GA 4L8GA 1PW7A 1D1QA 5FADA 4W5QA 1GT6A 3ZVRA 3CX3A 3FWPA 3O3MB 1KEPA 1S9DA 1WHTB 5ENVA 4EYSA 4PNZA 4L73A 1FNNA 1E0DA 4UTOA 1EGAA 4P0PB 2F43A 3EARA 3FLAA 1OU0A 4X60A 5D00A 5BR7A 2AJTA 1O94D 1NUUA 3G5UA 4X45A 5EERA 4KIFA 4TTPA 1PK8A 4PO9A 1LBTA 3JAWB 1NW6A 2VHXA 3KELA 4HEA6 4IV8A 3RJ9A 3WGLA 4CV3A 4HH4A 4DUGA 3CPJB 1PSZA 5KSZA 1YD7A 1KO1A 1XJQA 2W6ID 3RK0A 1UM9B 4ER0A 4NJOA 2OCAA 1JU9A 1X94A 3MRXA 1DJOA 4ETNA 5EHQA 3PC6A 5HOQA 3MMNA 3VZRA 4UD6A 2ECFA 2PX5A 3K72B 4I6EA 4V0NA 1HBJA 1JGTA 5A2QA 4JLJA 4KYVA 2FQYA 3IQZA 3REFA 5ALXA 1E2FA 2NV6A 3PT9A 5AOBA 1G8GA 1PWEA 1FRFS 3E7FA 3TIFA 5JEDA 1P39A 3TFOA 3THXA 2F3RA 3WP1B 1PE0A 3OBIA 3RRMA 2ZUFA 4EO4A 4HZIA 4HFMA 1W36C 2H54A 3AUAA 2FAXA 2JA2A 3FOCA 3ESZA 4OMUA 5EL0A 2NM0A 3QOXA 3G88A 2NQ8A 3N75A 4CKZA 1ODIA 4NL4H 3A2KA 1HE8B 1CR6A 3OPYI 1V5GA 4DNFA 1NRXA 1YI8A 3C7TA 3NCTA 1W30A 1Y3CE 2WABA 2FZ4A 4M8SA 5IX8A 5G0SA 5HIKA 4B74A 3WRXC 4YUAA 2JEOA 1JPNA 2EX4A 4NYMR 2VJCA 3TTWA 3TEJA 5HKOA 1E99A 3GW8A 1ZL0A 4FBMA 1VDZA 4QSHA 2P6PA 3GH3A 4EMUA 3UB2A 2OENG 3KYCB 2IEBA 4I50B 4QTTB 3GLHE 4X1YB 4D80A 2WU0A 1FA9A 2P6MA 2DGDA 4F97A 3BH7A 4YDQA 3SR0A 3OM0A 2BAGA 4AN0A 5IDWA 5ADUS 2BFFA 3C6BA 1Q1GA 5K8IA 2R0QC 1ZMRA 5TVGA 2W48A 2WI8A 5IG2A 1IB6A 4B73A 3AP3A 1XCGB 2YZ7A 3OZXA 1FQOA 3RUPA 4D5EA 4TVBA 4BNHA 1LLCA 2PX2A 2Q3CA 3ET5A 4V2UA 5PNTA 3RUDA 3UBMA 2P9YA 3LUKA 2KBEA 2FRXA 4RHTA 3JQCA 4UUMA 3X2FA 1NAIA 5JS7A 1VP3A 2ZVQX 4HDMA 5DP1A 1AS2A 1HLDA 3SG0A 3TL3A 1NN3A 4C03A 2I76A 1OFUA 1YOBA 4K6HA 5F5XA 3ZNQA 1ENYA 3FIUA 3R76A 1OLSA 1DBRA 1FNDA 1HEIA 2ATIA 1CT9A 2HU8A 2YOGA 3A3NA 1FYFA 3GIWA 3IALA 3NIBA 4L3VA 4YLGA 3W8EA 3FZEA 5JSUA 3WRXA 4NCJA 5P8WA 3SF0A 2J3LA 4Q4HB 4GL2A 1D6NA 3ZU2A 4RTLA 2ADMA 1KKLA 3PC8A 1Y5LA 1FIUA 2RB5A 1W4RA 4L8FA 3VU1A 2A2ZA 1FYXA 4ZHQA 1WV0A 3GJ5A 5E6UB 4DLRA 2J0QA 4PC7A 4LWQA 3OCVA 1U7UA 5HUQA 1NRJB 1M74A 2PL9A 4GRDA 3KL4A 2FN7A 2Q4DA 4A0SA 2G3YA 4HH0A 5AIAA 4RKFA 2BY4A 4A36A 2J5QA 4D6PA 3VAZA 4KSYA 4PZCA 4R2LA 1GA6A 4ZOLA 4RXTA 1EINA 4GYWA 4G0MA 1SOWA 1U4OA 2IQ5A 2YNMD 5HYVA 2B9EA 1Z8NA 2BMVA 3U1TA 5AP9A 4FDAA 1YQ9A 2XPCA 4IFTA 2B5OA 4JLNA 3SJCA 4D44A 2IWHA 4BX8A 5BSKA 1BE8A 4H7HA 4ZZIA 3FRIA 3GFFA 4ZMSA 4LSWA 4C14A 4EM6A 3DM5A 4LNHA 5AW8A 3MTQA 3KK0A 3I23A 5EFZA 5BPHA 2HMVA 1EJ0A 3HSKA 5KSOA 4YQYA 2DH5A 1WS6A 1CF2O 5A9SA 3G49A 1S01A 3IHTA 4QSMA 1CDZA 1DTSA 2VR1A 3JVEA 4XH9B 5ADHA 1X7XA 1R27A 4RETA 4R1UA 3CURA 2OV1A 4GMDA 3DNPA 4RJ2A 4OL0A 3V00A 2JBHA 4W9NC 1VPTA 1WA5A 2HF9A 1EKXA 5GIPE 1CZRA 2GGSA 4GKAA 3UKOA 2G67A 3VO2A 2ZB2A 3OEWA 4RMGA 2FEPA 1PIWA 1W1IA 