1TRUA

The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1truA00
5AGYA 3LXTA 1PSQA 4GQFA 2ZUPA 4GCIA 3GFKA 4BWSA 1E6BA 22GSA 5CRHA 2J23A 2WRTA 2MBSA 5ECOB 1F3AA 1M99A 2RUEA 1O85A 3OR5A 4KGIA 4OCFA 3TB2A 1NSWA 4JR4A 4XHMA 3H8QA 4G9HA 1V58A 1OYJA 2KHPA 5LCZA 1GNWA 3VFIA 4MJAA 1FVJA 2OACA 1SD8A 20GSA 4IVFA 2VCXA 3UL3A 4IS0A 3RHBA 4HU7A 4TXOA 3W8SA 2X64A 2C4JA 3CTGA 3N9JA 3FZ4A 1W4VA 2HZEA 3D0ZA 3CBUA 1K3LA 4PUFC 4RQRA 2GQMA 2V32A 3C8EA 4EO3A 1ZYQB 2JU5A 5H5QA 5H5RA 2GZYA 5ECQB 1YZXA 3D4TA 3GSSA 3ME8A 2L59A 4DSSA 2TRXA 4WEYA 3EE2A 1R26A 1THXA 2YZUA 3ZL5A 2YPMA 2V2GA 1ERVA 1MDIA 3HA9A 1YF1A 1A8LA 4MCUA 1WPIA 4ZB9A 3TOUA 4MDCA 1FB0A 1B4PA 1V9WA 2IFQB 3KTBA 3TJBA 4OMVA 1EWXA 4D73B 5KN3A 3TKQA 1T3BA 1WRYA 1JZRA 3TJKA 1X0RA 2K8SA 3Q19A 3FR6A 1SKRB 5DAKB 1JLWA 3IAM2 2DIYA 3VI5A 4LA1A 1OE7A 2H1GA 3CTFA 4TKYA 1GSSA 1JZDA 3ZIVA 2FUG2 2RLIA 2VD0A 2GGTA 4IP1A 3GX8A 5DJLA 2IMDA 3L9SA 1HQOA 2IMIA 4K9ZA 5J5NA 1BX9A 1W89A 4WF5A 3O76A 2F51A 1T8EB 3F63A 2R5GA 1ZOFA 5B8AA 1YY7A 5F06A 3A5WA 3TKSE 1V40A 4DEJA 1WMJA 1GRXA 3IPZA 1XWCA 3GA4A 5EPFA 5D9TA 1ABAA 2HSHA 3FZ5A 3C71A 4FIWA 2DSAA 4K0GA 5AIXA 1PL1A 3GSTA 2AB6A 3MWHA 2PWJA 1XOAA 2GSSA 2HRNA 4BVYA 1A23A 5D9WA 4AJ8A 4E8HA 1A8YA 5IPHA 2LKUA 4GRFA 5ECKB 2H0IA 1FVKA 3KXOA 2VLUA 3RBTA 2WZ9A 4IBPA 4KB3A 5ECLB 1SK2A 4PQ1A 5B6NA 1PRXA 4N11A 3GRXA 2IIYA 2O7KA 2OE1A 5G1KA 3WD6A 2WGRA 1WJKA 2GVPA 3F6DA 1WWJA 1OAZA 5IO0A 3TRPA 3US3A 3UIWA 4MF7A 5D96A 2FHEA 2VL2C 5JCGA 3VWWA 3GKXA 4Q5QA 4EDZA 2I9HA 3HKRA 3RHCA 1GSDA 2H66A 5IPGA 3KZQA 5FT3A 1DE1A 1GSEA 1FB6A 1R5AA 2HT9A 2FWHA 1O73A 1U3IA 3MNGA 4KSOA 3HYPA 1O6JA 4HQSA 3GV1A 1AW9A 4PXOA 3FYGA 1SL1B 3VWXA 3O3TA 4NV2A 3UAPA 4K7OA 3UEMA 4KUNA 4QL7A 2LNTA 4MZBA 4O7HA 2Z9SA 1OVNA 1EP8A 1THOA 5DDLA 1ERWA 1N2AA 1XPVA 3D4MA 5HR1A 4TXOB 1H4OA 5IMDA 5J9CA 4AJ6A 1Y6EA 4POBA 2HZEB 4ISDA 2BJXA 4I5QA 3DD3A 3HJPA 4ZBBA 1XIYA 2DC5A 3I9V2 2MMAA 1XVQA 2KLXA 2M46A 4ML1A 5GSTA 4HQZA 2OBIA 1TJDA 3P90A 2XHFA 2PGTA 3ZFLA 4MABA 4Q5NA 3CRTA 1PN9A 3GURA 3M9JA 4DSSB 2GLRA 2GQKA 1G0TA 2VUPA 2O8VB 2CVDA 3E9JB 4KAEA 3L4NA 3HJOA 2HLSA 2HSYA 3ZVJD 3RPNA 1UN2A 5ECMB 3QOUA 4F9ZA 2V1MA 1SYXA 4JEDA 1T4ZA 4X0XA 1AQXA 4ECJA 2VOCA 5ECNB 4WBRD 3EVIA 4ID0A 1ZMAA 2I1UA 2RIIA 1J0FA 3P7XA 11GSA 4TR1A 2C0DA 1TW9A 1ERTA 1PD21 5JWRB 1V98A 4MPFA 3BBYA 3ZMKA 1B48A 2E2GA 5HFGA 5C00A 2X99A 4KNDA 2K6VA 1M2DA 3TJJA 4ULXA 3GKMA 1NM3A 4L5OA 1AQVA 3LGCA 4F82A 3GHAA 2MMZA 4OWYA 1EGOA 1GNEA 4WR4A 5IMVA 4KCEA 5JWQB 4GQCA 2F3MA 4HI7A 5B8BA 3F3RA 1F3BA 4ML6A 1XCCA 1EGRA 1TRUA 2X8HA 1QXHA 1JHBA 2R6KA 4GSSA 2JSYA 1PQNA 1EV4A 1PA3A 4MK3A 2LRNA 5J9BA 1JFUA 1K0AA 5CO3A 4ZB8A 3VURA 2C3TA 3KP8A 4OFTA 4HUAA 2LRCA 3HD5A 2IWTA 4NXIA 1B9YC 3HVXA 3ED3A 2WS2A 3J7Yk 5CP1A 5A4VA 3KMOA 1BG5A 4ZL8A 2P5QA 1EEJA 2RUFA 3F3QA 2YV9A 4HEA2 4XS4B 1HNCA 2RM5A 4IJ3A 2NBSA 3ZREA 2VAFA 5J41A 4IQAA 2AUVA 4MH2A 1LJRA 4MZWA 2XBQA 2JSZA 17GSA 3LG6A 1VF2A 1XWGA 2AHEA 3O6TA 3HZ4A 2YZHA 4KDXA 1EOHA 3QAGA 1TXXA 3TRXA 3HZ8A 2VLTA 4YQUA 3EWLA 3FR9A 3UOMA 3IRAA 4HS1A 1GWCA 3EURA 1AUCA 2C1YA 2DJ2A 3HDCA 5ECSA 4YQMA 2WB9A 2YCDA 3P2AA 1URMA 4BA7A 2GSTA 2IJYA 6GSYA 1AQWA 5IIZA 4MJBA 2VCTA 3UVTA 3IA1A 4MF6A 2FCHA 2R37A 1TK5B 3CYNA 3U6VA 4QL9A 3FR3A 4POLA 3WGEA 4HU9A 2CX3A 1TI3A 2OKAA 1HNAA 1B4QA 3GX0A 1GSQA 3Q6OA 4IP6A 4XIHA 1UC7A 4J2FA 1G7OA 5IO2A 4V1Ap 3L9VA 1WOUA 3TJFA 2HYXA 2DJKA 3NOFA 4RI6A 1XW9A 5A4WA 2P31A 1Z7RA 1G6WA 3TDGA 2LTKA 4TR3A 1EV9A 4I6XA 3UMAA 4N0VA 5J3RA 5ELAA 5DCGA 2V6KA 3PR8A 2C80A 2VO4A 2L6CA 3BCIA 3WT2A 1VRSD 4HZ2A 3LEFA 4CDOA 2C3QA 5HFKA 3DRNA 3I69A 4N10A 1XXUA 1TU7A 4V2LA 3ZZXA 1A2LA 3A3TA 2GZZA 3H79A 1H75A 3GL3A 4EL1A 3KD0A 2VM1A 4I2UA 4G2EA 4X1UA 1E2YA 4Z7XA 3VLNA 3W6GA 1ILOA 1ZZYA 3TUEA 5GAND 1X9MB 1F6MC 3ZTLA 3IK7A 3ZVJA 4TR1B 3RPPA 1DUGA 1TTZA 2FWFA 3MSZA 3QMXA 4F0BA 1ST9A 3RDWA 5L71A 3A2VA 3BOAA 2DJJA 1OC9B 3H93A 4F03A 4O32A 12GSA 2B1LA 1M2AA 1IYIA 3LFLA 4MP4A 2H75A 1S3DA 4ECIA 3GKKA 3IR4A 3UARA 1OC8A 4F2IA 1QGVA 1K0CA 3CSIA 4NHZA 4MPGA 1EP7A 5CREA 4XCSA 2FA8A 5IMAA 3F0IA 2E2MA 1ML6A 2EC4A 1I9DA 2VLVA 1OE8A 5ECIB 2HE3A 4KE3A 4Q5FA 4XRAA 4K0NA 3HY2A 3KH9A 1KTEA 4LMVA 1X9WB 4MF5A 1A24A 2LEGA 2CX4A 2C0EA 3N5OA 3VPTA 2PPTA 5C04A 2A2RA 2GT5A 5DALA 4ACSA 6GSTA 4GF0A 2QKEA 3VK9A 1K0OA 2YANA 2K8VA 1M9AA 4FYUA 3EYTA 4MLYA 2H0GA 6GSXA 4KW6A 1F37A 5ELGA 3FZAA 1UA5A 5DJMA 4EF0A 1U3AA 1N8JA 2C3NA 2ZCTA 5CRWA 5IOXA 1TK8B 4RQXA 3C7MA 6GSVA 3K8NA 4JR6A 2LNSA 4E8EA 1AIUA 1GL8A 2H6XA 3QAVA 3GH9A 4TW5A 2YWIA 1QUWA 4EDYA 2H8LA 3BJ5A 1YDKA 4WF4A 4RI7A 5F05A 4JE1A 3APOA 3ERFA 2H73A 3C1SA 2YWOA 2F8FA 4JRRA 2FY6A 1Q4JA 2GZPA 1KNGA 3M0FA 3D6IA 2VL9A 2LJKA 5KN0A 3WYWA 3GNJA 3PGTA 3KP9A 3IOSA 1Z6NA 1M2BA 2E7PA 5ABRA 5J4UA 1V2AA 2TRCP 9GSSA 3JCML 3RAZA 1HD2A 3P8WA 1SJZA 3WGXA 5GAPD 4GXZA 1MDKA 1R7HA 3KM6A 3LYKA 3WT1A 2EIOA 1OKTA 4J57E 2MZCA 3ZLPA 5HR0A 2LUSA 5CRDA 3CRUA 4IQ1A 2JZTA 1SYRA 1T7PB 2LRTA 1Y25A 1K0MA 3Q18A 4I8BA 3SWLA 1X5CA 4L0UA 2IPAA 3UBLA 3EU4A 4RUVA 4WKWA 2H6ZA 5D9XA 1VF1A 1YJ6A 5DQSA 4YAPA 2B5EA 4KDUA 2DLXA 2P0GA 3CSJA 4L5LA 4ZXGA 2YP6A 4G19A 1MTCA 4Q5RA 2J9HA 2YN1A 3IE3A 2ON5A 3EC3A 4TRXA 3GH6A 3NZNA 4GLTA 2PN8A 4POKA 1K0DA 2H74A 1XOBA 4MJCA 2V41A 4GSTA 1T4YA 1GSUA 2F8AA 1K3OA 4LL4B 3DVWA 1O8WA 2ON7A 2VL3A 2CV4A 4KA0A 1VF4A 4IJIA 3TCOA 1DSBA 1NHOA 3TKRA 3ZRDA 2YNXA 5GZZB 2N5AA 4X43A 2PVOC 2X8CA 2FD3A 2LQQA 2N5BA 4P3YB 1TP9A 1J9BA 1OC3A 2CT6A 2L6DA 3KJYA 4BWQA 1X5DA 2EIQA 3C73A 1SD9A 3GN3A 2CVKA 4GTUA 3A2XA 5F8BA 4ECBA 4FO5A 1XWAA 2YWNA 5EY6A 2CZ3A 1TK0B 5IM9A 1T00A 4V2NA 3HJMA 5G30A 2JL4A 5ID2A 3GTUA 3MAKA 2OE3A 2TIRA 1K3YA 2XBIA 3FK8A 5KEJA 1GTAA 2MMNA 1YEPA 2VCVA 2XPEA 1SJ6A 2VD1A 2ES7A 1A2MA 4H86A 3FRCA 3WGDA 2PMTA 2LJAA 2HZFA 2MYGA 6GSUA 2AJQB 2M72A 2YV7A 1A0FA 2G2QA 3FHKA 1NHYA 4K6XA 2I3YA 1SU9A 3UVHA 3H1NA 1GLPA 2HI7A 1SKWB 4AJ7A 3DVXA 4WBJA 3G9BA 4WR5A 2DBCA 2OADA 1PL2A 2QC7A 3NIVA 1M0UA 1BQ7A 1BJXA 4KSMA 5IOWA 1EZKA 4ZBDA 2WULA 1V57A 1GLQA 14GSA 2IMEA 3M3MA 4JU5A 2H30A 4YQVA 3I43A 2OE0A 3EMXA 2CAQA 4CHSA 2H01A 3GKNA 16GSA 1TRWA 2H1BA 3TKSA 4YH2A 5D8IA 5HR3A 5HQPA 5COHA 5JCUA 3GIXA 4FH8A 1YF0A 2L57A 2HNLA 4PQHA 3VWVA 4IKHA 3FZ9A 4MA9A 3LWAA 3VPQA 1R4WA 2NTOA 3L78A 6GSWA 3APSA 3KTLA 5FHIA 4WXTA 2LS5A 2KOKA 2M80A 2R2JA 2L4CA 2B6MA 4V1Ag 2GTUA 1ZCPA 2GS3A 2CZ2A 3G7IA 1JZWA 1AXDA 5KN2A 2AYTA 4XS6A 3GL5A 2JADA 1G7EA 4EE0A 3F4SA 3FEUA 3J7Yb 3DXBA 2KUCA 1S3CA 2VCQA 3IXRA 3UBKA 3EINA 3G7YA 5F0GA 3KCMA 3QR6A 4EKZA 5LD0A 5JCWA 1TI1A 3DEXA 3LORA 1YEXA 4L0WA 3EU3A 2CVBA 1LBKA 3QFAC 1Z3EA 5FWGA 1SL0B 1RK4A 3D22A 2NVLA 4HJMA 3TJGA 2CAIA 2PVQA 4N0ZA 4ZL7A 1BYEA 2DJ0A 5B7CA 3F4RA 1Q98A 1SK1A 2CQ9A 4BPYA 1FO5A 1GTBA 2WCIA 1U88A 2X8GA 4HOJA 2E0QA 2I4AA 10GSA 4JBBA 3IK9A 2DIZA 2GSQA 3TOTA 3HCZA 5EL8A 3D5JA 2C0FA 3LJRA 3KEBA 5E4WA 5ECRB 3U5RE 4NHWA 2F9SA 3PH9A 4PQIA 2H70A 4XRDA 1R5PA 1U87A 2N5FA 4FYBA 4HJ2A 5ENUA 5GSSA 1FW1A 1B9XC 2K18A 1KEBA 4OO4A 2IL3A 2HFDA 2MBTA 4MH3A 5B6MA 1ZYEA 3KH7A 1ZGNA 3IHQA 5G31A 4L8EA 5ID2B 4TOPA 1SENA 3GTUB 5A4UA 1JZOA 4NWYA 2GQLA 3GYKA 2FWEA 2WDUA 2K9FA 3IDVA 4K7NA 5D93A 2DMMA 3CSHA 4OFNA 5IMCA 1GSFA 4PX1A 1EOGA 2VCZA 4AGSA 4LL1B 4IN0A 3L9UA 1C72A 2H19A 2VM2A 5AN1A 4ZBAA 3DIEA 4V2MA 1ERUA 3ERWA 4K7IA 5INYA 4HDEA 3KIJA 1Z5YE 3W8JA 2YWMA 3M9KA 1GUKA 3F9UA 1WIKA 4EC0A 2NPBA 1GTUA 4TN8A 1HNBA 3DYRA 2WFCA 4MJEA 1FHEA 2H72A 13GSA 3QFBC 3ERGA 1RW1A 4TR4A 2GT6A 1ACVA 1SL2B 2JZRA 2OBKA 2B3SA 2AV4A 2CA8A 3ZIJA 2FLSA 3PINA 3LYPA 1AAZA 1EEMA 1PKWA 2LV3A 2IMFA 3VWUA 5D73A 1F9MA 1TRVA 2H1DA 1GUMA 2DJ3A 2B1KA 3MDKA 3DKSA 4ILFA 5HFIA 4NMUA 5CRGA 3E3EA 3QD9A 5EVOA 3TRQA 4WETA 4N30A 2H6YA 2B7JA 1SK0A 2FNOA 4XS4A 2H71A 3GMFA 1GSYA 4POMA 1FAAA 5G5EA 2O87A 2O85A 3HVSA 2ZNMA 2PBJA 4XS1A 4IHUA 3QCPA 3CMIA 1ZL9A 5ECHB 6GSSA 1JLVA 3L0HA 3ME7A 1U6TA 3UJ1A 5CAXA 2YOIA 3IV4A 1I5GA 1VF3A 3VI7A 4KDYA 1VGLA 3QPMA 4MMMA 4K8MA 3C1RA 1Z6MA 4QQ7A 2FWGA 4O5RA 3SBCA 1PX6A 2RM6A 1XWBA 4TXVA 4HZ4A 4I97A 5CNWA 3KGKA 4OCEA 5E59A 4PNGA 2QGVA 1XZOA 1WE0A 3M8NA 2R3XA 3LXZA 5G2ZA 1TRSA 1TOFA 1OKDA 1GH2A 3HVVA 3GUSA 18GSA 4IELA 1WP0A 4ZIJA 4PGTA 3M1GA 4PUAA 3TGZA 3HHVA 5LNKe 1PGTA 1NW2A 3S9FA 1QQ2A 1TKDB 1XWKA 3IBHA 2VL2A 1LU4A 4FYCA 3F8UA 1RQMA 4KH7A 2H1AA 5G1LA 2OJLA 3F6FA 1IYHA 2C0GA 4IGJA 3E0UA 4ECCA 2GSRA 4LMWA 5DBQA 2D2ZA 4TVEA 5CYYA 3ZFBA 2HXKA 2VCWA 4PURA 4DSRA 2YJHA 1YKCA 2A4VA 2BMXA 1GUHA 1YQ1A 3ISOA 2KP1A 2BTOT 3G7JA 1BEDA 4LLRA 5IQYA 1PKZA 1FG4A 1QMVA 1K0BA 3V1WA 4F0CA 3A2WA 5IMZA 2GDRA 1XW6A 3EMPA 1MEKA 2XC2A 3BD2A 4MZCA 3FY7A 2O89A 1TU8A 4BVXA 2DJ1A 2XPDA 3FKFA 1X5EA 3D21A 8GSSA 1GP1A 3H4KA 4NAXA 2WJUA 2H0HA 1B8XA 4IW9A 4O92A 5AIVA 2JACA 1KBNA 2V6OA 5DQYA 4K1FA 5G5FA 1DE2A 5A5KA 1OC9A 4YAVA 2C8UA 2DMLA 2PU9C 3BCKA 3IAS2 3ZITA 5H5SA 1MDJA 1M7TA 2IFQA 4EUYA 2MMOA 3IC4A 2OA7A 5ECPB 4D73A 5DALB 3DWVA 2R4VA 3FW2A 3ZMLA 4NV5A 3AY8A 3LSZA 3LQ7A 1G6YA 1PMTA 1BAYA 1MD3A 5AISA 1DBYA 2FGXA 5DAKA 3DMLA 1TDIA 1XFLA 2PUKC 1FOVA 2HRFA 4TR0A 19GSA 3HXSA 1S3AA 2REMA 2YJ7A 4JZQA 2A2SA 4GWRA 3TKSC 1Z7PA 1QFNA 4CW9A 1XBSA 1Z9HA 2LSTA 1SJIA 2L5LA 4EXJA 1XVWA 3QDNA 1QK8A 5IMFA 3CXGA 2PERA 1SKSB 1ON4A 5DVBA 2I81A 4K2DA 2IN3A 1K0NA 4DVCA 3R2QA 4BL7A 2LJRA 1O8XA 2NDOA 1X9SB 1T1VA 2L5OA 2P5RA 4OD7A 2ALBA 5JWOB 1CQHA 2LQOA 1O7UA 5F07A 1GTIA 5HR2A 4KX4A 4ZB6A 1XW5A 3QAWA 1O81A 4EVMA 4NPBA 1UVZA 1USBA 2FA4A 2L4QA 3Q74A 1A0RP 4OFMA 1M9BA 2JZSA 3F4TA 2EIRA 2G0FA 2H76A 4DSQA 4AF2A 1F2EA 2B7KA 3DGQA 4GSNA 1GULA 5KN1A 1YKAA 4G10A 7GSSA 5D9VA 1A2JA 1HYUA 2KP2A 4ZL9A 2AAWA 3KMNA 2B5XA 4I2TA 3I6AA 1PX7A 1MD4A 4PNFA 2VIMA 2IMKA 3TKPA 2B5YA 3ZYWA 1AC1A 4XTSA 5DCHA 4J56E 1J08A 2QSIA 4KCAA 3APQA 4OO5A 4ZILA 1CQGA
