1TS8A

Structure of the pr cis planar intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts8A00
3NOUC 3GDIA 1P97A 3LIDA 1OTAA 2VV7A 2W27A 3UB7A 4GCZA 5DJUA 3NJAA 1V9YA 3UE6A 5HSQA 3A0VA 4EEPA 5F6AA 4LRXC 5J7EA 3PYPA 3MQQA 1XFQA 1XJ4A 3H82A 2INWA 4R3AA 2PYRA 4HH3A 4JGPA 3IS2A 1T1BA 4I3JA 3ICYA 2PR6A 1GSWA 1S66L 2PD8A 4LRYC 1XJ3A 4NXBA 4HHDA 3BY8A 2I9VA 4WUJA 3VOLA 2QKPA 4XT2A 1D7EA 3LIAA 2L0WA 1LT0A 2P7JA 2Z6DA 4KUKA 3CAXA 2V0WA 4GW9A 3UMEA 2D02A 1UGUA 3E4OA 4HQAA 2JHEA 4LLOB 3CWFA 4GHIB 4I38A 3LIBA 4GHIA 1DP6A 3EWKA 5F68A 3T50A 2WKQA 2M1CA 4EQ1A 1LSVA 1UWNX 2ZOHA 4HI4A 3BY9A 5AVFA 3HJKA 5HZHA 3B33A 1LSXA 1S1ZA 4HJ3A 5HDDA 2WKRA 4BBUA 1NWZA 4EETB 4EXOA 3MFXA 1LL8A 1TS7A 5F69A 4KQDA 2HV1A 5DKLA 3A0RA 1S4RA 2PDRA 1OTDA 4HNBA 2GJ3A 3LUQA 2WKPA 2K7SA 4K08A 5HDCA 5A8BA 2L4RA 2QJ5A 1DP9A 2H28A 5J3WA 1T19A 3K3CA 4EERA 3FC7A 3H82B 4HP4A 2ZBBA 5F5YA 3GECA 3F1PB 3IS2B 1MZUA 2KDKA 2V9AA 3F1PA 2L1MA 3UMDA 2W0NA 1TS8A 1EW0A 2B02A 4F3LB 1F9IA 3ULFA 3CLOA 4RQ9A 4F3LA 1X0OA 4XT2B 1N9NA 4JGRA 4I3AA 1OT6A 2OWJA 5DJTA 3UB9A 3KX0X 5G4ZA 4L9FA 3UB8A 4MN6A 1BYWA 1ODVA 3H9WA 4EESA 1XFNA 4EEUA 2D01A 2QJ7A 4MN5A 4WF0A 1LSWA 2V0UA 4HIAA 2PYPA 4PKYA 5DKKA 1S1YA 3OLOA 1S4SA 2J80A 2QHKA 2V1BA 1XJ6A 3UB6A 3MJQA 3ZQ5A 3E4QA 2VEAA 4LPZA 4I5SA 3LYXA 3RTYA 5J4EA 4M4XA 4I3IA 1OJ5A 4HOIA 5EFWA 3NHQA 3LICA 4HH2A 5G4YA 2KX6A 3LIFA 5AVEA 3H7WB 3VE4A 3EEHA 3H7WA 4HJ4A 1TS6A 3K3DA 5KIZA 5IS1A 1VB6A 2OWHA 4BBVA 4GS9B 4JGQA 5TBMB 3PHYA 1T18A 4GS9A 1DRMA 5TBMA 1WA9A 5HD3A 1V9ZA 3MR0A 1GSXA 4YWZA 1S67L 4BBTA 2VV8A 1OTIA 4LRZE 2Z6CA 3BWLA 5HWTA 1OT9A 1KOUA 2EA9A 2R78A 4PKYG 3SW1A 1TS0A 4EW7A 4HJ6A 4NXEA 5HWVA 3MQOA 1P0ZA 1UWPX 3C2WA 4KUOA 4R38A 3RH8B 2JN7A 1OTBA 1XJ2A 4L9GA 4NXGA 4WLAA 4JGOA 3IBRA 4WN5A 3F1NB 2PD7A 3F1NA 1Y28A 2ZOIA 5IU1A 3FG8A 1D06A 3LIEA 3C8CA 1OTEA 2PR5A 3E4PA 3LI8A 3NOTC 4NXFA 5I5LA 3VE3A 1DP8A 1OJGA 3MXQA 5HWWA 2YKHA 4DJ3A 4L9EA 4I39A 2PHYA 4R6LA 3HJIA 4R70A 2VLGA 2V1AA 1JNUA 2YKFA 3F1OB 1GSVA 3A0SA 3P7NA 4E04A 1T1AA 3F1OA 2OOLA 4H6JB 1G28A 4H6JA 3D72A 2A24B 2A24A 5HDSA 2BASA 2VV6A 3LI9A 5HD5A 3G6OA 1N9LA 1T1CA 2CMNA 4B9OA 1F98A 4WL9A 3NOPC 1N9OA 4HY8A 4HP9A 4DJ2A 2QWSA
chains in the Genus database with same CATH superfamily
1HLUP 4B93A 3M6HA 2W27A 3I7JA 4KZ3A 3K2NA 4XUXA 1MBLA 4YNRA 3C7UA 2VGLS 3EQVA 3UE6A 4KZ9A 5FA7A 4Y2FA 4LRXC 3PYPA 1S6RA 5DFXA 3H82A 1RCJA 2PYRA 2XD5A 4JGPA 2XDMA 2PAVP 2PR6A 2XD1A 2PD8A 5HARA 5FQQA 3T4SA 4S2OA 3OBFA 3LFVA 4KZ8A 4DF6A 1YMXA 3LIAA 4Q0IA 1ALQA 4R0QA 3N8LA 3HLBA 1IEMA 3VP4A 1PFLA 1K57A 1MKIA 2V0WA 4GW9A 2R9WA 4KQQA 3P01A 3E4OA 2WKEA 1HD8A 4HQAA 2WZZA 5CHMA 3FKWA 1KVMA 3CWFA 1MWSA 2VA0A 4I38A 1ONGA 1PZPA 1ERQA 1XA7A 4NG2A 5DF9A 3CPTB 2J7VA 4E3KA 2WKQA 2X71A 2EWWA 3S7NA 3PBOA 2J3WA 3UE3A 1FCOA 1RGYA 2ZOHA 3ZDJA 3TE8A 4HI4A 5CTMA 4EBPA 5CHUA 5AVFA 1LSXA 4UQIS 4ARZA 4FH2A 3C7VA 4GOGA 3S7OA 3BQAA 5HDDA 2O0YA 2ZL1A 4S2NC 1NWZA 2X02A 4EV4A 2PBYA 1SKOB 4FTXA 3A0RA 4UA7A 5EVIC 1OTDA 1YLYA 2Z2MB 4MN7A 2WKPA 5F83A 1A0KA 3WWXA 2L4RA 1DP9A 3JVVA 4KZAA 2X01A 5AJGA 5K5BA 2QYBA 2EWVA 4B88A 3G2YA 3ZG5A 3H82B 4DDSA 2Q9NA 2ZBBA 3HLFA 2B18A 3Q7ZA 4H8RA 3GECA 3F1PB 5HL6A 3MXSA 2KDKA 3UE0A 3W2ZA 3KSFA 2CC1A 3SZTA 3G4PA 5DTTA 4GB7A 1EROA 2JKRM 3WRTA 1F9IA 4WMCA 5AQAA 3CLOA 3ZGAB 2HDUA 1X0OA 4ZBEA 1K6RA 1Q2QA 3IQAA 5DFYA 3TRCA 3P09A 2OWJA 3LR0A 4PMAA 4Y13A 1STZA 5FSRA 3UDXA 3UB8A 1SHVA 3GV9A 5HPIA 1G68A 4UAAA 2VX8A 3R4KA 3H9WA 4EESA 4Y0OA 4EEUA 2V0UA 1BLCA 5L2FA 5EM0A 2RL3A 4GKUA 4JF4A 2Y55A 1YLZA 4KZ6A 4UHUA 3PBNA 5AQBA 1K25A 3KYZA 2V1BA 2WKIA 1YT4A 4E3OA 3UDFA 3BLMA 4LPZA 2WGWA 3UPPA 2HDRA 3BECA 2ZQCA 3LICA 4HBTA 4JXSA 3H7WB 4OPYA 3EEHA 4M3KA 4IHQA 1PI5A 1MWUA 3C5AA 2Q0OA 2O9BA 3O86A 5HX9A 3CZDA 