2CZQA 4RAQA 1M72A 2ZRGA 3T3MB 1FPQA 2X0IA 4PNEA 2XHZA 5FHRA 2O48X 2FMIA 2CFRA 1XROA 2P69A 2PR2A 3UMRA 1QP0A 1TA4A 1QVWA 1Q7CA 4Z2YA 3WLAA 4ES6A 2WQ6A 3W4KA 1ZJJA 2ZCUA 3HRKA 4ZI7B 3N0RA 1VOTA 3PQ7A 2CXOA 1D2CA 3U61B 2Z09A 1ZUD1 3A6DA 2VP0A 4IRMA 2SHKA 3VPCA 3ZV7A 1CPYA 2W90A 4Y2VA 5G0UA 4FS3A 2BDTA 4FQ8A 3DYVA 1XRNA 3VVMA 4WZAB 2VQSA 3ZHRA 3F2IA 2WINI 4REMA 4NENA 1M66A 1RXCA 2X14A 3TZCA 2WJ6A 3LI2A 4BLRA 3FNHA 4LHEA 5C53B 2GD1O 2FGJA 2VHEA 3GDHA 3OJOA 4WLFA 4AB1A 3KB6A 3OZFA 1S4QA 4FCCA 2OMKA 1SVKA 3P96A 1Q92A 1IHXA 1ZIDA 1QOZA 3ECCA 2X58A 1KEWA 2NXCA 4MCHA 1WBDA 3WYDA 2WIKA 4YRKA 2XT6A 2G6TA 3ESRA 3NHPA 1F5SA 2WT4A 3CR8A 1J1ZA 3O8OA 4ARZB 2C2YA 1QTIA 3SNHA 3WYBA 2GSWA 3ZDXB 3QVOA 1ZH8A 1G8KA 3T4XA 4ER3A 1EVIA 4ND8A 3CLRD 3DB1A 1EUCA 4UFPA 3SHTA 2YCBA 4JJAA 3IS3A 1VCMA 4OX9B 4P4LA 1GZ7A 2VDOB 3DEYX 4GOMD 4D2IA 3C7DB 3GRRA 3ILVA 1E3JA 2N75A 4M9RA 1G0OA 4NE2A 4DSAA 1G66A 1F6DA 1HYEA 3G2JA 5BOSB 4U3JA 5LDDC 1RYZA 4LRYA 4Q4HA 5JNVA 1JS1X 1YZYA 2AFIA 1BS1A 3I2IA 4LK2A 4ZQEA 1F12A 3WYCA 1PT7A 5IJWA 2P6UA 1JR3E 2DSNA 4HX5A 2FW1A 2WFLB 1E4EA 1AUOA 4DR2B 3NU1A 5B55A 3J7TA 3L8MA 2HNKA 1TZCA 3AP2A 3GFVA 2RHTA 1FSSA 3LK7A 3JQBC 3UJNA 2QG6A 4MQEB 1DUSA 3AVOA 1HV8A 1PWHA 3WRYC 4FU0A 4X6XA 2FX2A 4F11A 4F12A 3SVLA 5KO2A 1ETUA 3A6JA 3BJMA 1DQSA 4FGSA 2ZJ3A 4QQFA 1KZHA 3N05A 3AM1A 5GP1A 2IPOA 1WB4A 3GFQA 3GH1A 4GVXA 4Q3NA 3W6PA 4AMBA 1B2LA 4D8WA 7GPBA 2GESA 3AKDA 1RYHA 3RVJA 1DPFA 2PL5A 3OZCA 1KK0A 2ES4A 2V6IA 4ZZ2A 4WT7A 4JS0A 3KOXA 2GKGA 2RJ3A 3KOYA 4ZAWA 1GJRA 2HJGA 4E6PA 2KQUA 5JHGB 4Q4AA 1A8UA 3OZDA 2OC4A 2VUHB 5KHOC 2BYTA 2ALJA 5K7SA 3ZGLA 2H3HA 3KXIA 1U28A 2VZEA 1QVZA 4OMCA 1TGVA 3MS2A 1Y3HA 2Q5OA 3LHIA 3R3VA 2LCIA 2M1ZA 1QK5A 1UOQA 2HMAA 2O4UX 3MOSA 3P1JA 1UPCA 3SZMA 1NVUQ 2VJPA 1TJPB 2ZRAA 1YBFA 1GRCA 4G25A 1RYDA 4RJIA 1KFKB 1AHIA 1VMEA 4HMPA 1NY5A 3LK6A 4ZFNA 4YRMA 5KVCA 4RPGA 1SXQA 1DBQA 3W0LB 2A1TS 3BK7A 2Q5IA 4BXOB 1N6LA 1SZCA 4IG9A 3K8QA 4NBVA 5L3SA 3BH6A 1R9JA 1SQGA 1WUYA 4KHZA 2FPIA 4JP3A 3M83A 3ROPA 4ZHSA 2YS7A 1EWKA 3OZUA 3JQFA 3EMKA 3F90A 4HXGA 4RF3A 2I6FA 2SKCA 3DEZA 4ZVOA 1Y1TA 3LQ4A 1AMOA 3GPCA 4WESB 4H9GA 2HSZA 4DXDA 4XVQA 1JAZA 2IEZA 1HE3A 1DARA 4B76A 5EJ2A 1K0UA 1P72A 5IM5A 1AXEA 1L7AA 1P2SA 5FF9A 1PU2A 4J2TA 4DWWA 1R9MA 3TOVA 1LNSA 3K1AB 1GLGA 3N1UA 1JA1A 3IAEA 1IUKA 4X1KB 1X74A 3IEKA 4Q9LA 1SK9A 4B4DA 2BPOA 3H86A 4IIDA 4P4UA 4A2CA 1U8CB 1XCBA 4BQIA 4H7DA 5KYKA 4R2HA 1JDSA 1QH1B 2CHFA 3BMQB 1W0KA 5BNIA 3HCCA 5ILOA 4YECA 1JHYA 5DXAA 3OKPA 4YV7A 2JGDB 1JEDA 1QO0D 1JMKC 2Q3HA 2YFQA 1E3MA 4EHIA 4MW1A 3G9QA 