1TRKA

Refined structure of transketolase from saccharomyces cerevisiae at 2.0 angstroms resolution
Total Genus 246
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
246
sequence length
678
structure length
678
Chain Sequence
b'QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE
publication title Refined structure of transketolase from Saccharomyces cerevisiae at 2.0 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase(ketone residues)
total genus 246
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 1993-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trkA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trkA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1trkA01
1X7ZA 4ZP1A 4KXUA 3EXFA 2BFEB 3IAEA 4MZXA 2BFFA 5DGDA 2IHTA 3AHCA 5FEMA 3EA4A 3AHHA 5HHTA 5HGXA 1QS0B 2VK4A 3AI7A 1X7XB 3ZHUA 4GM1A 2IHUA 2XT9A 1V11B 1Y9DA 1OLXB 3DVAA 4C7VA 5ERYA 2R8PA 1GPUA 3ZHTA 3FLMA 1Q6ZA 2BEVB 4JUDX 4GPEA 1DTWB 3M7IA 3AHJA 1T9DA 2VJYA 2BFDB 1NI4A 2JLCA 3UPTA 3M6LA 1QGDA 1QS0A 1T9BA 1U5BB 2XTAA 2V3WA 5I51A 1X7XA 2R5NA 2BFCA 5AHKA 3ZHQA 1V11A 1X7YB 2G67A 1OLXA 2BEWB 5K2OA 1V5EA 5EJ6A 2OZLB 1UMBB 2BEVA 1V5FA 1OZGA 2PGOA 1YBHA 4JU8A 1W88B 3AHDA 2QTAA 1DTWA 1OVMA 3KOMA 1UMDB 1POWA 3IAFA 3M34A 2BP7B 4WBXC 2BFDA 2NXWA 1BFDA 1T9AA 4MPRA 5K6RA 2JI8A 3D7KA 2Q28A 3EXHC 3M49A 2Y0PA 1POXA 2C3YA 3E9YA 1NGSA 1TKAA 1JSCA 1OZHA 2AG0A 5K6TA 1PI3A 1X7YA 3F6EX 1PYDA 4KXWA 5I4IA 2BEWA 2VBIA 2Q5JA 5HJEA 2C3MA 2OZLA 1UMBA 1B0PA 4GM4A 5IMSA 1X80B 1W88A 2Q27A 2C31A 1UMDA 2DJIA 3AHGA 3ZHVA 3EXG1 1R9JA 2BP7A 2YICA 2AG1A 2Q5OA 4D5GA 4K9NA 3LPLA 4JUBA 5EXEA 1ITZA 2IEAA 2Q5LA 2EZ9A 4Q9DA 3F6BX 3HWX1 3LQ1A 2WVGA 1N0HA 2J9FA 4GG1A 5EJ9A 4K9OA 3ZHRA 2O1SA 4RJJA 2VK8A 2BFEA 2BEUB 3EXHB 2O1XA 1X80A 1UM9B 1TRKA 2BFBB 2Q5QA 4K9MA 2EZUA 3UK1A 2VK1A 4MPPA 2XT6A 1KEKA 3EY9A 2C42A 2PGNA 1V1RB 5HYVA 1UPAA 3EXIB 4MQ5A 1V1MB 3EXHA 1YI1A 1UM9A 2YIDA 3HYLA 2BFFB 1OZFA 4FEGA 2G25A 2BFBA 4K9KA 2IHVA 1U5BA 1RP7A 4XEUA 4JUFA 5EJ4A 1MCZA 2FN3A 4RJIA 1V5GA 1V1RA 1L8AA 2JI6A 1OLUB 3DUFB 1ZPDA 3FSJX 4K9LA 3EXIA 3EXEB 1V1MA 5ERXA 3DV0B 3ZHSA 5EJAA 2UZ1B 4FEEA 3L84A 4QPZA 1WCIB 1NI4B 3AHEA 3AHFA 1YD7A 2JGDB 4JD5A 1AY0A 2JI9A 3JU3A 3HWWA 5EJ8A 2BFCB 2JIBA 4RJKA 2C3OA 1UPCA 5K3SA 1TKCA 1UPBA 1Z8NA 2W93A 5EJ5A 3FZNA 4JUAA 1OLSB 1OLUA 3EYAA 3DUFA 2G28A 3EXEA 3DV0A 2E6KA 5I5EA 1IK6A 2UZ1A 4JUCA 2FWNA 1X7WB 1W85B 3EXG2 2C3PA 5ESDA 2C3UA 1YNOA 1WCIA 2WVHA 4C7XA 4KXXA 1T9CA 3LQ2A 1UMCB 2JGDA 1PVDA 1V16B 2VBGA 3LQ4A 1YHZA 5EJ7A 3OE1A 2EZ4A 5DGTA 4KXVA 2UZAA 3OOYA 1OLSA 2BEUA 1X7ZB 3EXFB 4K9QA 1YHYA 4QELA 2Q29A 2QTCA 5C4IA 1PO7A 2VBFA 3RIMA 4GP9A 1X7WA 4COKA 1W85A 2PANA 4D5EA 3MOSA 3AHIA 4K9PA 1QPBA 2JI7A 5I5GA 4GM0A 4JU9A 4MPJA 5EXDA 3DVAB 1UMCA 1V16A 4KXYA 1YI0A 2JLAA 2PDAA 4QQ8A 2J9FB 2EZ8A 2EZTA 5DEIA 5EJMA 4KGDA 1TKBA 2WVAA 2X7JA 2R8OA
chains in the Genus database with same CATH superfamily
1X7ZA 2O8BB 1IIRA 4Q66C 4QDKA 3TH5A 2P9CA 3WNZA 1X8KA 3VKGA 4I08A 4QYIB 1XJWA 2P6PA 2VO1A 4HNTA 3HHPA 4GI7A 2NTYC 1NSYA 1K9SA 1QF9A 3OOHA 3THSA 5ITWA 2I6SA 3KJNA 3NHPA 3I9NA 3BULA 2OFXA 2GT1A 2Z1NA 2ZS8A 4D9KA 1SZCA 3IEXA 1JQEA 3INTA 4JB0A 3NKVA 3FPAA 4P58A 1K7SN 1NJ5A 4QPJC 2P0EA 5EP4A 3OZAA 1N0IA 5ER9A 1N2IA 1QGZA 4C1BA 4EPVA 5IXYA 5JRZA 4ER0A 5HHTA 2H85A 5F2NA 4IJWA 3H9QA 3N28A 1XU4A 3IUSA 5T8KA 4RTRA 3KTAB 3VR1A 3LVFO 2VK4A 4N6NA 1T3GA 4QGHA 3SVZA 4MMXB 4E03A 2NYRA 5IUJC 4DV7B 3ZHUA 3OZXA 4I66A 2P6UA 3M81A 1XTQA 4MAAA 1UOPA 3TRFA 5K0FA 2RGUA 3PPXA 5FTNA 4FCWA 3TCNA 3WHKA 3CZMA 2XB8A 5JI3E 4N3AA 3U44B 1P73A 1Z16A 3C8DA 2H08A 4GE3A 2REBA 3QXSA 1HDZA 3GRAA 4YV2A 3LWNA 4AUEA 5FPSA 4E5KA 5JTUA 4DV2B 3KHKA 1JXOA 3NNNA 1H1LA 1E77A 5GPBA 1LI4A 2JKYA 2I66A 4ARZA 1AK9A 1XXHE 3ORRA 2WTAA 4G8BA 2NSDA 2PVCA 3KQYA 4X3CA 3RWBA 2FWMX 3LUKA 4LC9A 3LKVA 1XRPA 3M7IA 4OL9A 3AHJA 1YQTA 1EJ6A 4QBGB 4R9VA 3T3OA 2EBFX 1KAMA 1JWBB 4HJXA 4IXTA 4WOKA 2OPHA 3DOJA 2AI1A 3AJ8A 3V55A 3IIEA 1J5XA 3WGVA 5BRAA 4BEBA 1NPTO 1WDWB 3I8XA 3QELA 5JEDA 2AFIE 4NAUA 2VWQA 3OE7A 2Z83A 2WG2A 1SKMA 4MS3B 3H6HA 2FSUA 1PL7A 4RF5A 2KX7A 1QRAA 2OOSA 3QW4B 5T4BA 1XAGA 3UXHA 4KMSA 1O94C 1R37A 3OCJA 3DGFC 1QGDA 4IIUA 4WCFC 3WWYA 4F3NA 2GDZA 1MW8X 1Z5UA 4C3UA 3T3EA 1T4CA 5A3VA 3LYHA 1J09A 2C2XA 2CKDA 1M6WA 1NKTA 4FONA 4P33A 4KO1S 4E5DA 2BGKA 3HN7A 2HPAA 1D1TA 2ZTSA 3IP8A 4H0NA 2ERCA 2FEAA 1PZHA 4Y6RA 1MFZA 2UYHA 3QH4A 5CH3A 4A6DA 4ALLA 1GTZA 3AT1A 1QQ6A 3CHYA 3P4YA 4Q1FA 5U9CA 5DM70 1BGVA 3LYLA 2YNMA 3OJCA 5JY6A 3ND5A 2BV3A 2NZVG 4CM7A 3U1BA 1SPXA 4FWTA 1SQ6A 2V58A 3IGFA 2XUPA 5LMZA 2JLXA 1IH8A 2IY7A 4QAQA 4DA6A 2WIKA 5H8WA 3DE0X 2H4XA 3QPUA 3ABIA 1DU4A 1LSOA 2ZU6A 2W6NA 3NHRA 2PGOA 3QWFA 2IPAB 5CFLA 2D5IA 5JD6A 3KZOA 2H7CA 2X41A 5L51A 4FU0A 2IJGX 2IZ7A 1YVRA 4G1FA 4Y2SA 1ESEA 3HGMA 2ZIWB 5LUAA 1C7JA 1Z36A 2BLNA 3U3JA 2P40A 1ZNZA 4INAA 4RY0A 3AF2A 4WBXC 4MQFB 3U26A 4DJAA 1H69A 2QRGA 3U13A 1M34E 2VJOA 4AMZA 3BTSA 3IURA 4LC1A 1DBQA 2EGGA 3L1VA 4NEHB 3SOZA 4M89A 5AW0A 5IYZF 1TJ4A 2HHCA 1KSHA 4NYIQ 4URUR 3IYLW 3MVEA 2LIVA 3PUYA 5FTKA 2PKCA 1EDOA 2WLSA 4PLTA 2Y9PB 