3E2LA 2Y2IA 4BBVA 3GR2A 4X68A 3VOYA 1KGEA 3DTIA 2J3TC 2C6WB 5EVID 5HD3A 3IWQA 3Q1FA 2JE5A 3MR0A 4KG6A 4P6ZM 1H8MA 3VOZA 3N4IA 1W8QA 4R1GA 2ZQ8A 3LR3A 1ES4A 3NY4A 3PBTA 4MDZA 2HJEA 5FQIA 2EA9A 1FILA 4DKIA 3CJMA 2XH9A 2R78A 3NULA 4BMWA 3KO6A 1TS0A 2WYXA 3EGXC 5L8MA 1KE3A 4NXEA 4QU3A 2W3GA 5HWVA 4O7DA 4EU0A 5F1FA 4JXVA 4KG2A 4IVIA 4E3IA 2E8IA 3C2WA 3KYEA 4PM9A 1L0DA 4QB8A 3ZYTA 4JKTA 3MFDA 3VP2A 5CERA 5A91A 4WN5A 2XROA 1WYCA 5EOOA 2H10A 4X25A 3LIEA 3IWOA 1XX2A 1OTEA 1YLTA 2FFFB 4G3KA 3NOTC 1W79A 1Z09A 1DJBA 3C30A 4NXFA 3V67A 3VE3A 1GCEA 4LV2A 1OJGA 3QP8A 3TSGA 4S2NA 1VHMA 3T4KA 1H0MA 4KENB 4DN0A 4GNUA 1ESIA 4EUZA 2WGWB 2Y8HA 4IBXA 1J3WA 4OPQA 4DE1A 4CLCB 5EVIA 2H0TA 4WYYA 1YAXA 4R4SA 1K57C 2V1AA 5CRFA 3T1SA 5FQ9A 1C3BA 3HLEA 3Q81A 3T4TA 1BULA 1YSQA 1GSVA 5M18A 1CI8A 1K4FA 3O3VA 4H6JB 2A24B 3CI6A 4OOYA 3T1XA 4C3QA 1TVFA 2BASA 2VZWA 5HDSA 3GRJA 4B9OA 1LI9A 3V3SA 3N7WA 3IBJA 1F98A 2EXAA 3NOPC 2J3TD 2FZ0A 4Q0JA 1VEUB 4ETZA 4L0LA 5FEFA 3LIDA 2W3HA 4GCZA 3NJAA 2WAFA 1BUEA 5FAOA 5HSQA 4EWFA 5AQ7A 2HDSA 5F6AA 1TEMA 2HJ9C 1XFQA 3HL9A 1JWZA 4QPRA 2INWA 4R3AA 1T1BA 3ICYA 4LV3A 4II7A 3A3JA 4LRYC 2B5RA 5A90A 3UB5P 3IH8A 1IELA 3T4OA 1D7EA 2Y2HA 1CK3A 4UA9A 2L0WA 4FUWA 4BL3A 2GNXA 5IHVA 2BG1A 3RFBA 1K56D 2P7JA 3VSLA 1PYYA 5DF7A 5DVAA 1SDEA 4KUKA 3G30A 4MBKA 1UGUA 1CEGA 3M6BA 4MBFA 3EOIA 1PWCA 1TF1A 5FI6A 5C5KA 4O01A 3SOIA 4DXBA 5HFOA 1TDGA 3PR6A 3LIBA 1XKZA 4ZJ2A 2P04A 4Y7PA 1DP6A 2VGLM 1PW8A 3CPTA 2EX2A 1ZG4A 2Y2QA 2M1CA 3IT9A 4EQ1A 1L0FA 5CHJA 3E2KA 3BY9A 4GZBA 5HZHA 3B33A 1S1ZA 1ZG6A 4KZ4A 2WZXA 4OQGA 4IUKA 1SZVA 2WKRA 3A3DA 2ZC7A 3QP4A 2DMWA 4WEJA 1WYBA 4E3NA 1RP5A 4MNRA 2XA7S 4FSFA 1TS7A 5F69A 4KQDA 2PDRA 2HPBA 4ZDXA 3IF6A 3LUQA 4CLCC 4XUZA 3W8KA 1LLBA 2EFXA 2P08A 3G32A 1T19A 3K3CA 4EERA 3D4FA 1GHIA 4PM6A 3ISGA 5GL9A 3DW0A 1F2KA 3CMZA 3OCNA 1K56A 4MLLA 3UY6A 2OAP1 2ZM0A 4X53A 2V9AA 3F1PA 3KSIA 3UMDA 4ZRRA 5CXWA 4OLDA 2W1RA 2DCFA 5FAQA 4HEFA 3BM6A 2W3EA 3B42A 1Y54A 4JGRA 4UQIM 4HESA 5DJTA 4EBNA 3KX0X 3T4LA 3ZHHA 3UPNA 3BW6A 1S0WA 2V2FF 5DF8A 5TR7A 1FCNA 1XFNA 3WS0A 1XGIA 3JVUA 2QZ6A 4G3VA 2W3DA 4MN5A 4WF0A 3MF0A 2Y2OA 2GZAA 4HIAA 4WMCD 3HLWA 3ZNTA 4F94A 5DKKA 3IHBA 4CLCE 5TFQA 1OPXA 3S7QA 4MCWA 3LGOA 4WEKA 2XSSA 3VP1A 3FPWA 1ZTUA 1Y4OA 3UB6A 3PTEA 4DMZA 3MJQA 3E4QA 5J8XA 3L7HA 1E25A 3A3IA 2HDQA 2VEAA 3V50A 4JF6A 4I5SA 5MC7A 3LYXA 3RTYA 5FEGA 2BLSA 1KDWA 1OJ5A 4IEDA 3G31A 4OONA 4OLGA 1K6SA 5FQKA 2OLVA 3ZNYA 3HREA 3BFEA 4S2IA 3H7WA 5F1GA 1ERMA 3T1RA 4Z1WA 1DY6A 1SKFA 1TS6A 2WGVA 3IF6B 4Y15A 1ZHHB 5IS1A 3ZFZA 3BEBA 1NLZA 1IKIA 4GS9B 4JGQA 2ZMVA 3PHYA 1MC0A 4OP5A 3CG5A 3UO9A 4BLMA 1IOUA 4S2JA 3SS5A 4GDNA 1V9ZA 4YWZA 4JLFA 1MPLA 3HLCA 3NBLA 1S67L 5GHXA 4MMNA 3E98A 1YM1A 3DTEA 5CGWA 5HPFA 1H8ZA 1OTIA 4LRZE 4GN2A 4ZTKA 1KOUA 3IX3A 1BT5A 2XGNA 3DAVA 3V3RA 2PBDP 2VK3A 3SW1A 1IYOA 4QWOA 2JKTI 4X1MA 3TG9A 2LB9A 4BD0A 4DXCA 3Q7VB 1P0ZA 1SCWA 5CTNA 5D3OA 4KUOA 1ZKJA 4QY6A 2BTFP 4R38A 1I2WA 4N9LA 3AGFA 1W63Q 3LR5A 4LCLA 3IBRA 2HP9A 3B3XA 3F1NB 3FPVA 2PD7A 3VFHA 3VFFA 2ZOIA 4PM5A 4NKPA 3C8CA 3LEQA 3E4PA 2ZC6B 2HGVA 1KE4A 5I5LA 4JF5A 3HUMA 4S2MA 4E3MA 3JPUA 2YKHA 2ZQ7A 3ITBA 4BENA 1PIOA 3PAGA 2ZM2A 4K0WA 1NYYA 2WADA 2PHYA 4OKPA 3HUNA 4DE2A 2XQZA 1PWDA 4R70A 1CQAA 4CLCA 1JNUA 2YKFA 2OSUA 1KE0A 3F1OB 4ID4A 4NETA 2M7UA 2V20A 4E04A 4U3TA 2HZ5A 4AFIA 2OOLA 4OH0A 1KGFA 5FQMA 2DRWA 4H6JA 4D60A 2J8YA 1F5MA 2EX6A 1NRJA 5KSCA 2A24A 3CITA 5EM1A 3T4JA 3MMHA 3LI9A 3G6OA 1N9LA 4GLQA 5TJJA 1H3QA 4Z9QA 4BD1A 3QP5A 5HAQA 4CJNA 4CQHA 1DJCA 2FFYA 5GLAA 1N9OA 5CX7A 4HY8A 2WKHA 3S4XA 3OPPA 4X55A 2QWSA 1VEUA 3NOUC 2ZD8A 3PBRA 4GD6A 2VKSA 4R4RA 1OTAA 2VV7A 3UB7A 3HUOA 1V9YA 3TOIA 1HVBA 2G7UA 3DTMA 3A0VA 4EEPA 3SH9A 3IF6C 3VP0A 1XJ4A 1NJ4A 3C4PA 