3DP7A 1IXRC 4DMKA 5EQTA 1JYSA 1DBIA 2JFXA 1Z26A 2Z4SA 3HBLA 1ND6A 3R3ZA 3IAFA 1JHPA 1E6WA 4YO7A 2IZZA 4J9VA 2R5FA 1XEAA 2FLVA 3W5SA 5DHQA 4AC9A 4Z4QA 1XNQB 4FD2A 2PRKA 3IMKA 3REQA 1JYFA 4MNTA 4KPUB 5T3UA 4EK9A 3IKLA 4MW7A 2HC9A 2AF4C 2QQFA 2R7NA 2XUGA 1GZSA 2VXYA 3FPHA 3O91A 2DU8A 3W9SA 1LX7A 4FJ0A 5CHEA 2C00A 3AP1A 3WLPA 1TTTA 4DCUA 3I73A 1XG5A 5E1BA 1DVRA 3ORYA 4WCFC 4DHEA 3RIYA 3Q3JB 4QIHA 4BL5A 3DM9B 4JD5A 2DT5A 4RFLA 2XNKA 3BRWA 3DMTA 3ETJA 3IQFA 3IRUA 4Y7DA 1Y5RA 3DTVA 4I2VA 4BMPB 1PWYE 2IKQA 2O2CA 3JRWA 5LZ7A 2ZE7A 3RG8A 4JSTA 3JQQA 3HKEA 4RGYA 3ZDQA 1RZRA 5J9FA 5IKXA 1F20A 1AT1A 4V0MA 4BFCA 2VTKA 5FTNA 1H8HA 1XEWY 3UT0A 1WZEA 2RH8A 3T9EA 3VMFA 4LF8B 3BGVA 1CNFA 4B7AA 3DPIA 5E4FA 3VOAA 4DTCA 2JAUA 2WM2A 3TH5A 1XU7A 1L7OA 3PGXA 5DLYA 3ZHUA 4WKCA 2QLNA 4A0HA 1VHTA 4FI3F 4OB6A 2F3PA 3RJTA 3EZNA 1UKYA 2C2KA 4DQUA 2KWIA 3DMGA 1YUMA 2JZNA 3DS8A 4GHWA 2QRVA 4MR8B 3UWDA 4DC9A 1VZ2A 2IEAA 3IAM1 3W3AA 1KMNA 1JR2A 2QUJA 3ED1A 2M32A 3KB1A 1ORDA 2R8PA 3HJBA 4UM5A 5CH3A 2K2WA 1TB4A 4YC7A 4WXHA 4M36A 2VUIB 1DFGA 2QX6A 2VN8A 5EHIA 3OOJA 3U6KA 1K3UB 4NCAA 4B3FX 1N36B 3BEOA 3BTOA 2PN1A 4B33A 3RYIA 1BTOA 1VIDA 2OO5C 3KZNA 1HT2E 2BGGA 4WKPA 3LDUA 4K9NA 3ZCUA 1SXJB 3X1KA 3QE4A 1U94A 1DX6A 2JFHA 2OM6A 1JIJA 4FXOA 4KVFA 3RIHA 3K1TA 3KYJB 4CTJA 4CU2A 4X66B 3FMFA 1RM0A 4O3FA 2YY7A 1SXHA 5EHNA 2PY6A 1XLTA 1L2TA 1EDOA 3OIVA 3ZW7A 4RQBA 4B2PA 4B75A 3A06A 2B37A 1Y4AE 2PGDA 1OLUB 3P0FA 4LJSA 2ZM6B 1G38A 1X2EA 3W5VA 3D6VA 1KO5A 3PNLA 5ES3A 1V9SA 4LZAA 2P4SA 4A6DA 4B4VA 3PLAE 2YZ2A 1GO2A 3GCWA 2WHRA 3VR3A 2UU9B 1U1FA 1CF4A 3U3RA 1Q19A 2AXPA 1T8UA 3GMIA 3K6JA 4L76A 2V1UA 4A92A 2XBLA 4H17A 3PC7A 4X90A 2AFRA 4RK7A 1TECE 5IKMA 2H1VA 5AYVA 1AGRA 2YNMA 4R84A 4BKQA 2GD2A 1M6VB 1ISIA 3DAHA 4FN5A 3AIMA 1LX6A 1Z0UA 2Q0HA 3LGSA 4PFJA 4OQMA 4ZPJA 5T4BA 5JS6A 4YX9A 3FTQA 3NHRA 3C87A 3Q2IA 4GI7A 4I4TB 3PB3A 3RARA 3BTUA 2AUNA 1HURA 3BGOS 1X14A 4DM7A 2JLQA 3KTDA 2FFAA 2YWDA 5KOHA 3I52A 2HR1A 2Z58A 2HI0A 4OXNA 1ADGA 2JBAA 2EV9A 4FFVA 5J5VA 3WJ2A 5TQ0A 2JS7A 3ZLTA 2GF9A 4B32A 2INGX 3EGDA 3V4ZA 3UHFA 4ZKEA 1H3FA 2J09A 3O95A 2GCPA 4MS4A 4M4SA 3T38A 4BO6A 4XFJA 2NU6A 3QBDA 4CUZA 1ZXLA 2ZATA 2NU7A 3GFPA 4CN9A 2P5SA 3T3HA 3CGGA 1HDXA 5H5JA 1ZFNA 1L8XA 4I08A 1GNRA 2NU7B 3H3XA 2VC2B 3D6TB 5ELLA 4HHEA 2XCSB 1JU3A 5TGTA 2YYSA 1BVUA 1X7ZA 3D2BA 3RG2A 2RK3A 1SHJA 1HETA 1JZSA 2GM3A 3IELA 3LXXA 3O2QB 4HMQA 4LWZA 4WERA 5CH8A 1Z0JA 5D8DA 1R4MB 2ZIFA 1JEAA 4MS1A 3V7UA 1R4AA 1WCWA 3GK3A 1QYCA 1SXJA 1UEJA 2JBAB 2DBYA 4O6VA 5J2TA 4RY0A 5ITVA 4A15A 5HQJA 5KYWA 4Z9AA 4X20A 