2UDPA 2I2FA 1R74A 3E9YA 3T1VA 3U1VA 2PUEA 3DCJA 1TZBA 2Q6LA 2GFQA 3BWYA 2G0TA 4NCKA 3QEMA 4BOYA 4EYOA 4ZI7B 4ENSA 1SD5A 1FP6A 1MRNA 5DTIA 3AR6A 4J3NA 5AVYA 4LMAA 3UV3A 4Z3OA 3ZWCA 5JI2E 3TCKA 5I4KA 3QYJA 1JFVA 2IK8A 3R1IA 3K0FA 5EE9A 1NUAA 1MAUA 3U4HA 4TSRA 1RLMA 3BRSA 1BQ3A 1GKYA 1Z08A 2O3TA 2JJMA 2ZBGA 2XUQA 3H75A 4RY9A 3WG9A 5IK2D 1YFLA 2TYSB 3K1YA 4UC0A 3IEVA 2EIXA 1E3DA 3ZY6A 4O4LB 3OCWA 4I4TA 3IB6A 1KIAA 1MJNA 3O90A 4UNSA 3PKZA 1UAYA 9GPBA 2XWSA 3P5BA 2YRFA 4FI3C 3CKLA 4NOJA 2CL7X 2Y0DA 4FUTA 3T4UA 2C58A 1JEAA 3M70A 4TV8F 2IPOA 5LOVA 4JR1A 3PC7A 1A71A 3U7HB 1R10A 1FF9A 5AVQA 5H1YA 3R7WB 4E6PA 3PFCA 2WEKA 1TC1A 1V5IA 2PLWA 3C8MA 4NZZA 4X7MA 4PC3A 3B38A 3RTGA 1ZI8A 4Y2GA 1PS8A 4L3OA 1QX3A 4RXTA 4JXKA 4WXEA 4JC8A 5I8ZA 4KAAA 1EFRD 2L17A 2QORA 3H99A 4UBOA 3ZWBA 2Q5LA 2IU6A 4Q7EA 2F48A 1K66A 4G1EB 4CV3A 2A8YA 1SNYA 2PWPA 3GJRA 4ROTA 2JLYA 4FHDA 4RA9B 2YRXA 1LTKA 1CS4C 2R9VA 3N6XA 5EJ2A 4DRXB 2O23A 2BONA 1NL3A 1WOYA 3AUSA 4G3XA 1NZFA 3TZ6A 4EY5A 2QUAA 5JNVA 2ZQZA 4QU8A 1ZD9A 1CUEA 1I3KA 3M3HA 2JA1A 3O0TA 1MW9X 2QSJA 2VKQA 1WW3A 5DM2A 1Y1RA 2WAXA 2XSZA 3O74A 2C0CA 5MHTA 2CVOA 4JOCA 3MJ4A 5G02A 2F1JA 5CXQA 1CQJA 4C3VA 1T9HA 1YBMA 5IAEA 1SXJC 3BMOB 5BWBA 4LOAA 4KE8A 3OHPA 3AZOA 1TECE 2PA0A 2WT8A 2Z8YA 1QZUA 2MIIA 1Z5VA 1CP2A 3HJUA 1OIXA 5BNTA 2CLOB 3ABQB 1I9CA 1FTSA 5FORA 1BX3A 2YH2A 1IWPB 4OQXA 3VPHA 5K3EA 3L0YA 4BFLA 1ADBA 5JZVA 2RI1A 4Q3EA 4D43A 1PN3A 3HPRA 1QKJA 3WRYC 2BVNA 1ONOA 3U40A 3PCXA 3PDJA 1P2FA 3QKSB 5D5HA 4OD0A 5HE8A 4X6XA 5ALFA 3HCFA 5LJLA 1BC5A 4EKIA 5K8UA 1DOAA 4YGXB 4BVLA 5KVAA 1P4GA 2OORA 3B8EA 5EUBA 3AEKB 1FFCA 2XT6A 5F1YA 3MWDB 5EMKA 3PICA 1P4RA 1YVDA 4WADA 2CBXA 1KEKA 1C50A 4HX2A 3KKEA 4L15A 4HGOA 4I1VA 4YRIA 2P1ZA 2O8FA 3LM8A 1FDTA 4Q4HB 1N7JA 2Z30A 3NWEA 5HYVA 4MGIR 4E4RA 1JL3A 1KZYC 1Q3HA 1RDFA 1ZA1A 3L04A 3LPDA 3O47A 1E5QA 3N0TA 1ZH8A 3WTBA 2AQIA 5KSOA 4AJ2A 4JP1A 5KJCA 3BQNB 1E3IA 1N75A 3ITNA 5DKFA 3EUWA 2J08A 4Y98A 5I8PA 1ML3A 2O7QA 3I4FA 1SQ5A 5DSTA 1IFXA 4NECA 2Y27A 1VMKA 4PM4A 4B6PA 4RV4A 4S3MA 3RVQA 4XVUA 1T1JA 2LCFA 4YH1A 3IB3A 5BURA 3VO9A 4RTJA 3WKCA 2ICAA 3DFKA 4V1CI 4BLRA 2QN6A 2HADA 2J41A 3AB8A 2VAVA 3EF3A 4EDFA 4MDYA 1KQOA 3I58A 5CM8B 4F5DA 2RH9B 4YASA 4DVGA 2BFBA 4MZDA 1E63A 2X0NA 4F11A 2IH4A 1EYZA 3ASVA 3QMVA 2VHUA 1Q57A 3PFIA 1F4VA 2MYUA 3TNDA 1DDGA 3LBIA 3ZDRA 1GZ7A 1JEEA 1WPQA 3JQAD 3DPSA 3S99A 1Y9EA 4QUKA 2PMDA 1IEVA 4MV5A 1Y5LA 2ZYSA 2XZDA 4QNMA 1Q1GA 5CYFA 2ZIZA 3TM4A 1QFZA 3EGWA 3DTNA 4KQ1A 4DLRA 4WESB 2YYAA 2NU8B 4XWTA 1HTWA 4HWGA 3CH6A 3D6AA 3IAM1 1ZGCA 1SUFA 4UUPA 4LWOA 2CL0X 2FPPB 3FB4A 3WB2A 2PKWA 1UEXC 2VPIA 1WBBA 5H3CA 3IAHA 1CEYA 1KK1A 4REOA 4DMKA 4BGEA 3T5GA 2FSIA 1O58A 5C8YF 4Y6PA 2DLNA 3KD3A 2CJWA 1OLUB 4WOPA 1D09A 2VNKA 2HRQA 1EMDA 2X7XA 3GU3A 3DUFB 3I05A 2JBAA 4QPNA 5SYMA 3OX4A 5LBUA 1W6RA 1KP9A 4DSAA 4KR7A 4N0MA 3DL4A 2GA8A 2D59A 1X70A 2PL1A 3L43A 4TXNA 1E6LA 5L45A 1DX6A 3DYBA 3K9GA 2BI4A 2Q5CA 2QU8A 3CSSA 5K4AA 1DARA 2OQ2A 3IKLA 3G5MA 3QE4A 3VVLA 3P9PA 1FEZA 2PLNA 4Q3BA 1L7OA 3CF4G 2CNLA 5TT0A 5ADWA 4C2UA 3B51X 5IARA 2COKA 1EUDA 2JGIA 2OBXA 2KQUA 1UPXA 5E1OA 5ESXA 5I47A 3PX7A 3KVRA 4EO7A 1XRSB 2GD2A 4CVNA 2GJKA 3ROEA 4MVYA 1VRCA 1JMYA 5IAGA 4V0RA 4BV9A 4CN9A 2A5DA 3WGMA 3I34X 4GKBA 1H2WA 3ZOZA 2P27A 2ATVA 2WJYA 5BN4B 3VUFA 4TS9A 2QP9X 1CR6A 3KDSE 2JIPA 3PGVA 4IVQA 3QMMA 3TZEA 4PINA 4ZT4A 3O6VA 2VC2B 5C53B 2QDKA 1I0ZA 4U00A 1TXGA 3SK0A 4CQLA 2WWYA 3DE7X 2JHAA 1B7GO 1Y89A 2AFHE 2W22A 3MS4A 4W63A 2JIDA 5G2OA 3EVNA 3V8BA 1JDTA 2PSHA 3GFVA 1A9YA 2IUYA 5JHHB 2ZT6A 4JJKA 2VTBB 2UV8A 2NO0A 1TUBA 3LFUA 4X8OA 5JBIA 5F7OA 2C2WA 3OE5A 2JAPA 2JFOA 4KRFA 4RIGA 5LZ7A 4BN0A 4GVLA 4L0CA 4P7GA 2CDBA 1VE9A 1G9SA 3Q3EA 4E22A 4BNUA 2B6HA 1YMUA 1WABA 1E96A 2AMJA 5LWQA 1V4BA 4OHKA 1YZGA 2RHBA 5LD2B 3DE5X 4K28A 3L8DA 3CFYA 3FI9A 5IU6A 1PGJA 4XGIA 3KKKA 4ZTZB 1ZMRA 4KQIA 1BTOA 3W4JA 2O5RA 1U5CA 4J0QA 2BFNA 4IG9A 3RW9A 4AM8A 3CX4A 4IIJA 1RPZA 5C52B 3NVDA 2X5KO 1DADA 2VXBA 4Z3KA 1TTHA 4G86A 3DMTA 5D1NA 2OV4A 4CM9D 5LIPA 4M7RA 1R64A 3U3DA 3UMYA 2EBWA 1UJCA 2HMSA 2WTBA 4DC0A 3DZCA 5CAEB 1WXDA 3SDBA 4DABA 3NAGA 1T5IA 4O29A 4W1SA 1A9SA 2QG6A 1FDOA 1NFQA 2IEZA 3L0BA 3NKLA 3SAJA 4DJFC 3E4DA 3D8UA 5J47A 2IBTA 421PA 1DJQA 1P0PA 3MINA 5TY0A 3MJSA 4B3GA 1QYVA 3OQ1A 1N6KA 2Q2NA 2ZJYA 3ISVA 4PG5A 4DJTA 1HEUA 1MNAA 3NBZC 4P7KA 3RAPR 3IBGA 1N6OA 3QRWA 1ZUD1 4JBWA 2SCUB 5CA0B 1DAMA 2YASA 3ACDA 2VPTA 3HYCA 1L7AA 2PH1A 4UEQA 4BO1A 4CCYB 4WA7A 2HU2A 3UOGA 1U8EA 5DHRA 1QBKC 5C8XA 1AA9A 4JLSA 4IEFB 4MRAA 2QW8A 3H65A 1CDDA 1HOXA 1S2OA 4MVJH 4OK5A 4B7UA 3C6QA 5IT0A 3HO6A 5EWLB 4HAYA 3VBCA 3N53A 3RHTA 5REQA 2FWJA 2GWHA 2ZULA 1F2UB 1HRDA 4M86A 1P80A 1WHTB 5HCIA 2IZ6A 3SNKA 3T9DA 5CIQA 2IGBA 4AAYA 1T6ZA 1SN7A 4COKA 1S1CA 4TYPA 1IM8A 3COVA 2H8GA 1OB2A 3FPJA 3CNEA 2C83A 2P2LA 3K6JA 1M2JA 1YA6A 4MUIA 1P74A 4K9PA 1VZ2A 2B99A 3NO4A 5B64A 1V45E 3L6EA 4C22A 1W5SA 4L8WB 4S1NA 4EGSA 3WIUA 2RGBA 2AMLA 2AR9A 2HV8A 4QLAA 5KYUB 1M2WA 2WY2D 5J4HA 4X5OA 3GRZA 1V16A 2IYRA 1P7WA 4BMVA 1FYWA 1LPAB 3JQ8A 2FR8C 1TZKA 4BNGA 3H4VA 2FOXA 4B0PA 2D1RA 4C0QC 1GTRA 