chains in the Genus database with same CATH superfamily
5AGYA 1XG8A 3LXTA 1PSQA 4GQFA 2ZUPA 4GCIA 4KF9A 3GFKA 4BWSA 1E6BA 22GSA 4O5UA 5CRHA 2J23A 2WRTA 3PPUA 2MBSA 5ECOB 1F3AA 1M99A 2RUEA 1O85A 3OR5A 4KGIA 4OCFA 3TB2A 1ZYPA 1NSWA 4JR4A 4MNNA 4XHMA 3H8QA 4G9HA 1V58A 1OYJA 2KHPA 5LCZA 1GNWA 3VFIA 4MJAA 1FVJA 2OACA 1SD8A 20GSA 4IVFA 2VCXA 3UL3A 4IS0A 3RHBA 4HU7A 4TXOA 3W8SA 2X64A 2C4JA 3CTGA 3N9JA 3FZ4A 1W4VA 2HZEA 3D0ZA 3CBUA 1K3LA 4PUFC 3LW9A 4HSCX 4RQRA 2GQMA 2V32A 3C8EA 4EO3A 1ZYQB 2JU5A 5H5QA 5H5RA 2GZYA 5ECQB 1YZXA 4BVXB 3D4TA 3GSSA 3ME8A 2L59A 4DSSA 2TRXA 4WEYA 3EE2A 4K5RA 1R26A 1THXA 2YZUA 3ZL5A 2YPMA 2V2GA 1ERVA 1MDIA 3HA9A 1YF1A 1A8LA 4MCUA 4O5QA 1WPIA 4ZB9A 3TOUA 4MDCA 1FB0A 1B4PA 1V9WA 2IFQB 3KTBA 3TJBA 4OMVA 1EWXA 4D73B 5KN3A 3TKQA 1T3BA 1WRYA 1JZRA 3TJKA 1X0RA 2K8SA 3Q19A 3FR6A 1SKRB 1M3IA 5DAKB 1JLWA 3IAM2 2DIYA 3VI5A 4LA1A 1OE7A 2H1GA 3CTFA 4TKYA 1GSSA 1JZDA 3ZIVA 2FUG2 2RLIA 2VD0A 2GGTA 4IP1A 3GX8A 5DJLA 2IMDA 3L9SA 1HQOA 2IMIA 4K9ZA 5J5NA 1BX9A 1W89A 4WF5A 3O76A 2F51A 1T8EB 3F63A 4BL7B 2R5GA 1ZOFA 5B8AA 1YY7A 5F06A 3A5WA 3TKSE 1V40A 4DEJA 1WMJA 1GRXA 3IPZA 1XWCA 2A2PA 1ZYNA 3GA4A 5EPFA 5D9TA 1ABAA 2HSHA 3FZ5A 3C71A 4FIWA 2DSAA 4K0GA 5AIXA 1PL1A 3GSTA 2AB6A 3MWHA 3MIXA 2PWJA 1XOAA 2GSSA 4A5PA 2HRNA 4BVYA 5BRTA 1A23A 5D9WA 4AJ8A 4E8HA 1A8YA 5IPHA 2LKUA 4GRFA 5ECKB 2H0IA 1FVKA 3KXOA 2VLUA 3RBTA 2WZ9A 4IBPA 4KB3A 5ECLB 1SK2A 4PQ1A 5B6NA 1PRXA 4N11A 3GRXA 2IIYA 2O7KA 2OE1A 5G1KA 3WD6A 2WGRA 1WJKA 2GVPA 3F6DA 1WWJA 1OAZA 5IO0A 2R0PA 3TRPA 3US3A 3UIWA 4MF7A 5D96A 2FHEA 2VL2C 5JCGA 3VWWA 3GKXA 4Q5QA 4EDZA 2I9HA 3HKRA 3RHCA 1GSDA 2H66A 5IPGA 3KZQA 5FT3A 1DE1A 1GSEA 1FB6A 1R5AA 2HT9A 2FWHA 1O73A 1U3IA 3MNGA 4KSOA 3HYPA 1O6JA 4HQSA 3GV1A 1AW9A 4PXOA 3FYGA 1SL1B 3VWXA 3O3TA 4NV2A 3UAPA 4K7OA 3UEMA 4KUNA 4QL7A 2LNTA 4MZBA 4O7HA 2Z9SA 1OVNA 1EP8A 1THOA 5DDLA 1ERWA 1N2AA 1XPVA 3D4MA 3IC8A 5HR1A 4EIPA 4TXOB 1H4OA 5IMDA 5J9CA 4AJ6A 4USSA 1Y6EA 4POBA 2HZEB 4ISDA 4G0KA 2BJXA 4I5QA 3DD3A 3HJPA 4ZBBA 1XIYA 2DC5A 3I9V2 2MMAA 1XVQA 2KLXA 2M46A 4ML1A 5GSTA 4HQZA 2OBIA 1TJDA 5BMUA 3P90A 2XHFA 2PGTA 3ZFLA 4MABA 4Q5NA 3CRTA 1PN9A 3GURA 3M9JA 4DSSB 2GLRA 2GQKA 1G0TA 2VUPA 2O8VB 2CVDA 3E9JB 4KAEA 3L4NA 3HJOA 2HLSA 2HSYA 3ZVJD 3RPNA 1UN2A 5ECMB 3QOUA 4F9ZA 4K2XA 2V1MA 1SYXA 4JEDA 1T4ZA 4X0XA 1AQXA 4ECJA 2VOCA 5ECNB 4WBRD 3EVIA 4ID0A 1ZMAA 2I1UA 2RIIA 1J0FA 3P7XA 11GSA 4TR1A 2C0DA 1TW9A 1ERTA 1PD21 5JWRB 1V98A 4MPFA 3BBYA 3ZMKA 1B48A 2E2GA 5HFGA 5C00A 4G0IA 2X99A 4KNDA 2K6VA 1M2DA 3TJJA 4ULXA 3GKMA 1NM3A 4L5OA 1AQVA 3LGCA 4F82A 4G0LA 3GHAA 2MMZA 4OWYA 1EGOA 1GNEA 4WR4A 1FOHA 5IMVA 4KCEA 5JWQB 4GQCA 2F3MA 4HI7A 5B8BA 3F3RA 1F3BA 4ML6A 1XCCA 4K5SA 1EGRA 1TRUA 2X8HA 1QXHA 1JHBA 2R6KA 4GSSA 2JSYA 1PQNA 1EV4A 1PA3A 4MK3A 2LRNA 5J9BA 1JFUA 1K0AA 5CO3A 5KOXA 4ZB8A 3VURA 2C3TA 3KP8A 4OFTA 4HUAA 2LRCA 3HD5A 2IWTA 4NXIA 1B9YC 3HVXA 3ED3A 2WS2A 3J7Yk 5CP1A 5A4VA 2DKIA 4BVYB 3KMOA 4CY8A 1BG5A 4ZL8A 2P5QA 1EEJA 2RUFA 3F3QA 2YV9A 4HEA2 4XS4B 1HNCA 2RM5A 2UZ8A 4IJ3A 2NBSA 3ZREA 2VAFA 5J41A 4IQAA 2AUVA 4MH2A 1LJRA 4MZWA 2XBQA 2JSZA 17GSA 3LG6A 1VF2A 1XWGA 2AHEA 3O6TA 3HZ4A 2YZHA 4KDXA 1EOHA 3QAGA 1TXXA 3TRXA 3HZ8A 2VLTA 4YQUA 3EWLA 3FR9A 3UOMA 3IRAA 4HS1A 1GWCA 3EURA 1AUCA 2C1YA 2DJ2A 3HDCA 4YQMA 5ECSA 2WB9A 2YCDA 3P2AA 1URMA 4BA7A 2GSTA 2IJYA 6GSYA 1AQWA 5IIZA 4MJBA 2VCTA 3UVTA 3IA1A 4MF6A 2FCHA 2R37A 1TK5B 3CYNA 3U6VA 4QL9A 3FR3A 4POLA 3HVNA 3WGEA 4HU9A 2CX3A 1TI3A 2OKAA 1HNAA 1B4QA 3GX0A 1GSQA 3Q6OA 4IP6A 4XIHA 1UC7A 4J2FA 1G7OA 5IO2A 4V1Ap 3L9VA 1WOUA 3TJFA 2HYXA 2DJKA 3NOFA 4RI6A 1XW9A 5A4WA 2P31A 1Z7RA 1G6WA 3TDGA 2LTKA 4TR3A 1EV9A 4I6XA 3UMAA 4N0VA 5J3RA 5ELAA 5DCGA 2V6KA 3PR8A 2C80A 2VO4A 2L6CA 3BCIA 3WT2A 1VRSD 4HZ2A 3LEFA 4CDOA 2C3QA 5HFKA 3DRNA 3I69A 4N10A 1XXUA 1TU7A 4V2LA 3ZZXA 1A2LA 3A3TA 2GZZA 3H79A 1H75A 3GL3A 4EL1A 3KD0A 2VM1A 4I2UA 4G2EA 4X1UA 1E2YA 3EPTA 4Z7XA 3VLNA 3W6GA 1ILOA 1ZZYA 3TUEA 5GAND 1X9MB 1F6MC 3ZTLA 3IK7A 3ZVJA 4TR1B 3RPPA 1DUGA 1TTZA 2FWFA 4FQUA 3MSZA 3QMXA 4F0BA 1ST9A 3RDWA 5L71A 3A2VA 3BOAA 2DJJA 1OC9B 3H93A 4F03A 4O32A 12GSA 2B1LA 1M2AA 1IYIA 3LFLA 4MP4A 2H75A 1S3DA 4ECIA 3GKKA 3IR4A 3UARA 1OC8A 4F2IA 1QGVA 1K0CA 3CSIA 4NHZA 4MPGA 1EP7A 5CREA 4XCSA 2FA8A 5IMAA 3F0IA 2E2MA 1ML6A 2EC4A 1I9DA 2VLVA 1OE8A 5ECIB 2HE3A 4KE3A 4Q5FA 4XRAA 4K0NA 3HY2A 3KH9A 1KTEA 4LMVA 1X9WB 4MF5A 1A24A 2LEGA 2CX4A 2C0EA 3N5OA 3VPTA 2PPTA 5C04A 2A2RA 2GT5A 5DALA 4ACSA 6GSTA 4GF0A 2QKEA 3VK9A 1K0OA 2YANA 2K8VA 1M9AA 4FYUA 3EYTA 4MLYA 2H0GA 6GSXA 4KW6A 1F37A 5ELGA 3FZAA 1UA5A 5DJMA 4EF0A 1U3AA 1N8JA 2C3NA 2ZCTA 5CRWA 2HSMA 5IOXA 1TK8B 4RQXA 3C7MA 6GSVA 3K8NA 4JR6A 2LNSA 4E8EA 1AIUA 1GL8A 2H6XA 3QAVA 3GH9A 3R3EA 4TW5A 2YWIA 4Z2TA 1QUWA 4EDYA 2H8LA 3BJ5A 1YDKA 4WF4A 4RI7A 5F05A 4JE1A 3APOA 3ERFA 2H73A 3C1SA 2YWOA 2F8FA 4JRRA 2FY6A 1Q4JA 2GZPA 1KNGA 3M0FA 3FMWA 3D6IA 2VL9A 2LJKA 5KN0A 3WYWA 3GNJA 3PGTA 3KP9A 3IOSA 1Z6NA 1M2BA 2E7PA 5ABRA 5J4UA 1V2AA 2TRCP 9GSSA 3JCML 3RAZA 1HD2A 3P8WA 1SJZA 3WGXA 5GAPD 4GXZA 1MDKA 1R7HA 3KM6A 3LYKA 3WT1A 2EIOA 1OKTA 4J57E 2MZCA 3ZLPA 5HR0A 2LUSA 5CRDA 3CRUA 4IQ1A 2JZTA 1SYRA 1T7PB 2LRTA 1Y25A 1K0MA 3Q18A 4I8BA 3SWLA 1X5CA 4L0UA 2IPAA 3UBLA 3EU4A 4RUVA 4WKWA 2H6ZA 5D9XA 1VF1A 1YJ6A 5DQSA 4YAPA 4Z2RA 2B5EA 4KDUA 2DLXA 2P0GA 3CSJA 4L5LA 4ZXGA 2YP6A 4G19A 1MTCA 4Q5RA 2J9HA 2YN1A 3IE3A 2ON5A 3EC3A 4TRXA 3GH6A 3NZNA 4GLTA 4YKGA 2PN8A 4POKA 1K0DA 2H74A 1XOBA 4MJCA 2V41A 4GSTA 1T4YA 1GSUA 2F8AA 2HRAA 1K3OA 4LL4B 3DVWA 1O8WA 2ON7A 2VL3A 2CV4A 4KA0A 1VF4A 4IJIA 3TCOA 1DSBA 1NHOA 3TKRA 3ZRDA 2YNXA 5GZZB 2N5AA 4X43A 2PVOC 2X8CA 2FD3A 2LQQA 2N5BA 4P3YB 1TP9A 1J9BA 1OC3A 2CT6A 2L6DA 3KJYA 4BWQA 1X5DA 2EIQA 3C73A 1SD9A 3GN3A 2CVKA 4GTUA 3A2XA 5F8BA 4ECBA 4FO5A 1XWAA 2YWNA 5EY6A 2CZ3A 1TK0B 5IM9A 1T00A 4V2NA 3HJMA 5G30A 2JL4A 5ID2A 3GTUA 3MAKA 2OE3A 2TIRA 1K3YA 2X4AA 2XBIA 3FK8A 5KEJA 1GTAA 1M3JA 2MMNA 1YEPA 2VCVA 2XPEA 1SJ6A 2VD1A 2ES7A 1A2MA 4H86A 3FRCA 3WGDA 2PMTA 2LJAA 2HZFA 2MYGA 6GSUA 2AJQB 2M72A 2YV7A 1A0FA 2G2QA 3FHKA 1NHYA 2DKHA 4BIKA 4K6XA 2I3YA 1SU9A 3UVHA 3H1NA 1GLPA 2HI7A 1SKWB 4AJ7A 3DVXA 4WBJA 3G9BA 4WR5A 2DBCA 2OADA 1PL2A 2QC7A 3NIVA 1M0UA 1BQ7A 1BJXA 4KSMA 5IOWA 1EZKA 4ZBDA 2WULA 1V57A 1GLQA 14GSA 2IMEA 3M3MA 4JU5A 2H30A 4YQVA 3I43A 2OE0A 3EMXA 2CAQA 4CHSA 2H01A 4X4JA 3GKNA 16GSA 1TRWA 2H1BA 3TKSA 4YH2A 5D8IA 5HR3A 5HQPA 5COHA 5JCUA 3GIXA 4FH8A 1YF0A 2L57A 2HNLA 4PQHA 3VWVA 4IKHA 3FZ9A 4MA9A 3LWAA 3VPQA 1R4WA 2NTOA 3L78A 6GSWA 3APSA 3KTLA 5FHIA 4WXTA 2LS5A 2KOKA 2M80A 2R2JA 2L4CA 2B6MA 4V1Ag 2GTUA 1ZCPA 2GS3A 2CZ2A 3G7IA 1JZWA 1AXDA 5KN2A 2AYTA 4XS6A 3GL5A 2JADA 1G7EA 4EE0A 3F4SA 3FEUA 3J7Yb 3DXBA 2KUCA 1S3CA 2VCQA 3IXRA 3UBKA 3EINA 3G7YA 5F0GA 3KCMA 3QR6A 2A4HA 4EKZA 5LD0A 5JCWA 1TI1A 3DEXA 3LORA 1YEXA 4L0WA 3EU3A 2CVBA 1LBKA 3QFAC 1Z3EA 5FWGA 1SL0B 4Z2UA 1RK4A 3D22A 2NVLA 4HJMA 3TJGA 2CAIA 2PVQA 4N0ZA 4ZL7A 1BYEA 2DJ0A 5B7CA 3F4RA 1Q98A 1SK1A 2CQ9A 4BPYA 1FO5A 1GTBA 2WCIA 1U88A 2X8GA 4HOJA 2E0QA 2I4AA 10GSA 4JBBA 3IK9A 2DIZA 2GSQA 3TOTA 3HCZA 5EL8A 3D5JA 2C0FA 3LJRA 3KEBA 5E4WA 5ECRB 3U5RE 4NHWA 2F9SA 3PH9A 4PQIA 2H70A 4XRDA 1R5PA 1U87A 2N5FA 4FYBA 4HJ2A 5ENUA 5GSSA 1FW1A 1B9XC 2K18A 1KEBA 4OO4A 2IL3A 2HFDA 2R0GA 2MBTA 4MH3A 5B6MA 1ZYEA 3KH7A 1ZGNA 3IHQA 5G31A 4L8EA 5ID2B 4TOPA 1SENA 3GTUB 5A4UA 1JZOA 4NWYA 2GQLA 3GYKA 2FWEA 2WDUA 2K9FA 3IDVA 4K7NA 5D93A 4ICYA 2DMMA 3CSHA 4OFNA 5IMCA 1GSFA 4PX1A 1EOGA 2VCZA 4AGSA 4LL1B 4IN0A 3L9UA 1C72A 2H19A 2VM2A 5AN1A 4ZBAA 3DIEA 4V2MA 1ERUA 3ERWA 4K7IA 5INYA 4HDEA 3KIJA 1Z5YE 3W8JA 2QA1A 2YWMA 3M9KA 1GUKA 3F9UA 1WIKA 4EC0A 2NPBA 1GTUA 4TN8A 1HNBA 3DYRA 2WFCA 4MJEA 1FHEA 2X49A 2H72A 13GSA 3QFBC 3ERGA 1RW1A 4TR4A 2GT6A 1ACVA 1SL2B 2JZRA 2OBKA 2B3SA 2AV4A 2CA8A 3ZIJA 2FLSA 3PINA 3LYPA 1AAZA 1EEMA 1PKWA 2LV3A 2IMFA 3VWUA 5D73A 1F9MA 1TRVA 2H1DA 1GUMA 2DJ3A 2B1KA 3MDKA 3DKSA 4ILFA 5HFIA 4NMUA 5CRGA 3E3EA 4CY6A 3QD9A 5EVOA 3TRQA 4WETA 4N30A 2H6YA 2B7JA 1SK0A 2FNOA 4XS4A 2H71A 3GMFA 1GSYA 4POMA 1FAAA 5G5EA 2O87A 2O85A 2HRKA 3HVSA 2ZNMA 2PBJA 4XS1A 4IHUA 3QCPA 3CMIA 1ZL9A 5ECHB 6GSSA 1JLVA 3L0HA 3ME7A 1U6TA 3UJ1A 5CAXA 2YOIA 1S3RA 4YKFA 3IV4A 2R0CA 1I5GA 1VF3A 3VI7A 4KDYA 1VGLA 3QPMA 4MMMA 4K8MA 3C1RA 1Z6MA 4QQ7A 2FWGA 4O5RA 3SBCA 1PX6A 2RM6A 1XWBA 4TXVA 4HZ4A 4I97A 5CNWA 3KGKA 4OCEA 5E59A 4PNGA 2QGVA 1XZOA 1WE0A 3M8NA 2R3XA 3LXZA 5G2ZA 1TRSA 1TOFA 1OKDA 1GH2A 3HVVA 3GUSA 18GSA 4IELA 1WP0A 4ZIJA 4PGTA 3M1GA 4PUAA 3TGZA 3HHVA 5LNKe 1PGTA 1NW2A 3S9FA 1QQ2A 1TKDB 1XWKA 3IBHA 2VL2A 1LU4A 4FYCA 3F8UA 1RQMA 4KH7A 2H1AA 5G1LA 2OJLA 3F6FA 1IYHA 2C0GA 4IGJA 3E0UA 1PFOA 4ECCA 2GSRA 4LMWA 5DBQA 2D2ZA 4TVEA 5CYYA 3ZFBA 2HXKA 2VCWA 4PURA 4DSRA 2YJHA 1YKCA 2A4VA 2BMXA 1GUHA 1YQ1A 3ISOA 2KP1A 2BTOT 2QA2A 3G7JA 1BEDA 4LLRA 5IQYA 1PKZA 1FG4A 1QMVA 1K0BA 3V1WA 4F0CA 3A2WA 5IMZA 2GDRA 1XW6A 3EMPA 1MEKA 2XC2A 3BD2A 4MZCA 3FY7A 2O89A 1TU8A 4BVXA 2DJ1A 2XPDA 3IHGA 3FKFA 1X5EA 3D21A 8GSSA 1GP1A 3H4KA 4NAXA 3MYDA 2WJUA 2H0HA 1B8XA 4IW9A 4O92A 5AIVA 2JACA 1KBNA 2V6OA 5DQYA 4K1FA 5G5FA 1DE2A 5A5KA 1OC9A 4YAVA 2C8UA 2DMLA 2PU9C 3BCKA 3IAS2 3ZITA 5H5SA 1MDJA 1M7TA 2IFQA 4EUYA 2MMOA 3IC4A 2OA7A 5ECPB 4D73A 5DALB 3DWVA 2R4VA 3FW2A 3ZMLA 4NV5A 5KOWA 3AY8A 3LSZA 3LQ7A 1G6YA 3A5IA 1PMTA 1BAYA 1MD3A 5AISA 1DBYA 2FGXA 5DAKA 3DMLA 1TDIA 1XFLA 2PUKC 1FOVA 2HRFA 4TR0A 19GSA 3HXSA 4PTSA 1S3AA 2REMA 2YJ7A 4JZQA 2A2SA 4GWRA 3TKSC 1Z7PA 1QFNA 4CW9A 1XBSA 1Z9HA 2LSTA 1SJIA 2L5LA 4EXJA 1XVWA 3QDNA 1QK8A 5IMFA 3CXGA 2PERA 1SKSB 1ON4A 5DVBA 2I81A 4K2DA 2IN3A 1K0NA 4DVCA 3R2QA 4BL7A 2LJRA 1O8XA 2NDOA 1X9SB 1T1VA 2L5OA 2P5RA 4OD7A 2ALBA 5JWOB 1CQHA 2LQOA 1O7UA 5F07A 1GTIA 5HR2A 4KX4A 4ZB6A 1XW5A 3QAWA 1O81A 4EVMA 4NPBA 1UVZA 1USBA 2FA4A 2L4QA 3Q74A 1A0RP 4OFMA 1M9BA 2JZSA 3F4TA 2EIRA 2G0FA 2H76A 4DSQA 4AF2A 1F2EA 2B7KA 3DGQA 4GSNA 1GULA 5KN1A 1YKAA 4G10A 7GSSA 5D9VA 1A2JA 1HYUA 2KP2A 4ZL9A 2AAWA 3KMNA 2B5XA 4I2TA 3I6AA 1PX7A 1MD4A 4PNFA 2VIMA 2IMKA 3TKPA 2B5YA 3ZYWA 1AC1A 1PN0A 4XTSA 5DCHA 4J56E 1J08A 2QSIA 4KCAA 3APQA 4OO5A 4ZILA 3CQFA 4EIQA 1CQGA