4JI7B 1D2HA 4WKOA 3GEPA 4P08A 4UEJA 4WFKA 3FMGA 1IPHA 1S6YA 2QLBA 3IPRA 2FPMA 1VQ1A 3H2GA 1JJIA 4GMFA 3EA4A 2FJPA 1J06A 5C4IA 1I7LA 1NY6A 2CL6X 5BYKA 3FOFC 1W25A 1WPRA 2J9GA 3UC5A 1Z0SA 4GC9A 1WW3A 5LD2C 4C5CA 5M2QA 3PNSA 1UF9A 4LVCA 4V24A 1VZ3A 2D0DA 1GVHA 2UUAB 5I3CA 1M6YA 2BFBB 3JVUA 3I9NA 1DKNA 1EK5A 2C97A 1QYVA 2CUTA 3OMLA 4KI7A 4JVLA 3SCZA 1D2NA 3WLNA 821PA 3U56A 4QM6A 2J3MA 1N3BA 1KPIA 2RGNA 2IU6A 3SQLA 1JV2B 2QN2A 3DFZA 3FVWA 3GPDG 2C8LA 5K0NA 4ZJPA 2PJZA 1HT3A 2XUIA 4ISCA 1OD6A 4K2AA 2X5KO 4R5MA 1WDTA 2PGXA 3KZ1E 3RVLA 3FB1A 2PTHA 2PA0A 2NO4A 1XIVA 2BHRA 3BXHA 1W5AA 2FG5A 4RABA 1K6JA 1EM6A 3KRTA 4KK3A 4B6SA 4V03A 3C2QA 2G4LA 1S4MA 3ITDA 3F73A 4HS9A 3QVVA 3AUYA 2HT1A 3NYRA 1M6NA 5FA6A 1JBQA 1I4DD 3MILA 4HYQA 1FX1A 1RJ9B 2YV5A 4X7RA 5EPOA 1Z7GA 1IDOA 3HHEA 3LLCA 5SYNA 3X43A 3K1YA 4C4PA 1PBTA 4Q3EA 1XKQA 2E6KA 1RM5A 4ZO4A 3W6OA 3DYIA 1KP9A 2Y0PA 2F1RA 1W36D 5HGXA 4J7AA 3G1TA 4LQDA 5I8PA 5KTKA 1Z83A 1ZOOA 1DC8A 1L1EA 3FCYA 3I9FA 3F6SA 4B31A 1JHMA 3U4HA 5BWOA 3M5DA 5EMNA 5BSWA 4JKOA 4DV2B 1OZGA 2ZWOA 4IICA 2OQIA 2WWTA 2PLFA 3A25A 3HNOA 3IAS6 3KVRA 3WBKA 4F5EA 5ES4B 2Z2ZA 4RK6A 4KDFA 1NWCA 1UZAA 3MTEA 3ZLUA 3HVHA 3GN1A 1P2TA 4Q7MB 4KW7A 2PO5A 1ZD1A 1CUZA 3KYBA 1D6MA 1E89A 4RMHA 3P9ZA 2V3WA 3AL3A 2I34A 4DNOA 4DLWA 3TDNA 1DKPA 4I99A 1N78A 3PENA 3VISA 1FNBA 1YZQA 1L5NA 4BUJA 2WSMA 3GT7A 3OM8A 4TLDA 1DRWA 3AESA 3KD2A 2V4ZA 1I3KA 5TDHA 4GPZA 2H2FA 1OBHA 2W83A 2PSEA 2H85A 4RPJA 2ZJOA 1SUCA 3TI7A 3L0YA 1WQ1R 5LB4A 4RTJA 1IK6A 1A7AA 1VE7A 2XT0A 1M10A 3EGXA 4QPJC 3T3IA 3TSWA 1IQ0A 1V37A 1EBFA 1NXQA 1O9HA 5LA6B 2BSQA 2JG3A 1A9TA 1KDOA 2FMXA 4BLSA 4Q3LA 1QZ3A 2JEZA 1G3RA 3FN4A 4YMLA 2R7MA 5JHHB 2P9GA 4DIBA 2AOVA 1FK8A 1IL0A 2ATCA 3EMBA 3HLTA 4WWHA 1CY0A 3PGKA 1OQAA 4QQNA 3BRQA 2Y1GA 3AR6A 4J3JA 4MRSA 1V5FA 2CNBA 3L0DA 4DLZA 4D8VA 2I6XA 3AR5A 2VYND 3INTA 3GAFA 2AZDA 3OQIB 3TRKA 3TAXA 1KWGA 2RGCA 5KVAA 4BGIA 3D59A 3FLBA 4XD7A 3IQIX 4Z5XA 1J8QA 1Y98A 3OO1A 5HRCA 4FK8A 2TMGA 3CXRA 3H6GA 4CQMA 1EQ2A 1YR9A 5GM2A 4YXWD 2H29A 4XFDA 3AHCA 3ULKA 4R41A 2I3AA 1KJNA 1VXOA 5ENDA 2BGJA 4XSHA 2HEGA 3UB3A 4J4HA 2CMGA 4TS3A 2CC2A 1ZEMA 4I1YA 1M2OA 3L4BA 1G5RA 4MVJI 1B0PA 1GRQA 3UJHA 2YZNA 1Y34E 4DVGA 1TLFA 2W2PA 4JMLA 2GOYA 1PX0A 5H9WA 5K0JA 4AUMA 3FGPA 1THGA 4YCCA 3O83A 3STVA 3P9QA 3MJFA 3BHIA 3JZIA 1CZLA 5CB6A 4PSDA 1KK2A 1NXSA 5F7ZA 2JFUA 1JKJB 5FB3A 1ETHA 1NA5A 1DFHA 2I4RA 1VL5A 2X41A 2VWPA 3CF4A 2C7OA 3LWBA 4MR7A 5AQ1A 1B6RA 1WHSB 2FWPA 5CX1A 3L7NA 4QFMA 1KE1A 2OR3A 4JITA 4EPYA 1HPLA 3W2FA 1G42A 1A8HA 5HF5A 4MWZA 5JS1A 2XIJA 3A9CA 