1Y5IA 1KPHA 1E1QA 3STXA 1HLGA 5BV1A 2J3JA 3I8SA 1XALA 3KHSA 2WVAA 2X7JA 5FBLB 3JD4A 5CGZA 2I03A 4YUYA 3UCXA 2XUFA 3SHFA 4RFLA 4U2FA 1HXHA 4BUJA 4RX1A 1RXSA 2WW8A 2P5SA 3EIWA 1YUBA 2HMYB 3MMPA 1KEWA 3OE4A 3IAEA 1LF5A 3MOIA 4MW1A 4NMXB 5I9MA 1TIPA 1W34A 2G17A 2V4MA 5FRDA 4BO6A 3WGKA 2CZQA 2JKZA 5CLFA 1VZ3A 4QODA 4YNBA 3L1KA 1E2GA 3JVEA 1GRCA 1YVEI 4LXTA 5CHEA 4C0HA 4PO9A 2BBSA 4LYDA 1EK1A 3EA4A 4DCNA 2H54A 3F0TA 2MSKA 4TRNA 5LYJA 2AJLI 4DR2B 4EHHA 3ZI7A 2PS3A 3B20A 2HY7A 2XVYA 1ECGA 2Z8XA 4MUYA 5EXTA 5ITSA 3PWKA 4QATA 4NLLA 5K8TA 3PDHA 2QLFA 1TL7C 3OMWA 5FUVA 4XB1A 3OQVA 2ZYAA 1Z13A 3GUZA 4ZOLB 2IUSA 3QKTA 5BQFA 2FX5A 3SDSA 3JAMA 1V6AA 3BGVA 1JHQA 3W8DA 5EKSA 1MH1A 2O3RA 3DVAA 1XD9A 4C7VA 4UKDA 5KHOC 2HH9A 3GELA 1SVKA 2GAAA 4TKMA 5FUMA 3SF0A 3VDMA 5CX1A 5KWVA 4UM8B 2PUAA 1QBGA 1T10A 4PS0A 4PU0A 3BWXA 2H1SA 3NYIA 4DIBA 5KMGA 5FNZA 4W5WA 3ETHA 1MO3A 2EQBA 2FX3A 3K0AA 3P9ZA 1RJDA 4C4SA 2O8DA 1DKOA 1SZPA 5FF9A 2FY8A 3B1KA 3IUJA 3WYNA 3C3DA 3TIFA 1YQWA 4LF6B 3CINA 1LLFA 3N2KA 1EGMB 1LI5A 5B3AA 3FSGA 4IHJB 3AUYA 2ZBEA 1YHNA 1VLJA 2TRSB 4M0LA 5D6NA 3QFFA 5CLJA 3QXXA 4NFYA 1ZFNA 1RBYA 2ZYUX 3BH7A 5TEVA 3D7SA 3T1QA 5DM0A 3GLHB 4P92A 1T3HA 2QBYB 1XMPA 3AESB 4YRZA 5E4JA 2JHFA 2PWZA 5GJCA 1PZFA 4ANFA 5CFMA 4EH1A 1F7VA 3TRIA 4EJ2A 4L85A 2WM8A 3PA8A 3KQSA 2OFFA 2Z6VA 4C0LA 4M9QA 4GYKA 4BMXA 4J03A 1D5WA 2W0MA 3AVYA 2IE0A 3PFGA 3V1TC 4YV0A 1RZRA 2XQVA 5DW3A 4RVSA 2QVXX 2QVBA 5BVHB 3BD8A 3C3PA 2ACEA 4ZTBA 4UCWA 5AIAA 5HE9A 4II2A 1D9ZA 1QG6A 4B4UA 1V11A 5JUWA 4XCQA 1U0JA 1H85A 1W47A 4B84A 5GWXA 2Q6VA 5L7WA 2IDJA 2PXHA 1JFTA 3UIEA 4J76A 5P21A 4FDVA 2R00C 3PHIA 4L5YA 5HTOA 1OYWA 2I29A 2O3SA 1WOMA 4IV8A 4LI0A 3RG2A 3RU9A 4ZQBA 3OH8A 3RKSA 1ZI9A 5K4HA 4YS6A 3TKAA 2MINB 5JASA 4MUMA 1LWNA 3VC7A 2QT0A 2MYTA 1UFVA 4N7BA 2H4FA 3KCNA 1MJHA 1P1KA 1IN1A 2AN1A 5JCPA 2A14A 4M0PA 4OBBA 3OQ6A 4RH0A 4YMIA 3C3CA 5LA6F 2II6A 1HDXA 1UAGA 2VUSA 4Q9LA 4E46A 2AW3A 1JJVA 1ZJYA 3RIEA 1A1VA 3VJRA 1PZXA 1ULZA 5KJ6A 4NFHA 1L5WA 4DLYA 1DQRA 5B30A 3K20A 1GP2A 3OP4A 4E07A 1Z0ZA 5TC4A 3GCZA 1JIQA 4HUQB 4Q4JB 2X8JA 2FRVA 5E3IA 3A3KA 3ROXA 3ESYA 1BDBA 3CF0A 3V8EA 4DLLA 1OIVA 3QVSA 3WYBA 2XDQB 4OB7A 5TV2A 2JJYA 3DG9A 2F8LA 3JVDA 3RTDA 3F97A 3G2OA 3NU1A 2VCYA 1LC0A 5BT8A 1XD8A 1NLFA 2W90A 2OV6A 2NU7B 1SZJG 4TWIA 1ZJ5A 4YXWA 4FBMA 5JJCA 3BMQB 4RCYA 1OAOA 4D0GA 3SYKA 1LVUA 1H1TA 3QW2A 3F6CA 2Q99A 3A3PA 1THTA 2WWGA 4ZDIA 1A77A 1I3OA 3CU5A 1XUOA 4MYDA 1XHFA 3TX2A 4YCSA 1NJSA 1XQXA 5DI3A 4RD3A 3KX2A 5K6TA 1VLZA 2Y1DA 1AQIA 3K70B 4N5IX 1WEKA 3P96A 1S9HA 5CLIA 4B83A 4EFNA 3FWYA 4N12A 4ZJUA 5DK4A 5EZYB 1NXSA 2H1LA 1SVOA 1OASA 3BXGA 2YFKA 1JS1X 3OM9A 3ZY3A 1FX0B 1B73A 1FFDA 5E8RA 4MEBA 3W77A 1O4VA 5BV2P 5LD2C 4PFSA 1A1SA 4XYMA 1SVLA 4II3A 2YZKA 1RIIA 3OZEA 5HF9A 3UV7A 1M2HA 2ZJ6A 1B0PA 3ZDFA 5DM60 3GNLA 3RU7A 4H6XA 4BFSA 5ILOA 1ZM4A 4GMGA 2GNOA 4Q1EA 4MJLA 2H2AA 3BWBA 1Y1SA 3FTCA 3QEOA 2E9SA 2H7VA 4FE4A 5IG2A 4X6YA 5T4FA 3DTYA 4OP1A 2ZGVA 4LE1A 3V42A 3TW6A 5C34B 2DJ5A 2O7VA 4RFSA 2FK8A 4U3JB 1Z6ZA 1PR1A 1KJJA 1LQTA 3QWAA 2X3YA 2PRJA 1P81A 1CZRA 1UPTA 3A3OA 2R8XA 5EIXA 2I3GA 2O2IA 1RVV1 1XMJA 4JT8A 4JYZA 2ZE5A 3DM5A 4QULA 5K0LA 3VISA 4GZLA 3PUJA 1R0WA 4FQ8A 2PZJA 4PYLA 5JDCC 2ANCA 1KE2A 2C94A 5E7MA 2CEKA 4DCVA 4YAUA 1YUMA 3BSSA 4UE3S 4JUBA 2O2SA 4WX2B 3SOPA 3G0BA 3MCAA 4FZ3A 3CEHA 1YTLA 5AJVB 1SBCA 1ZRSA 2GKOA 4PRZA 5EWJA 4RWEA 2Q1XA 4I36A 3OTOB 1GQYA 1W1WA 4NJEB 3D8TA 4CLXA 3ZI4A 4RZIA 4NE2A 2OHJA 2XPCA 5EY5B 2Y6UA 3OIYA 2IY9A 1UDWA 3KOOA 3PRYA 1VI2A 2H00A 4LJ5A 4MVJE 1E9AA 4Y7DA 2RCYA 2WMOB 4O2BF 2QG9A 3E9ZA 3FPBA 3LO8A 4F4HA 1XTRA 2H57A 3PHJA 4E09A 3GI1A 3SC2A 2HNBA 3M9LA 1B6TA 1YASA 1BSVA 1PSZA 3TN7A 2IYZA 2VPZA 1A2KC 2XWBF 5G0TA 1S2LA 3I39X 2W48A 5BSVA 1X6VA 2QD3A 3BAZA 1NXOA 4X1IB 4CQJA 2CBZA 3JR3A 5KYGA 4D9NA 3O2QB 4RGQA 1DEXA 5K01A 5LMCA 4QXQA 3ZHOA 5H4GA 5BV7A 2BRUC 3NTUA 3AFGA 2L18A 4FFMA 4KR6A 4RK5A 5SZKB 4UZEA 2H65A 3LHDA 4KU4A 3WFZA 5KCZA 5TS2A 4O1IA 2CNKA 3NTVA 3UJ9A 1SHJA 2Q41A 3UAOA 1G19A 2GEJA 2ON6A 2EEPA 3O4VA 4MVJG 4EJSC 3M8KA 3QLUA 3ZQKA 4Q0MA 3SM3A 1APBA 3VSCA 1QZ3A 2GSWA 3CPSA 4PCAA 3EY9A 4OFBA 3FHOA 1O8BA 3U9LA 3KSUA 4AKHA 3M4NA 1G42A 3JATB 4G0NA 2CXSA 5LN1A 1XP8A 1ZH4A 4UQOA 1DEOA 1H65A 4NBTA 3GL9A 1VE5A 1S8NA 3TO5A 2OGTA 3E1GA 3VNRA 4R0NA 3ED1A 1QIFA 2XNDD 2PMEA 4JP8A 4PRKA 4D81A 2TMKA 3G23A 2VA9A 3ZVMA 3IR7A 2VSYA 3R5FA 4L5CA 4UTOA 3RVKA 4BV3A 5KYNA 2Y92A 4M83A 1UUFA 5FBHA 5ALEA 5H83A 3DHVA 1O08A 3SZOA 2R6GA 3W8FA 3V6MA 1KDYA 1H2FA 2R66A 1PTJC 1UEJA 4HADA 1Q17A 1XK6A 1YI1A 2DBZA 2H06A 1WTAA 4HMPA 5LB4A 3LECA 4XIIA 1FY2A 3LCMA 1UM9A 3LUBA 1ADCA 2WZCA 3LLUA 4JQCA 4NMMA 4XIFA 2Y1OA 2ZW9A 4GBMA 4R2LA 3TS1A 3CUYA 1XD2B 1HT2E 4HY3A 1BXZA 4Y9UA 4YQYA 5EQDA 4BNYA 4CODB 1QRSA 3KSRA 1SJ9A 3B3JA 3LGAA 4O8CA 5JSYA 4D3FA 1RQ7A 2X7HA 1HEYA 4LXYA 1EAYA 3AWDA 2Y1WA 5DWVA 2MMCA 1AO3A 3VMFA 1DBVO 4IJUA 4U5QA 4S12A 1N6LA 4S04A 1C30B 1Z0FA 1N9KA 1WMFA 3OT1A 5LZ5A 3ZWVA 4ECEA 3NKFA 4CLHA 5KQRA 1NBMD 4IVNA 2AWNA 4DRYA 1W9HA 1A7JA 4EYEA 2AOVA 3GJ0A 3Q3JB 4RGVA 2PRZA 2PO5A 3LCUA 3QX3A 1JTFA 3EGEA 5IH3A 5DFAA 