chains in the Genus database with same CATH topology
5AGYA 3LXTA 1PSQA 4GQFA 2ZUPA 4GCIA 4KF9A 3GFKA 4BWSA 1E6BA 22GSA 4O5UA 5CRHA 2J23A 2WRTA 3PPUA 2MBSA 5ECOB 1F3AA 1M99A 2RUEA 1O85A 3OR5A 4KGIA 4OCFA 3TB2A 1ZYPA 1NSWA 4JR4A 4MNNA 4XHMA 3H8QA 4G9HA 1V58A 1OYJA 2KHPA 5LCZA 1GNWA 3VFIA 4MJAA 1FVJA 2OACA 1SD8A 20GSA 4IVFA 2VCXA 3UL3A 4IS0A 3RHBA 4HU7A 4TXOA 3W8SA 2X64A 2C4JA 3CTGA 3N9JA 3FZ4A 1W4VA 2HZEA 3D0ZA 3CBUA 1K3LA 4PUFC 3LW9A 4RQRA 2GQMA 2V32A 3C8EA 4EO3A 1ZYQB 2JU5A 5H5QA 5H5RA 2GZYA 5ECQB 1YZXA 4BVXB 3D4TA 3GSSA 3ME8A 2L59A 4DSSA 2TRXA 4WEYA 3EE2A 4K5RA 1R26A 1THXA 2YZUA 3ZL5A 2YPMA 2V2GA 1ERVA 1MDIA 3HA9A 1YF1A 1A8LA 4MCUA 4O5QA 1WPIA 4ZB9A 3TOUA 4MDCA 1FB0A 1B4PA 1V9WA 2IFQB 3KTBA 3TJBA 4OMVA 1EWXA 4D73B 5KN3A 3TKQA 1T3BA 1WRYA 1JZRA 3TJKA 1X0RA 2K8SA 3Q19A 3FR6A 1SKRB 5DAKB 1JLWA 3IAM2 2DIYA 3VI5A 4LA1A 1OE7A 2H1GA 3CTFA 4TKYA 1GSSA 1JZDA 3ZIVA 2FUG2 2RLIA 2VD0A 2GGTA 4IP1A 3GX8A 5DJLA 2IMDA 3L9SA 1HQOA 2IMIA 4K9ZA 5J5NA 1BX9A 1W89A 4WF5A 3O76A 2F51A 1T8EB 3F63A 4BL7B 2R5GA 1ZOFA 5B8AA 1YY7A 5F06A 3A5WA 3TKSE 1V40A 4DEJA 1WMJA 1GRXA 3IPZA 1XWCA 2A2PA 1ZYNA 3GA4A 5EPFA 5D9TA 1ABAA 2HSHA 3FZ5A 3C71A 4FIWA 2DSAA 4K0GA 5AIXA 1PL1A 3GSTA 2AB6A 3MWHA 3MIXA 2PWJA 1XOAA 2GSSA 4A5PA 2HRNA 4BVYA 5BRTA 1A23A 5D9WA 4AJ8A 4E8HA 1A8YA 5IPHA 2LKUA 4GRFA 5ECKB 2H0IA 1FVKA 3KXOA 2VLUA 3RBTA 2WZ9A 4IBPA 4KB3A 5ECLB 1SK2A 4PQ1A 5B6NA 1PRXA 4N11A 3GRXA 2IIYA 2O7KA 2OE1A 5G1KA 3WD6A 2WGRA 1WJKA 2GVPA 3F6DA 1WWJA 1OAZA 5IO0A 2R0PA 3TRPA 3US3A 3UIWA 4MF7A 5D96A 2FHEA 2VL2C 5JCGA 3VWWA 3GKXA 4Q5QA 4EDZA 2I9HA 3HKRA 3RHCA 1GSDA 2H66A 5IPGA 3KZQA 5FT3A 1DE1A 1GSEA 1FB6A 1R5AA 2HT9A 2FWHA 1O73A 1U3IA 3MNGA 4KSOA 3HYPA 1O6JA 4HQSA 3GV1A 1AW9A 4PXOA 3FYGA 1SL1B 3VWXA 3O3TA 4NV2A 3UAPA 4K7OA 3UEMA 4KUNA 4QL7A 2LNTA 4MZBA 4O7HA 2Z9SA 1OVNA 1EP8A 1THOA 5DDLA 1ERWA 1N2AA 1XPVA 3D4MA 3IC8A 5HR1A 4EIPA 4TXOB 1H4OA 5IMDA 5J9CA 4AJ6A 4USSA 1Y6EA 4POBA 2HZEB 4ISDA 4G0KA 2BJXA 4I5QA 3DD3A 3HJPA 4ZBBA 1XIYA 2DC5A 3I9V2 2MMAA 1XVQA 2KLXA 2M46A 4ML1A 5GSTA 4HQZA 2OBIA 1TJDA 5BMUA 3P90A 2XHFA 2PGTA 3ZFLA 4MABA 4Q5NA 3CRTA 1PN9A 3GURA 3M9JA 4DSSB 2GLRA 2GQKA 1G0TA 2VUPA 2O8VB 2CVDA 3E9JB 4KAEA 3L4NA 3HJOA 2HLSA 2HSYA 3ZVJD 3RPNA 1UN2A 5ECMB 3QOUA 4F9ZA 4K2XA 2V1MA 1SYXA 4JEDA 1T4ZA 4X0XA 1AQXA 4ECJA 2VOCA 5ECNB 4WBRD 3EVIA 4ID0A 1ZMAA 2I1UA 2RIIA 1J0FA 3P7XA 11GSA 4TR1A 2C0DA 1TW9A 1ERTA 1PD21 5JWRB 1V98A 4MPFA 3BBYA 3ZMKA 1B48A 2E2GA 5HFGA 5C00A 4G0IA 2X99A 4KNDA 2K6VA 1M2DA 3TJJA 4ULXA 3GKMA 1NM3A 4L5OA 1AQVA 3LGCA 4F82A 4G0LA 3GHAA 2MMZA 4OWYA 1EGOA 1GNEA 4WR4A 1FOHA 5IMVA 4KCEA 5JWQB 4GQCA 2F3MA 4HI7A 5B8BA 3F3RA 1F3BA 4ML6A 1XCCA 4K5SA 1EGRA 1TRUA 2X8HA 1QXHA 1JHBA 2R6KA 4GSSA 2JSYA 1PQNA 1EV4A 1PA3A 4MK3A 2LRNA 5J9BA 1JFUA 1K0AA 5CO3A 5KOXA 4ZB8A 3VURA 2C3TA 3KP8A 4OFTA 4HUAA 2LRCA 3HD5A 2IWTA 4NXIA 1B9YC 3HVXA 3ED3A 2WS2A 3J7Yk 5CP1A 5A4VA 2DKIA 4BVYB 3KMOA 4CY8A 1BG5A 4ZL8A 2P5QA 1EEJA 2RUFA 3F3QA 2YV9A 4HEA2 4XS4B 1HNCA 2RM5A 2UZ8A 4IJ3A 2NBSA 3ZREA 2VAFA 5J41A 4IQAA 2AUVA 4MH2A 1LJRA 4MZWA 2XBQA 2JSZA 17GSA 3LG6A 1VF2A 1XWGA 2AHEA 3O6TA 3HZ4A 2YZHA 4KDXA 1EOHA 3QAGA 1TXXA 3TRXA 3HZ8A 2VLTA 4YQUA 3EWLA 3FR9A 3UOMA 3IRAA 4HS1A 1GWCA 3EURA 1AUCA 2C1YA 2DJ2A 3HDCA 4YQMA 5ECSA 2WB9A 2YCDA 3P2AA 1URMA 4BA7A 2GSTA 2IJYA 6GSYA 1AQWA 5IIZA 4MJBA 2VCTA 3UVTA 3IA1A 4MF6A 2FCHA 2R37A 1TK5B 3CYNA 3U6VA 4QL9A 3FR3A 4POLA 3WGEA 4HU9A 2CX3A 1TI3A 2OKAA 1HNAA 1B4QA 3GX0A 1GSQA 3Q6OA 4IP6A 4XIHA 1UC7A 4J2FA 1G7OA 5IO2A 4V1Ap 3L9VA 1WOUA 3TJFA 2HYXA 2DJKA 3NOFA 4RI6A 1XW9A 5A4WA 2P31A 1Z7RA 1G6WA 3TDGA 2LTKA 4TR3A 1EV9A 4I6XA 3UMAA 4N0VA 5J3RA 5ELAA 5DCGA 2V6KA 3PR8A 2C80A 2VO4A 2L6CA 3BCIA 3WT2A 1VRSD 4HZ2A 3LEFA 4CDOA 2C3QA 5HFKA 3DRNA 3I69A 4N10A 1XXUA 1TU7A 4V2LA 3ZZXA 1A2LA 3A3TA 2GZZA 3H79A 1H75A 3GL3A 4EL1A 3KD0A 2VM1A 4I2UA 4G2EA 4X1UA 1E2YA 3EPTA 4Z7XA 3VLNA 3W6GA 1ILOA 1ZZYA 3TUEA 5GAND 1X9MB 1F6MC 3ZTLA 3IK7A 3ZVJA 4TR1B 3RPPA 1DUGA 1TTZA 2FWFA 4FQUA 3MSZA 3QMXA 4F0BA 1ST9A 3RDWA 5L71A 3A2VA 3BOAA 2DJJA 1OC9B 3H93A 4F03A 4O32A 12GSA 2B1LA 1M2AA 1IYIA 3LFLA 4MP4A 2H75A 1S3DA 4ECIA 3GKKA 3IR4A 3UARA 1OC8A 4F2IA 1QGVA 1K0CA 3CSIA 4NHZA 4MPGA 1EP7A 5CREA 4XCSA 2FA8A 5IMAA 3F0IA 2E2MA 1ML6A 2EC4A 1I9DA 2VLVA 1OE8A 5ECIB 2HE3A 4KE3A 4Q5FA 4XRAA 4K0NA 3HY2A 3KH9A 1KTEA 4LMVA 1X9WB 4MF5A 1A24A 2LEGA 2CX4A 2C0EA 3N5OA 3VPTA 2PPTA 5C04A 2A2RA 2GT5A 5DALA 4ACSA 6GSTA 4GF0A 2QKEA 3VK9A 1K0OA 2YANA 2K8VA 1M9AA 4FYUA 3EYTA 4MLYA 2H0GA 6GSXA 4KW6A 1F37A 5ELGA 3FZAA 1UA5A 5DJMA 4EF0A 1U3AA 1N8JA 2C3NA 2ZCTA 5CRWA 2HSMA 5IOXA 1TK8B 4RQXA 3C7MA 6GSVA 3K8NA 4JR6A 2LNSA 4E8EA 1AIUA 1GL8A 2H6XA 3QAVA 3GH9A 3R3EA 4TW5A 2YWIA 4Z2TA 1QUWA 4EDYA 2H8LA 3BJ5A 1YDKA 4WF4A 4RI7A 5F05A 4JE1A 3APOA 3ERFA 2H73A 3C1SA 2YWOA 2F8FA 4JRRA 2FY6A 1Q4JA 2GZPA 1KNGA 3M0FA 3FMWA 3D6IA 2VL9A 2LJKA 5KN0A 3WYWA 3GNJA 3PGTA 3KP9A 3IOSA 1Z6NA 1M2BA 2E7PA 5ABRA 5J4UA 1V2AA 2TRCP 9GSSA 3JCML 3RAZA 1HD2A 3P8WA 1SJZA 3WGXA 5GAPD 4GXZA 1MDKA 1R7HA 3KM6A 3LYKA 3WT1A 2EIOA 1OKTA 4J57E 2MZCA 3ZLPA 5HR0A 2LUSA 5CRDA 3CRUA 4IQ1A 2JZTA 1SYRA 1T7PB 2LRTA 1Y25A 1K0MA 3Q18A 4I8BA 3SWLA 1X5CA 4L0UA 2IPAA 3UBLA 3EU4A 4RUVA 4WKWA 2H6ZA 5D9XA 1VF1A 1YJ6A 5DQSA 4YAPA 4Z2RA 2B5EA 4KDUA 2DLXA 2P0GA 3CSJA 4L5LA 4ZXGA 2YP6A 4G19A 1MTCA 4Q5RA 2J9HA 2YN1A 3IE3A 2ON5A 3EC3A 4TRXA 3GH6A 3NZNA 4GLTA 4YKGA 2PN8A 4POKA 1K0DA 2H74A 1XOBA 4MJCA 2V41A 4GSTA 1T4YA 1GSUA 2F8AA 2HRAA 1K3OA 4LL4B 3DVWA 1O8WA 2ON7A 2VL3A 2CV4A 4KA0A 1VF4A 4IJIA 3TCOA 1DSBA 1NHOA 3TKRA 3ZRDA 2YNXA 5GZZB 2N5AA 4X43A 2PVOC 2X8CA 2FD3A 2LQQA 2N5BA 4P3YB 1TP9A 1J9BA 1OC3A 2CT6A 2L6DA 3KJYA 4BWQA 1X5DA 2EIQA 3C73A 1SD9A 3GN3A 2CVKA 4GTUA 3A2XA 5F8BA 4ECBA 4FO5A 1XWAA 2YWNA 5EY6A 2CZ3A 1TK0B 5IM9A 1T00A 4V2NA 3HJMA 5G30A 2JL4A 5ID2A 3GTUA 3MAKA 2OE3A 2TIRA 1K3YA 2X4AA 2XBIA 3FK8A 5KEJA 1GTAA 2MMNA 1YEPA 2VCVA 2XPEA 1SJ6A 2VD1A 2ES7A 1A2MA 4H86A 3FRCA 3WGDA 2PMTA 2LJAA 2HZFA 2MYGA 6GSUA 2AJQB 2M72A 2YV7A 1A0FA 2G2QA 3FHKA 1NHYA 2DKHA 4K6XA 2I3YA 1SU9A 3UVHA 3H1NA 1GLPA 2HI7A 1SKWB 4AJ7A 3DVXA 4WBJA 3G9BA 4WR5A 2DBCA 2OADA 1PL2A 2QC7A 3NIVA 1M0UA 1BQ7A 1BJXA 4KSMA 5IOWA 1EZKA 4ZBDA 2WULA 1V57A 1GLQA 14GSA 2IMEA 3M3MA 4JU5A 2H30A 4YQVA 3I43A 2OE0A 3EMXA 2CAQA 4CHSA 2H01A 4X4JA 3GKNA 16GSA 1TRWA 2H1BA 3TKSA 4YH2A 5D8IA 5HR3A 5HQPA 5COHA 5JCUA 3GIXA 4FH8A 1YF0A 2L57A 2HNLA 4PQHA 3VWVA 4IKHA 3FZ9A 4MA9A 3LWAA 3VPQA 1R4WA 2NTOA 3L78A 6GSWA 3APSA 3KTLA 5FHIA 4WXTA 2LS5A 2KOKA 2M80A 2R2JA 2L4CA 2B6MA 4V1Ag 2GTUA 1ZCPA 2GS3A 2CZ2A 3G7IA 1JZWA 1AXDA 5KN2A 2AYTA 4XS6A 3GL5A 2JADA 1G7EA 4EE0A 3F4SA 3FEUA 3J7Yb 3DXBA 2KUCA 1S3CA 2VCQA 3IXRA 3UBKA 3EINA 3G7YA 5F0GA 3KCMA 3QR6A 2A4HA 4EKZA 5LD0A 5JCWA 1TI1A 3DEXA 3LORA 1YEXA 4L0WA 3EU3A 2CVBA 1LBKA 3QFAC 1Z3EA 5FWGA 1SL0B 4Z2UA 1RK4A 3D22A 2NVLA 4HJMA 3TJGA 2CAIA 2PVQA 4N0ZA 4ZL7A 1BYEA 2DJ0A 5B7CA 3F4RA 1Q98A 1SK1A 2CQ9A 4BPYA 1FO5A 1GTBA 2WCIA 1U88A 2X8GA 4HOJA 2E0QA 2I4AA 10GSA 4JBBA 3IK9A 2DIZA 2GSQA 3TOTA 3HCZA 5EL8A 3D5JA 2C0FA 3LJRA 3KEBA 5E4WA 5ECRB 3U5RE 4NHWA 2F9SA 3PH9A 4PQIA 2H70A 4XRDA 1R5PA 1U87A 2N5FA 4FYBA 4HJ2A 5ENUA 5GSSA 1FW1A 1B9XC 2K18A 1KEBA 4OO4A 2IL3A 2HFDA 2R0GA 2MBTA 4MH3A 5B6MA 1ZYEA 3KH7A 1ZGNA 3IHQA 5G31A 4L8EA 5ID2B 4TOPA 1SENA 3GTUB 5A4UA 1JZOA 4NWYA 2GQLA 3GYKA 2FWEA 2WDUA 2K9FA 3IDVA 4K7NA 5D93A 4ICYA 2DMMA 3CSHA 4OFNA 5IMCA 1GSFA 4PX1A 1EOGA 2VCZA 4AGSA 4LL1B 4IN0A 3L9UA 1C72A 2H19A 2VM2A 5AN1A 4ZBAA 3DIEA 4V2MA 1ERUA 3ERWA 4K7IA 5INYA 4HDEA 3KIJA 1Z5YE 3W8JA 2QA1A 2YWMA 3M9KA 1GUKA 3F9UA 1WIKA 4EC0A 2NPBA 1GTUA 4TN8A 1HNBA 3DYRA 2WFCA 4MJEA 1FHEA 2X49A 2H72A 13GSA 3QFBC 3ERGA 1RW1A 4TR4A 2GT6A 1ACVA 1SL2B 2JZRA 2OBKA 2B3SA 2AV4A 2CA8A 3ZIJA 2FLSA 3PINA 3LYPA 1AAZA 1EEMA 1PKWA 2LV3A 2IMFA 3VWUA 5D73A 1F9MA 1TRVA 2H1DA 1GUMA 2DJ3A 2B1KA 3MDKA 3DKSA 4ILFA 5HFIA 4NMUA 5CRGA 3E3EA 4CY6A 3QD9A 5EVOA 3TRQA 4WETA 4N30A 2H6YA 2B7JA 1SK0A 2FNOA 4XS4A 2H71A 3GMFA 1GSYA 4POMA 1FAAA 5G5EA 2O87A 2O85A 2HRKA 3HVSA 2ZNMA 2PBJA 4XS1A 4IHUA 3QCPA 3CMIA 1ZL9A 5ECHB 6GSSA 1JLVA 3L0HA 3ME7A 1U6TA 3UJ1A 5CAXA 2YOIA 4YKFA 3IV4A 