1PD0A 1T4CB 2C8VA 4HDRB 4NFYA 4D4IA 5A4FS 2Q1UA 3RF6A 3HA5A 3LVRE 5A4KA 2ZBRA 1CERA 1OWLA 3O31A 1CJVC 2QR3A 2RHLA 1UIRA 3L79A 4N7RA 3S6JA 2OB1A 3H8JA 4G9BA 3ER6A 1D4OA 4LRXA 2PQ0A 4RKWA 3QKSA 5F9FA 3V7WA 3IDQA 4H2DA 4TMWA 1QZTA 2ZRPA 3RQIA 1I3CA 3MT0A 4R1QA 2D1QA 2PEZA 2ZLBA 3M2TA 2YFYA 4RSMA 3TLXA 4LE2A 4D9HA 2UYCA 4ZJZA 5B1HA 4A7PA 1EGVB 1GUZA 2YBDA 4YUVA 1U1IA 2QN7A 4PEVA 2J59A 4REQB 1X1RA 3H8SA 3ZK7A 3HEBA 3PLRA 2ZJBA 2CWWA 2ZRIA 3EISA 3NS7A 1J97A 4I3FA 2Q62A 4JU9A 5DYNA 2RAPA 4Z7OB 5LDGA 2KB0A 4TN1A 2EERA 2CEKA 3JYHA 4BGVA 4KQEA 2EBFX 1O5IA 1P6XA 2VUUA 3DHVA 4CE6A 3A1VA 1JQLB 3V1YA 3L8DA 3CNNA 3PHBE 1LJLA 2WSIA 4ESHA 4HNUA 5HS6A 1UAYA 3GRUA 1IAQA 5CB4A 1X6VA 3RNOA 4TTVA 1GPAA 4CNQA 3P5BA 1KAQA 4QT4A 3W1EA 1JFTA 2WIDA 1PZFA 4LSZA 2BMEA 1XZGA 3ODGA 1QVAA 2XECA 4P4SB 3SIWA 3JAMA 5AJHA 1LPSA 3KCQA 3LOQA 2VSNA 2G70A 3GZJA 2XSZA 3KAPA 3ONNA 5IVHA 4QZVA 3GAZA 4ML3A 4MOWA 3I72A 1PQUA 3OPYB 3ZTYA 1G6OA 1OF1A 1UDBA 2JGMA 2QTVA 2WKWA 1E69A 2F3TA 1OXSC 1XFDA 1PGPA 1ZCZA 4RPKA 4FC7A 2X5NA 1B8PA 1VPLA 2ZTHA 1H2WA 3LL4A 4NARA 2NXEA 2V9PA 3DO8A 1ZOPA 3DD1A 3QVGB 2IA5A 1JG3A 1ZC3A 2WUFA 3LW8A 3EEQA 3I2JA 3QJYA 1XCJA 3HA7A 1UWLA 3DGFC 3P9XA 1SFRA 2CE2X 3L7KA 4EI7A 3WKCA 3N53A 1SWVA 2WU4A 1IM8A 3X2SA 5IDXA 1XZPA 3PFWO 3TMYA 2OGSA 3SJ7A 2N1MA 2HL6A 2O2YA 4YP6A 4ITRC 2BFPA 5H1YA 1SKMA 2HWYA 3K05A 1WVMA 4EB6A 4NMMA 4O2LA 4M7WA 4BMOB 2P6OA 2DP4E 1D2EA 3E1KA 3OURA 1JAIA 2Q3MA 3QHPA 5CG1A 3GEHA 3KEMA 5KQRA 4RDHA 1PL6A 2P3QA 3FTPA 3PNQA 3SC2B 2NACA 1JHUA 1E5VA 2Q7XA 3U40A 3M89A 5A2GA 3KFXA 4U02A 2I66A 1U3UA 5FTWA 3BE5A 3LJKA 2WPDA 3V33A 4IOJA 1HO3A 1T3GA 3J81A 2YWFA 3TXXA 2FPOA 3EXG2 3O8BA 1K2WA 4OHMA 4EGAA 1WPXA 1YQWA 2H5IA 2YV1A 3AWDA 3H04A 1I5OA 3TPCA 1EDBA 4CIWA 5F1OA 3PFFA 2R1TB 1GYPA 4UHCA 5EIEA 2WDPA 3NHJA 4MA4A 5BO5A 3DWGA 4ZCMA 3B89A 4CLHA 2VATA 5LKRA 1XAHA 4U7JA 2Z6AA 1S2MA 4M1QA 2GZ2A 3U7GA 2B0JA 4KFCA 1E5XA 1U0OC 1WV1A 2ZJ8A 1JXOA 1JDBC 1IC6A 4I5DA 4KXQA 4G0OA 5AMXA 4I1UA 4ZHQB 1G1AA 3IPAA 1ZM9A 5CAEB 2BCGY 1CQZA 1KKUA 4D8XA 2DFNA 4GU5A 5G1NA 2G8NA 2HBQA 3C3AA 4QFBA 5IT5A 4ZTUB 5EXDA 4DPLA 2J0EA 3O74A 4UREA 4WFIA 5JLAA 1EDDA 1UT5A 1U0HC 2QF7A 1P2BA 3DXXA 4MYSA 4NZNA 2QI9F 4PYKA 4J0GA 2CE7A 1I4EB 4P4SA 5H0IA 3SKVA 2ZJAA 3UGQA 1GZUA 1LKZA 2X19A 2OYSA 2D6FA 3DZIA 4DAEA 1DI0A 1KYQA 2W58A 4FW9A 4Q9AA 4ZMRA 4HWOA 4UBJA 3TKAA 1XA4A 1Z4MA 3NLLA 4QVIA 3IBGA 5C7IO 3ZV6A 2ATXA 4CL3A 2OGZA 4LF7B 2QQEA 4GYJA 1QS0B 4UMDA 1KS2A 3OTWA 1XZHA 1I4OA 3HI6A 3NDIA 4MB6A 5AXCA 2QAJA 4RH3A 2AQIA 4E5UA 1NVDA 3KT8A 3NMUF 4MQFA 2HN9A 4YRLA 