3W6UA 4ZYYA 1U9JA 4RJIA 3RAFC 1MIOB 4FFOA 1M75A 2QQ5A 3C3MA 3ZZ1A 2P90A 4AULA 2OXCA 1L1RA 2PBZA 1Y4UA 3NGLA 2IHZA 2YQ4A 4KH1A 1XOIA 2PSJA 1RLTA 3FNGA 3I32A 4XRRA 3F4BA 1KQNA 2JD1A 1LDMA 4M46A 2PO7A 5EHZA 2J3KA 1NP3A 1VKJA 3EXIA 4MJ7A 3S55A 4RDHA 1DQPA 4ED9A 4W5QA 2A88A 2CD9A 3IQZA 3CE9A 1QH8A 2QRJA 4GC5A 3VDNB 3DB1A 2J6IA 3HWSA 4OCZA 4DGQA 4IMJB 4KNYA 4M0EA 3PNVA 1CF9A 3CUTA 3LLCA 2P11A 3ILSA 4JOSA 1K89A 2OXEA 3DMFA 2BM9A 3EIXA 2W8BB 4IIFA 2OHXA 3DZIA 4KTVE 2ZRLA 3OCCA 3CS3A 3DVLA 4D4LA 2XVXA 4NCBA 5IABA 3ANLA 3OTQA 1ULSA 1Q2XA 1Z17A 5F4BA 4FVTA 2R0QC 1F12A 3N8GA 5J58A 5D87A 1ZK2A 4PE5B 3L8GA 1IJKA 2J0EA 2OZPA 4TZTA 1ZIXA 3D6NB 3EE6A 3FA2A 1JU4A 4M9XA 4KZKA 3KSBC 1VG8A 4MWZA 2WSMA 1VFNA 4XDYA 1JJBA 3HWWA 1DKNA 2Q4BA 3I9KA 4LX8A 7REQB 2C5AA 5MFZA 1JWLA 2IXAA 5BR7A 1W4CA 4ZYXA 2F1OA 2GEBA 1PJQA 3E3NA 2QX6A 4MWCA 4Y30A 5AK6A 3WHPA 4D9EA 1K4MA 2IYQA 4URXR 2W93A 1KJIA 4NEGA 1FNMA 2ZBRA 4IDOA 1ISPA 4W7IA 1P1IA 5D86A 1K8XB 4LZWA 2I65A 3NC4A 4GGOA 1YAJA 4XLZA 2C9BA 2ZPUA 3UAVA 1UDCA 4W5NA 2ZJAA 4QC2A 5AO9A 4EBBA 4LRYA 5FHQA 3WLHA 5K8IA 4MMYB 3W9UA 3K5IA 4U7HA 4JC0A 4QG7A 3U2QA 3HZZA 1W581 2Q21A 3H9JA 4GPZA 3QWBA 3UGJA 3F71A 3H3XA 2CB9A 1KFEB 1T5HX 2H2WA 4QFDA 3L0PA 4XD7A 1PCXA 2A9JA 2UZ0A 3NXKA 1O2DA 4R1UA 4AKIA 3VUEA 4OM8A 1QGUB 3PC4A 4WCVA 3K70C 4IS3A 1A4XA 3BWDD 1DC5A 2C3PA 4Y2TA 1K6IA 2YHAA 1ZU5A 2OY0A 4WFKA 4QPDA 4AWAA 5EPEA 3VR5A 5A3QA 3FDZB 3RUAA 1D1PA 1G8JA 4YMVA 2A59A 1T36B 2LNDA 5CLQA 5KJ1A 3N75A 4F7WA 1LV7A 2R5FA 3BUSA 2RHOA 4G9GA 2XA2A 3M89A 3NW9A 3DE1X 4OKIA 4Y2QA 5FUQA 2DT5A 3P9QA 2B5WA 4AMGA 4PZUA 1I6LA 2FPUA 4HB0A 2XF2A 1WZNA 1AX9A 1U8FO 2A7QA 1NJFA 1ICIA 3BZWA 4QGAA 1UT6A 3G2IA 4IEEA 5IJ0A 5LQRA 4JAVC 2G6TA 2QQEA 1F6BA 2PQ6A 3GP8A 1VHQA 2IQIA 4X00A 1NVUQ 4BFZA 1XLTC 3I01M 2FFBA 2CGEA 2WHEA 4KE7A 4GD3Q 2UZAA 3NVAA 4J7AA 4U7DA 1S3IA 1WEHA 3ZJ4A 1NG1A 2ZJ4A 3N8IA 1KQ3A 2AV6A 2X5OA 1QC5A 2GJ9A 3BF7A 2CSXA 2ALJA 1FSZA 2P9BA 3DHYA 1FDSA 1TADA 3I6IA 4M8KA 2WNHA 1TM2A 4L51A 4M55A 3UKDA 1PLJA 1KA9H 3SXJA 2PKYX 5HIAA 4OJQA 4ZDJA 2GZ2A 1FBTA 2IY8A 2X0IA 1MP0A 4BZXA 5COQA 5EZSA 4ENQA 3TMYA 2XMQA 4LJYA 1PEAA 4FW9A 4I4TF 4EO9A 3G9UA 5DI9A 2VAMA 3MFQA 4F7DA 5HKBA 3HQ4O 5C5EA 4HDKB 4EDHA 5T6MA 4DR4B 3HCRA 1UOQA 2I6XA 1A8IA 5LOVF 3STVA 2GI4A 4D5EA 4HYYA 4QHTA 4CGZA 3KUCA 2B1JA 4HLCA 4GI1A 2HPHA 4YP1A 1KDRA 3E9RA 3FWPA 2C1ZA 2PGXA 4JHLA 4D4IA 2YQZA 2VP3A 1X92A 3H8JA 3KJEA 1B0AA 2CDAA 3IV7A 1NQ5A 1SPBS 1N34B 1KARA 1QDEA 2OBBA 3FPHA 3LPMA 1XEAA 2PUJA 3A6KA 2CV0A 1TGVA 4JBYA 4U2KA 3REOA 1JHXA 3BCRA 2PDAA 4Z0TA 4QQ8A 5GAJA 5BV0A 1WZEA 3L7YA 4W9NC 2A1IA 1JDBC 3VJKA 2GBLC 1DIAA 4DN6A 4D4HA 5KYVA 2QVZX 5JPIA 4BVAA 4P5EA 5EMLA 3RFUA 1JJ7A 4RZXA 2PX5A 1X2BA 4J7XA 1Z2PX 3KZ1E 4DV5B 1Y8RA 2WUFA 3COPA 4YHBA 3HEMA 3L49A 1BROA 4C08A 1V4VA 3T5AA 1E0JA 3AL2A 4CR8A 1KERA 1ODKA 3QNMA 2HK9A 2GEFA 2Q4DA 2WILA 3SSOA 1FU4A 2CHGA 3G9XA 3AR3A 2YVAA 2BTQB 4FWIB 3PJDA 4BNXA 1TQ6A 1WXIA 3B6EA 4YJHA 5BXQC 4KGXA 4MV6A 1J1ZA 3ZCTA 2FA9A 3SBEA 3RD5A 1NQOA 3O7WA 4MW5A 4XAQA 1MRSA 5CX1B 3QIVA 2N9UA 3IKJA 1PX2A 1XK7A 3P7MA 1TW2A 1OE0A 2JCYA 3F7OA 1TVKB 4JGBA 3BJIC 2WF6A 1NNSA 3KZKA 3C3EA 4EY3A 2RHJA 3TLZA 3RJZA 4XA8A 3TL2A 2G88A 2BWJA 3EOBI 3TYXA 2JCSA 3VTFA 1Z0SA 3R0VA 2PRKA 1DAFA 1GSAA 2R3SA 1C1HA 1WMEA 1GVHA 1QHHB 2IT1A 3G6WA 1YNSA 2M1ZA 3LJKA 5DT2A 3SLGA 2YNMD 5AM1A 3MAGA 2HT6A 1JLSA 2BMEA 2K2QB 3M4YA 2C95A 2NM0A 1JIUA 3D43A 1WMBA 3FLMA 4BNKA 1W25A 3HRIA 4PC7A 1A4RA 4E08A 2F4VB 2OP0A 1NLUA 4AF7A 1T26A 4B44A 1OFTA 4C43A 1SU6A 2TSYB 1YS9A 1I1HA 3A6DA 4HNGA 2NPOA 3LDAA 4EB6B 2PKEA 1B43A 4DLWA 4DDKA 1ACLA 4JKOA 2CLIB 3NPMA 4P2GA 1G5IA 4TL6A 5E9JA 1DAPA 3L1UA 2BFDB 1IRIA 1NW8A 4C5CA 4MKXA 4D98A 3L8ZA 4ZJYA 4OI4A 1GD1O 4CL0A 8OHMA 5ICCA 3ZNNA 4OGGA 1LJ8A 2OILA 2WM9B 3OLWA 4DV6B 3HKCB 4J0HA 4JYCA 2D4HA 2FUG1 3VHXA 5C7OO 2PT7A 2RHCA 3LVBA 1QJ4A 4R54A 3RS3A 2FRXA 3SU8A 1T1RA 1SWVA 2AOUA 3FYTA 3FMFA 4MV7A 5EN4A 5FJIA 1U5BB 4HDOB 4IXWA 2DMRA 3U4GA 3CJQA 2BFCA 1GTG1 1HZJA 1U7WA 2RC5A 2ROQA 3GGOA 3L02A 1T0HB 4BN4A 5FP0A 5SY9A 2V5UA 4IDFA 2QN1A 5DHFA 4FM9A 2HSWA 4WVLA 4GKKB 3CUUA 4PSKA 5EWMA 1XMQB 1T2EA 4KFUA 3UMVA 1SA0A 4NG4A 3K31A 1V5EA 3GDHA 5KUTA 1C7ZA 1G4HA 1QRDA 3AEZA 3WLNA 3PEWA 1XNHA 1R6TA 2CC2A 3I6MA 2A9RA 2P9GA 1UP4A 3GEMA 3HYNA 4HL6A 3UAGA 4KBYA 3UGTA 3PEYA 3VQTA 2R84A 3ZLBA 1XVUA 5CNJA 5BWNA 3GDOA 4P5PA 4PC6A 1DTWA 3HA3A 3WGNA 3B8HA 3U7RA 4BHTA 4E1BA 5A9SB 5HZKA 3AVUA 3C15C 3C70A 3A9TA 4X71A 5TPZA 3WLFA 4AYXA 1Y8QB 4BJHB 3U4QA 3ME5A 4YRQA 4HMQA 2V8BA 2DWCA 4E3WA 1XPJA 3LMKA 1I7LA 2VDRB 2VDKB 3KB8A 4I99A 1OYOA 5I9TA 4ZJPA 1OA1A 4C4PA 1B26A 4EY4A 1ID1A 1Z29A 3VZPA 4B6EA 2ET6A 1DAHA 4XOIA 1CU1A 2Q28A 3AYZB 1TPZA 4HXEB 5IHXA 2FHPA 1KQPA 3SR0A 1WG8A 1KBOA 4AY6A 2AMYA 2C84A 3E5RA 1A7KA 1UBMS 3M1AA 2FI1A 1B23P 3ETLA 4M6WB 5E0OA 1U7OA 2FG5A 2AG0A 1ZIOA 4OKNA 1PT8A 1LK0A 1TJNA 5A5EA 5K99A 3P9RA 5EKDA 5GIPE 2NWQA 1X7YA 1KQGA 3CVWA 4EI7A 3FBTA 2M6SA 2EJWA 2VF8A 3BHIA 3DL0A 4OHPA 4MB6A 4MGEA 4MVJM 1QPZA 2PX4A 4MCIA 4YRFA 4ALJA 2XSZD 1CEQA 1K63A 5BWMA 3JYHA 1SVNA 2EFDB 5SYNA 3E2MA 3GBVA 2OENG 1ISGA 