2R0CA 1I5GA 1VF3A 3VI7A 4KDYA 1VGLA 3QPMA 4MMMA 4K8MA 3C1RA 1Z6MA 4QQ7A 2FWGA 4O5RA 3SBCA 1PX6A 2RM6A 1XWBA 4TXVA 4HZ4A 4I97A 5CNWA 3KGKA 4OCEA 5E59A 4PNGA 2QGVA 1XZOA 1WE0A 3M8NA 2R3XA 3LXZA 5G2ZA 1TRSA 1TOFA 1OKDA 1GH2A 3HVVA 3GUSA 18GSA 4IELA 1WP0A 4ZIJA 4PGTA 3M1GA 4PUAA 3TGZA 3HHVA 5LNKe 1PGTA 1NW2A 3S9FA 1QQ2A 1TKDB 1XWKA 3IBHA 2VL2A 1LU4A 4FYCA 3F8UA 1RQMA 4KH7A 2H1AA 5G1LA 2OJLA 3F6FA 1IYHA 2C0GA 4IGJA 3E0UA 4ECCA 2GSRA 4LMWA 5DBQA 2D2ZA 4TVEA 5CYYA 3ZFBA 2HXKA 2VCWA 4PURA 4DSRA 2YJHA 1YKCA 2A4VA 2BMXA 1GUHA 1YQ1A 3ISOA 2KP1A 2BTOT 2QA2A 3G7JA 1BEDA 4LLRA 5IQYA 1PKZA 1FG4A 1QMVA 1K0BA 3V1WA 4F0CA 3A2WA 5IMZA 2GDRA 1XW6A 3EMPA 1MEKA 2XC2A 3BD2A 4MZCA 3FY7A 2O89A 1TU8A 4BVXA 2DJ1A 2XPDA 3IHGA 3FKFA 1X5EA 3D21A 8GSSA 1GP1A 3H4KA 4NAXA 3MYDA 2WJUA 2H0HA 1B8XA 4IW9A 4O92A 5AIVA 2JACA 1KBNA 2V6OA 5DQYA 4K1FA 5G5FA 1DE2A 5A5KA 1OC9A 4YAVA 2C8UA 2DMLA 2PU9C 3BCKA 3IAS2 3ZITA 5H5SA 1MDJA 1M7TA 2IFQA 4EUYA 2MMOA 3IC4A 2OA7A 5ECPB 4D73A 5DALB 3DWVA 2R4VA 3FW2A 3ZMLA 4NV5A 5KOWA 3AY8A 3LSZA 3LQ7A 1G6YA 3A5IA 1PMTA 1BAYA 1MD3A 5AISA 1DBYA 2FGXA 5DAKA 3DMLA 1TDIA 1XFLA 2PUKC 1FOVA 2HRFA 4TR0A 19GSA 3HXSA 4PTSA 1S3AA 2REMA 2YJ7A 4JZQA 2A2SA 4GWRA 3TKSC 1Z7PA 1QFNA 4CW9A 1XBSA 1Z9HA 2LSTA 1SJIA 2L5LA 4EXJA 1XVWA 3QDNA 1QK8A 5IMFA 3CXGA 2PERA 1SKSB 1ON4A 5DVBA 2I81A 4K2DA 2IN3A 1K0NA 4DVCA 3R2QA 4BL7A 2LJRA 1O8XA 2NDOA 1X9SB 1T1VA 2L5OA 2P5RA 4OD7A 2ALBA 5JWOB 1CQHA 2LQOA 1O7UA 5F07A 1GTIA 5HR2A 4KX4A 4ZB6A 1XW5A 3QAWA 1O81A 4EVMA 4NPBA 1UVZA 1USBA 2FA4A 2L4QA 3Q74A 1A0RP 4OFMA 1M9BA 2JZSA 3F4TA 2EIRA 2G0FA 2H76A 4DSQA 4AF2A 1F2EA 2B7KA 3DGQA 4GSNA 1GULA 5KN1A 1YKAA 4G10A 7GSSA 5D9VA 1A2JA 1HYUA 2KP2A 4ZL9A 2AAWA 3KMNA 2B5XA 4I2TA 3I6AA 1PX7A 1MD4A 4PNFA 2VIMA 2IMKA 3TKPA 2B5YA 3ZYWA 1AC1A 1PN0A 4XTSA 5DCHA 4J56E 1J08A 2QSIA 4KCAA 3APQA 4OO5A 4ZILA 4EIQA 1CQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGY A;  3LXT A;  1PSQ A;  4GQF A;  2ZUP A;  4GCI A;  3GFK A;  4BWS A;  1E6B A;  22GS A;  5CRH A;  2J23 A;  2WRT A;  2MBS A;  5ECO B;  1F3A A;  1M99 A;  2RUE A;  1O85 A;  3OR5 A;  4KGI A;  4OCF A;  3TB2 A;  1NSW A;  4JR4 A;  4XHM A;  3H8Q A;  4G9H A;  1V58 A;  1OYJ A;  2KHP A;  5LCZ A;  1GNW A;  3VFI A;  4MJA A;  1FVJ A;  2OAC A;  1SD8 A;  20GS A;  4IVF A;  2VCX A;  3UL3 A;  4IS0 A;  3RHB A;  4HU7 A;  4TXO A;  3W8S A;  2X64 A;  2C4J A;  3CTG A;  3N9J A;  3FZ4 A;  1W4V A;  2HZE A;  3D0Z A;  3CBU A;  1K3L A;  4PUF C;  4RQR A;  2GQM A;  2V32 A;  3C8E A;  4EO3 A;  1ZYQ B;  2JU5 A;  5H5Q A;  5H5R A;  2GZY A;  5ECQ B;  1YZX A;  3D4T A;  3GSS A;  3ME8 A;  2L59 A;  4DSS A;  2TRX A;  4WEY A;  3EE2 A;  1R26 A;  1THX A;  2YZU A;  3ZL5 A;  2YPM A;  2V2G A;  1ERV A;  1MDI A;  3HA9 A;  1YF1 A;  1A8L A;  4MCU A;  1WPI A;  4ZB9 A;  3TOU A;  4MDC A;  1FB0 A;  1B4P A;  1V9W A;  2IFQ B;  3KTB A;  3TJB A;  4OMV A;  1EWX A;  4D73 B;  5KN3 A;  3TKQ A;  1T3B A;  1WRY A;  1JZR A;  3TJK A;  1X0R A;  2K8S A;  3Q19 A;  3FR6 A;  1SKR B;  5DAK B;  1JLW A;  3IAM 2;  2DIY A;  3VI5 A;  4LA1 A;  1OE7 A;  2H1G A;  3CTF A;  4TKY A;  1GSS A;  1JZD A;  3ZIV A;  2FUG 2;  2RLI A;  2VD0 A;  2GGT A;  4IP1 A;  3GX8 A;  5DJL A;  2IMD A;  3L9S A;  1HQO A;  2IMI A;  4K9Z A;  5J5N A;  1BX9 A;  1W89 A;  4WF5 A;  3O76 A;  2F51 A;  1T8E B;  3F63 A;  2R5G A;  1ZOF A;  5B8A A;  1YY7 A;  5F06 A;  3A5W A;  3TKS E;  1V40 A;  4DEJ A;  1WMJ A;  1GRX A;  3IPZ A;  1XWC A;  3GA4 A;  5EPF A;  5D9T A;  1ABA A;  2HSH A;  3FZ5 A;  3C71 A;  4FIW A;  2DSA A;  4K0G A;  5AIX A;  1PL1 A;  3GST A;  2AB6 A;  3MWH A;  2PWJ A;  1XOA A;  2GSS A;  2HRN A;  4BVY A;  1A23 A;  5D9W A;  4AJ8 A;  4E8H A;  1A8Y A;  5IPH A;  2LKU A;  4GRF A;  5ECK B;  2H0I A;  1FVK A;  3KXO A;  2VLU A;  3RBT A;  2WZ9 A;  4IBP A;  4KB3 A;  5ECL B;  1SK2 A;  4PQ1 A;  5B6N A;  1PRX A;  4N11 A;  3GRX A;  2IIY A;  2O7K A;  2OE1 A;  5G1K A;  3WD6 A;  2WGR A;  1WJK A;  2GVP A;  3F6D A;  1WWJ A;  1OAZ A;  5IO0 A;  3TRP A;  3US3 A;  3UIW A;  4MF7 A;  5D96 A;  2FHE A;  2VL2 C;  5JCG A;  3VWW A;  3GKX A;  4Q5Q A;  4EDZ A;  2I9H A;  3HKR A;  3RHC A;  1GSD A;  2H66 A;  5IPG A;  3KZQ A;  5FT3 A;  1DE1 A;  1GSE A;  1FB6 A;  1R5A A;  2HT9 A;  2FWH A;  1O73 A;  1U3I A;  3MNG A;  4KSO A;  3HYP A;  1O6J A;  4HQS A;  3GV1 A;  1AW9 A;  4PXO A;  3FYG A;  1SL1 B;  3VWX A;  3O3T A;  4NV2 A;  3UAP A;  4K7O A;  3UEM A;  4KUN A;  4QL7 A;  2LNT A;  4MZB A;  4O7H A;  2Z9S A;  1OVN A;  1EP8 A;  1THO A;  5DDL A;  1ERW A;  1N2A A;  1XPV A;  3D4M A;  5HR1 A;  4TXO B;  1H4O A;  5IMD A;  5J9C A;  4AJ6 A;  1Y6E A;  4POB A;  2HZE B;  4ISD A;  2BJX A;  4I5Q A;  3DD3 A;  3HJP A;  4ZBB A;  1XIY A;  2DC5 A;  3I9V 2;  2MMA A;  1XVQ A;  2KLX A;  2M46 A;  4ML1 A;  5GST A;  4HQZ A;  2OBI A;  1TJD A;  3P90 A;  2XHF A;  2PGT A;  3ZFL A;  4MAB A;  4Q5N A;  3CRT A;  1PN9 A;  3GUR A;  3M9J A;  4DSS B;  2GLR A;  2GQK A;  1G0T A;  2VUP A;  2O8V B;  2CVD A;  3E9J B;  4KAE A;  3L4N A;  3HJO A;  2HLS A;  2HSY A;  3ZVJ D;  3RPN A;  1UN2 A;  5ECM B;  3QOU A;  4F9Z A;  2V1M A;  1SYX A;  4JED A;  1T4Z A;  4X0X A;  1AQX A;  4ECJ A;  2VOC A;  5ECN B;  4WBR D;  3EVI A;  4ID0 A;  1ZMA A;  2I1U A;  2RII A;  1J0F A;  3P7X A;  11GS A;  4TR1 A;  2C0D A;  1TW9 A;  1ERT A;  1PD2 1;  5JWR B;  1V98 A;  4MPF A;  3BBY A;  3ZMK A;  1B48 A;  2E2G A;  5HFG A;  5C00 A;  2X99 A;  4KND A;  2K6V A;  1M2D A;  3TJJ A;  4ULX A;  3GKM A;  1NM3 A;  4L5O A;  1AQV A;  3LGC A;  4F82 A;  3GHA A;  2MMZ A;  4OWY A;  1EGO A;  1GNE A;  4WR4 A;  5IMV A;  4KCE A;  5JWQ B;  4GQC A;  2F3M A;  4HI7 A;  5B8B A;  3F3R A;  1F3B A;  4ML6 A;  1XCC A;  1EGR A;  1TRU A;  2X8H A;  1QXH A;  1JHB A;  2R6K A;  4GSS A;  2JSY A;  1PQN A;  1EV4 A;  1PA3 A;  4MK3 A;  2LRN A;  5J9B A;  1JFU A;  1K0A A;  5CO3 A;  4ZB8 A;  3VUR A;  2C3T A;  3KP8 A;  4OFT A;  4HUA A;  2LRC A;  3HD5 A;  2IWT A;  4NXI A;  1B9Y C;  3HVX A;  3ED3 A;  2WS2 A;  3J7Y k;  5CP1 A;  5A4V A;  3KMO A;  1BG5 A;  4ZL8 A;  2P5Q A;  1EEJ A;  2RUF A;  3F3Q A;  2YV9 A;  4HEA 2;  4XS4 B;  1HNC A;  2RM5 A;  4IJ3 A;  2NBS A;  3ZRE A;  2VAF A;  5J41 A;  4IQA A;  2AUV A;  4MH2 A;  1LJR A;  4MZW A;  2XBQ A;  2JSZ A;  17GS A;  3LG6 A;  1VF2 A;  1XWG A;  2AHE A;  3O6T A;  3HZ4 A;  2YZH A;  4KDX A;  1EOH A;  3QAG A;  1TXX A;  3TRX A;  3HZ8 A;  2VLT A;  4YQU A;  3EWL A;  3FR9 A;  3UOM A;  3IRA A;  4HS1 A;  1GWC A;  3EUR A;  1AUC A;  2C1Y A;  2DJ2 A;  3HDC A;  5ECS A;  4YQM A;  2WB9 A;  2YCD A;  3P2A A;  1URM A;  4BA7 A;  2GST A;  2IJY A;  6GSY A;  1AQW A;  5IIZ A;  4MJB A;  2VCT A;  3UVT A;  3IA1 A;  4MF6 A;  2FCH A;  2R37 A;  1TK5 B;  3CYN A;  3U6V A;  4QL9 A;  3FR3 A;  4POL A;  3WGE A;  4HU9 A;  2CX3 A;  1TI3 A;  2OKA A;  1HNA A;  1B4Q A;  3GX0 A;  1GSQ A;  3Q6O A;  4IP6 A;  4XIH A;  1UC7 A;  4J2F A;  1G7O A;  5IO2 A;  4V1A p;  3L9V A;  1WOU A;  3TJF A;  2HYX A;  2DJK A;  3NOF A;  4RI6 A;  1XW9 A;  5A4W A;  2P31 A;  1Z7R A;  1G6W A;  3TDG A;  2LTK A;  4TR3 A;  1EV9 A;  4I6X A;  3UMA A;  4N0V A;  5J3R A;  5ELA A;  5DCG A;  2V6K A;  3PR8 A;  2C80 A;  2VO4 A;  2L6C A;  3BCI A;  3WT2 A;  1VRS D;  4HZ2 A;  3LEF A;  4CDO A;  2C3Q A;  5HFK A;  3DRN A;  3I69 A;  4N10 A;  1XXU A;  1TU7 A;  4V2L A;  3ZZX A;  1A2L A;  3A3T A;  2GZZ A;  3H79 A;  1H75 A;  3GL3 A;  4EL1 A;  3KD0 A;  2VM1 A;  4I2U A;  4G2E A;  4X1U A;  1E2Y A;  4Z7X A;  3VLN A;  3W6G A;  1ILO A;  1ZZY A;  3TUE A;  5GAN D;  1X9M B;  1F6M C;  3ZTL A;  3IK7 A;  3ZVJ A;  4TR1 B;  3RPP A;  1DUG A;  1TTZ A;  2FWF A;  3MSZ A;  3QMX A;  4F0B A;  1ST9 A;  3RDW A;  5L71 A;  3A2V A;  3BOA A;  2DJJ A;  1OC9 B;  3H93 A;  4F03 A;  4O32 A;  12GS A;  2B1L A;  1M2A A;  1IYI A;  3LFL A;  4MP4 A;  2H75 A;  1S3D A;  4ECI A;  3GKK A;  3IR4 A;  3UAR A;  1OC8 A;  4F2I A;  1QGV A;  1K0C A;  3CSI A;  4NHZ A;  4MPG A;  1EP7 A;  5CRE A;  4XCS A;  2FA8 A;  5IMA A;  3F0I A;  2E2M A;  1ML6 A;  2EC4 A;  1I9D A;  2VLV A;  1OE8 A;  5ECI B;  2HE3 A;  4KE3 A;  4Q5F A;  4XRA A;  4K0N A;  3HY2 A;  3KH9 A;  1KTE A;  4LMV A;  1X9W B;  4MF5 A;  1A24 A;  2LEG A;  2CX4 A;  2C0E A;  3N5O A;  3VPT A;  2PPT A;  5C04 A;  2A2R A;  2GT5 A;  5DAL A;  4ACS A;  6GST A;  4GF0 A;  2QKE A;  3VK9 A;  1K0O A;  2YAN A;  2K8V A;  1M9A A;  4FYU A;  3EYT A;  4MLY A;  2H0G A;  6GSX A;  4KW6 A;  1F37 A;  5ELG A;  3FZA A;  1UA5 A;  5DJM A;  4EF0 A;  1U3A A;  1N8J A;  2C3N A;  2ZCT A;  5CRW A;  5IOX A;  1TK8 B;  4RQX A;  3C7M A;  6GSV A;  3K8N A;  4JR6 A;  2LNS A;  4E8E A;  1AIU A;  1GL8 A;  2H6X A;  3QAV A;  3GH9 A;  4TW5 A;  2YWI A;  1QUW A;  4EDY A;  2H8L A;  3BJ5 A;  1YDK A;  4WF4 A;  4RI7 A;  5F05 A;  4JE1 A;  3APO A;  3ERF A;  2H73 A;  3C1S A;  2YWO A;  2F8F A;  4JRR A;  2FY6 A;  1Q4J A;  2GZP A;  1KNG A;  3M0F A;  3D6I A;  2VL9 A;  2LJK A;  5KN0 A;  3WYW A;  3GNJ A;  3PGT A;  3KP9 A;  3IOS A;  1Z6N A;  1M2B A;  2E7P A;  5ABR A;  5J4U A;  1V2A A;  2TRC P;  9GSS A;  3JCM L;  3RAZ A;  1HD2 A;  3P8W A;  1SJZ A;  3WGX A;  5GAP D;  4GXZ A;  1MDK A;  1R7H A;  3KM6 A;  3LYK A;  3WT1 A;  2EIO A;  1OKT A;  4J57 E;  2MZC A;  3ZLP A;  5HR0 A;  2LUS A;  5CRD A;  3CRU A;  4IQ1 A;  2JZT A;  1SYR A;  1T7P B;  2LRT A;  1Y25 A;  1K0M A;  3Q18 A;  4I8B A;  3SWL A;  1X5C A;  4L0U A;  2IPA A;  