4Q0HA 1PW1A 3IS2A 3Q82A 1L3LA 3NDGA 3LO7A 2A49A 2W1TA 1XJ3A 2Y2KA 4NXBA 4WZ4A 4HHDA 3G34A 5CEBA 3IXHA 5I94A 2I9VA 4S2KA 3VOLA 5E43A 4LCMA 2H5SA 2QKPA 3MKFA 4S2PA 4OPRA 3O88A 2ACGA 5IT5A 4U0TA 2J9OA 4OVDA 4DRTA 2Z6DA 5FI2A 2K2NA 2NUTC 4P0MA 3CAXA 5GLCA 2JHEA 1K4EA 2KLIA 5KMWA 4P87A 1L0GA 4LLOB 4WBGA 4EUVA 4GHIB 5EOEA 3QNBA 1WE4A 3NCKA 2JKRI 1EI5A 5E2GA 3UNWA 5E2EA 3MZEA 5EUAA 5FASA 3T50A 1GA0A 4Y0UA 3C38A 1YLPA 1LSVA 1UWNX 3BYDA 4KZBA 2WGIA 3S22A 2E8JA 1AXBA 1LI0A 2O9CA 5DTKA 2VJWA 1H5XA 3BFFA 1XP4A 4EXOA 3IXGA 2HV1A 4FCFA 3R7WB 5DKLA 4R23A 1S4RA 4HNBA 2VGKA 3OPHA 3ZVTA 1NY0A 1E3UA 3HBRA 4KQOA 2K7SA 4HBUA 3O5YA 1BTLA 3BFGA 5A8BA 4Y17A 2H28A 3GMWA 2K31A 2RCXA 5EV0A 5M1AA 5M19A 3FC7A 3HCYA 2ZJ9A 4HP4A 4JXWA 4Y0TA 3NC8A 5F5YA 3WS2A 1IFQA 3IS2B 3W4PA 4C75A 1MZUA 5DTSA 1G5UA 2W1TB 4D2OA 2GDNA 1EW0A 4F3LB 2PT7A 3MSHA 3ULFA 5FQJA 3U4LP 1VQQA 4RQ9A 3W4OA 4KQRA 4OQ0A 2O9AA 4ZAMA 1N9NA 2XR0A 1YQSA 2Q9MA 2Y2NA 5LBRA 1OT6A 3UB9A 3LCEA 4RVAA 4ETXA 4Y3IA 4QY5A 1VETB 1OMEA 1G6OA 1BYWA 3KSGA 2XA7M 2PU2A 3QNCA 2D01A 2QJ7A 1P9WA 1TD5A 1L2SA 1LSWA 3LY3A 4OPZA 4LFUA 1S1YA 4BWIA 1GHPA 1S4SA 1YMSA 4N1HA 2QHKA 4ME4A 5GHYA 4GD8A 4LV1A 1XPBA 5J4EA 5KZHA 5HAIA 4I3IA 3PBSA 3MBZA 5EFWA 4OQIA 3NHQA 4HH2A 3WRZA 1KGGA 4OOLA 2OV5A 4BQMA 3HLDA 3GQZA 2IWDA 4HJ4A 3K3DA 2JKTM 3UPOA 2EX8A 2P74A 2OWHA 3MXRA 1YLJA 5TBMB 2ZQDA 3N8SA 3S7PA 4GS9A 1DRMA 3P98A 1ES2A 1FR1A 4OOMA 1M40A 2XLNA 1CI9A 1U60A 5EVEA 4ESPA 2Y59A 2V8FA 4LGWA 5A92A 4N9KA 3IF5A 2JKGA 2VV8A 3CUEC 1XXMA 5L10A 3ZVWA 3MS6A 5HWTA 1D1JA 3TW8A 1NXYA 4KZ7A 4EW7A 1NYMA 4IVKA 1Z6FA 3IWIA 3MQOA 2A2LA 1XGJA 3QP1A 3Q7VA 3DTKA 3RH8B 2XK1A 4R3JA 1LL9A 4WLAA 2MJ6A 1L0EA 4P6BA 2M7VA 2ZMFA 1FCMA 3F1NA 3FG8A 2IA2A 3ZCZA 5FDSA 3IHAA 3OPRA 4UEYA 2LB5A 3B47A 1YSPA 4GJ4A 2ZMAA 2PR5A 5E2HA 3LEZA 1ESUA 4EBLA 4PHTA 2W3FA 4A5RA 3TJZC 3BRMA 1SDNA 4BL2A 2Y2MA 2Y2GA 1FSYA 2WK0A 3MXQA 5HWWA 4DJ3A 3Q07A 4L9EA 2XFTA 3BQ8A 1RGZA 3IX4A 4IJGA 4QJGA 4DE3A 2PU4A 4R6LA 4UA6A 3HJIA 1MY8A 2VLGA 2ZLYA 4JXGA 4C6YA 1CF0A 5EE8A 1O07A 3A0SA 3P7NA 3T4QA 2QMIA 3F1OA 1PRQA 1E4DA 1JVJA 1G28A 2P9VB 1I5QA 3DWKA 3GTCA 3FYZA 2VV6A 5HD5A 1N9BA 4MEZA 4OQHA 5HW3A 3VP3A 3LY4A 4X56A 5CECA 1K55A 4BJPA 4X69A 5FDHA 4CLCD 4WL9A 3ZG0A 3SS4A 3SH7A 4K91A 4HP9A 2I72A 4P85A 3GDIA 5A93A 3E0YA 1P97A 1JWPA 4NEED 4YFMA 1K54C 4JPMA 5DJUA 2WUQA 3BLSA 4CPKA 1Q2PA 2EX9A 3S1YA 5EVLA 2FH5A 3CHWP 2J9PA 1BLSA 5J7EA 3MQQA 5FAPA 1PWGA 2PRFA 2QPNA 3NIAA 4FH4A 3ZG7B 3SH8A 3RJUA 4Y5FA 4HH3A 4I3JA 1GSWA 1S66L 4WZ5C 2XRNA 4QHCA 2IWCA 1LHYA 4FD8A 2Y4AA 3BY8A 1H8YA 5JYPA 4WUJA 3HLGA 3U2AA 2Y79A 3OCLA 4XT2A 1AWIA 1KDSA 4DE0A 3AGDA 1LT0A 4E3JA 1BZAA 5FATA 1NRFA 3VSKA 3OPLA 3UMEA 4XXRA 2VGJA 3WS5A 2D02A 3O87A 4RX2A 5GHZA 4B4ZA 1IYQA 3W4QA 4RA7A 3A3FA 3AGEA 4JBFA 2O99A 2XEPA 5HAPA 1ES3A 4EQIA 5TGFA 4GHIA 4K0XA 3EWKA 5F68A 3M2KA 2ZQAA 5AQ9A 3QP6A 2V8CA 3GSGA 3JYIA 2G2WA 3EGDC 4E6WA 3ITAA 4ARZB 3HJKA 1W7FA 4S2LA 1IKGA 4HJ3A 2ZL1B 3KYQA 3CUEA 5JYOA 1XA1A 5F82A 4BBUA 3BJNA 4EETB 3MFXA 1G6AA 3UDIA 1LL8A 3OZHA 5U47A 3MQ0A 4MBHA 3RXWA 5EPHA 3UE1A 2GJ3A 3R7WA 3VV4A 3MKEA 4K08A 5HDCA 3VMAA 2QJ5A 1FSWA 2AVXA 3SS3A 2XF3A 1FQGA 5J3WA 3MZDA 2ZQ9A 2DNSA 2G2UA 1ONHA 2XFSA 4O0PA 5G18A 4E3LA 3RXXA 2V1ZA 1FR6A 2A3UA 4WM9A 2L1MA 1E3UD 2W0NA 3PXPA 4PM8A 1TS8A 1NLYA 4LV0A 2B02A 4PPRA 2GX5A 4B4XA 1NZOA 1QMFA 4F3LA 2ZM8A 2B95A 4XT2B 1GHMA 5FI7A 2UV0E 5EECA 3IX8A 4I3AA 3BFDA 5G4ZA 1KVLA 4L9FA 1QMEA 1PI4A 1IYPA 4PAUA 4MN6A 1VETA 1ODVA 1YKDA 4X1LA 3IH9A 1K0KA 4P6ZS 2PYPA 2KOIA 4PKYA 4N92A 1MXOA 3OLOA 1CJFA 5KSHA 4KZ5A 1YPRA 4RYEA 3OOVA 4U0XA 2J80A 4X6TA 3DWZA 2JBFA 1XJ6A 3PBQA 1N4OA 3ZQ5A 1ZC2A 1TDLA 4ZJ3A 2NUPC 4M4XA 4O8GA 2Z2LB 3MZFA 4DDYA 1YLWA 4HOIA 4YINA 5G4YA 1W5DA 4GDBA 