1I36A 2JARA 3F7NA 2R7LA 4KDEA 3FPSA 2R1VA 4R40A 2QNBA 3Q5DA 1FPMA 4TWBA 3KXDA 4HQ0A 2NT4A 1JXQA 1KH1A 3NEJA 2YHIA 4F2HA 1P7YA 1H0SA 2PQMA 4XR4A 4DQVA 4PSAA 1NUQA 3U4IA 4I1RA 4LXGA 1ICEA 1UBOS 3W2IA 2FFQA 2D8MA 3C2QA 1I24A 3OZBA 5AKZA 3TAUA 4DKJA 3MMXA 2FG6C 5IBCA 1NX9A 3RSCA 1HUQA 3KNZA 4TT8A 5ISMA 5CVVA 2GCOB 5AWFC 3GFOA 1VM6A 4UNPA 1KL7A 4MI3A 3W1VA 9ATCA 3JY6A 1BEUB 4KR0A 3WL8A 4YY3B 2DEUA 4HH0A 4WBSA 2YWHA 1EFVA 4DDWA 3EB9A 1NSFA 1UJ5A 3EQZA 1TE2A 4OXNA 5EXEA 3RYFB 4TZ6A 3NI2A 1OZ0A 2R47A 1I4EB 1RQ2A 3R5TA 4IIJF 4PZZA 4PQGA 5IXSA 3UJAA 3LT1A 2QLTA 3DW3X 1YZKA 2RGWA 3LZ6A 4HGYA 1OY1A 3TIVA 3KEMA 2IEBA 1GCAA 2QTWB 1N0HA 1VLLA 4EI2A 2BL4A 1NASA 1CRZA 3D0OA 4IKEA 4KZPA 3AG5A 5EJ9A 1USGA 4DREA 4JR0A 5JBQA 4FLMA 5KNBH 3OG9A 4H3HB 2XXAA 1GRNA 2GYWA 4FOSA 4M1QA 4FJ0A 3FW1A 2F00A 4UTZA 2O5CA 1U3FA 1ZZGA 4H59A 1JHAA 1ZG3A 4F4DA 4JT4A 1YS7A 1Z2EA 2JGAA 4ZQFA 1G5FA 4X8HA 3TZQA 1GSIA 1QIHA 1IXKA 1PL0A 5D7BA 5TQ0B 2PN1A 3DWGA 3F6YA 3LBFA 3VU9A 3NASA 4CNBA 4JY7A 1U98A 3QXGA 4D9GA 1DO0A 1M7HA 4WNIA 3TGWA 1SK8A 4QO8A 4B3CA 2GYYA 5CVTA 4JB8A 4M53A 1XEXB 4LOLA 1J07A 4B75A 1IG0A 2VAXA 1SIWA 1UK9A 2EDCA 4WEOA 2Q5QA 3IP5A 2WIFA 3KOUA 3CBGA 4MKHA 4MR9A 3OLZA 1BJTA 2JFPA 5AI6A 5AKXA 2QMEA 4ARBA 4YMGA 3E7XA 3N0XA 2R00A 1V4NA 4LDPA 4CM3A 4F9EA 1II0A 3LUJA 1JKFA 3Q8KA 3GT7A 1EZ4A 1BEZA 1CZUA 4N7MA 3P9XA 3HRKA 4LOHA 3VHRA 1I94B 3FX2A 1J2JA 4I3HA 3QKIA 4KX5A 3TSOA 1TAQA 4D3ZA 4BZWA 2ZQ5A 5H59A 7GPBA 3SF8B 2A0WA 3RV4A 1OH6A 4D25A 1U65A 3K5HA 5B58T 4F4UA 1EI9A 2MR5A 1WXHA 3UC9A 5JQGB 5DO9A 4G5OA 2Z2XA 4M1WA 4PZEA 4R7TA 1KDOA 1J42A 3FTNA 1CIPA 1G1AA 2JFXA 2MYPA 4M88A 4CLEA 3ZZTA 5CDGA 3FOCA 2AEJA 2RGDA 2WJ6A 5FULA 5LMNB 3A1UA 3VJMA 3F8TA 4AJIA 4RPJA 2X4LA 1Y4ZA 4UTPA 3L7OA 1Q50A 3BVPA 5F64A 2RIRA 1KY4A 1FMLA 3AJEA 3COZA 4GLOA 3H97A 5JLJA 4QYXA 3KPYA 1JEQA 1QDLB 3PGLA 4OMDA 4JBHA 5GVRA 3U6BA 1EEXB 1WCYA 4HP8A 2GN1A 3I72A 4HDCA 3TEMA 2YIDA 3GHHA 2VZ8A 3IQWA 3FWKA 3UMSA 4X0EA 3HYLA 1FRZA 2J0SA 1ZWLA 4FEGA 1NW5A 4WI1A 4YI3A 4KFRA 5ALRA 2XNSA 4E5PA 1WMSA 4UXJA 5I45A 4JMPA 4XM0A 2RCNA 2O0LA 4RK4A 1URPA 1ZM7A 2XD4A 1TQDA 2P3QA 1E92A 1CX9B 2J6HA 2PWAA 3PIDA 3REFA 1DINA 2QN3A 3BE6A 1VBFA 4PS1A 3UK6A 4BX3A 5A9RA 5HOEA 1I4LD 5LYJF 3D2BA 1GQRA 1P0IA 3HJNA 3U9TA 4J7CA 2ZAOA 5I9SA 1PJAA 3OZFA 1ZD8A 4HF7A 3GA7A 3Q8LA 4KBGA 2J9ZB 1Q5PA 1TT5B 1JMKC 1MT0A 2GR9A 2Y2VA 2ZYHA 1Z5PA 2GTIA 1Z12A 2KM1A 2VIIA 3E22B 4ZVSA 3ONDA 2AXPA 2FVYA 1T4DA 3B1VA 2EHJA 2IYVA 3DNMA 4AZVA 1Q44A 1U2EA 2W6PA 1SCJA 5JPDA 2Q6OA 4WEQA 1KBQA 4BB5A 5GADl 5IKOA 2H1WA 2KYRA 3TI7A 2X5NA 3SYTA 1FVXA 5IBQA 4OQYA 3PR1A 4AQYB 6Q21A 4ESOA 3FSJX 3S4YA 2OCPA 5DCLA 4IRUB 4N40A 2Q1YA 1IN7A 1AHIA 3DV0B 4YJ3B 2OYRA 4V03A 3VNQA 3FJYA 2WIDA 2NYAA 4QG3A 4N76A 1HX7A 3H5TA 1JSRA 3H5WA 4BJ3A 4PONA 5CXUA 1L6IA 3NC1C 1GRRA 2XUIA 4R83A 1VSTA 2BGUA 3IQEA 2FX2A 3A6PC 3WAGA 5B6PA 1MQ9A 3L84A 1M1NA 3MT8A 3JVUA 4DLSA 2GX6A 4Z4EA 3A0UA 3K9WA 1Z75A 2G07A 3ZBPA 4BLUA 1E6EA 1PQUA 2HQBA 4Q1VA 4P54A 4GX1A 4Q00A 2W6IA 1FYEA 3OQIA 1P6QA 1AB5A 4D6PA 2REQB 2DQKA 3EG9A 1NRIA 4MRNA 4US1R 3DD1A 4K2AA 5BQ5A 4D0NA 2GPAA 4EGQA 2WUEA 4WKGA 2IS4A 2I7XA 1E6WA 2PU5A 1QJCA 4JNKA 1U90A 4XLTA 4AS3A 4R1NA 3CN7A 3CNOA 3Q6IA 1RNLA 1OA0A 3FTFA 3TZHA 1TMGE 5B1HA 3UN1A 4HDAA 1UFOA 1PHRA 2OAQ1 4UULA 5MN6A 2C7OA 3DZHA 1GXSA 1UPBA 2ATCA 1KSJA 2B3TA 3A70A 1I1OA 3G8YA 2WJJA 4HTFA 5AM4A 3K9BA 3TXAA 2H18A 3WQRA 1WY5A 1OLSB 2HSGA 3VBEA 1CJSA 2I2WA 1W4RA 4HAUA 1FW8A 3HCNA 3OVMA 4MTCA 3ZUGA 4KDRA 1HQYE 4OJMX 1ISIA 4QL3A 1PRYA 4RUKA 2OL4A 1S2GA 1N0WA 2QV0A 1AXEA 3VKWA 3LKBA 4NPCA 5AJWA 3EXEA 2P6MA 2G9RA 1BS1A 2O48X 4IDBA 5E2BA 3CPEA 3W6NA 4EJSA 5I5EA 3H16A 3RJMA 2VJQA 3CVJA 3S2UA 1P0QA 3SHVA 3PT5A 5KC8A 3R0JA 5AVVA 4AWXA 4Q48A 1P9WA 4TWJA 1KO5A 2I3ZA 1FVFA 3IAM6 3P2YA 3WMGA 2KBEA 3OA0A 2PD3A 1YQDA 5ALGA 1WDKA 3P2JA 4JYPA 3J7AC 4P4TA 2MSNA 4H7HA 3AKDA 2BGGA 3P32A 4BC0A 1EG2A 3MCVA 4Z51A 1R0CA 1VSVA 1F0NA 2I3BA 1NN3A 4IRXA 2AUTA 3WIOA 4A16A 2ZI6A 1O0CA 3OIWA 3THRA 3WP0A 2YMQA 3QTBA 3LNCA 3BMNA 3TIIA 1PTJA 3GLGE 3GMTA 5HF5A 3ROMA 1T3LA 1C2TA 3RRFA 4IGKA 1CUCA 3DSRA 4BDSA 3NHWA 3WMXA 5K0CA 2NSHA 1PT7A 5TGZA 1I0IA 3KLBA 2IPLA 3LNTA 3P8ZA 4L16A 1E1QD 5GIOE 3TAXA 2JIMA 1IEWA 2DR3A 3ST7A 5TR9A 4U2DA 4OAQA 3TOZA 1YJ5A 2HKIA 4HWSA 3TDMA 1KORA 2FRDC 1X15A 1IU9A 3M5WA 3SZMA 3LQFA 3SJUA 3LYAA 2VDNB 1Y3FE 4BBAA 4YDQA 2GKSA 1WO8A 2YHBA 4L4SA 3BSYA 4WNCA 1ZH0A 3H8WA 5AQEA 5FFNA 3UJ7A 1LNQA 3EVTA 3SI7A 3AUTA 4DZTA 3L1JA 4OAPA 2HQ1A 3MNFA 1QHEA 5A4DA 2GN0A 4OP2A 4PLZA 4R8RA 2WF5A 4AMYA 3TG2A 1EDZA 1N2CA 2Y68A 5FV4A 1W46A 1TTTA 1JRLA 1OR8A 1DVRA 1C8LA 4C7JA 3K8QA 5K2MA 3V3TA 4TYNA 4LF8B 2VQ3A 1WNTA 2R6FA 4GQAA 4HDQB 4H7FA 1UODA 4JBGA 3MTIA 2VSQA 1H2BA 2NACA 4U1RA 4CTJA 2WD7A 5FNVB 1IOVA 2W42A 2DUUA 4QLBA 1OQAA 1TJ5A 5EXDA 2OCAA 3JD3A 3S70A 4MHSA 3T52A 1IE3A 4R1OA 4Q5IA 1I32A 1YI0A 4LGMA 4AROA 3SIXA 1J0CA 1QYRA 2VYFA 1SO8A 5EJMA 3WMEA 4DBZA 3L6UA 1E8DA 3MSXA 4IWXA 2OCYC 3L8FA 2I4LA 3D4NA 1Q1ZA 3OPNA 3FMPB 4CWAA 4B73A 4ZCMA 3LT4A 1E7YA 4DEVA 3OBBA 3RSGA 2ST1A 4KPUA 1JI3A 2NZ2A 2BFEB 1G66A 4MZXA 3FSGD 4AQDA 