1L4MA 5DXFA 3UJ3X 2Q3DA 4Y2QA 5H3LA 4YP7A 2GCNA 3EXFA 3TKLA 5KWSA 2I6UA 4LXQA 2QP9X 3KXLA 3SX0A 5BW4A 2EWVA 3ELWA 4M0DA 3V42A 1L3IA 5COBA 2QD5A 2VWHA 1NNI1 1V4NA 3C1OA 1YB7A 1X1TA 2XDAA 3HB7A 3LC1O 3U4CA 1J8MF 4GPAA 3H84A 1HYBA 1RWVA 4DIOA 3S2IA 1TCCA 1KIMA 3FMPB 4E5NA 3ZE6A 4MGYR 3ROZA 2PXAA 4XM1A 3IXQA 1UBRS 3V6MA 3PTAA 1R5OA 3C8HA 5AHOA 4D4KA 3GUZA 1X8KA 1C41A 4PICA 5C51B 3VDQA 5IF3A 3DBIA 4GI1A 1Z5OA 1CUGA 3VU8A 1WOMA 1KRHA 1ZESA 2GEDA 1FP2A 2XGGA 4G1VA 4BASA 4OI2A 3O8CA 1KQOA 3DKVA 3PL1A 3PUVA 1E2KA 3OAAA 5AW4A 1Y80A 1NYQA 3NHAA 1YRAA 1MTOA 5AK0A 1CB0A 2YRFA 2H57A 4OQPA 4N9QA 3SMVA 5J2TF 4J1TA 2IH2A 3RWOA 4UNNA 1QHFA 1M1NA 1P1RA 3QFHA 4CMEC 3HN7A 1HNXB 1H05A 2AI1A 2Z1MA 3PGVA 4P8RA 5FUWA 3PDHA 4YJKA 1YQXA 1LSSA 3U4QA 1JFRA 1DSSG 2JCYA 1WMSA 1VCOA 2ONYA 2C2BA 3EY4A 2PHZA 3KYCA 4IZIA 1AQYA 3A9VA 4CBVA 4E0BA 1LSOA 2FPUA 2JJ8A 2XY4A 3HGMA 3T7RA 1YBAA 4KZKA 4LHSA 2OO5A 2X1VA 3SGLA 4D96A 3WGOA 2DTEA 4K05A 4YYZA 4EA9A 4YDHB 4H0NA 2PUBA 2XWPA 4XM0A 4ECEA 1XD8A 1R15A 1VCNA 1ZCBA 2AG6A 2F6RA 3TGLA 3C6MA 4MS3B 2GBGA 1A8IA 1VL8A 2RAFA 3KR2A 1GGVA 3HZZA 5DCWA 4DDWA 2WF6A 4M0KA 1Q7EA 1NQUA 4CIDA 5GM1A 2AYXA 2WQZA 4IMRA 2VJOA 1Z06A 2JI6A 1FFGA 2OCIA 1DKQA 2V0NA 1QFJA 3KKOA 3LKDA 4ZVKA 5EPUA 2MU1A 4BZPA 3DLHA 2IX3A 5BV2P 3REOA 1KSFX 4JWKA 4G4GA 3BWYA 1F7UA 1E59A 4UUOA 2YS6A 5FUQA 2FXIA 5BUZA 2QRJA 4LY0A 5K8UA 1Y8QB 2QVZX 4R8MA 5FFMA 4P92A 4KGVA 2QRHA 3W8FA 1KL7A 1DAEA 3IIKA 2ODNA 1FP7A 4PCLA 5HJEA 4M9SA 3LECA 3WVNA 1F1BA 3ABRB 1MPXA 3HA3A 1EEHA 1Y4UA 1JIIA 3QWIA 4IEEA 1MRSA 1HT1E 1ICEA 1N5IA 4R2JA 4DZRA 1Z35A 4ZVTA 4F9FA 3CNEA 4UTNA 5JO9A 4GBED 3SEFA 2EKBA 5IFLA 1VP9A 4LS3A 1I7QB 1NX9A 2WHYA 1PJSA 3FFBA 3JAWA 1VJRA 1EE9A 3LBNA 4DJDC 1P7PA 1B3RA 2ZGVA 5IHXA 2XCQA 5M29A 2BEVA 1FCJA 4D7AA 2PUAA 4DLBA 3HXLA 4CRWB 5F33A 2XWBF 4K9MA 4C20A 3CWCA 3OIUA 4EL0A 4WI1A 3FFTA 1X1CA 2NWQA 1U0BB 1QUFA 3PQ4A 4TSFD 4LF6B 1YULA 2BRUA 2IW1A 4WLOA 5BV7A 2CLKB 2OD2A 2JAQA 2SECE 4XDHA 2QN3A 1XNGA 3W9YA 3H97A 2C61A 5E6SA 1YDFA 3LZDA 2PKWA 5FLXA 5LP6C 5IANA 4I8DA 5A9RA 2HRCA 2W43A 1OA0A 1PFYA 1O95D 4W1SA 1EM8B 2I4OA 4KO3S 3VOSA 1PSDA 4OQZA 2WD7B 1JKMA 4BQNA 5JNTA 2FFBA 4MTCA 4J1NA 4KXLA 5EIWA 1NOKA 4I36A 5ERGB 5ICSA 2AOTA 1VKNA 1KJ8A 2WHPA 3OZWA 4LOHA 2FVXA 5DMXA 4D4MA 4E94A 4YRDA 3R3YA 2VTDA 1VFPA 2CNOA 3AI7A 3CEPB 4XWAA 1IUPA 1I33A 4WBNA 3T1TA 2QUIA 4BDSA 1K7CA 2WD9A 4MROA 1FMFA 1GQSA 3E3OA 1NMSA 1SQ6A 4QUKA 5E9JA 5GOTA 3V4SA 4DM4A 5CDUA 5HZGA 1H3EA 3EA0A 4HADA 1M75A 1GNLA 1OW3B 4LMAA 1B26A 2DR0A 1PJTA 1KY4A 2B78A 4X64B 1IY1A 1ZR2A 2EVWX 2Q7OE 