3HVFA 1P9RA 2EFUA 2KX6A 3LIFA 1BLPA 1K54A 5AVEA 3VE4A 3FZCA 3L9KA 3KSHA 3PAEA 1O7EA 2JKFA 3DBAA 5KIZA 3FV7A 1VB6A 3ZG8B 2ZC5B 2ZC3B 1T18A 3BFCA 1PZOA 4RX3A 5TBMA 3EEAA 3FWLA 3IXDA 4ZJ1A 1WA9A 2H0YA 4KG5A 3EQUA 4IUHA 3M2JA 1GSXA 1FOFA 4WZ5A 3GVBA 1DJAA 1K38A 4BBTA 5L09A 3ZG9B 1IYSA 2WAEA 4IBRA 4NK3A 2Z6CA 3BWLA 1K55C 1OT9A 3NI9A 2EXBA 4PKYG 1JTDA 3T12B 5FL3A 2UWXA 3WS1A 4HJ6A 2ZC4B 3OC2A 3T1QB 5CGXA 4FOFA 1UWPX 3D9YA 1PNEA 2JN7A 1OTBA 1XJ2A 4L9GA 4NXGA 4JGOA 2Y2PA 2R9XA 1FIKA 3V39A 1M6KA 1Y28A 5IU1A 1CEFA 2Y2JA 1D06A 3WS4A 1BLHA 3LR4A 3NDEA 4N1XA 5HL1A 3FKVA 3LI8A 1LL5A 3V5MA 5BOHA 2OLUA 3A3EA 1J9MA 2C5WB 1DP8A 3UN7A 2IWBA 2JCHA 4YOFA 3D3OA 4QD4A 4I39A 5L07A 1W63M 4LENA 5EVIB 4PM7A 4R3BA 1MKMA 3QHYA 2Y2LA 5GLBA 3IXBA 1ACFA 3C4OA 3QP2A 3G35A 1T1AA 1EWZA 4Q8IA 1I2SA 3D72A 1JTGA 1BSGA 1JWVA 2HP6A 1MWRA 2JC7A 2P9VA 1NZUA 1W8YA 1ES5A 5GLDA 1T1CA 2CMNA 4WELA 1HTZA 4OP8A 5E2FA 2Y91A 3N8RA 4G3WA 5CEDA 1HZOA 3G2ZA 3NECA 4E6XA 1MWTA 2HF6A 1VM1A 2OAQ1 2HP5A 1GA9A 3N6IA 5CGSA 4DJ2A 1SKOA
chains in the Genus database with same CATH topology
3NOUC 4B93A 3GDIA 4ETZA 3E0YA 4L0LA 1P97A 3PBRA 3LIDA 2VKSA 1OTAA 4NEED 2VV7A 2W27A 3UB7A 2W3HA 4GCZA 3K2NA 5DJUA 3NJAA 4YNRA 1V9YA 2VGLS 3EQVA 3UE6A 5HSQA 2G7UA 2FH5A 3A0VA 4Y2FA 5F6AA 4EEPA 4LRXC 5J7EA 3PYPA 2HJ9C 3MQQA 1XFQA 1XJ4A 5DFXA 3H82A 4QPRA 2INWA 4R3AA 2PYRA 4Y5FA 4Q0HA 4HH3A 4JGPA 3IS2A 1T1BA 4I3JA 3ICYA 2PR6A 1GSWA 4II7A 1S66L 2PD8A 2W1TA 4LRYC 1XJ3A 2XRNA 4NXBA 3T4SA 4HHDA 3BY8A 2I9VA 4WUJA 3OBFA 3VOLA 3U2AA 3LFVA 2QKPA 2Y79A 3OCLA 4XT2A 3T4OA 1D7EA 3LIAA 5IT5A 4Q0IA 2L0WA 2GNXA 1LT0A 3RFBA 2P7JA 2Z6DA 2K2NA 2NUTC 4KUKA 3CAXA 2V0WA 4GW9A 3UMEA 2D02A 3P01A 1UGUA 3E4OA 4HQAA 2JHEA 3EOIA 2KLIA 1TF1A 5C5KA 4O01A 4LLOB 3CWFA 2O99A 4EUVA 2VA0A 4GHIB 4I38A 3PR6A 3LIBA 4GHIA 2JKRI 2P04A 1DP6A 3EWKA 5F68A 2VGLM 5DF9A 3T50A 2WKQA 3S7NA 2EWWA 3PBOA 2J3WA 2M1CA 3C38A 4EQ1A 3EGDC 1LSVA 1UWNX 3UE3A 2ZOHA 3TE8A 4HI4A 3BY9A 4ARZB 5AVFA 3HJKA 5HZHA 3B33A 1LSXA 1S1ZA 4HJ3A 4UQIS 4ARZA 4IUKA 3BQAA 3S7OA 5HDDA 2O0YA 2O9CA 2WKRA 3CUEA 3KYQA 2VJWA 4BBUA 1NWZA 2DMWA 3BJNA 4WEJA 4EETB 4EXOA 3MFXA 2XA7S 4FSFA 1LL8A 1TS7A 5F69A 4KQDA 2HV1A 3MQ0A 3R7WB 5DKLA 3A0RA 1S4RA 2PDRA 1OTDA 4HNBA 2GJ3A 3R7WA 4MN7A 3LUQA 4CLCC 3VV4A 2WKPA 4KQOA 2K7SA 3O5YA 4K08A 5HDCA 5A8BA 2L4RA 2QJ5A 1DP9A 3JVVA 2P08A 2H28A 5AJGA 5K5BA 5J3WA 2K31A 1T19A 2QYBA 3K3CA 2EWVA 4EERA 3FC7A 4O0PA 3H82B 3HCYA 4HP4A 2ZBBA 2B18A 3OCNA 5F5YA 1IFQA 3GECA 3F1PB 3IS2B 5HL6A 2OAP1 1MZUA 2KDKA 3W2ZA 2V9AA 3F1PA 3KSFA 3KSIA 2L1MA 3UMDA 2W0NA 2W1TB 3PXPA 1TS8A 4ZRRA 2JKRM 1NLYA 1EW0A 2B02A 2W1RA 4F3LB 1F9IA 2GX5A 2PT7A 3ULFA 3CLOA 4RQ9A 4F3LA 1X0OA 2W3EA 3B42A 4XT2B 2O9AA 1N9NA 4JGRA 5DFYA 4I3AA 3TRCA 5LBRA 4UQIM 1OT6A 2OWJA 3LR0A 5DJTA 3UB9A 3KX0X 5G4ZA 3T4LA 4L9FA 4ETXA 4Y3IA 1STZA 3BW6A 4PAUA 3UB8A 4MN6A 1G6OA 5HPIA 1BYWA 1ODVA 1YKDA 2VX8A 3KSGA 2XA7M 4P6ZS 3R4KA 3H9WA 4EESA 1XFNA 3JVUA 4EEUA 2D01A 4G3VA 2W3DA 2QJ7A 4MN5A 1P9WA 1TD5A 4WF0A 3MF0A 1LSWA 2V0UA 2GZAA 4HIAA 2PYPA 2KOIA 4PKYA 5DKKA 1S1YA 3OLOA 4BWIA 5KSHA 4CLCE 1OPXA 3S7QA 1S4SA 4MCWA 3OOVA 2J80A 3PBNA 4WEKA 2XSSA 3KYZA 3FPWA 2QHKA 2V1BA 1XJ6A 1ZTUA 3PBQA 4ME4A 3UB6A 4DMZA 3MJQA 3ZQ5A 3E4QA 2VEAA 4LPZA 4I5SA 5MC7A 3LYXA 3RTYA 5J4EA 2NUPC 4M4XA 4I3IA 1OJ5A 4O8GA 3PBSA 4HOIA 5EFWA 3NHQA 3LICA 4HH2A 5G4YA 1P9RA 2KX6A 3LIFA 5AVEA 3H7WB 3VE4A 3EEHA 3H7WA 4OOLA 4IHQA 3KSHA 4HJ4A 4Z1WA 1TS6A 3K3DA 2JKTM 3DBAA 5KIZA 2O9BA 1ZHHB 5IS1A 1VB6A 2OWHA 1NLZA 4BBVA 4GS9B 4JGQA 5TBMB 2ZMVA 3PHYA 1MC0A 1T18A 3S7PA 4GS9A 1DRMA 2J3TC 5TBMA 3EEAA 1WA9A 5HD3A 1IOUA 3EQUA 1V9ZA 4IUHA 4OOMA 3MR0A 1GSXA 4YWZA 4P6ZM 1H8MA 1S67L 4BBTA 4MMNA 3E98A 2VV8A 3LR3A 3CUEC 3PBTA 4MDZA 5HPFA 1OTIA 