1YL7A 2G71A 4MV9A 1I2CA 2HJGA 1C0PA 1Z7EA 3ICQB 3NOVA 3HDQA 1VP3A 2IHTA 2IITA 5FEMA 1WF6A 4GI2A 3EUFA 3V32A 5M34A 1SOVA 2QVYX 4BO9A 5B6JA 1WSDA 2PNFA 1GTMA 3NT5A 1XWFA 3B5JA 4QBHA 5A2QA 4KITB 2XX3A 4MVCA 4C4TA 1XTTA 1M6EX 5B4VA 3C6XA 2L0XA 1PW7A 1R88A 4Q34A 5B1IA 2PK3A 1AXGA 5LZ9A 3EZNA 3JQ9C 4O2LA 5KNLA 2D2IA 1RZRD 4ES6A 4LJ9A 3PJFA 3BXFA 5M04A 1RLOA 2C54A 3S7ZA 2OHOA 2PJZA 2UUOA 4X85A 5KYXB 1J5EB 4QOSA 5LVAA 2IA5A 3TK1A 1RBMA 1ORDA 1OC2A 2JCGA 2WOOA 3PA6A 3SZ3A 4RD1A 3CB2A 4YUZA 4CF7A 5LQSA 2FEOA 4G36A 3FH0A 1NR5A 1YJCA 3R3ZA 2Y1KA 5TPWA 3HC7A 3C5HA 4YMWA 2QSYA 1Z5WA 4GPEA 1BN7A 2VJKA 3C74A 2D2FA 2EP8A 4LG1A 2GBGA 5FOWA 1ZSYA 4CMKA 4S1WA 1SBYA 3N2GB 1JWAB 1R0SA 3E9EA 3U3MA 4DUGA 2HMWA 1KFKB 1GLNA 1XI2A 4O4JA 2AUNA 1GPKA 1Q0QA 1S2IA 5IZCA 4AKEA 2JCXA 1JZQA 1FSFA 4KCGA 1L3BA 1EVLA 4H6WA 2ENWA 4U7GA 3ANXA 3GH3A 3ZZUA 1XZPA 4C4ZA 3GC6A 2ZJ0A 5DN9A 4A0HA 3H1AA 1SQFA 1FQJA 4IOLA 4ZVMA 2AB0A 4HH1A 4W8GA 4CEHA 1Z9BA 2DP4E 3KOYA 4ZKDA 1AVTA 4RHCA 2OQVA 4DADA 2B9VA 1Z4KA 1EVEA 3HFJA 1N9GB 1NI4A 4RLSA 2UUBB 5E4TA 4RA6B 4NAVA 4ZGBA 2QN8A 5I01A 3GN1A 4PV7A 5DX1A 3F1LA 3AM5A 3HY3A 3T5DA 4YXWD 3ZCQA 3UAYA 2QD2A 4EG8A 1KI1A 4JYAB 1YK0A 1XLTA 4P4SB 3ZE9A 4IX9A 4URFA 4YJDA 1TW3A 2JBWA 1XYGA 4Z0PA 2C7VA 3PE3A 3SGLA 4NJOA 1GG9A 4B9EA 2QYTA 3CUSA 4BLWA 2OOKA 3MYRA 2XUOA 4TRJA 2GRAA 4L95C 1YZVA 5ARBA 1DC8A 1O03A 2HBQA 4KQJA 3A1TA 3I28A 4CW7A 3GRYA 2WYUA 4UZSA 2Q2OA 5SY6A 1GGMA 1X1TA 4R9RA 1CQZA 3N87A 1NVVR 3IPXA 3RBXA 3HZOA 1M8KA 2C4TA 4G5RA 1QM5A 4G1VA 2JF0A 4WTOA 2JGEA 1SUDA 3PPWA 1R7RA 2B1GA 2ILTA 2OZLB 2BEVA 2G5CA 2GDJA 3CX8A 4L22A 4RV9A 5D6OA 5TMPA 2R62A 4KX3A 4H60A 1ZEJA 4NU0A 2QM8A 4P7JA 2OHVA 4HXYA 1YR8A 1OXSC 3LLSA 5EIBC 5D3ZA 2WAOA 2V6IA 1NFRA 3H19A 3MWYW 4E1AA 2IBSA 2ECQA 3DPIA 5JXHA 1Z38A 2I80A 3IAFA 4LWZA 4DCUA 2ZT8A 3Q11A 2B3DA 3X1KA 5IASA 2ODBA 2EC5A 3KHUA 3CONA 5DBOA 4NSNA 1KVQA 5JANA 1MZVA 3CKYA 3TOSA 2BGJA 1R8YA 1T9AA 4GGMX 2ATIA 1RMYA 2B2NA 3LQQA 2NZXA 3RSZA 2FR1A 1J8FA 5KOYA 2GBLA 5ALKA 1ML4A 3FF4A 4JODA 1GEGA 1LY1A 1SU7A 3IXQA 3M49A 1IAQA 4UNIA 3ZJVA 1I80A 2YQ5A 3KDPA 2DR0A 4EQZA 4CKWB 4JEHA 3DLCA 3SCZA 1H0RA 4HRAA 2GNPA 1F9EA 2WKPA 2MHCA 3DBRA 3PYLA 4B2LA 2SKDA 5J5CA 3EZGA 4FT2A 1SG0A 4B4KA 4J1QA 1E2QA 4MQBA 4RANA 2R6ZA 3HR4A 4YIKA 5ANRB 2Q1WA 5AW1A 2VNHA 5BW8A 3ZHXA 3PKIA 3EEOA 1WSBA 3ZZ0A 3NFYA 4AX4A 3GAFA 1RJ9A 4K3UA 1N1DA 4EB8A 2HWYA 2NG1A 3MIZA 1R9NA 1Z62A 3ANMA 2DTXA 1NE7A 1XRLA 3IR5A 4UUAA 4MCHA 4N41A 5F7XA 2FPIB 4JJAA 4LRXA 2PT5A 4F6CA 1IHPA 3QY0A 5MF6A 5HRAA 2PJRA 1JLLA 1O94D 3B7GA 1Z37A 1GCIA 1AJEA 3IHWA 2D8AA 3GBPA 2DPXA 3I0MA 4BFUA 1ZRNA 4PFQA 5BW4A 4LS3A 3IP3A 3EZYA 1NXXA 5F21A 5JEEA 2OBYA 1GU1A 1QVAA 1U1DA 2V7GA 4KL8S 2RAVA 1CUUA 2VHEA 3WADA 3ZBUA 2EGUA 3PGMA 4LBZA 5HIKA 1S2DA 1DSSG 2NZ8A 4DE5A 3CIFA 1O6ZA 2GPTA 3HM2A 2I76A 3D7RA 1KS2A 3K9HA 4FINA 5KI6A 2BH2A 2FAXA 3H1BA 4D5GA 2OGUA 1K75A 1WP9A 3MQ2A 4R68A 4HPXB 5FWDA 4MLDA 2J6CA 4F6RB 1S02A 2FE4A 1QRRA 2CNOA 1HEIA 3RYHB 1I7SB 3ESRA 4A0QA 1BQ4A 2CZGA 3KQHA 1VCOA 3HBAA 3ZCVA 1EESA 2UAGA 3OC0A 3F6BX 4X8LA 3B7PA 1M1UA 1UFRA 2WVGA 3FCEA 3V7NA 1QQ7A 4KIGA 3SSNA 4OYLA 4NESA 4S0ZA 4AIRA 3U3XA 1OJLA 4EMSA 2QWXA 2JRLA 2WPDD 1VA5A 1V9LA 2YTZA 1HT3A 3OSZA 3JXEA 3TR5A 4R0MA 1P0MA 1JHYA 2HZBA 4HX9A 1I3NA 1A5BB 2G8LA 4OL0A 1VLQA 3R7LA 1P1RA 2GJ4A 3D4BA 3N8KA 3PUHA 1GA6A 3IBTA 4LVUA 1ZJZA 4MB0A 4MVJI 2GFIA 4Z9YA 2BBOA 3GF4A 4I9UA 5EFZA 1AA6A 3K1JA 2BFOA 2BN4A 3MGAA 1XXHA 4JJ7A 3ENWA 2QOEA 2FDRA 1DJLA 3R3UA 4C0XA 4CKCB 3MCTA 4IZ6A 4QE3A 3T7RA 1L7RA 3KZVA 1P6UA 1Z34A 4C7OA 4FGWA 2BCEA 1U2PA 2ZOSA 2KLHA 5TT1A 1UWVA 2VZ0A 4QUBA 1M6VA 1I5EA 4LJLA 1KAHA 2AFIA 1OGJA 3PR3A 1FLNA 3K2IA 4GECA 4POAA 2BFWA 1Q12A 3GNTA 2QRQA 4J0CA 4X45A 1MX9A 2ONZA 5H16A 5GJBA 4EG7A 3WQBA 4PAOA 1ZD4A 2IGTA 1ONNA 4R84A 3AUUA 3D3WB 1RFLA 1KIFA 3QX9A 3C3YA 3U17A 1P18A 1ZXLA 2ID9A 5SV2A 3EFBA 2NUAB 3ZWAA 5HIJA 1AK1A 1WD5A 2P30A 5HUQA 3U7FB 3PQ5A 4RU1A 4KOAA 4O4HA 4PNZA 2NVBA 3NIGB 1Q0RA 3FR8A 1P1FA 1GZ5A 3I52A 1T9GR 4MRPA 1H94A 5HIIA 2Q3DA 4ZK6A 3PC6A 4H17A 4P3OA 5HKKA 2V6BA 5HFAA 2RDMA 3PQ8A 4ZK2A 3FJ1A 3PHHA 3U7QA 3UW1A 3JQCA 3NGXA 3V4FA 4BWGA 2JH8A 1ZWKA 4HNAB 3O1LA 2KBFA 2OCIA 4IGFA 5LLSA 1B93A 3RREA 4YAKA 5ECGC 2OCGA 4L4RA 5C1PA 4IZHA 3GVXA 1L5GB 3OHSX 1T8RA 3HLYA 4KYVA 3UV6A 3K30A 1Z82A 2XMBA 1MTOA 1O8CA 1VKZA 2BFFB 4CF4A 5IYZB 1PX0A 2GXQA 1Z2CA 2YL2A 4YEDA 3FD8A 3FCSB 4NHOA 3R7FA 4B3SB 4GVPA 2ZRFA 1AUOA 3JQAB 1M34A 4CLRB 3E15A 5KX5B 3K6RA 1RYNA 3KPUA 4BMSA 1JJIA 4C05A 1E2HA 1NP6A 2TMYA 4HDMA 1UBKS 1WXXA 3KT0A 5E6UA 5BN5B 3RWOA 5C80A 521PA 3AI2A 3ROTA 1CETA 2QIOA 1U0LA 2ZSUA 4LNAA 3DDUA 4RM2A 2CFTA 1O9HA 2PZBA 2VI5A 3DKRA 3JYPA 4YJFB 5K1ZA 3KYDA 3VR4H 2RKBA 5KDDA 2AX3A 1L0BA 3JAKB 3JR7A 4JUFA 1JHVA 3D7LA 2V3VA 4NJMA 4PGMA 3DEFA 7ADHA 1NBAA 1QTQA 1OCEA 3AVVA 4NV3A 3RR2A 4E1VA 3TLMA 4EG1A 2QP4A 1K7EB 2GM9A 2ZTHA 1B8OA 1AKRA 4JJ8A 3RC3A 3WL7A 1HQKA 1MAWA 2FSVC 1DRJA 2CVPA 2QVGA 4EL5A 4NBLA 4B6GA 2QRVA 2ZVPX 3EIOA 3C3BA 3OCXA 4KSBA 5AI9A 4CL8A 5JFOA 5LNK6 5HTKA 1FUKA 1ZLXA 2B7CA 1I51A 3GJ8A 3PVSA 4KWCA 4P7FA 1V26A 4ZAZA 4MYTA 