2NYUA 1S7CA 3H5NA 1A0OA 3CRQA 5JAOA 4JJ4A 4WZBB 5DGTA 4N9WA 2YIJA 1CY2A 1Y9AA 3QU2A 3F3MA 3K5PA 3X1JA 2BE7A 2HDHA 2PWAA 4Q7LA 2IP2A 2OD9A 3RVOA 2EZ4A 3GRZA 3SFVA 1FVHA 2X86A 5AW2A 1DDOA 5JCXA 1JJVA 1G291 2Y0CA 1N4DA 3Q3CA 1U5AA 5KC8A 2X1LA 3GJRA 2HMYB 1M1UA 3TQOA 4D9EA 3DGEC 3Q11A 4LTNA 1Y8ZA 3PNMA 1DKLA 2PM8A 3HJRA 2ZZKA 3HFJA 2C31A 4RTPA 3KHKA 3AUXA 2BLNA 2F9FA 2H31A 1PGNA 3H3FA 1IVSA 3OCXA 3A31A 2ZSBA 2FP4A 1P8JA 4FGWA 1VJDA 5CW2A 4N6OA 4YJ2F 3HCFA 1QJCA 5ICFA 3UJ8A 2HWUA 3E35A 1RHQA 4MDYA 4P3OA 5KSWB 1QKIA 1E8NA 1L7DA 3NNNA 1CY1A 4FEYA 4KTTE 4XQEA 4F4DA 5KX5B 1H4TA 1VJ1A 3L0BA 5BQPA 2A9FA 3ROFA 3THWB 2NSHA 3GJSA 1GN8A 2W6QA 3RS3A 1UJBA 3HR7A 2J7PD 3K30A 1MIOA 2NZVG 4FKMA 4BYMA 9LDTA 3LWNA 4BFWA 1JE1A 2ZKIA 3NNDA 1XF1A 4IJVA 4RU1A 4X8OA 1C9MA 1K0FA 5EZ6B 1WXGA 5IAOA 5K3SA 3G0BA 1TX4B 5JXWA 3EJ6A 3OZEA 3AVQA 4ZQHA 4YXFA 2HZ7A 3JYPA 4L8VA 3PUKA 4TRRA 2AF3C 4QX6A 2BWJA 5CH5A 1AKMA 1E64A 1JI0A 1C2TA 1BXGB 3IULA 1SKBA 1KPGA 1JAHA 2BFDB 2G0NA 2P91A 4OLHA 2VTBB 4ALJA 2F3SA 3DDOA 4O33A 5LN1A 5HTOA 2IX9A 1SUSA 3M70A 1WWKA 3D8RA 4HB4A 2NTEA 3RANA 2YC2C 3EVCA 1K27A 5JAHA 5ALHA 2HIAA 2XB6A 3OE5A 2OLKA 3RJ5A 3HWX1 3F6CA 1NI3A 5REQB 2PAAA 1MVLA 1P18A 4JBIA 2WMYA 5AHWA 1FZTA 3N2KA 3FSEA 4COKA 3SXJA 1AS0A 1HOTA 1NAHA 2Y0BA 3EXIB 3A6KA 3HL0A 3GT0A 4M9XA 4O2AF 3KUKA 3EVFA 3HWSA 3F9IA 4ZVRA 4MRMB 3DV0A 1Z0DA 3R0VA 4ICIA 4INZA 3SX2A 1C1DA 1GNSA 2V9ZA 4DMRA 1YJAA 3NOQA 1E9VA 4TZ0A 2VRCD 1KJQA 4HF7A 4XTCS 3WICA 5KU7A 3LMKA 4NNPA 2HTFA 4UQLA 1MBZA 1OH6A 3PQ3A 1N0HA 3GXBA 3OETA 3ZQ4A 2VSQA 3A2NA 2GS9A 3MCVA 5IXSA 3OWOA 4DR3B 1E9EA 4NECA 1DRJA 4QOSA 1OXTA 3ZZUA 1TT7A 3WK4A 1H8EA 4ZICA 1NULA 4PZUA 2ZSHA 5DP2A 3BMNB 4NYJQ 1I7DA 3BZWA 2WUGA 4BP3A 2DPYA 1MB9A 2R6ZA 1FRNA 1C0PA 1P80A 4KVAA 4WTOA 2I3DA 1LQUA 1SZPA 1NZJA 2VDKB 4QO8A 1JWBB 1WXFA 1H8ED 2VK2A 2Y1EA 3DT6A 3NASA 3UK1A 4TRMA 4AZ3A 2WU8A 1CVLA 1LFDB 5I3ZA 1SU4A 3GJ4A 4EPWA 5K99A 4U0JA 4BO0A 2J32A 5C8DA 3UXHA 4GVPA 2PQ6A 2PUDA 2ODTX 4YBZA 3ICWA 2BEJA 1E7SA 3HB5X 4UU7A 2O2SA 4M6WA 4HWTA 4UJ5A 2CDAA 2ID7A 4I81A 1YQGA 4DUPA 4MUAA 2Q4EA 1W49A 2QJFA 3UAYA 3ZY6A 4HZUB 1SOVA 2YUIA 2HEIA 2ETVA 1SULA 1RJEA 1JRLA 4F1JA 4DWVA 2VP3A 2PSHA 4DMUB 4BCCA 2PV0A 4JYBA 3TRFA 3GQVA 4C6SA 4D57A 3F8TA 4NBLA 1YB2A 1E18A 1GNPA 2AL7A 2OV4A 3FUXA 4LXGA 3RAPR 4XTRA 4EJSA 4CF4A 2PKQO 4QUIA 5JEEA 1YVRA 3PBKA 1EEXB 1KBZA 1PFKA 5I4CA 1BKYA 1NJ2A 2Y2UA 2IXAA 3TAUA 3ZKWA 3NEJA 4MWGA 3BWBA 5E3IA 5IKEA 4J1SA 5CVCA 4J0KA 4NESA 3MJHA 4OKNA 2JCSA 1Z2NX 3V8RA 3DNMA 4R3UC 3OLWA 2BHLA 2HA7A 2GI4A 4J0QA 1Z2EA 3LA6A 3O4IA 