2HJEA 2Z6CA 3BWLA 4LRZE 1OT9A 5HWTA 1KOUA 2EA9A 3TW8A 2R78A 4PKYG 5FL3A 4BMWA 3KO6A 3SW1A 1TS0A 4EW7A 4HJ6A 3EGXC 5L8MA 2JKTI 4NXEA 2W3GA 5HWVA 3OC2A 2LB9A 4EU0A 3MQOA 2A2LA 1P0ZA 1UWPX 4FOFA 3C2WA 4KUOA 4R38A 3RH8B 2JN7A 1OTBA 1W63Q 3ZYTA 3LR5A 1XJ2A 4L9GA 4NXGA 4WLAA 4JGOA 2MJ6A 3IBRA 4WN5A 2M7VA 2XROA 3F1NB 3FPVA 2ZMFA 2PD7A 3F1NA 1Y28A 2ZOIA 5IU1A 3FG8A 2IA2A 1D06A 3LIEA 4NKPA 3C8CA 2LB5A 4UEYA 3B47A 1YSPA 4GJ4A 1OTEA 3LR4A 2PR5A 3E4PA 3LI8A 4G3KA 2HGVA 3NOTC 3V67A 4NXFA 3C30A 4PHTA 5I5LA 2W3FA 3TJZC 3VE3A 1DP8A 1OJGA 3MXQA 5HWWA 2YKHA 4DJ3A 1VHMA 3T4KA 4DN0A 4YOFA 3D3OA 4L9EA 4I39A 3BQ8A 2Y8HA 4IJGA 1W63M 2PHYA 4R6LA 3HJIA 4CLCB 1MKMA 4R70A 2VLGA 1YAXA 2V1AA 1JNUA 4CLCA 2YKFA 3T4TA 1YSQA 3F1OB 1GSVA 3A0SA 3P7NA 2M7UA 3T4QA 4E04A 4AFIA 1T1AA 3F1OA 2OOLA 4H6JB 1G28A 4H6JA 3D72A 2A24B 3CI6A 1F5MA 1NRJA 2A24A 3CITA 3T4JA 5HDSA 2BASA 2VZWA 3MMHA 2VV6A 3LI9A 5HD5A 3G6OA 1N9LA 4GLQA 1T1CA 2CMNA 5TJJA 4WELA 4G3WA 1H3QA 4B9OA 4BJPA 4CLCD 2HF6A 3IBJA 1F98A 4WL9A 4CQHA 3NOPC 2J3TD 1N9OA 5CX7A 2FZ0A 2OAQ1 4HY8A 4Q0JA 4HP9A 4DJ2A 2QWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOU C;  3GDI A;  1P97 A;  3LID A;  1OTA A;  2VV7 A;  2W27 A;  3UB7 A;  4GCZ A;  5DJU A;  3NJA A;  1V9Y A;  3UE6 A;  5HSQ A;  3A0V A;  4EEP A;  5F6A A;  4LRX C;  5J7E A;  3PYP A;  3MQQ A;  1XFQ A;  1XJ4 A;  3H82 A;  2INW A;  4R3A A;  2PYR A;  4HH3 A;  4JGP A;  3IS2 A;  1T1B A;  4I3J A;  3ICY A;  2PR6 A;  1GSW A;  1S66 L;  2PD8 A;  4LRY C;  1XJ3 A;  4NXB A;  4HHD A;  3BY8 A;  2I9V A;  4WUJ A;  3VOL A;  2QKP A;  4XT2 A;  1D7E A;  3LIA A;  2L0W A;  1LT0 A;  2P7J A;  2Z6D A;  4KUK A;  3CAX A;  2V0W A;  4GW9 A;  3UME A;  2D02 A;  1UGU A;  3E4O A;  4HQA A;  2JHE A;  4LLO B;  3CWF A;  4GHI B;  4I38 A;  3LIB A;  4GHI A;  1DP6 A;  3EWK A;  5F68 A;  3T50 A;  2WKQ A;  2M1C A;  4EQ1 A;  1LSV A;  1UWN X;  2ZOH A;  4HI4 A;  3BY9 A;  5AVF A;  3HJK A;  5HZH A;  3B33 A;  1LSX A;  1S1Z A;  4HJ3 A;  5HDD A;  2WKR A;  4BBU A;  1NWZ A;  4EET B;  4EXO A;  3MFX A;  1LL8 A;  1TS7 A;  5F69 A;  4KQD A;  2HV1 A;  5DKL A;  3A0R A;  1S4R A;  2PDR A;  1OTD A;  4HNB A;  2GJ3 A;  3LUQ A;  2WKP A;  2K7S A;  4K08 A;  5HDC A;  5A8B A;  2L4R A;  2QJ5 A;  1DP9 A;  2H28 A;  5J3W A;  1T19 A;  3K3C A;  4EER A;  3FC7 A;  3H82 B;  4HP4 A;  2ZBB A;  5F5Y A;  3GEC A;  3F1P B;  3IS2 B;  1MZU A;  2KDK A;  2V9A A;  3F1P A;  2L1M A;  3UMD A;  2W0N A;  1TS8 A;  1EW0 A;  2B02 A;  4F3L B;  1F9I A;  3ULF A;  3CLO A;  4RQ9 A;  4F3L A;  1X0O A;  4XT2 B;  1N9N A;  4JGR A;  4I3A A;  1OT6 A;  2OWJ A;  5DJT A;  3UB9 A;  3KX0 X;  5G4Z A;  4L9F A;  3UB8 A;  4MN6 A;  1BYW A;  1ODV A;  3H9W A;  4EES A;  1XFN A;  4EEU A;  2D01 A;  2QJ7 A;  4MN5 A;  4WF0 A;  1LSW A;  2V0U A;  4HIA A;  2PYP A;  4PKY A;  5DKK A;  1S1Y A;  3OLO A;  1S4S A;  2J80 A;  2QHK A;  2V1B A;  1XJ6 A;  3UB6 A;  3MJQ A;  3ZQ5 A;  3E4Q A;  2VEA A;  4LPZ A;  4I5S A;  3LYX A;  3RTY A;  5J4E A;  4M4X A;  4I3I A;  1OJ5 A;  4HOI A;  5EFW A;  3NHQ A;  3LIC A;  4HH2 A;  5G4Y A;  2KX6 A;  3LIF A;  5AVE A;  3H7W B;  3VE4 A;  3EEH A;  3H7W A;  4HJ4 A;  1TS6 A;  3K3D A;  5KIZ A;  5IS1 A;  1VB6 A;  2OWH A;  4BBV A;  4GS9 B;  4JGQ A;  5TBM B;  3PHY A;  1T18 A;  4GS9 A;  1DRM A;  5TBM A;  1WA9 A;  5HD3 A;  1V9Z A;  3MR0 A;  1GSX A;  4YWZ A;  1S67 L;  4BBT A;  2VV8 A;  1OTI A;  4LRZ E;  2Z6C A;  3BWL A;  5HWT A;  1OT9 A;  1KOU A;  2EA9 A;  2R78 A;  4PKY G;  3SW1 A;  1TS0 A;  4EW7 A;  4HJ6 A;  4NXE A;  5HWV A;  3MQO A;  1P0Z A;  1UWP X;  3C2W A;  4KUO A;  4R38 A;  3RH8 B;  2JN7 A;  1OTB A;  1XJ2 A;  4L9G A;  4NXG A;  4WLA A;  4JGO A;  3IBR A;  4WN5 A;  3F1N B;  2PD7 A;  3F1N A;  1Y28 A;  2ZOI A;  5IU1 A;  3FG8 A;  1D06 A;  3LIE A;  3C8C A;  1OTE A;  2PR5 A;  3E4P A;  3LI8 A;  3NOT C;  4NXF A;  5I5L A;  3VE3 A;  1DP8 A;  1OJG A;  3MXQ A;  5HWW A;  2YKH A;  4DJ3 A;  4L9E A;  4I39 A;  2PHY A;  4R6L A;  3HJI A;  4R70 A;  2VLG A;  2V1A A;  1JNU A;  2YKF A;  3F1O B;  1GSV A;  3A0S A;  3P7N A;  4E04 A;  1T1A A;  3F1O A;  2OOL A;  4H6J B;  1G28 A;  4H6J A;  3D72 A;  2A24 B;  2A24 A;  5HDS A;  2BAS A;  2VV6 A;  3LI9 A;  5HD5 A;  3G6O A;  1N9L A;  1T1C A;  2CMN A;  4B9O A;  1F98 A;  4WL9 A;  3NOP C;  1N9O A;  4HY8 A;  4HP9 A;  4DJ2 A;  2QWS A; 