3UBL A;  3EU4 A;  4RUV A;  4WKW A;  2H6Z A;  5D9X A;  1VF1 A;  1YJ6 A;  5DQS A;  4YAP A;  2B5E A;  4KDU A;  2DLX A;  2P0G A;  3CSJ A;  4L5L A;  4ZXG A;  2YP6 A;  4G19 A;  1MTC A;  4Q5R A;  2J9H A;  2YN1 A;  3IE3 A;  2ON5 A;  3EC3 A;  4TRX A;  3GH6 A;  3NZN A;  4GLT A;  2PN8 A;  4POK A;  1K0D A;  2H74 A;  1XOB A;  4MJC A;  2V41 A;  4GST A;  1T4Y A;  1GSU A;  2F8A A;  1K3O A;  4LL4 B;  3DVW A;  1O8W A;  2ON7 A;  2VL3 A;  2CV4 A;  4KA0 A;  1VF4 A;  4IJI A;  3TCO A;  1DSB A;  1NHO A;  3TKR A;  3ZRD A;  2YNX A;  5GZZ B;  2N5A A;  4X43 A;  2PVO C;  2X8C A;  2FD3 A;  2LQQ A;  2N5B A;  4P3Y B;  1TP9 A;  1J9B A;  1OC3 A;  2CT6 A;  2L6D A;  3KJY A;  4BWQ A;  1X5D A;  2EIQ A;  3C73 A;  1SD9 A;  3GN3 A;  2CVK A;  4GTU A;  3A2X A;  5F8B A;  4ECB A;  4FO5 A;  1XWA A;  2YWN A;  5EY6 A;  2CZ3 A;  1TK0 B;  5IM9 A;  1T00 A;  4V2N A;  3HJM A;  5G30 A;  2JL4 A;  5ID2 A;  3GTU A;  3MAK A;  2OE3 A;  2TIR A;  1K3Y A;  2XBI A;  3FK8 A;  5KEJ A;  1GTA A;  2MMN A;  1YEP A;  2VCV A;  2XPE A;  1SJ6 A;  2VD1 A;  2ES7 A;  1A2M A;  4H86 A;  3FRC A;  3WGD A;  2PMT A;  2LJA A;  2HZF A;  2MYG A;  6GSU A;  2AJQ B;  2M72 A;  2YV7 A;  1A0F A;  2G2Q A;  3FHK A;  1NHY A;  4K6X A;  2I3Y A;  1SU9 A;  3UVH A;  3H1N A;  1GLP A;  2HI7 A;  1SKW B;  4AJ7 A;  3DVX A;  4WBJ A;  3G9B A;  4WR5 A;  2DBC A;  2OAD A;  1PL2 A;  2QC7 A;  3NIV A;  1M0U A;  1BQ7 A;  1BJX A;  4KSM A;  5IOW A;  1EZK A;  4ZBD A;  2WUL A;  1V57 A;  1GLQ A;  14GS A;  2IME A;  3M3M A;  4JU5 A;  2H30 A;  4YQV A;  3I43 A;  2OE0 A;  3EMX A;  2CAQ A;  4CHS A;  2H01 A;  3GKN A;  16GS A;  1TRW A;  2H1B A;  3TKS A;  4YH2 A;  5D8I A;  5HR3 A;  5HQP A;  5COH A;  5JCU A;  3GIX A;  4FH8 A;  1YF0 A;  2L57 A;  2HNL A;  4PQH A;  3VWV A;  4IKH A;  3FZ9 A;  4MA9 A;  3LWA A;  3VPQ A;  1R4W A;  2NTO A;  3L78 A;  6GSW A;  3APS A;  3KTL A;  5FHI A;  4WXT A;  2LS5 A;  2KOK A;  2M80 A;  2R2J A;  2L4C A;  2B6M A;  4V1A g;  2GTU A;  1ZCP A;  2GS3 A;  2CZ2 A;  3G7I A;  1JZW A;  1AXD A;  5KN2 A;  2AYT A;  4XS6 A;  3GL5 A;  2JAD A;  1G7E A;  4EE0 A;  3F4S A;  3FEU A;  3J7Y b;  3DXB A;  2KUC A;  1S3C A;  2VCQ A;  3IXR A;  3UBK A;  3EIN A;  3G7Y A;  5F0G A;  3KCM A;  3QR6 A;  4EKZ A;  5LD0 A;  5JCW A;  1TI1 A;  3DEX A;  3LOR A;  1YEX A;  4L0W A;  3EU3 A;  2CVB A;  1LBK A;  3QFA C;  1Z3E A;  5FWG A;  1SL0 B;  1RK4 A;  3D22 A;  2NVL A;  4HJM A;  3TJG A;  2CAI A;  2PVQ A;  4N0Z A;  4ZL7 A;  1BYE A;  2DJ0 A;  5B7C A;  3F4R A;  1Q98 A;  1SK1 A;  2CQ9 A;  4BPY A;  1FO5 A;  1GTB A;  2WCI A;  1U88 A;  2X8G A;  4HOJ A;  2E0Q A;  2I4A A;  10GS A;  4JBB A;  3IK9 A;  2DIZ A;  2GSQ A;  3TOT A;  3HCZ A;  5EL8 A;  3D5J A;  2C0F A;  3LJR A;  3KEB A;  5E4W A;  5ECR B;  3U5R E;  4NHW A;  2F9S A;  3PH9 A;  4PQI A;  2H70 A;  4XRD A;  1R5P A;  1U87 A;  2N5F A;  4FYB A;  4HJ2 A;  5ENU A;  5GSS A;  1FW1 A;  1B9X C;  2K18 A;  1KEB A;  4OO4 A;  2IL3 A;  2HFD A;  2MBT A;  4MH3 A;  5B6M A;  1ZYE A;  3KH7 A;  1ZGN A;  3IHQ A;  5G31 A;  4L8E A;  5ID2 B;  4TOP A;  1SEN A;  3GTU B;  5A4U A;  1JZO A;  4NWY A;  2GQL A;  3GYK A;  2FWE A;  2WDU A;  2K9F A;  3IDV A;  4K7N A;  5D93 A;  2DMM A;  3CSH A;  4OFN A;  5IMC A;  1GSF A;  4PX1 A;  1EOG A;  2VCZ A;  4AGS A;  4LL1 B;  4IN0 A;  3L9U A;  1C72 A;  2H19 A;  2VM2 A;  5AN1 A;  4ZBA A;  3DIE A;  4V2M A;  1ERU A;  3ERW A;  4K7I A;  5INY A;  4HDE A;  3KIJ A;  1Z5Y E;  3W8J A;  2YWM A;  3M9K A;  1GUK A;  3F9U A;  1WIK A;  4EC0 A;  2NPB A;  1GTU A;  4TN8 A;  1HNB A;  3DYR A;  2WFC A;  4MJE A;  1FHE A;  2H72 A;  13GS A;  3QFB C;  3ERG A;  1RW1 A;  4TR4 A;  2GT6 A;  1ACV A;  1SL2 B;  2JZR A;  2OBK A;  2B3S A;  2AV4 A;  2CA8 A;  3ZIJ A;  2FLS A;  3PIN A;  3LYP A;  1AAZ A;  1EEM A;  1PKW A;  2LV3 A;  2IMF A;  3VWU A;  5D73 A;  1F9M A;  1TRV A;  2H1D A;  1GUM A;  2DJ3 A;  2B1K A;  3MDK A;  3DKS A;  4ILF A;  5HFI A;  4NMU A;  5CRG A;  3E3E A;  3QD9 A;  5EVO A;  3TRQ A;  4WET A;  4N30 A;  2H6Y A;  2B7J A;  1SK0 A;  2FNO A;  4XS4 A;  2H71 A;  3GMF A;  1GSY A;  4POM A;  1FAA A;  5G5E A;  2O87 A;  2O85 A;  3HVS A;  2ZNM A;  2PBJ A;  4XS1 A;  4IHU A;  3QCP A;  3CMI A;  1ZL9 A;  5ECH B;  6GSS A;  1JLV A;  3L0H A;  3ME7 A;  1U6T A;  3UJ1 A;  5CAX A;  2YOI A;  3IV4 A;  1I5G A;  1VF3 A;  3VI7 A;  4KDY A;  1VGL A;  3QPM A;  4MMM A;  4K8M A;  3C1R A;  1Z6M A;  4QQ7 A;  2FWG A;  4O5R A;  3SBC A;  1PX6 A;  2RM6 A;  1XWB A;  4TXV A;  4HZ4 A;  4I97 A;  5CNW A;  3KGK A;  4OCE A;  5E59 A;  4PNG A;  2QGV A;  1XZO A;  1WE0 A;  3M8N A;  2R3X A;  3LXZ A;  5G2Z A;  1TRS A;  1TOF A;  1OKD A;  1GH2 A;  3HVV A;  3GUS A;  18GS A;  4IEL A;  1WP0 A;  4ZIJ A;  4PGT A;  3M1G A;  4PUA A;  3TGZ A;  3HHV A;  5LNK e;  1PGT A;  1NW2 A;  3S9F A;  1QQ2 A;  1TKD B;  1XWK A;  3IBH A;  2VL2 A;  1LU4 A;  4FYC A;  3F8U A;  1RQM A;  4KH7 A;  2H1A A;  5G1L A;  2OJL A;  3F6F A;  1IYH A;  2C0G A;  4IGJ A;  3E0U A;  4ECC A;  2GSR A;  4LMW A;  5DBQ A;  2D2Z A;  4TVE A;  5CYY A;  3ZFB A;  2HXK A;  2VCW A;  4PUR A;  4DSR A;  2YJH A;  1YKC A;  2A4V A;  2BMX A;  1GUH A;  1YQ1 A;  3ISO A;  2KP1 A;  2BTO T;  3G7J A;  1BED A;  4LLR A;  5IQY A;  1PKZ A;  1FG4 A;  1QMV A;  1K0B A;  3V1W A;  4F0C A;  3A2W A;  5IMZ A;  2GDR A;  1XW6 A;  3EMP A;  1MEK A;  2XC2 A;  3BD2 A;  4MZC A;  3FY7 A;  2O89 A;  1TU8 A;  4BVX A;  2DJ1 A;  2XPD A;  3FKF A;  1X5E A;  3D21 A;  8GSS A;  1GP1 A;  3H4K A;  4NAX A;  2WJU A;  2H0H A;  1B8X A;  4IW9 A;  4O92 A;  5AIV A;  2JAC A;  1KBN A;  2V6O A;  5DQY A;  4K1F A;  5G5F A;  1DE2 A;  5A5K A;  1OC9 A;  4YAV A;  2C8U A;  2DML A;  2PU9 C;  3BCK A;  3IAS 2;  3ZIT A;  5H5S A;  1MDJ A;  1M7T A;  2IFQ A;  4EUY A;  2MMO A;  3IC4 A;  2OA7 A;  5ECP B;  4D73 A;  5DAL B;  3DWV A;  2R4V A;  3FW2 A;  3ZML A;  4NV5 A;  3AY8 A;  3LSZ A;  3LQ7 A;  1G6Y A;  1PMT A;  1BAY A;  1MD3 A;  5AIS A;  1DBY A;  2FGX A;  5DAK A;  3DML A;  1TDI A;  1XFL A;  2PUK C;  1FOV A;  2HRF A;  4TR0 A;  19GS A;  3HXS A;  1S3A A;  2REM A;  2YJ7 A;  4JZQ A;  2A2S A;  4GWR A;  3TKS C;  1Z7P A;  1QFN A;  4CW9 A;  1XBS A;  1Z9H A;  2LST A;  1SJI A;  2L5L A;  4EXJ A;  1XVW A;  3QDN A;  1QK8 A;  5IMF A;  3CXG A;  2PER A;  1SKS B;  1ON4 A;  5DVB A;  2I81 A;  4K2D A;  2IN3 A;  1K0N A;  4DVC A;  3R2Q A;  4BL7 A;  2LJR A;  1O8X A;  2NDO A;  1X9S B;  1T1V A;  2L5O A;  2P5R A;  4OD7 A;  2ALB A;  5JWO B;  1CQH A;  2LQO A;  1O7U A;  5F07 A;  1GTI A;  5HR2 A;  4KX4 A;  4ZB6 A;  1XW5 A;  3QAW A;  1O81 A;  4EVM A;  4NPB A;  1UVZ A;  1USB A;  2FA4 A;  2L4Q A;  3Q74 A;  1A0R P;  4OFM A;  1M9B A;  2JZS A;  3F4T A;  2EIR A;  2G0F A;  2H76 A;  4DSQ A;  4AF2 A;  1F2E A;  2B7K A;  3DGQ A;  4GSN A;  1GUL A;  5KN1 A;  1YKA A;  4G10 A;  7GSS A;  5D9V A;  1A2J A;  1HYU A;  2KP2 A;  4ZL9 A;  2AAW A;  3KMN A;  2B5X A;  4I2T A;  3I6A A;  1PX7 A;  1MD4 A;  4PNF A;  2VIM A;  2IMK A;  3TKP A;  2B5Y A;  3ZYW A;  1AC1 A;  4XTS A;  5DCH A;  4J56 E;  1J08 A;  2QSI A;  4KCA A;  3APQ A;  4OO5 A;  4ZIL A;  1CQG A; 
#chains in the Genus database with same CATH topology
 5AGY A;  1XG8 A;  3LXT A;  1PSQ A;  4GQF A;  2ZUP A;  4GCI A;  4KF9 A;  3GFK A;  4BWS A;  1E6B A;  22GS A;  4O5U A;  5CRH A;  2J23 A;  2WRT A;  3PPU A;  2MBS A;  5ECO B;  1F3A A;  1M99 A;  2RUE A;  1O85 A;  3OR5 A;  4KGI A;  4OCF A;  3TB2 A;  1ZYP A;  1NSW A;  4JR4 A;  4MNN A;  4XHM A;  3H8Q A;  4G9H A;  1V58 A;  1OYJ A;  2KHP A;  5LCZ A;  1GNW A;  3VFI A;  4MJA A;  1FVJ A;  2OAC A;  1SD8 A;  20GS A;  4IVF A;  2VCX A;  3UL3 A;  4IS0 A;  3RHB A;  4HU7 A;  4TXO A;  3W8S A;  2X64 A;  2C4J A;  3CTG A;  3N9J A;  3FZ4 A;  1W4V A;  2HZE A;  3D0Z A;  3CBU A;  1K3L A;  4PUF C;  3LW9 A;  4HSC X;  4RQR A;  2GQM A;  2V32 A;  3C8E A;  4EO3 A;  1ZYQ B;  2JU5 A;  5H5Q A;  5H5R A;  2GZY A;  5ECQ B;  1YZX A;  4BVX B;  3D4T A;  3GSS A;  3ME8 A;  2L59 A;  4DSS A;  2TRX A;  4WEY A;  3EE2 A;  4K5R A;  1R26 A;  1THX A;  2YZU A;  3ZL5 A;  2YPM A;  2V2G A;  1ERV A;  1MDI A;  3HA9 A;  1YF1 A;  1A8L A;  4MCU A;  4O5Q A;  1WPI A;  4ZB9 A;  3TOU A;  4MDC A;  1FB0 A;  1B4P A;  1V9W A;  2IFQ B;  3KTB A;  3TJB A;  4OMV A;  1EWX A;  4D73 B;  5KN3 A;  3TKQ A;  1T3B A;  1WRY A;  1JZR A;  3TJK A;  1X0R A;  2K8S A;  3Q19 A;  3FR6 A;  1SKR B;  1M3I A;  5DAK B;  1JLW A;  3IAM 2;  2DIY A;  3VI5 A;  4LA1 A;  1OE7 A;  2H1G A;  3CTF A;  4TKY A;  1GSS A;  1JZD A;  3ZIV A;  2FUG 2;  2RLI A;  2VD0 A;  2GGT A;  4IP1 A;  3GX8 A;  5DJL A;  2IMD A;  3L9S A;  1HQO A;  2IMI A;  4K9Z A;  5J5N A;  1BX9 A;  1W89 A;  4WF5 A;  3O76 A;  2F51 A;  1T8E B;  3F63 A;  4BL7 B;  2R5G A;  1ZOF A;  5B8A A;  1YY7 A;  5F06 A;  3A5W A;  3TKS E;  1V40 A;  4DEJ A;  1WMJ A;  1GRX A;  3IPZ A;  1XWC A;  2A2P A;  1ZYN A;  3GA4 A;  5EPF A;  5D9T A;  1ABA A;  2HSH A;  3FZ5 A;  3C71 A;  4FIW A;  2DSA A;  4K0G A;  5AIX A;  1PL1 A;  3GST A;  2AB6 A;  3MWH A;  3MIX A;  2PWJ A;  1XOA A;  2GSS A;  4A5P A;  2HRN A;  4BVY A;  5BRT A;  1A23 A;  5D9W A;  4AJ8 A;  4E8H A;  1A8Y A;  5IPH A;  2LKU A;  4GRF A;  5ECK B;  2H0I A;  1FVK A;  3KXO A;  2VLU A;  3RBT A;  2WZ9 A;  4IBP A;  4KB3 A;  5ECL B;  1SK2 A;  4PQ1 A;  5B6N A;  1PRX A;  4N11 A;  3GRX A;  2IIY A;  2O7K A;  2OE1 A;  5G1K A;  3WD6 A;  2WGR A;  1WJK A;  2GVP A;  3F6D A;  1WWJ A;  1OAZ A;  