3U26A 1NBIA 4EENA 3IAAA 1YGPA 1C3EA 2F64A 2JAWA 4LFBB 1FMLA 3S4YA 1M34E 3AIOA 3MCZA 4L15A 4QBKA 4QKQA 3NHLA 1NVWQ 3CO0S 5J1SB 4UM9B 1TD9A 2OESA 5KNBH 2OP0A 4B3HA 4EQ6A 4I66A 3MTAA 4YP9A 4EFKA 4EJSB 1J20A 4DLTA 1SBTA 1DU4A 5FL3A 4BNWA 2GF2A 3PR2B 2F90A 2ZCVA 4MV6A 5KI6A 4WK6A 1AKYA 1VJ0A 5JJLA 3NALA 4C06A 2ZW9A 2QMEA 1E4YA 2NO6A 5AK5A 3U9SA 3M4XA 3I05A 4YPFA 1Z3CA 2YV2A 2EKPA 1WCIB 1WF6A 3A1DA 3BYZA 3BZBA 3CS3A 4KITB 4HH1A 4RPIA 4EHDA 4PZLA 1OI7A 5F1PA 2Q3LA 4DA8A 1I4WA 1H5UA 2QP3A 2J0UB 5JPIA 1YCHA 4KYUA 1Q0RA 3BWDD 1QIGA 1XN4A 2IZ6A 1NP6A 1G1MA 4I5IA 3VH1A 4E70A 3QEBZ 4FD3A 1E2BA 4H6VA 3VR4D 3P32A 3G0HA 3R9XA 3P94A 4X1KA 1OV4A 5FORA 3RHSA 2HK9A 5BP7A 2WLTA 4L0DA 1FMTA 4MV3A 4Y6QA 3AR9A 1ZDMA 4W7IA 4OXRA 3LIPA 4V0LA 1P0QA 4H08A 5C0OE 1KS9A 3GJ3A 3ZK8A 4H6PA 1R3UA 3DONA 1PQ4A 3KKQA 1ZH2A 4U6NA 2C94A 3SQOA 4BN4A 2JLZA 1IJFA 1U6JA 4MYRA 3UK6A 4ZV9A 1AA6A 2XZOA 4GZMA 4AJJA 3RT7A 5LMUB 3ECSA 4D4GA 3WTCA 2P30A 3PUJA 2OORA 4HLNA 4GAEA 4C3OB 4YI5A 2HU7A 4P5DA 5HDBB 3JCZA 1KEZA 3H7AA 2KW5A 3JQGB 4R2KA 1T5HX 1E9CA 3V3TA 4A8JB 4BMNA 2NNLD 5HKLA 4M0FA 1M2VA 1RFGE 2NGRA 2P3SA 3BXEA 3KLNA 4LPSA 3R7FA 1YZHA 4R2MA 5JUWA 4B3DA 1PNQA 1ZM2A 4JAVC 1E1CA 3AUFA 3G5MA 5DLDA 5FWNA 3K6SB 2XB8A 1Y63A 2NQ2C 2YUTA 4PLPA 3G9ZA 1LZKA 3DL0A 4XVUA 5CA0A 3VNBA 3D5EA 1P5JA 1A5TA 4CQNA 3DH0A 1DBVO 2PMCA 4GP6A 3ZGYA 3SQMA 3OY2A 1DJQA 1CS0A 3QV1A 1NZFA 3OZIA 4JI0B 2OCLA 4JI1B 4HUTA 1AIPA 1JIKA 3KAKA 1VGVA 2FUKA 4RMJA 4L5JA 1MO3A 4WOBA 4LRUA 4RIEA 3Q8LA 3D6JA 3RS2A 2ZAOA 3R24A 2QXTA 3G2OA 1KU0A 4EFDA 4W5OA 4DSTA 2QY9A 5TT1A 3FJ1A 4QL3A 1V2HE 1B0AA 2Q3JA 2B7BA 3AF0A 4GLLA 2LDXA 4JR1A 4O4HF 4WCFA 1RKVA 4XJTA 4FLEA 3LQ2A 3M34A 4IUYA 1Z4NA 3KEGA 1O57A 2WJ4A 2HV8A 1Y8RA 2QAGC 2ERYA 1M2FA 3FWNA 4Q3DA 3TZBA 1MZPA 2ZK7A 4JX9A 4TMKA 4ZT3A 2YYAA 4J9UE 3QUTA 2C4UA 3AM5A 4Q4LA 5FPHA 2J7PA 2Q6OA 5C1BA 2WWXA 2Q49A 3FSGA 2BKAA 1E3TA 4TYMA 3GBVA 2X1MA 1XDZA 1BFUA 3WBFA 3HA2A 3R09A 4F6RB 2PE5A 4NWIA 3VGJA 2BGLA 4ESVA 1QONA 2AJ8A 2PPVA 2RHOA 2GETA 1WL8A 3JPYA 3T3PB 4U8GA 1AQLA 2AFIB 2DTXA 3C3WA 3NEYA 4HP8A 5ERXA 2ZAIA 3ML1A 5F7XA 1PNTA 3L0IB 5LZ2A 2I9KA 3AFNA 3DMNA 1AJEA 5AHRA 5LLDA 5F1YA 2HJRA 3BB4A 4REOA 1XPJA 3I6IA 4Q1VA 4Y2TA 3SHQA 5IT9A 4R0VA 1NU8A 2QUZA 3PITA 2A0KA 1XEWX 4G3XA 5MN5A 3U16A 1BKSB 2VKQA 4RZ3A 4WOJA 3GLUA 1VLVA 1SCUB 2V55B 3B70A 4G8BA 4AF7A 4AP5A 4BP9A 3I39X 4UD2A 3TR0A 5E0KB 1FMCA 3GROA 1XRMA 3AIKA 4HRYA 4GG1A 3KVVA 5EEGA 3CZQA 4BZQA 4LI3X 1K06A 1R7RA 3ZVKA 1XKLA 1NJ8A 1EK6A 4ENUA 4P7JA 5CIQA 3Q9UA 2VNHA 3FUTA 3TSCA 1ESNA 4MV9A 3H9UA 1CZHA 1ULSA