#chains in the Genus database with same CATH topology
 1HLU P;  4B93 A;  3M6H A;  2W27 A;  3I7J A;  4KZ3 A;  3K2N A;  4XUX A;  1MBL A;  4YNR A;  3C7U A;  2VGL S;  3EQV A;  3UE6 A;  4KZ9 A;  5FA7 A;  4Y2F A;  4LRX C;  3PYP A;  1S6R A;  5DFX A;  3H82 A;  1RCJ A;  2PYR A;  2XD5 A;  4JGP A;  2XDM A;  2PAV P;  2PR6 A;  2XD1 A;  2PD8 A;  5HAR A;  5FQQ A;  3T4S A;  4S2O A;  3OBF A;  3LFV A;  4KZ8 A;  4DF6 A;  1YMX A;  3LIA A;  4Q0I A;  1ALQ A;  4R0Q A;  3N8L A;  3HLB A;  1IEM A;  3VP4 A;  1PFL A;  1K57 A;  1MKI A;  2V0W A;  4GW9 A;  2R9W A;  4KQQ A;  3P01 A;  3E4O A;  2WKE A;  1HD8 A;  4HQA A;  2WZZ A;  5CHM A;  3FKW A;  1KVM A;  3CWF A;  1MWS A;  2VA0 A;  4I38 A;  1ONG A;  1PZP A;  1ERQ A;  1XA7 A;  4NG2 A;  5DF9 A;  3CPT B;  2J7V A;  4E3K A;  2WKQ A;  2X71 A;  2EWW A;  3S7N A;  3PBO A;  2J3W A;  3UE3 A;  1FCO A;  1RGY A;  2ZOH A;  3ZDJ A;  3TE8 A;  4HI4 A;  5CTM A;  4EBP A;  5CHU A;  5AVF A;  1LSX A;  4UQI S;  4ARZ A;  4FH2 A;  3C7V A;  4GOG A;  3S7O A;  3BQA A;  5HDD A;  2O0Y A;  2ZL1 A;  4S2N C;  1NWZ A;  2X02 A;  4EV4 A;  2PBY A;  1SKO B;  4FTX A;  3A0R A;  4UA7 A;  5EVI C;  1OTD A;  1YLY A;  2Z2M B;  4MN7 A;  2WKP A;  5F83 A;  1A0K A;  3WWX A;  2L4R A;  1DP9 A;  3JVV A;  4KZA A;  2X01 A;  5AJG A;  5K5B A;  2QYB A;  2EWV A;  4B88 A;  3G2Y A;  3ZG5 A;  3H82 B;  4DDS A;  2Q9N A;  2ZBB A;  3HLF A;  2B18 A;  3Q7Z A;  4H8R A;  3GEC A;  3F1P B;  5HL6 A;  3MXS A;  2KDK A;  3UE0 A;  3W2Z A;  3KSF A;  2CC1 A;  3SZT A;  3G4P A;  5DTT A;  4GB7 A;  1ERO A;  2JKR M;  3WRT A;  1F9I A;  4WMC A;  5AQA A;  3CLO A;  3ZGA B;  2HDU A;  1X0O A;  4ZBE A;  1K6R A;  1Q2Q A;  3IQA A;  5DFY A;  3TRC A;  3P09 A;  2OWJ A;  3LR0 A;  4PMA A;  4Y13 A;  1STZ A;  5FSR A;  3UDX A;  3UB8 A;  1SHV A;  3GV9 A;  5HPI A;  1G68 A;  4UAA A;  2VX8 A;  3R4K A;  3H9W A;  4EES A;  4Y0O A;  4EEU A;  2V0U A;  1BLC A;  5L2F A;  5EM0 A;  2RL3 A;  4GKU A;  4JF4 A;  2Y55 A;  1YLZ A;  4KZ6 A;  4UHU A;  3PBN A;  5AQB A;  1K25 A;  3KYZ A;  2V1B A;  2WKI A;  1YT4 A;  4E3O A;  3UDF A;  3BLM A;  4LPZ A;  2WGW A;  3UPP A;  2HDR A;  3BEC A;  2ZQC A;  3LIC A;  4HBT A;  4JXS A;  3H7W B;  4OPY A;  3EEH A;  4M3K A;  4IHQ A;  1PI5 A;  1MWU A;  3C5A A;  2Q0O A;  2O9B A;  3O86 A;  5HX9 A;  3CZD A;  3E2L A;  2Y2I A;  4BBV A;  3GR2 A;  4X68 A;  3VOY A;  1KGE A;  3DTI A;  2J3T C;  2C6W B;  5EVI D;  5HD3 A;  3IWQ A;  3Q1F A;  2JE5 A;  3MR0 A;  4KG6 A;  4P6Z M;  1H8M A;  3VOZ A;  3N4I A;  1W8Q A;  4R1G A;  2ZQ8 A;  3LR3 A;  1ES4 A;  3NY4 A;  3PBT A;  4MDZ A;  2HJE A;  5FQI A;  2EA9 A;  1FIL A;  4DKI A;  3CJM A;  2XH9 A;  2R78 A;  3NUL A;  4BMW A;  3KO6 A;  1TS0 A;  2WYX A;  3EGX C;  5L8M A;  1KE3 A;  4NXE A;  4QU3 A;  2W3G A;  5HWV A;  4O7D A;  4EU0 A;  5F1F A;  4JXV A;  4KG2 A;  4IVI A;  4E3I A;  2E8I A;  3C2W A;  3KYE A;  4PM9 A;  1L0D A;  4QB8 A;  3ZYT A;  4JKT A;  3MFD A;  3VP2 A;  5CER A;  5A91 A;  4WN5 A;  2XRO A;  1WYC A;  5EOO A;  2H10 A;  4X25 A;  3LIE A;  3IWO A;  1XX2 A;  1OTE A;  1YLT A;  2FFF B;  4G3K A;  3NOT C;  1W79 A;  1Z09 A;  1DJB A;  3C30 A;  4NXF A;  3V67 A;  3VE3 A;  1GCE A;  4LV2 A;  1OJG A;  3QP8 A;  3TSG A;  4S2N A;  1VHM A;  3T4K