3VR6A 3A3YA 1PT6A 2QLMA 3QY9A 4EZBA 5DYYA 2FSGA 1R6DA 1Z18A 3BIJA 2HMVA 4TV8B 5CX4A 3RO7A 2GVNA 5JATA 4RULA 3CR8A 3GNQA 4ZO9A 3GH1A 4M0DA 3LOUA 1R5OA 3DHEA 4RQTA 4ZPJA 1CK4A 3QE0A 1DFHA 3JWIA 3I9FA 3UJHA 2G1JA 3WLOA 5IFKA 1PK9A 4XD7D 3X1MA 1WQ4A 3JS5A 4P1ZA 4M8NE 5GONA 4U2EA 1SXPA 5C31A 3W3ZB 1KH2A 3M0EA 1ZW6A 2BKXA 4NZOA 4YRSA 1Y9ZA 3C1UA 2DPLA 2J5QA 2QAGB 4RK6A 2OZEA 1CJUC 3PEEA 3AHEA 4XGKA 4E6EA 1MO5A 3VR5D 3O9ZA 4RNCA 4ZCSA 1NOJA 3GVPA 2HZ7A 2JASA 3AM3A 3G7NA 5ICMA 3S29A 2BGRA 3B13B 3USES 2HF7A 2PGDA 4IJKA 4IJVA 1NE2A 1JQ5A 1H23A 1PHPA 3VTZA 1OFGA 3EFOA 2JEOA 2XZPA 3CO0S 3FWZA 3I73A 3OQJA 3QBEA 4OK6A 4RJKA 2C3OA 4FUQA 4ENVA 2P5YA 3RYIB 1WA5A 2JEYA 2IYPA 5EPOA 4RFVA 1BGXT 3RDPA 5B58C 3AJDA 4RXUA 4LSMA 2XYVA 1UXKA 3CRQA 3O9MA 2A7XA 1FQWA 5E6SB 4LOKA 4JLKA 2JJ1D 4UFPA 5AM3A 2G80A 1F2TA 1GCUA 1H8EA 1EA5A 1GR0A 3OQBA 3G13A 1HYBA 4QDJA 4YBRA 4CHGA 1Z88A 2QRMA 3C5EA 4U7FA 3L6DA 2O5VA 2QM3A 3PUWA 3E6AA 3EF1A 3R6DA 4R9NA 3QA9A 5F3DA 2VYVA 2JGMA 1JE1A 3TECE 2FETA 1OVGA 4NR0A 5KSPA 4RKRA 4JDPA 1FIUA 3HHEA 5J9FA 3OX2A 4EUFA 4ZHSA 1PYOA 5CB4A 1HWYA 4BFWA 1ZC4A 4YAFA 4B6QA 5CT8A 2XOKA 2FKNA 2Z3VA 3BD9A 3NALA 3GAMA 3OF5A 1A69A 1QIEA 3AERA 4OQDA 4CMIB 2FVXA 2IFTA 8ABPA 2FZLA 2N47A 2V74B 4N82A 1KTVA 2GN2A 2PUDA 3H83A 1KI9A 3H2YA 3EG5A 2VXOA 2JFGA 5G3ZA 1USIA 1U28A 5JROA 2P7IA 4TKVB 3EPHA 3S8EA 3ICCA 5IUNC 4KSYA 1QFJA 2C7GA 4Q1CA 3EMKA 5G4KA 2WFAA 5JFTA 3HH8A 5GM2A 3PB3A 4ER3A 4XGNA 1YCFA 2H3EA 2X4DA 3G0OA 2ZRJA 3KU4A 1PFGA 2IUEA 2VJAA 3AP1A 3MCUA 4K9DA 1CDOA 2RGAA 1DJMA 3PCTA 3AGQA 4QTYA 4HCJA 1AKUA 4G24A 3WWEA 1VKRA 3KOXA 3AKCA 5CK4A 3TI9A 2VQFB 1C3OB 1JU9A 1Q1BA 4L9RA 3ZWQA 3I2JA 2IYLD 4CF6A 4E4TA 1FP1D 1SR8A 3EXFB 2QGNA 1UM8A 3B89A 3N58A 5BUZA 4L74A 3BJRA 1NVEA 1MX5A 2P4HX 3H0KA 1FMCA 1MQAA 4QTZA 5DWQA 1UADA 4EG0A 2NUBA 2XE7A 3PEFA 4WKPA 5JZSA 2V7QD 3GLIB 2PGLA 4HDRB 2QPTA 3IALA 3W90A 3FAKA 2XYQA 4ZIRB 2P4QA 5BSKA 2ZCJA 3U6KA 4E4YA 3QUBA 1PDWA 4EM6A 2QTLA 1JKIA 3SY8A 3HU1A 2VDQB 4IOMA 1DMSA 3RK0A 3HG7A 3KKQA 3DBLB 3QE3A 1WKVA 4Q19A 3WY9A 3MD0A 1HFWA 1RRGA 2GHRA 2KW5A 5DHSA 1AQUA 2ZXFA 4K8OA 5ALMA 4N18A 2VATA 1Z8HA 3CKMA 1ZU4A 2EP7A 3GK3A 2W2LA 4WJZA 5ALSA 1BA2A 1J9ZA 2AJTA 2DBRA 2F3QA 3OAAA 4GX2A 4TN5A 3CF4A 5JD3A 1QE3A 5THKA 1EXWA 3N5CA 2WDZA 1B15A 3EDRA 3SM9A 3TQOA 2F1KA 5C8YB 4OKSA 2JAUA 3R9XA 2RKWA 4L8VA 4HQOA 4M0UA 1TF5A 4ZFNA 1C4XA 5AM5A 2DY0A 5I9BA 2AR0A 3OEEA 2FWIA 3ENKA 3JQ7B 4ZZ0A 3ISTA 3L01A 3QEJA 3PD7A 5FA6A 1J7KA 2VP9A 4EAQA 1YZLA 3VVCA 1WB4A 1F9AA 3O84A 4HG2A 4LV5B 2CMFA 1RKVA 1WUTA 1X13A 3ONWA 1SOMA 2EL7A 3WWCA 1U0NA 1AGXA 4Q1BA 4RE5A 1L9XA 2R8OA 1RC0A 4ENTA 1R6BX 4LVOA 1ARZA 1NY6A 1RM4A 4G2TA 1P72A 4KXUA 4TLLB 5SZHB 3RIGA 1BDHA 1SD1A 3K0BA 1I13A 2C5EA 1OX4A 2G0AA 2W2OA 3IVMA 3OPVA 4XYGA 3QI2A 4YCMA 2VXCA 3EN0A 1YJ8A 2WLTA 3F2IA 1FMJA 3PNLA 5FR2A 5CFOA 5L40A 5LFAA 1QP8A 3I2IA 3OX1A 2FN4A 2J5XA 3R8CA 2DBQA 3UVEA 2QTVB 5GVSA 2HREA 1CUVA 2VCHA 3VO2A 2WJVA 1LI7A 1V8DA 2C1XA 3I2HA 4IS2A 4CMHA 4P82A 3IVAA 4EEKA 3V8NA 1Y1LA 4RVHA 1Z6TA 4F3YA 3E58A 2OZKA 2VJMA 5HGXA 1KI6A 2M2IA 4OLJA 2QL9A 3H7IA 3NBYC 5FUYA 4D79A 2NGRA 3B5EA 1T3SA 1Y0BA 1M1ZA 2YUTA 3NHSA 4WZBB 3PF9A 3ZEAA 3CLUC 1QRTA 4EJ0A 5H7XA 1KZ9A 2DQSA 2QK4A 1C0IA 1NBHA 3A6FA 4NIMA 4V0QA 1FJGB 4XDHA 5D2CA 2JDIA 3VX4A 3QYFA 2Q3JA 2JIZA 1N2EA 2O8EA 3CO5A 2O0JA 3EC2A 4HLUA 4N01A 3VPSA 1RQXA 4R3WA 1RRCA 4JQSA 4ZDWA 1O0SA 1YU6A 4HN9A 4JUDX 5FWYB 5IMBA 5H81A 5CBPA 4UHHA 1P39A 2ZYIA 4UHCA 2AFHA 2ZR9A 1DIBA 3CTPA 1H2RS 4DNOA 3L5KA 2OO3A 5BUSA 2B8WA 4FHFA 1E4EB 5KTKA 2P9JA 3ZDEA 4IIHA 4BIIA 1YT5A 3ZC3A 5IX8A 3VU3A 1IM5A 3EBOA 4DMUB 1Z07A 2H9YA 2JS7A 3D8HA 1E66A 4AKTA 2GXAA 1FRQA 2XNHA 1SMKA 3C3AA 3EWNA 1RVDA 2R1TA 1X38A 1XZEA 1NPDA 2IYUA 2EARA 2OFOA 1FYVA 4ZJZA 2EGHA 2EQAA 3FUUA 1W4BA 2C2HA 2G82A 3D4PA 5DX8A 3A9WA 3SZUA 3R8FA 2WFLB 3BXXA 2C57A 5LYYA 3G82C 4RSHA 5L3ZA 4UNNA 3M6XA 3L1HA 1M54A 4J90A 3K16A 4NNJA 1JXMA 3Q9UA 2X5JO 3G89A 1UT8A 1H8HD 1Q0UA 2DFDA 1V8PA 1EDBA 4XX0A 3EQ7A 3QGMA 1GGVA 3ZBQA 3HADA 3MS7A 2E4YA 2FE1A 2OVBA 2CBGA 4L6CA 3T3NA 3Q7EA 2G67A 4LZPA 5DN6D 3BB1A 1EUZA 1LBHA 4DANA 1FL9A 1MX1A 4FSHA 1ST2A 4YWHA 4KQXA 2DF8A 3T1YB 3JARB 3MK31 4G2NA 1LDBA 1T43A 4HZIA 5LU8A 3OPXA 1G8AA 3WB9A 3QU7A 3IIJA 1E6MA 1HA3A 2XE4A 5AKKA 2QAGC 2R6JA 2EW8A 1M8JA 2OT3B 4V02A 2X40A 1BXRA 4X20A 1SRRA 1ONPA 1W88B 1ETHA 2PCJA 2GFHA 1UZLA 2RFLA 4OHXA 4TKUA 4WK6A 1HL7A 1EIZA 1JFFB 3HNPA 5EFOA 1U7PA 2CJYA 4R2XA 1VB5A 3DHNA 3LY7A 4C01A 2ZWOA 1E2JA 4DMGA 2HW8A 3V7UA 3GRVA 4R7ZA 3TD6A 4YP6A 4LXIA 1ZHOA 4UD2A 1AQNA 2IP1A 4E5NA 3JWHA 3LTEA 4AJ1A 5CPFA 2FUEA 3GLRA 3EHDA 4CXMA 1QB8A 4Q4AA 5FPQA 2AFRA 1TRHA 2FPWA 4DWJA 4KLZA 3TRKA 4M2LA 1C4KA 2YXPX 3A06A 3SQMA 3HPQA 5KZMB 1JEOA 5CDUA 2RK3A 1YF3A 1UBFA 2O4CA 1V7ZA 5K3CA 4BPBA 2RAUA 2ZTUA 4M9RA 4IDGA 1JPJA 1R8QA 2C5SA 4CKXA 4DYHA 1VXOA 2HU7A 1XVIA 3MWJA 1PT9A 1KRHA 2HV9A 4AG5A 5F9HA 4ZT3A 4CDRA 1FLDA 2K6GA 3LDGA 1M1YE 1CT9A 1PYDA 1JB1A 2XCLA 3TBFA 2Q9BA 5KYKA 1O96B 4ZV7A 4J1TC 4PXSA 1V8ZA 1DKUA 3D3JA 2Q5JA 3BIOA 2FW0A 4EABA 2ZWMA 1EBUA 1KU0A 3I01A 2AN3A 5CLHA 3HJFA 1FFYA 1E1CA 