5IO0 A;  2R0P A;  3TRP A;  3US3 A;  3UIW A;  4MF7 A;  5D96 A;  2FHE A;  2VL2 C;  5JCG A;  3VWW A;  3GKX A;  4Q5Q A;  4EDZ A;  2I9H A;  3HKR A;  3RHC A;  1GSD A;  2H66 A;  5IPG A;  3KZQ A;  5FT3 A;  1DE1 A;  1GSE A;  1FB6 A;  1R5A A;  2HT9 A;  2FWH A;  1O73 A;  1U3I A;  3MNG A;  4KSO A;  3HYP A;  1O6J A;  4HQS A;  3GV1 A;  1AW9 A;  4PXO A;  3FYG A;  1SL1 B;  3VWX A;  3O3T A;  4NV2 A;  3UAP A;  4K7O A;  3UEM A;  4KUN A;  4QL7 A;  2LNT A;  4MZB A;  4O7H A;  2Z9S A;  1OVN A;  1EP8 A;  1THO A;  5DDL A;  1ERW A;  1N2A A;  1XPV A;  3D4M A;  3IC8 A;  5HR1 A;  4EIP A;  4TXO B;  1H4O A;  5IMD A;  5J9C A;  4AJ6 A;  4USS A;  1Y6E A;  4POB A;  2HZE B;  4ISD A;  4G0K A;  2BJX A;  4I5Q A;  3DD3 A;  3HJP A;  4ZBB A;  1XIY A;  2DC5 A;  3I9V 2;  2MMA A;  1XVQ A;  2KLX A;  2M46 A;  4ML1 A;  5GST A;  4HQZ A;  2OBI A;  1TJD A;  5BMU A;  3P90 A;  2XHF A;  2PGT A;  3ZFL A;  4MAB A;  4Q5N A;  3CRT A;  1PN9 A;  3GUR A;  3M9J A;  4DSS B;  2GLR A;  2GQK A;  1G0T A;  2VUP A;  2O8V B;  2CVD A;  3E9J B;  4KAE A;  3L4N A;  3HJO A;  2HLS A;  2HSY A;  3ZVJ D;  3RPN A;  1UN2 A;  5ECM B;  3QOU A;  4F9Z A;  4K2X A;  2V1M A;  1SYX A;  4JED A;  1T4Z A;  4X0X A;  1AQX A;  4ECJ A;  2VOC A;  5ECN B;  4WBR D;  3EVI A;  4ID0 A;  1ZMA A;  2I1U A;  2RII A;  1J0F A;  3P7X A;  11GS A;  4TR1 A;  2C0D A;  1TW9 A;  1ERT A;  1PD2 1;  5JWR B;  1V98 A;  4MPF A;  3BBY A;  3ZMK A;  1B48 A;  2E2G A;  5HFG A;  5C00 A;  4G0I A;  2X99 A;  4KND A;  2K6V A;  1M2D A;  3TJJ A;  4ULX A;  3GKM A;  1NM3 A;  4L5O A;  1AQV A;  3LGC A;  4F82 A;  4G0L A;  3GHA A;  2MMZ A;  4OWY A;  1EGO A;  1GNE A;  4WR4 A;  1FOH A;  5IMV A;  4KCE A;  5JWQ B;  4GQC A;  2F3M A;  4HI7 A;  5B8B A;  3F3R A;  1F3B A;  4ML6 A;  1XCC A;  4K5S A;  1EGR A;  1TRU A;  2X8H A;  1QXH A;  1JHB A;  2R6K A;  4GSS A;  2JSY A;  1PQN A;  1EV4 A;  1PA3 A;  4MK3 A;  2LRN A;  5J9B A;  1JFU A;  1K0A A;  5CO3 A;  5KOX A;  4ZB8 A;  3VUR A;  2C3T A;  3KP8 A;  4OFT A;  4HUA A;  2LRC A;  3HD5 A;  2IWT A;  4NXI A;  1B9Y C;  3HVX A;  3ED3 A;  2WS2 A;  3J7Y k;  5CP1 A;  5A4V A;  2DKI A;  4BVY B;  3KMO A;  4CY8 A;  1BG5 A;  4ZL8 A;  2P5Q A;  1EEJ A;  2RUF A;  3F3Q A;  2YV9 A;  4HEA 2;  4XS4 B;  1HNC A;  2RM5 A;  2UZ8 A;  4IJ3 A;  2NBS A;  3ZRE A;  2VAF A;  5J41 A;  4IQA A;  2AUV A;  4MH2 A;  1LJR A;  4MZW A;  2XBQ A;  2JSZ A;  17GS A;  3LG6 A;  1VF2 A;  1XWG A;  2AHE A;  3O6T A;  3HZ4 A;  2YZH A;  4KDX A;  1EOH A;  3QAG A;  1TXX A;  3TRX A;  3HZ8 A;  2VLT A;  4YQU A;  3EWL A;  3FR9 A;  3UOM A;  3IRA A;  4HS1 A;  1GWC A;  3EUR A;  1AUC A;  2C1Y A;  2DJ2 A;  3HDC A;  4YQM A;  5ECS A;  2WB9 A;  2YCD A;  3P2A A;  1URM A;  4BA7 A;  2GST A;  2IJY A;  6GSY A;  1AQW A;  5IIZ A;  4MJB A;  2VCT A;  3UVT A;  3IA1 A;  4MF6 A;  2FCH A;  2R37 A;  1TK5 B;  3CYN A;  3U6V A;  4QL9 A;  3FR3 A;  4POL A;  3HVN A;  3WGE A;  4HU9 A;  2CX3 A;  1TI3 A;  2OKA A;  1HNA A;  1B4Q A;  3GX0 A;  1GSQ A;  3Q6O A;  4IP6 A;  4XIH A;  1UC7 A;  4J2F A;  1G7O A;  5IO2 A;  4V1A p;  3L9V A;  1WOU A;  3TJF A;  2HYX A;  2DJK A;  3NOF A;  4RI6 A;  1XW9 A;  5A4W A;  2P31 A;  1Z7R A;  1G6W A;  3TDG A;  2LTK A;  4TR3 A;  1EV9 A;  4I6X A;  3UMA A;  4N0V A;  5J3R A;  5ELA A;  5DCG A;  2V6K A;  3PR8 A;  2C80 A;  2VO4 A;  2L6C A;  3BCI A;  3WT2 A;  1VRS D;  4HZ2 A;  3LEF A;  4CDO A;  2C3Q A;  5HFK A;  3DRN A;  3I69 A;  4N10 A;  1XXU A;  1TU7 A;  4V2L A;  3ZZX A;  1A2L A;  3A3T A;  2GZZ A;  3H79 A;  1H75 A;  3GL3 A;  4EL1 A;  3KD0 A;  2VM1 A;  4I2U A;  4G2E A;  4X1U A;  1E2Y A;  3EPT A;  4Z7X A;  3VLN A;  3W6G A;  1ILO A;  1ZZY A;  3TUE A;  5GAN D;  1X9M B;  1F6M C;  3ZTL A;  3IK7 A;  3ZVJ A;  4TR1 B;  3RPP A;  1DUG A;  1TTZ A;  2FWF A;  4FQU A;  3MSZ A;  3QMX A;  4F0B A;  1ST9 A;  3RDW A;  5L71 A;  3A2V A;  3BOA A;  2DJJ A;  1OC9 B;  3H93 A;  4F03 A;  4O32 A;  12GS A;  2B1L A;  1M2A A;  1IYI A;  3LFL A;  4MP4 A;  2H75 A;  1S3D A;  4ECI A;  3GKK A;  3IR4 A;  3UAR A;  1OC8 A;  4F2I A;  1QGV A;  1K0C A;  3CSI A;  4NHZ A;  4MPG A;  1EP7 A;  5CRE A;  4XCS A;  2FA8 A;  5IMA A;  3F0I A;  2E2M A;  1ML6 A;  2EC4 A;  1I9D A;  2VLV A;  1OE8 A;  5ECI B;  2HE3 A;  4KE3 A;  4Q5F A;  4XRA A;  4K0N A;  3HY2 A;  3KH9 A;  1KTE A;  4LMV A;  1X9W B;  4MF5 A;  1A24 A;  2LEG A;  2CX4 A;  2C0E A;  3N5O A;  3VPT A;  2PPT A;  5C04 A;  2A2R A;  2GT5 A;  5DAL A;  4ACS A;  6GST A;  4GF0 A;  2QKE A;  3VK9 A;  1K0O A;  2YAN A;  2K8V A;  1M9A A;  4FYU A;  3EYT A;  4MLY A;  2H0G A;  6GSX A;  4KW6 A;  1F37 A;  5ELG A;  3FZA A;  1UA5 A;  5DJM A;  4EF0 A;  1U3A A;  1N8J A;  2C3N A;  2ZCT A;  5CRW A;  2HSM A;  5IOX A;  1TK8 B;  4RQX A;  3C7M A;  6GSV A;  3K8N A;  4JR6 A;  2LNS A;  4E8E A;  1AIU A;  1GL8 A;  2H6X A;  3QAV A;  3GH9 A;  3R3E A;  4TW5 A;  2YWI A;  4Z2T A;  1QUW A;  4EDY A;  2H8L A;  3BJ5 A;  1YDK A;  4WF4 A;  4RI7 A;  5F05 A;  4JE1 A;  3APO A;  3ERF A;  2H73 A;  3C1S A;  2YWO A;  2F8F A;  4JRR A;  2FY6 A;  1Q4J A;  2GZP A;  1KNG A;  3M0F A;  3FMW A;  3D6I A;  2VL9 A;  2LJK A;  5KN0 A;  3WYW A;  3GNJ A;  3PGT A;  3KP9 A;  3IOS A;  1Z6N A;  1M2B A;  2E7P A;  5ABR A;  5J4U A;  1V2A A;  2TRC P;  9GSS A;  3JCM L;  3RAZ A;  1HD2 A;  3P8W A;  1SJZ A;  3WGX A;  5GAP D;  4GXZ A;  1MDK A;  1R7H A;  3KM6 A;  3LYK A;  3WT1 A;  2EIO A;  1OKT A;  4J57 E;  2MZC A;  3ZLP A;  5HR0 A;  2LUS A;  5CRD A;  3CRU A;  4IQ1 A;  2JZT A;  1SYR A;  1T7P B;  2LRT A;  1Y25 A;  1K0M A;  3Q18 A;  4I8B A;  3SWL A;  1X5C A;  4L0U A;  2IPA A;  3UBL A;  3EU4 A;  4RUV A;  4WKW A;  2H6Z A;  5D9X A;  1VF1 A;  1YJ6 A;  5DQS A;  4YAP A;  4Z2R A;  2B5E A;  4KDU A;  2DLX A;  2P0G A;  3CSJ A;  4L5L A;  4ZXG A;  2YP6 A;  4G19 A;  1MTC A;  4Q5R A;  2J9H A;  2YN1 A;  3IE3 A;  2ON5 A;  3EC3 A;  4TRX A;  3GH6 A;  3NZN A;  4GLT A;  4YKG A;  2PN8 A;  4POK A;  1K0D A;  2H74 A;  1XOB A;  4MJC A;  2V41 A;  4GST A;  1T4Y A;  1GSU A;  2F8A A;  2HRA A;  1K3O A;  4LL4 B;  3DVW A;  1O8W A;  2ON7 A;  2VL3 A;  2CV4 A;  4KA0 A;  1VF4 A;  4IJI A;  3TCO A;  1DSB A;  1NHO A;  3TKR A;  3ZRD A;  2YNX A;  5GZZ B;  2N5A A;  4X43 A;  2PVO C;  2X8C A;  2FD3 A;  2LQQ A;  2N5B A;  4P3Y B;  1TP9 A;  1J9B A;  1OC3 A;  2CT6 A;  2L6D A;  3KJY A;  4BWQ A;  1X5D A;  2EIQ A;  3C73 A;  1SD9 A;  3GN3 A;  2CVK A;  4GTU A;  3A2X A;  5F8B A;  4ECB A;  4FO5 A;  1XWA A;  2YWN A;  5EY6 A;  2CZ3 A;  1TK0 B;  5IM9 A;  1T00 A;  4V2N A;  3HJM A;  5G30 A;  2JL4 A;  5ID2 A;  3GTU A;  3MAK A;  2OE3 A;  2TIR A;  1K3Y A;  2X4A A;  2XBI A;  3FK8 A;  5KEJ A;  1GTA A;  1M3J A;  2MMN A;  1YEP A;  2VCV A;  2XPE A;  1SJ6 A;  2VD1 A;  2ES7 A;  1A2M A;  4H86 A;  3FRC A;  3WGD A;  2PMT A;  2LJA A;  2HZF A;  2MYG A;  6GSU A;  2AJQ B;  2M72 A;  2YV7 A;  1A0F A;  2G2Q A;  3FHK A;  1NHY A;  2DKH A;  4BIK A;  4K6X A;  2I3Y A;  1SU9 A;  3UVH A;  3H1N A;  1GLP A;  2HI7 A;  1SKW B;  4AJ7 A;  3DVX A;  4WBJ A;  3G9B A;  4WR5 A;  2DBC A;  2OAD A;  1PL2 A;  2QC7 A;  3NIV A;  1M0U A;  1BQ7 A;  1BJX A;  4KSM A;  5IOW A;  1EZK A;  4ZBD A;  2WUL A;  1V57 A;  1GLQ A;  14GS A;  2IME A;  3M3M A;  4JU5 A;  2H30 A;  4YQV A;  3I43 A;  2OE0 A;  3EMX A;  2CAQ A;  4CHS A;  2H01 A;  4X4J A;  3GKN A;  16GS A;  1TRW A;  2H1B A;  3TKS A;  4YH2 A;  5D8I A;  5HR3 A;  5HQP A;  5COH A;  5JCU A;  3GIX A;  4FH8 A;  1YF0 A;  2L57 A;  2HNL A;  4PQH A;  3VWV A;  4IKH A;  3FZ9 A;  4MA9 A;  3LWA A;  3VPQ A;  1R4W A;  2NTO A;  3L78 A;  6GSW A;  3APS A;  3KTL A;  5FHI A;  4WXT A;  2LS5 A;  2KOK A;  2M80 A;  2R2J A;  2L4C A;  2B6M A;  4V1A g;  2GTU A;  1ZCP A;  2GS3 A;  2CZ2 A;  3G7I A;  1JZW A;  1AXD A;  5KN2 A;  2AYT A;  4XS6 A;  3GL5 A;  2JAD A;  1G7E A;  4EE0 A;  3F4S A;  3FEU A;  3J7Y b;  3DXB A;  2KUC A;  1S3C A;  2VCQ A;  3IXR A;  3UBK A;  3EIN A;  3G7Y A;  5F0G A;  3KCM A;  3QR6 A;  2A4H A;  4EKZ A;  5LD0 A;  5JCW A;  1TI1 A;  3DEX A;  3LOR A;  1YEX A;  4L0W A;  3EU3 A;  2CVB A;  1LBK A;  3QFA C;  1Z3E A;  5FWG A;  1SL0 B;  4Z2U A;  1RK4 A;  3D22 A;  2NVL A;  4HJM A;  3TJG A;  2CAI A;  2PVQ A;  4N0Z A;  4ZL7 A;  1BYE A;  2DJ0 A;  5B7C A;  3F4R A;  1Q98 A;  1SK1 A;  2CQ9 A;  4BPY A;  1FO5 A;  1GTB A;  2WCI A;  1U88 A;  2X8G A;  4HOJ A;  2E0Q A;  2I4A A;  10GS A;  4JBB A;  3IK9 A;  2DIZ A;  2GSQ A;  3TOT A;  3HCZ A;  5EL8 A;  3D5J A;  2C0F A;  3LJR A;  3KEB A;  5E4W A;  5ECR B;  3U5R E;  4NHW A;  2F9S A;  3PH9 A;  4PQI A;  2H70 A;  4XRD A;  1R5P A;  1U87 A;  2N5F A;  4FYB A;  4HJ2 A;  5ENU A;  5GSS A;  1FW1 A;  1B9X C;  2K18 A;  1KEB A;  4OO4 A;  2IL3 A;  2HFD A;  2R0G A;  2MBT A;  4MH3 A;  5B6M A;  1ZYE A;  3KH7 A;  1ZGN A;  3IHQ A;  5G31 A;  4L8E A;  5ID2 B;  4TOP A;  1SEN A;  3GTU B;  5A4U A;  1JZO A;  4NWY A;  2GQL A;  3GYK A;  2FWE A;  2WDU A;  2K9F A;  3IDV A;  4K7N A;  5D93 A;  4ICY A;  2DMM A;  3CSH A;  4OFN A;  5IMC A;  1GSF A;  4PX1 A;  1EOG A;  2VCZ A;  4AGS A;  4LL1 B;  4IN0 A;  3L9U A;  1C72 A;  2H19 A;  2VM2 A;  5AN1 A;  4ZBA A;  3DIE A;  4V2M A;  1ERU A;  3ERW A;  4K7I A;  5INY A;  4HDE A;  3KIJ A;  1Z5Y E;  3W8J A;  2QA1 A;  2YWM A;  3M9K A;  1GUK A;  3F9U A;  1WIK A;  4EC0 A;  2NPB A;  1GTU A;  4TN8 A;  1HNB A;  3DYR A;  2WFC A;  4MJE A;  1FHE A;  2X49 A;  2H72 A;  13GS A;  3QFB C;  3ERG A;  1RW1 A;  4TR4 A;  2GT6 A;  1ACV