A;  1H0M A;  4KEN B;  4DN0 A;  4GNU A;  1ESI A;  4EUZ A;  2WGW B;  2Y8H A;  4IBX A;  1J3W A;  4OPQ A;  4DE1 A;  4CLC B;  5EVI A;  2H0T A;  4WYY A;  1YAX A;  4R4S A;  1K57 C;  2V1A A;  5CRF A;  3T1S A;  5FQ9 A;  1C3B A;  3HLE A;  3Q81 A;  3T4T A;  1BUL A;  1YSQ A;  1GSV A;  5M18 A;  1CI8 A;  1K4F A;  3O3V A;  4H6J B;  2A24 B;  3CI6 A;  4OOY A;  3T1X A;  4C3Q A;  1TVF A;  2BAS A;  2VZW A;  5HDS A;  3GRJ A;  4B9O A;  1LI9 A;  3V3S A;  3N7W A;  3IBJ A;  1F98 A;  2EXA A;  3NOP C;  2J3T D;  2FZ0 A;  4Q0J A;  1VEU B;  4ETZ A;  4L0L A;  5FEF A;  3LID A;  2W3H A;  4GCZ A;  3NJA A;  2WAF A;  1BUE A;  5FAO A;  5HSQ A;  4EWF A;  5AQ7 A;  2HDS A;  5F6A A;  1TEM A;  2HJ9 C;  1XFQ A;  3HL9 A;  1JWZ A;  4QPR A;  2INW A;  4R3A A;  1T1B A;  3ICY A;  4LV3 A;  4II7 A;  3A3J A;  4LRY C;  2B5R A;  5A90 A;  3UB5 P;  3IH8 A;  1IEL A;  3T4O A;  1D7E A;  2Y2H A;  1CK3 A;  4UA9 A;  2L0W A;  4FUW A;  4BL3 A;  2GNX A;  5IHV A;  2BG1 A;  3RFB A;  1K56 D;  2P7J A;  3VSL A;  1PYY A;  5DF7 A;  5DVA A;  1SDE A;  4KUK A;  3G30 A;  4MBK A;  1UGU A;  1CEG A;  3M6B A;  4MBF A;  3EOI A;  1PWC A;  1TF1 A;  5FI6 A;  5C5K A;  4O01 A;  3SOI A;  4DXB A;  5HFO A;  1TDG A;  3PR6 A;  3LIB A;  1XKZ A;  4ZJ2 A;  2P04 A;  4Y7P A;  1DP6 A;  2VGL M;  1PW8 A;  3CPT A;  2EX2 A;  1ZG4 A;  2Y2Q A;  2M1C A;  3IT9 A;  4EQ1 A;  1L0F A;  5CHJ A;  3E2K A;  3BY9 A;  4GZB A;  5HZH A;  3B33 A;  1S1Z A;  1ZG6 A;  4KZ4 A;  2WZX A;  4OQG A;  4IUK A;  1SZV A;  2WKR A;  3A3D A;  2ZC7 A;  3QP4 A;  2DMW A;  4WEJ A;  1WYB A;  4E3N A;  1RP5 A;  4MNR A;  2XA7 S;  4FSF A;  1TS7 A;  5F69 A;  4KQD A;  2PDR A;  2HPB A;  4ZDX A;  3IF6 A;  3LUQ A;  4CLC C;  4XUZ A;  3W8K A;  1LLB A;  2EFX A;  2P08 A;  3G32 A;  1T19 A;  3K3C A;  4EER A;  3D4F A;  1GHI A;  4PM6 A;  3ISG A;  5GL9 A;  3DW0 A;  1F2K A;  3CMZ A;  3OCN A;  1K56 A;  4MLL A;  3UY6 A;  2OAP 1;  2ZM0 A;  4X53 A;  2V9A A;  3F1P A;  3KSI A;  3UMD A;  4ZRR A;  5CXW A;  4OLD A;  2W1R A;  2DCF A;  5FAQ A;  4HEF A;  3BM6 A;  2W3E A;  3B42 A;  1Y54 A;  4JGR A;  4UQI M;  4HES A;  5DJT A;  4EBN A;  3KX0 X;  3T4L A;  3ZHH A;  3UPN A;  3BW6 A;  1S0W A;  2V2F F;  5DF8 A;  5TR7 A;  1FCN A;  1XFN A;  3WS0 A;  1XGI A;  3JVU A;  2QZ6 A;  4G3V A;  2W3D A;  4MN5 A;  4WF0 A;  3MF0 A;  2Y2O A;  2GZA A;  4HIA A;  4WMC D;  3HLW A;  3ZNT A;  4F94 A;  5DKK A;  3IHB A;  4CLC E;  5TFQ A;  1OPX A;  3S7Q A;  4MCW A;  3LGO A;  4WEK A;  2XSS A;  3VP1 A;  3FPW A;  1ZTU A;  1Y4O A;  3UB6 A;  3PTE A;  4DMZ A;  3MJQ A;  3E4Q A;  5J8X A;  3L7H A;  1E25 A;  3A3I A;  2HDQ A;  2VEA A;  3V50 A;  4JF6 A;  4I5S A;  5MC7 A;  3LYX A;  3RTY A;  5FEG A;  2BLS A;  1KDW A;  1OJ5 A;  4IED A;  3G31 A;  4OON A;  4OLG A;  1K6S A;  5FQK A;  2OLV A;  3ZNY A;  3HRE A;  3BFE A;  4S2I A;  3H7W A;  5F1G A;  1ERM A;  3T1R A;  4Z1W A;  1DY6 A;  1SKF A;  1TS6 A;  2WGV A;  3IF6 B;  4Y15 A;  1ZHH B;  5IS1 A;  3ZFZ A;  3BEB A;  1NLZ A;  1IKI A;  4GS9 B;  4JGQ A;  2ZMV A;  3PHY A;  1MC0 A;  4OP5 A;  3CG5 A;  3UO9 A;  4BLM A;  1IOU A;  4S2J A;  3SS5 A;  4GDN A;  1V9Z A;  4YWZ A;  4JLF A;  1MPL A;  3HLC A;  3NBL A;  1S67 L;  5GHX A;  4MMN A;  3E98 A;  1YM1 A;  3DTE A;  5CGW A;  5HPF A;  1H8Z A;  1OTI A;  4LRZ E;  4GN2 A;  4ZTK A;  1KOU A;  3IX3 A;  1BT5 A;  2XGN A;  3DAV A;  3V3R A;  2PBD P;  2VK3 A;  3SW1 A;  1IYO A;  4QWO A;  2JKT I;  4X1M A;  3TG9 A;  2LB9 A;  4BD0 A;  4DXC A;  3Q7V B;  1P0Z A;  1SCW A;  5CTN A;  5D3O A;  4KUO A;  1ZKJ A;  4QY6 A;  2BTF P;  4R38 A;  1I2W A;  4N9L A;  3AGF A;  1W63 Q;  3LR5 A;  4LCL A;  3IBR A;  2HP9 A;  3B3X A;  3F1N B;  3FPV A;  2PD7 A;  3VFH A;  3VFF A;  2ZOI A;  4PM5 A;  4NKP A;  3C8C A;  3LEQ A;  3E4P A;  2ZC6 B;  2HGV A;  1KE4 A;  5I5L