1N9ZA 5AXDA 2FUG6 3V33A 5KYTA 1GG5A 2YIJA 1G5RA 3P9KA 3C85A 3MWLA 1YZNA 4HB4A 4DW8A 2CFOA 2XQIA 2X15A 3D8BA 2IWHA 4A6EA 5KYYA 4RTKA 1T34A 3JQ9A 1J21A 1RQPA 4X24A 1UBCA 2QR3A 4QFCA 3RKRA 3ZHVA 3MMZA 2PZKA 4NK5A 3LBNA 2DHCA 4UAJA 1TCCA 3ABSB 1PNTA 2FKAA 4US0R 5DBFA 1FNDA 2P2NA 4XB2A 1P5ZB 2D5CA 1M66A 3S68A 1CR1A 4D9CA 3F98A 3K8YA 1N2SA 2GLUA 3ABRB 4F56A 4LZZA 3L6BA 1KOFA 1ISMA 4CEIB 3ED5A 2IEAA 4DNPA 1U5AA 2FR0A 2WF9A 3I04M 4DRZA 2EJCA 1A8UA 3X2SA 4ND5A 5DNCA 1GVNB 1SVIA 2W37A 3OIVA 2QD1A 4K40A 5HFNA 2QPLA 5CLGA 3ZLTA 2GCEA 3FUWA 3TDKA 2ZJ7A 2O8CB 1H2AS 2V0CA 4KWEA 4GYJA 1QIGA 2HHLA 3VM6A 1IQ0A 3LG2A 5TMEA 4RY2A 4NI5A 4AN4A 4BNMA 4UTXA 3FRJA 5DPMA 5EE5B 4PZPA 2AJDA 2O8BA 2GA9A 3IAAA 4Q24A 4FB5A 4L73A 1QIMA 3MWEB 4TN1A 2EKZA 2G72A 1SUAA 3NCHA 3FKSD 4KSCA 3O94A 3NRCA 2Q3BA 2X5XA 2HXYA 2WHYA 4OHRA 5BQPA 3P2OA 2HX1A 1COZA 1LNZA 5I9NA 1RAGA 1JB9A 2YDXA 3QKWA 4FDMA 4YDSA 1KO8A 4IMRA 1R4MB 1S0UA 3MPUA 2H1HA 1QKIA 5FO0A 1KAEA 4IWYA 3L8HA 1J9EA 3WJ1A 3LT5A 3GOQA 5F7JA 2ZUCA 1B41A 4DLTA 3NHKA 1Z7BA 4BRWA 4MHTA 2EZUA 4RZSA 2A5JA 4MIYA 2I4NA 3E3LA 4NONA 5CDFE 4XIYA 4QDXA 4GBGA 2A4MA 1RLUA 2NW6A 1CZOA 3LLMA 1GHTA 1I4OA 1KI2A 1HORA 4KACA 3G2LA 4V24A 5HJ5A 3ZE7A 4OBXA 3IH5A 3VV2A 1G18A 3UFXB 3U44A 3BWEA 3BDIA 1FU8A 1DWUA 4NENB 2A30A 2GRUA 4BC1A 4J0DA 4FGZA 3T95A 2XT0A 2B83A 2INGX 3KR9A 4HB3A 3AFIA 3AWIA 4MUGA 2QYOA 4EZEA 2UVPB 4RYDA 1CZKA 4CM1A 1TO6A 2O3JA 3P94A 4NYIR 4G0OA 5J2UA 4MQEA 3BOSA 1JG4A 1ZITA 5TQVA 3AIOA 3RUDA 4CUJA 5LA6B 2PBFA 4Y2HA 1KXZA 4LVNA 3BXEA 3NR2A 4J9UE 1M0TA 4TTIA 3RRXA 5ADUS 4RM3A 2B98A 2PGJA 1PJ3A 3HBNA 3IHKA 1UXHA 3SR4A 4N3BA 3I8OA 1OBOA 4GO1A 1W36D 3R0XA 2Y77A 4MP3A 4YRPA 3G6KA 4O02B 4WNAA 3TLXA 2X86A 1Q1QA 4CTMA 1KZ6A 4Y2UA 4WCDA 4LISA 1Z5OA 3O4JA 3E1KA 3AKZA 4O4IF 3DDHA 3QFRA 2XA1A 5G53C 1M76A 3KZXA 4IV5A 3PVCA 4IXDA 2CLKB 4N5DA 4X54A 3U81A 1XELA 3R3WA 5EJIA 5DTJA 3KJQA 4RXMA 4TVSA 5I9IA 4YTEA 1ZCFA 3RGWS 4OLFA 4XPIA 3EPLA 3HYRA 1RW4A 2IHVA 3TLYA 4M54A 4DT1A 2AC2A 4GNKA 4ZVVA 3G17A 2W6ID 5ENZA 3GLFB 4OMFG 3HCWA 3UY4A 4D9JA 2J48A 1Z6PA 2ZE7A 1ISFA 3L4SO 4FKMA 1KI3A 4PXAA 4P84A 1CUSA 5EJ4A 3VPCA 1W44A 1MCZA 4G4JA 3R5HA 4FR5A 3T61A 3DLHA 1BCRA 2CK3A 1KJ8A 2JLSA 1SCNE 4PTYA 4XH9B 4XVCA 4XWYA 1SUCA 1YQUA 1T9KA 4RABA 2PR2A 3MLEA 4BLSA 3NONA 4DC1A 3S44A 4PX5A 5EE1A 3E84A 4RHEA 5JAHA 1JKJA 1LK5A 1LW6E 1XAJA 4ZU1X 1WY7A 2QPAA 2VWHA 2WKQA 3ZD8A 4C7BA 1LGYA 1RWKA 1U2DC 1ZM2A 4K7JA 5TIIA 4YCNA 5GINE 4FKZA 1ZZEA 2WFMA 3AEUB 4CQLB 2E0IA 1UKVY 3K1AA 4A0SA 1JHZA 4L7VA 3HJAA 4FNMA 2XTJA 5B37A 1RADA 4LOIA 2WNIA 1BWPA 1QFYA 3U16A 5KSWB 4O4JF 3CX7A 2WSSA 4K3VA 4OQZA 5EJAA 5FWXA 5HS6A 5JSQA 1OFVA 2YHUA 2D0DA 1BCSA 3THWB 2JD0A 4D6YA 3F6SA 4G8DA 3F3SA 1LDYA 4L2IB 1N5DA 4TX1A 5ECYA 4FEEA 3PHGA 4RL6A 1VIVA 1VJRA 1OI4A 4M99A 1T3ZA 2PMFA 1P9NA 1MAAA 1F17A 4FYKA 4P86A 1BIFA 3K15A 4Y9DA 3UMRA 1T4GA 2Z2JA 1SOAA 5JVDA 4HNRA 1XLUA 1KK2A 1IJEA 3ON5A 1UBLS 3KT6A 4B3IA 1ORTA 4TMVA 4KJXA 2F8TA 2DFNA 3X43A 4EJFA 3JWGA 2JJ8A 2O57A 3ZIUA 4CUKA 3QF4B 5LQJA 3R3JA 3SLKA 4DC9A 3K53A 3Q72A 4RTSA 4DJDC 2OAP1 5I7UA 4O2BB 4G4GA 5C32A 2QLBA 1JT2A 4OBEA 2H1FA 5ALTA 3HABA 3H18A 4QJ5A 2X22A 2XWQA 3ZLJA 1RYBA 1TEVA 1C4OA 2ODTX 3WR5A 4A15A 1DCTA 4MVJA 3ML1A 4HLNA 4B6SA 4MDFA 3LH5A 4PBTA 1N8KA 3H2SA 3KKPA 3M82A 3JAWB 4KXYA 1IHXA 1JAHA 4ZMRA 3OQMA 3CF2A 3ND6A 4BNDB 2YVKA 1ZOSA 4B6FA 4ZQGA 1RXYA 4ABYA 2WP0A 4X63A 4DDHA 4LY6A 2PSFA 4WINA 3Q9LA 1TX4B 3FYDA 4J3JA 4EW6A 3BTVA 5F76A 1HE1C 1KMIY 3PL1A 2JB9A 3H2BA 4MAFA 5FPTA 1UANA 4FD2A 2UZ3A 4IILA 2FWNA 4CKZA 1YDFA 1OWLA 4JJ4A 3F47A 2BMFA 3EYWA 4Y7CA 4XCVA 2VJLA 3JZAA 2XLBA 3TJRA 5BNIA 1JH9A 5CT4A 2JGNA 4QREA 5BN3B 1ORVA 1VG1A 3PHBE 1X87A 4DUZB 4AICA 1SC1A 3HJRA 1AH2A 1IHYA 4FQ5A 4B45A 2IHJA 3BL6A 3M4ZA 1QO0A 1VFPA 2HI0A 3I6ZA 3KJGA 1AN9A 1ZK4A 3OICA 4RA9A 1E69A 1HRKA 4TXLA 2C2YA 4BFXA 4C20A 4WN9B 2PG3A 5KS2A 3E2IA 2O5EA 3A0RB 5M7EA 4AX8A 4EOGA 2O2CA 2PCLA 4YB8A 5CFRA 821PA 3ANTA 3HJTA 1KI4A 1ECCA 1L3IA 1JHOA 1WLYA 2C04A 1P4AA 2A5GA 4V0ME 1TUEA 3WL3A 4CE6A 3TKYA 3LFHA 2N1MA 3IFSA 3OE1A 4JLUA 2CXXA 4JUIA 3VAZA 5BSGA 5IDYA 1JFRA 1PS9A 3PD0A 4KXVA 3HDJA 2PZGA 3JWPA 2NUPB 4GOKA 4LGYA 2DH5A 1VJCA 1X7ZB 2VT7A 1Z0AA 3C39A 4RF4A 4EEXA 1D9XA 5F9FA 1TYAE 2YX1A 4LHYA 4IDNA 4ESHA 4XUDA 1H6CA 3RSSA 4OIMA 3W1WA 4I1PA 2ECFA 3Q9SA 3TD2A 1XZLA 1CB7A 1LSJA 1R15A 5BSHA 5BYKA 4YO8A 2IUUA 4JA0A 1H22A 1JVBA 4FC6A 4DYDA 4U7TB 5BOVA 1E4VA 1O6FA 3BDVA 3FAZA 4GP9A 4OQNA 4RK0A 1QGYA 2DUJA 3BWVA 3DDZX 4RJLA 1XCLA 1ZMTA 3RS4A 1EFKA 1W85A 2Y6VA 1F8XA 3AFHA 3OUTA 3OJLA 1W5FA 3TEFA 4JJGA 3FOFC 1H93A 3GPCA 3KQUA 1E2FA 3FUVA 4MXDA 1M2OA 1C0LA 2LRHA 4WOBA 4OGLA 1D4AA 1QYIA 4R7GA 4ZVNA 4ZCQA 3WISA 3WLAA 2YYZA 3OTIA 1QO7A 3U61B 1PD0A 1P6XA 1GNPA 1GL7A 3LIIA 2OGZA 3LDHA 4B09A 4K88A 3CCFA 2R11A 1GPAA 1ISSA 1JVNA 1PBTA 5CH8A 2DTEA 3KBBA 4QJ3A 3WI7A 1EK6A 4MB2A 3VC3A 4CPDA 1H1LB 4FOLA 3NHAA 3SJZA 1U2QA 2EZTA 3HB9A 4LECA 4RJ2A 4WW0A 4ZANA 4QUEA 4ARZB 2OCBA 4ZRMA 1BDIA 1XDWA 5AI5A 2I0FA 4EI8A 5L3QA 3QVJA 1Z5GA 4OI0A 3HXMA 3LUGA 3GLIE 3A9CA 1E6KA 1YTUA 3AUJB 1W59A 3RABA 4LI3X 1RYEA 3MN1A