A;  1SL2 B;  2JZR A;  2OBK A;  2B3S A;  2AV4 A;  2CA8 A;  3ZIJ A;  2FLS A;  3PIN A;  3LYP A;  1AAZ A;  1EEM A;  1PKW A;  2LV3 A;  2IMF A;  3VWU A;  5D73 A;  1F9M A;  1TRV A;  2H1D A;  1GUM A;  2DJ3 A;  2B1K A;  3MDK A;  3DKS A;  4ILF A;  5HFI A;  4NMU A;  5CRG A;  3E3E A;  4CY6 A;  3QD9 A;  5EVO A;  3TRQ A;  4WET A;  4N30 A;  2H6Y A;  2B7J A;  1SK0 A;  2FNO A;  4XS4 A;  2H71 A;  3GMF A;  1GSY A;  4POM A;  1FAA A;  5G5E A;  2O87 A;  2O85 A;  2HRK A;  3HVS A;  2ZNM A;  2PBJ A;  4XS1 A;  4IHU A;  3QCP A;  3CMI A;  1ZL9 A;  5ECH B;  6GSS A;  1JLV A;  3L0H A;  3ME7 A;  1U6T A;  3UJ1 A;  5CAX A;  2YOI A;  1S3R A;  4YKF A;  3IV4 A;  2R0C A;  1I5G A;  1VF3 A;  3VI7 A;  4KDY A;  1VGL A;  3QPM A;  4MMM A;  4K8M A;  3C1R A;  1Z6M A;  4QQ7 A;  2FWG A;  4O5R A;  3SBC A;  1PX6 A;  2RM6 A;  1XWB A;  4TXV A;  4HZ4 A;  4I97 A;  5CNW A;  3KGK A;  4OCE A;  5E59 A;  4PNG A;  2QGV A;  1XZO A;  1WE0 A;  3M8N A;  2R3X A;  3LXZ A;  5G2Z A;  1TRS A;  1TOF A;  1OKD A;  1GH2 A;  3HVV A;  3GUS A;  18GS A;  4IEL A;  1WP0 A;  4ZIJ A;  4PGT A;  3M1G A;  4PUA A;  3TGZ A;  3HHV A;  5LNK e;  1PGT A;  1NW2 A;  3S9F A;  1QQ2 A;  1TKD B;  1XWK A;  3IBH A;  2VL2 A;  1LU4 A;  4FYC A;  3F8U A;  1RQM A;  4KH7 A;  2H1A A;  5G1L A;  2OJL A;  3F6F A;  1IYH A;  2C0G A;  4IGJ A;  3E0U A;  1PFO A;  4ECC A;  2GSR A;  4LMW A;  5DBQ A;  2D2Z A;  4TVE A;  5CYY A;  3ZFB A;  2HXK A;  2VCW A;  4PUR A;  4DSR A;  2YJH A;  1YKC A;  2A4V A;  2BMX A;  1GUH A;  1YQ1 A;  3ISO A;  2KP1 A;  2BTO T;  2QA2 A;  3G7J A;  1BED A;  4LLR A;  5IQY A;  1PKZ A;  1FG4 A;  1QMV A;  1K0B A;  3V1W A;  4F0C A;  3A2W A;  5IMZ A;  2GDR A;  1XW6 A;  3EMP A;  1MEK A;  2XC2 A;  3BD2 A;  4MZC A;  3FY7 A;  2O89 A;  1TU8 A;  4BVX A;  2DJ1 A;  2XPD A;  3IHG A;  3FKF A;  1X5E A;  3D21 A;  8GSS A;  1GP1 A;  3H4K A;  4NAX A;  3MYD A;  2WJU A;  2H0H A;  1B8X A;  4IW9 A;  4O92 A;  5AIV A;  2JAC A;  1KBN A;  2V6O A;  5DQY A;  4K1F A;  5G5F A;  1DE2 A;  5A5K A;  1OC9 A;  4YAV A;  2C8U A;  2DML A;  2PU9 C;  3BCK A;  3IAS 2;  3ZIT A;  5H5S A;  1MDJ A;  1M7T A;  2IFQ A;  4EUY A;  2MMO A;  3IC4 A;  2OA7 A;  5ECP B;  4D73 A;  5DAL B;  3DWV A;  2R4V A;  3FW2 A;  3ZML A;  4NV5 A;  5KOW A;  3AY8 A;  3LSZ A;  3LQ7 A;  1G6Y A;  3A5I A;  1PMT A;  1BAY A;  1MD3 A;  5AIS A;  1DBY A;  2FGX A;  5DAK A;  3DML A;  1TDI A;  1XFL A;  2PUK C;  1FOV A;  2HRF A;  4TR0 A;  19GS A;  3HXS A;  4PTS A;  1S3A A;  2REM A;  2YJ7 A;  4JZQ A;  2A2S A;  4GWR A;  3TKS C;  1Z7P A;  1QFN A;  4CW9 A;  1XBS A;  1Z9H A;  2LST A;  1SJI A;  2L5L A;  4EXJ A;  1XVW A;  3QDN A;  1QK8 A;  5IMF A;  3CXG A;  2PER A;  1SKS B;  1ON4 A;  5DVB A;  2I81 A;  4K2D A;  2IN3 A;  1K0N A;  4DVC A;  3R2Q A;  4BL7 A;  2LJR A;  1O8X A;  2NDO A;  1X9S B;  1T1V A;  2L5O A;  2P5R A;  4OD7 A;  2ALB A;  5JWO B;  1CQH A;  2LQO A;  1O7U A;  5F07 A;  1GTI A;  5HR2 A;  4KX4 A;  4ZB6 A;  1XW5 A;  3QAW A;  1O81 A;  4EVM A;  4NPB A;  1UVZ A;  1USB A;  2FA4 A;  2L4Q A;  3Q74 A;  1A0R P;  4OFM A;  1M9B A;  2JZS A;  3F4T A;  2EIR A;  2G0F A;  2H76 A;  4DSQ A;  4AF2 A;  1F2E A;  2B7K A;  3DGQ A;  4GSN A;  1GUL A;  5KN1 A;  1YKA A;  4G10 A;  7GSS A;  5D9V A;  1A2J A;  1HYU A;  2KP2 A;  4ZL9 A;  2AAW A;  3KMN A;  2B5X A;  4I2T A;  3I6A A;  1PX7 A;  1MD4 A;  4PNF A;  2VIM A;  2IMK A;  3TKP A;  2B5Y A;  3ZYW A;  1AC1 A;  1PN0 A;  4XTS A;  5DCH A;  4J56 E;  1J08 A;  2QSI A;  4KCA A;  3APQ A;  4OO5 A;  4ZIL A;  3CQF A;  4EIQ A;  1CQG A; 
#chains in the Genus database with same CATH homology
 5AGY A;  3LXT A;  1PSQ A;  4GQF A;  2ZUP A;  4GCI A;  4KF9 A;  3GFK A;  4BWS A;  1E6B A;  22GS A;  4O5U A;  5CRH A;  2J23 A;  2WRT A;  3PPU A;  2MBS A;  5ECO B;  1F3A A;  1M99 A;  2RUE A;  1O85 A;  3OR5 A;  4KGI A;  4OCF A;  3TB2 A;  1ZYP A;  1NSW A;  4JR4 A;  4MNN A;  4XHM A;  3H8Q A;  4G9H A;  1V58 A;  1OYJ A;  2KHP A;  5LCZ A;  1GNW A;  3VFI A;  4MJA A;  1FVJ A;  2OAC A;  1SD8 A;  20GS A;  4IVF A;  2VCX A;  3UL3 A;  4IS0 A;  3RHB A;  4HU7 A;  4TXO A;  3W8S A;  2X64 A;  2C4J A;  3CTG A;  3N9J A;  3FZ4 A;  1W4V A;  2HZE A;  3D0Z A;  3CBU A;  1K3L A;  4PUF C;  3LW9 A;  4RQR A;  2GQM A;  2V32 A;  3C8E A;  4EO3 A;  1ZYQ B;  2JU5 A;  5H5Q A;  5H5R A;  2GZY A;  5ECQ B;  1YZX A;  4BVX B;  3D4T A;  3GSS A;  3ME8 A;  2L59 A;  4DSS A;  2TRX A;  4WEY A;  3EE2 A;  4K5R A;  1R26 A;  1THX A;  2YZU A;  3ZL5 A;  2YPM A;  2V2G A;  1ERV A;  1MDI A;  3HA9 A;  1YF1 A;  1A8L A;  4MCU A;  4O5Q A;  1WPI A;  4ZB9 A;  3TOU A;  4MDC A;  1FB0 A;  1B4P A;  1V9W A;  2IFQ B;  3KTB A;  3TJB A;  4OMV A;  1EWX A;  4D73 B;  5KN3 A;  3TKQ A;  1T3B A;  1WRY A;  1JZR A;  3TJK A;  1X0R A;  2K8S A;  3Q19 A;  3FR6 A;  1SKR B;  5DAK B;  1JLW A;  3IAM 2;  2DIY A;  3VI5 A;  4LA1 A;  1OE7 A;  2H1G A;  3CTF A;  4TKY A;  1GSS A;  1JZD A;  3ZIV A;  2FUG 2;  2RLI A;  2VD0 A;  2GGT A;  4IP1 A;  3GX8 A;  5DJL A;  2IMD A;  3L9S A;  1HQO A;  2IMI A;  4K9Z A;  5J5N A;  1BX9 A;  1W89 A;  4WF5 A;  3O76 A;  2F51 A;  1T8E B;  3F63 A;  4BL7 B;  2R5G A;  1ZOF A;  5B8A A;  1YY7 A;  5F06 A;  3A5W A;  3TKS E;  1V40 A;  4DEJ A;  1WMJ A;  1GRX A;  3IPZ A;  1XWC A;  2A2P A;  1ZYN A;  3GA4 A;  5EPF A;  5D9T A;  1ABA A;  2HSH A;  3FZ5 A;  3C71 A;  4FIW A;  2DSA A;  4K0G A;  5AIX A;  1PL1 A;  3GST A;  2AB6 A;  3MWH A;  3MIX A;  2PWJ A;  1XOA A;  2GSS A;  4A5P A;  2HRN A;  4BVY A;  5BRT A;  1A23 A;  5D9W A;  4AJ8 A;  4E8H A;  1A8Y A;  5IPH A;  2LKU A;  4GRF A;  5ECK B;  2H0I A;  1FVK A;  3KXO A;  2VLU A;  3RBT A;  2WZ9 A;  4IBP A;  4KB3 A;  5ECL B;  1SK2 A;  4PQ1 A;  5B6N A;  1PRX A;  4N11 A;  3GRX A;  2IIY A;  2O7K A;  2OE1 A;  5G1K A;  3WD6 A;  2WGR A;  1WJK A;  2GVP A;  3F6D A;  1WWJ A;  1OAZ A;  5IO0 A;  2R0P A;  3TRP A;  3US3 A;  3UIW A;  4MF7 A;  5D96 A;  2FHE A;  2VL2 C;  5JCG A;  3VWW A;  3GKX A;  4Q5Q A;  4EDZ A;  2I9H A;  3HKR A;  3RHC A;  1GSD A;  2H66 A;  5IPG A;  3KZQ A;  5FT3 A;  1DE1 A;  1GSE A;  1FB6 A;  1R5A A;  2HT9 A;  2FWH A;  1O73 A;  1U3I A;  3MNG A;  4KSO A;  3HYP A;  1O6J A;  4HQS A;  3GV1 A;  1AW9 A;  4PXO A;  3FYG A;  1SL1 B;  3VWX A;  3O3T A;  4NV2 A;  3UAP A;  4K7O A;  3UEM A;  4KUN A;  4QL7 A;  2LNT A;  4MZB A;  4O7H A;  2Z9S A;  1OVN A;  1EP8 A;  1THO A;  5DDL A;  1ERW A;  1N2A A;  1XPV A;  3D4M A;  3IC8 A;  5HR1 A;  4EIP A;  4TXO B;  1H4O A;  5IMD A;  5J9C A;  4AJ6 A;  4USS A;  1Y6E A;  4POB A;  2HZE B;  4ISD A;  4G0K A;  2BJX A;  4I5Q A;  3DD3 A;  3HJP A;  4ZBB A;  1XIY A;  2DC5 A;  3I9V 2;  2MMA A;  1XVQ A;  2KLX A;  2M46 A;  4ML1 A;  5GST A;  4HQZ A;  2OBI A;  1TJD A;  5BMU A;  3P90 A;  2XHF A;  2PGT A;  3ZFL A;  4MAB A;  4Q5N A;  3CRT A;  1PN9 A;  3GUR A;  3M9J A;  4DSS B;  2GLR A;  2GQK A;  1G0T A;  2VUP A;  2O8V B;  2CVD A;  3E9J B;  4KAE A;  3L4N A;  3HJO A;  2HLS A;  2HSY A;  3ZVJ D;  3RPN A;  1UN2 A;  5ECM B;  3QOU A;  4F9Z A;  4K2X A;  2V1M A;  1SYX A;  4JED A;  1T4Z A;  4X0X A;  1AQX A;  4ECJ A;  2VOC A;  5ECN B;  4WBR D;  3EVI A;  4ID0 A;  1ZMA A;  2I1U A;  2RII A;  1J0F A;  3P7X A;  11GS A;  4TR1 A;  2C0D A;  1TW9 A;  1ERT A;  1PD2 1;  5JWR B;  1V98 A;  4MPF A;  3BBY A;  3ZMK A;  1B48 A;  2E2G A;  5HFG A;  5C00 A;  4G0I A;  2X99 A;  4KND A;  2K6V A;  1M2D A;  3TJJ A;  4ULX A;  3GKM A;  1NM3 A;  4L5O A;  1AQV A;  3LGC A;  4F82 A;  4G0L A;  3GHA A;  2MMZ A;  4OWY A;  1EGO A;  1GNE A;  4WR4 A;  1FOH A;  5IMV A;  4KCE A;  5JWQ B;  4GQC A;  2F3M A;  4HI7 A;  5B8B A;  3F3R A;  1F3B A;  4ML6 A;  1XCC A;  4K5S A;  1EGR A;  1TRU A;  2X8H A;  1QXH A;  1JHB A;  2R6K A;  4GSS A;  2JSY A;  1PQN A;  1EV4 A;  1PA3 A;  4MK3 A;  2LRN A;  5J9B A;  1JFU A;  1K0A A;  5CO3 A;  5KOX A;  4ZB8 A;  3VUR A;  2C3T A;  3KP8 A;  4OFT A;  4HUA A;  2LRC A;  3HD5 A;  2IWT A;  4NXI A;  1B9Y C;  3HVX A;  3ED3 A;  2WS2 A;  3J7Y k;  5CP1 A;  5A4V A;  2DKI A;  4BVY B;  3KMO A;  4CY8 A;  1BG5 A;  4ZL8 A;  2P5Q A;  1EEJ A;  2RUF A;  3F3Q A;  2YV9 A;  4HEA 2;  4XS4 B;  1HNC A;  2RM5 A;  2UZ8 A;  4IJ3 A;  2NBS A;  3ZRE A;  2VAF A;  5J41 A;  4IQA A;  2AUV A;  4MH2 A;  1LJR A;  4MZW A;  2XBQ A;  2JSZ A;  17GS A;  3LG6 A;  1VF2 A;  1XWG A;  2AHE A;  3O6T A;  3HZ4 A;  2YZH A;  4KDX A;  1EOH A;  3QAG A;  1TXX A;  3TRX A;  3HZ8 A;  2VLT A;  4YQU A;  3EWL A;  3FR9 A;  3UOM A;  3IRA A;  4HS1 A;  1GWC A;  3EUR A;  1AUC A;  2C1Y A;  2DJ2 A;  3HDC A;  4YQM A;  5ECS A;  2WB9 A;  2YCD A;  3P2A A;  1URM A;  4BA7 A;  2GST A;  2IJY A;  6GSY A;  1AQW A;  5IIZ A;  4MJB A;  2VCT A;  3UVT A;  3IA1 A;  4MF6 A;  2FCH A;  2R37 A;  1TK5 B;  3CYN A;  3U6V A;  4QL9 A;  3FR3 A;  4POL A;  3WGE A;  4HU9 A;  2CX3 A;  1TI3 A;  2OKA A;  1HNA A;  1B4Q A;  3GX0 A;  1GSQ A;  3Q6O A;  4IP6 A;  4XIH A;  1UC7 A;  4J2F A;  1G7O A;  5IO2 A;  4V1A p;  3L9V A;  1WOU A;  3TJF A;  2HYX A;  2DJK A;  3NOF A;  4RI6 A;  1XW9 A;  5A4W A;  2P31 A;  1Z7R A;  1G6W A;  3TDG A;  2LTK A;  4TR3 A;  1EV9 A;  4I6X A;  3UMA A;  4N0V A;  5J3R A;  5ELA A;  5DCG A;  2V6K A;  3PR8 A;  2C80 A;  2VO4 A;  2L6C A;  3BCI A;  3WT2 A;  1VRS D;  4HZ2 A;  3LEF A;  4CDO A;  2C3Q A;  5HFK A;  3DRN A;  3I69 A;  4N10 A;  1XXU A;  1TU7 A;  4V2L A;  3ZZX A;  1A2L A;  3A3T A;  2GZZ A;  3H79 A;  1H75 A;  3GL3 A;  4EL1 A;  3KD0 A;  2VM1 A;  4I2U A;  4G2E A;  4X1U A;  1E2Y A;  3EPT A;  4Z7X A;  3VLN A;  3W6G A;  1ILO A;  1ZZY A;  3TUE A;  5GAN D;  1X9M B;  1F6M C;  3ZTL A;  3IK7 A;  3ZVJ A;  4TR1 B;  3RPP A;  1DUG A;  1TTZ A;  2FWF A;  4FQU A;  3MSZ A;  3QMX A;  4F0B A;  1ST9 A;  3RDW A;  5L71 A;  3A2V A;  3BOA A;  2DJJ A;  1OC9 B;  3H93 A;  4F03 A;  4O32 A;  12GS A;  2B1L A;  1M2A A;  1IYI A;  3LFL A;  4MP4 A;  2H75 A;  1S3D A;  4ECI A;  3GKK A;  3IR4 A;  3UAR A;  1OC8 A;  4F2I A;  1QGV A;  1K0C A;  3CSI A;  4NHZ A;  4MPG A;  1EP7 A;  5CRE A;  4XCS A;  2FA8 A;  5IMA A;  3F0I A;  2E2M A;  1ML6 A;  2EC4 A;  1I9D A;  2VLV A;  1OE8 A;  5ECI B;  2HE3 A;  4KE3 A;  4Q5F A;  4XRA A;  4K0N A;  3HY2 A;  3KH9 A;  1KTE A;  4LMV A;  1X9W B;  4MF5 A;  1A24 A;  2LEG A;  2CX4 A;  2C0E A;  3N5O A;  3VPT A;  2PPT A;  5C04 A;  2A2R A;  2GT5 A;  5DAL A;  4ACS A;  6GST A;  4GF0 A;  2QKE A;  3VK9 A;  1K0O A;  2YAN A;  2K8V A;  1M9A A;  4FYU A;  3EYT A;  4MLY A;  2H0G A;  6GSX A;  4KW6 A;  1F37 A;  5ELG A;  3FZA A;  1UA5 A;  5DJM A;  4EF0 A;  1U3A A;  1N8J A;  2C3N A;  2ZCT A;  5CRW A;  2HSM A;  5IOX A;  1TK8 B;  4RQX A;  3C7M A;  6GSV A;  3K8N A;  4JR6 A;  2LNS A;  4E8E A;  1AIU A;  1GL8 A;  2H6X A;  3QAV A;  3GH9 A;  3R3E A;  4TW5 A;  2YWI A;  4Z2T A;  1QUW A;  4EDY A;  2H8L A;  3BJ5 A;  1YDK A;  4WF4 A;  4RI7 A;  5F05 A;  4JE1 A;  3APO A;  3ERF A;  2H73 A;  3C1S A;  2YWO A;  2F8F A;  4JRR A;  2FY6 A;  1Q4J A;  2GZP A;  1KNG A;  3M0F A;  3FMW A;  3D6I A;  2VL9 A;  2LJK A;  5KN0 A;  3WYW A;  3GNJ A;  3PGT A;  3KP9 A;  3IOS A;  1Z6N A;  1M2B A;  2E7P A;  5ABR A;  5J4U A;  1V2A A;  2TRC P;  9GSS A;  3JCM L;  3RAZ A;  1HD2 A;  3P8W A;  1SJZ A;  3WGX A;  5GAP D;  4GXZ A;  1MDK A;  1R7H A;  3KM6 A;  3LYK A;  3WT1 A;  2EIO A;  1OKT A;  4J57 E;  2MZC A;  3ZLP A;  5HR0 A;  2LUS A;  5CRD A;  3CRU A;  4IQ1 A;  2JZT A;  1SYR A;  1T7P B;  2LRT A;  1Y25 A;  1K0M A;  3Q18 A;  4I8B A;  3SWL A;  1X5C A;  4L0U A;  2IPA A;  3UBL A;  3EU4 A;  4RUV A;  4WKW A;  2H6Z A;  5D9X A;  1VF1 A;  1YJ6 A;  5DQS A;  4YAP A;  4Z2R A;  2B5E A;  4KDU A;  2DLX A;  2P0G A;  3CSJ A;  4L5L A;  4ZXG A;  2YP6 A;  4G19 A;  1MTC A;  4Q5R A;  2J9H A;  2YN1 A;  3IE3 A;  2ON5 A;  3EC3 A;  4TRX A;  3GH6 A;  3NZN A;  4GLT A;  4YKG A;  2PN8 A;  4POK A;  1K0D A;  2H74 A;  1XOB A;  4MJC A;  2V41 A;  4GST A;  1T4Y A;  1GSU A;  2F8A A;  2HRA A;  1K3O A;  4LL4 B;  3DVW A;  1O8W A;  2ON7 A;  2VL3 A;  2CV4 A;  4KA0 A;  1VF4 A;  4IJI A;  3TCO A;  1DSB A;  1NHO A;  3TKR A;  3ZRD A;  2YNX A;  5GZZ B;  2N5A A;  4X43 A;  2PVO C;  2X8C A;  2FD3 A;  2LQQ A;  2N5B A;  4P3Y B;  1TP9 A;  1J9B A;  1OC3 A;  2CT6 A;  2L6D A;  3KJY A;  4BWQ A;  1X5D A;  2EIQ A;  3C73 A;  1SD9 A;  3GN3 A;  2CVK A;  4GTU A;  3A2X A;  5F8B A;  4ECB A;  4FO5 A;  1XWA A;  2YWN A;  5EY6 A;  2CZ3 A;  1TK0 B;  5IM9 A;  1T00 A;  4V2N A;  3HJM A;  5G30 A;  2JL4 A;  5ID2 A;  3GTU A;  3MAK A;  2OE3 A;  2TIR A;  1K3Y A;  2X4A A;  2XBI A;  3FK8 A;  5KEJ A;  1GTA A;  2MMN A;  1YEP A;  2VCV A;  2XPE A;  1SJ6 A;  2VD1 A;  2ES7 A;  1A2M A;  4H86 A;  3FRC A;  3WGD A;  2PMT A;  2LJA A;  2HZF A;  2MYG A;  6GSU A;  2AJQ B;  2M72 A;  2YV7 A;  1A0F A;  2G2Q A;  3FHK A;  1NHY A;  2DKH A;  4K6X A;  2I3Y A;  1SU9 A;  3UVH A;  3H1N A;  1GLP A;  2HI7 A;  1SKW B;  4AJ7 A;  3DVX A;  4WBJ A;  3G9B A;  4WR5 A;  2DBC A;  2OAD A;  1PL2 A;  2QC7 A;  3NIV A;  1M0U A;  1BQ7 A;  1BJX A;  4KSM A;  5IOW A;  1EZK A;  4ZBD A;  2WUL A;  1V57 A;  1GLQ A;  14GS A;  2IME A;  3M3M A;  4JU5 A;  2H30 A;  4YQV A;  3I43 A;  2OE0 A;  3EMX A;  2CAQ A;  4CHS A;  2H01 A;  4X4J A;  3GKN A;  16GS A;  1TRW A;  2H1B A;  3TKS A;  4YH2 A;  5D8I A;  5HR3 A;  5HQP A;  5COH A;  5JCU A;  3GIX A;  4FH8 A;  1YF0 A;  2L57 A;  2HNL A;  4PQH A;  3VWV A;  4IKH A;  3FZ9 A;  4MA9 A;  3LWA A;  3VPQ A;  1R4W A;  2NTO A;  3L78 A;  6GSW A;  3APS A;  3KTL A;  5FHI A;  4WXT A;  2LS5 A;  2KOK A;  2M80 A;  2R2J A;  2L4C A;  2B6M A;  4V1A g;  2GTU A;  1ZCP A;  2GS3 A;  2CZ2 A;  3G7I A;  1JZW A;  1AXD A;  5KN2 A;  2AYT A;  4XS6 A;  3GL5 A;  2JAD A;  1G7E A;  4EE0 A;  3F4S A;  3FEU A;  3J7Y b;  3DXB A;  2KUC A;  1S3C A;  2VCQ A;  3IXR A;  3UBK A;  3EIN A;  3G7Y A;  5F0G A;  3KCM A;  3QR6 A;  2A4H A;  4EKZ A;  5LD0 A;  5JCW A;  1TI1 A;  3DEX A;  3LOR A;  1YEX A;  4L0W A;  3EU3 A;  2CVB A;  1LBK A;  3QFA C;  1Z3E A;  5FWG A;  1SL0 B;  4Z2U A;  1RK4 A;  3D22 A;  2NVL A;  4HJM A;  3TJG A;  2CAI A;  2PVQ A;  4N0Z A;  4ZL7 A;  1BYE A;  2DJ0 A;  5B7C A;  3F4R A;  1Q98 A;  1SK1 A;  2CQ9 A;  4BPY A;  1FO5 A;  1GTB A;  2WCI A;  1U88 A;  2X8G A;  4HOJ A;  2E0Q A;  2I4A A;  10GS A;  4JBB A;  3IK9 A;  2DIZ A;  2GSQ A;  3TOT A;  3HCZ A;  5EL8 A;  3D5J A;  2C0F A;  3LJR A;  3KEB A;  5E4W A;  5ECR B;  3U5R E;  4NHW A;  2F9S A;  3PH9 A;  4PQI A;  2H70 A;  4XRD A;  1R5P A;  1U87 A;  2N5F A;  4FYB A;  4HJ2 A;  5ENU A;  5GSS A;  1FW1 A;  1B9X C;  2K18 A;  1KEB A;  4OO4 A;  2IL3 A;  2HFD A;  2R0G A;  2MBT A;  4MH3 A;  5B6M A;  1ZYE A;  3KH7 A;  1ZGN A;  3IHQ A;  5G31 A;  4L8E A;  5ID2 B;  4TOP A;  1SEN A;  3GTU B;  5A4U A;  1JZO A;  4NWY A;  2GQL A;  3GYK A;  2FWE A;  2WDU A;  2K9F A;  3IDV A;  4K7N A;  5D93 A;  4ICY A;  2DMM A;  3CSH A;  4OFN A;  5IMC A;  1GSF A;  4PX1 A;  1EOG A;  2VCZ A;  4AGS A;  4LL1 B;  4IN0 A;  3L9U A;  1C72 A;  2H19 A;  2VM2 A;  5AN1 A;  4ZBA A;  3DIE A;  4V2M A;  1ERU A;  3ERW A;  4K7I A;  5INY A;  4HDE A;  3KIJ A;  1Z5Y E;  3W8J A;  2QA1 A;  2YWM A;  3M9K A;  1GUK A;  3F9U A;  1WIK A;  4EC0 A;  2NPB A;  1GTU A;  4TN8 A;  1HNB A;  3DYR A;  2WFC A;  4MJE A;  1FHE A;  2X49 A;  2H72 A;  13GS A;  3QFB C;  3ERG A;  1RW1 A;  4TR4 A;  2GT6 A;  1ACV A;  1SL2 B;  2JZR A;  2OBK A;  2B3S A;  2AV4 A;  2CA8 A;  3ZIJ A;  2FLS A;  3PIN A;  3LYP A;  1AAZ A;  1EEM A;  1PKW A;  2LV3 A;  2IMF A;  3VWU A;  5D73 A;  1F9M A;  1TRV A;  2H1D A;  1GUM A;  2DJ3 A;  2B1K A;  3MDK A;  3DKS A;  4ILF A;  5HFI A;  4NMU A;  5CRG A;  3E3E A;  4CY6 A;  3QD9 A;  5EVO A;  3TRQ A;  4WET A;  4N30 A;  2H6Y A;  2B7J A;  1SK0 A;  2FNO A;  4XS4 A;  2H71 A;  3GMF A;  1GSY A;  4POM A;  1FAA A;  5G5E A;  2O87 A;  2O85 A;  2HRK A;  3HVS A;  2ZNM A;  2PBJ A;  4XS1 A;  4IHU A;  3QCP A;  3CMI A;  1ZL9 A;  5ECH B;  6GSS A;  1JLV A;  3L0H A;  3ME7 A;  1U6T A;  3UJ1 A;  5CAX A;  2YOI A;  4YKF A;  3IV4 A;  2R0C A;  1I5G A;  1VF3 A;  3VI7 A;  4KDY A;  1VGL A;  3QPM A;  4MMM A;  4K8M A;  3C1R A;  1Z6M A;  4QQ7 A;  2FWG A;  4O5R A;  3SBC A;  1PX6 A;  2RM6 A;  1XWB A;  4TXV A;  4HZ4 A;  4I97 A;  5CNW A;  3KGK A;  4OCE A;  5E59 A;  4PNG A;  2QGV A;  1XZO A;  1WE0 A;  3M8N A;  2R3X A;  3LXZ A;  5G2Z A;  1TRS A;  1TOF A;  1OKD A;  1GH2 A;  3HVV A;  3GUS A;  18GS A;  4IEL A;  1WP0 A;  4ZIJ A;  4PGT A;  3M1G A;  4PUA A;  3TGZ A;  3HHV A;  5LNK e;  1PGT A;  1NW2 A;  3S9F A;  1QQ2 A;  1TKD B;  1XWK A;  3IBH A;  2VL2 A;  1LU4 A;  4FYC A;  3F8U A;  1RQM A;  4KH7 A;  2H1A A;  5G1L A;  2OJL A;  3F6F A;  1IYH A;  2C0G A;  4IGJ A;  3E0U A;  4ECC A;  2GSR A;  4LMW A;  5DBQ A;  2D2Z A;  4TVE A;  5CYY A;  3ZFB A;  2HXK A;  2VCW A;  4PUR A;  4DSR A;  2YJH A;  1YKC A;  2A4V A;  2BMX A;  1GUH A;  1YQ1 A;  3ISO A;  2KP1 A;  2BTO T;  2QA2 A;  3G7J A;  1BED A;  4LLR A;  5IQY A;  1PKZ A;  1FG4 A;  1QMV A;  1K0B A;  3V1W A;  4F0C A;  3A2W A;  5IMZ A;  2GDR A;  1XW6 A;  3EMP A;  1MEK A;  2XC2 A;  3BD2 A;  4MZC A;  3FY7 A;  2O89 A;  1TU8 A;  4BVX A;  2DJ1 A;  2XPD A;  3IHG A;  3FKF A;  1X5E A;  3D21 A;  8GSS A;  1GP1 A;  3H4K A;  4NAX A;  3MYD A;  2WJU A;  2H0H A;  1B8X A;  4IW9 A;  4O92 A;  5AIV A;  2JAC A;  1KBN A;  2V6O A;  5DQY A;  4K1F A;  5G5F A;  1DE2 A;  5A5K A;  1OC9 A;  4YAV A;  2C8U A;  2DML A;  2PU9 C;  3BCK A;  3IAS 2;  3ZIT A;  5H5S A;  1MDJ A;  1M7T A;  2IFQ A;  4EUY A;  2MMO A;  3IC4 A;  2OA7 A;  5ECP B;  4D73 A;  5DAL B;  3DWV A;  2R4V A;  3FW2 A;  3ZML A;  4NV5 A;  5KOW A;  3AY8 A;  3LSZ A;  3LQ7 A;  1G6Y A;  3A5I A;  1PMT A;  1BAY A;  1MD3 A;  5AIS A;  1DBY A;  2FGX A;  5DAK A;  3DML A;  1TDI A;  1XFL A;  2PUK C;  1FOV A;  2HRF A;  4TR0 A;  19GS A;  3HXS A;  4PTS A;  1S3A A;  2REM A;  2YJ7 A;  4JZQ A;  2A2S A;  4GWR A;  3TKS C;  1Z7P A;  1QFN A;  4CW9 A;  1XBS A;  1Z9H A;  2LST A;  1SJI A;  2L5L A;  4EXJ A;  1XVW A;  3QDN A;  1QK8 A;  5IMF A;  3CXG A;  2PER A;  1SKS B;  1ON4 A;  5DVB A;  2I81 A;  4K2D A;  2IN3 A;  1K0N A;  4DVC A;  3R2Q A;  4BL7 A;  2LJR A;  1O8X A;  2NDO A;  1X9S B;  1T1V A;  2L5O A;  2P5R A;  4OD7 A;  2ALB A;  5JWO B;  1CQH A;  2LQO A;  1O7U A;  5F07 A;  1GTI A;  5HR2 A;  4KX4 A;  4ZB6 A;  1XW5 A;  3QAW A;  1O81 A;  4EVM A;  4NPB A;  1UVZ A;  1USB A;  2FA4 A;  2L4Q A;  3Q74 A;  1A0R P;  4OFM A;  1M9B A;  2JZS A;  3F4T A;  2EIR A;  2G0F A;  2H76 A;  4DSQ A;  4AF2 A;  1F2E A;  2B7K A;  3DGQ A;  4GSN A;  1GUL A;  5KN1 A;  1YKA A;  4G10 A;  7GSS A;  5D9V A;  1A2J A;  1HYU A;  2KP2 A;  4ZL9 A;  2AAW A;  3KMN A;  2B5X A;  4I2T A;  3I6A A;  1PX7 A;  1MD4 A;  4PNF A;  2VIM A;  2IMK A;  3TKP A;  2B5Y A;  3ZYW A;  1AC1 A;  1PN0 A;  4XTS A;  5DCH A;  4J56 E;  1J08 A;  2QSI A;  4KCA A;  3APQ A;  4OO5 A;  4ZIL A;  4EIQ A;  1CQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...