A;  4JF5 A;  3HUM A;  4S2M A;  4E3M A;  3JPU A;  2YKH A;  2ZQ7 A;  3ITB A;  4BEN A;  1PIO A;  3PAG A;  2ZM2 A;  4K0W A;  1NYY A;  2WAD A;  2PHY A;  4OKP A;  3HUN A;  4DE2 A;  2XQZ A;  1PWD A;  4R70 A;  1CQA A;  4CLC A;  1JNU A;  2YKF A;  2OSU A;  1KE0 A;  3F1O B;  4ID4 A;  4NET A;  2M7U A;  2V20 A;  4E04 A;  4U3T A;  2HZ5 A;  4AFI A;  2OOL A;  4OH0 A;  1KGF A;  5FQM A;  2DRW A;  4H6J A;  4D60 A;  2J8Y A;  1F5M A;  2EX6 A;  1NRJ A;  5KSC A;  2A24 A;  3CIT A;  5EM1 A;  3T4J A;  3MMH A;  3LI9 A;  3G6O A;  1N9L A;  4GLQ A;  5TJJ A;  1H3Q A;  4Z9Q A;  4BD1 A;  3QP5 A;  5HAQ A;  4CJN A;  4CQH A;  1DJC A;  2FFY A;  5GLA A;  1N9O A;  5CX7 A;  4HY8 A;  2WKH A;  3S4X A;  3OPP A;  4X55 A;  2QWS A;  1VEU A;  3NOU C;  2ZD8 A;  3PBR A;  4GD6 A;  2VKS A;  4R4R A;  1OTA A;  2VV7 A;  3UB7 A;  3HUO A;  1V9Y A;  3TOI A;  1HVB A;  2G7U A;  3DTM A;  3A0V A;  4EEP A;  3SH9 A;  3IF6 C;  3VP0 A;  1XJ4 A;  1NJ4 A;  3C4P A;  4Q0H A;  1PW1 A;  3IS2 A;  3Q82 A;  1L3L A;  3NDG A;  3LO7 A;  2A49 A;  2W1T A;  1XJ3 A;  2Y2K A;  4NXB A;  4WZ4 A;  4HHD A;  3G34 A;  5CEB A;  3IXH A;  5I94 A;  2I9V A;  4S2K A;  3VOL A;  5E43 A;  4LCM A;  2H5S A;  2QKP A;  3MKF A;  4S2P A;  4OPR A;  3O88 A;  2ACG A;  5IT5 A;  4U0T A;  2J9O A;  4OVD A;  4DRT A;  2Z6D A;  5FI2 A;  2K2N A;  2NUT C;  4P0M A;  3CAX A;  5GLC A;  2JHE A;  1K4E A;  2KLI A;  5KMW A;  4P87 A;  1L0G A;  4LLO B;  4WBG A;  4EUV A;  4GHI B;  5EOE A;  3QNB A;  1WE4 A;  3NCK A;  2JKR I;  1EI5 A;  5E2G A;  3UNW A;  5E2E A;  3MZE A;  5EUA A;  5FAS A;  3T50 A;  1GA0 A;  4Y0U A;  3C38 A;  1YLP A;  1LSV A;  1UWN X;  3BYD A;  4KZB A;  2WGI A;  3S22 A;  2E8J A;  1AXB A;  1LI0 A;  2O9C A;  5DTK A;  2VJW A;  1H5X A;  3BFF A;  1XP4 A;  4EXO A;  3IXG A;  2HV1 A;  4FCF A;  3R7W B;  5DKL A;  4R23 A;  1S4R A;  4HNB A;  2VGK A;  3OPH A;  3ZVT A;  1NY0 A;  1E3U A;  3HBR A;  4KQO A;  2K7S A;  4HBU A;  3O5Y A;  1BTL A;  3BFG A;  5A8B A;  4Y17 A;  2H28 A;  3GMW A;  2K31 A;  2RCX A;  5EV0 A;  5M1A A;  5M19 A;  3FC7 A;  3HCY A;  2ZJ9 A;  4HP4 A;  4JXW A;  4Y0T A;  3NC8 A;  5F5Y A;  3WS2 A;  1IFQ A;  3IS2 B;  3W4P A;  4C75 A;  1MZU A;  5DTS A;  1G5U A;  2W1T B;  4D2O A;  2GDN A;  1EW0 A;  4F3L B;  2PT7 A;  3MSH A;  3ULF A;  5FQJ A;  3U4L P;  1VQQ A;  4RQ9 A;  3W4O A;  4KQR A;  4OQ0 A;  2O9A A;  4ZAM A;  1N9N A;  2XR0 A;  1YQS A;  2Q9M A;  2Y2N A;  5LBR A;  1OT6 A;  3UB9 A;  3LCE A;  4RVA A;  4ETX A;  4Y3I A;  4QY5 A;  1VET B;  1OME A;  1G6O A;  1BYW A;  3KSG A;  2XA7 M;  2PU2 A;  3QNC A;  2D01 A;  2QJ7 A;  1P9W A;  1TD5 A;  1L2S A;  1LSW A;  3LY3 A;  4OPZ A;  4LFU A;  1S1Y A;  4BWI A;  1GHP A;  1S4S A;  1YMS A;  4N1H A;  2QHK A;  4ME4 A;  5GHY A;  4GD8 A;  4LV1 A;  1XPB A;  5J4E A;  5KZH A;  5HAI A;  4I3I A;  3PBS A;  3MBZ A;  5EFW A;  4OQI A;  3NHQ A;  4HH2 A;  3WRZ A;  1KGG A;  4OOL A;  2OV5 A;  4BQM A;  3HLD A;  3GQZ A;  2IWD A;  4HJ4 A;  3K3D A;  2JKT M;  3UPO A;  2EX8 A;  2P74 A;  2OWH A;  3MXR A;  1YLJ A;  5TBM B;  2ZQD A;  3N8S A;  3S7P A;  4GS9 A;  1DRM A;  3P98 A;  1ES2 A;  1FR1 A;  4OOM A;  1M40 A;  2XLN A;  1CI9 A;  1U60 A;  5EVE A;  4ESP A;  2Y59 A;  2V8F A;  4LGW A;  5A92 A;  4N9K A;  3IF5 A;  2JKG A;  2VV8 A;  3CUE C;  1XXM A;  5L10 A;  3ZVW A;  3MS6 A;  5HWT A;  1D1J A;  3TW8 A;  1NXY A;  4KZ7 A;  4EW7 A;  1NYM A;  4IVK A;  1Z6F A;  3IWI A;  3MQO A;  2A2L A;  1XGJ A;  3QP1 A;  3Q7V A;  3DTK A;  3RH8 B;  2XK1 A;  4R3J A;  1LL9 A;  4WLA A;  2MJ6 A;  1L0E A;  4P6B A;  2M7V A;  2ZMF A;  1FCM A;  3F1N A;  3FG8 A;  2IA2 A;  3ZCZ A;  5FDS A;  3IHA A;  3OPR A;  4UEY A;  2LB5 A;  3B47 A;  1YSP A;  4GJ4 A;  2ZMA A;  2PR5 A;  5E2H A;  3LEZ A;  1ESU A;  4EBL A;  4PHT A;  2W3F A;  4A5R A;  3TJZ C;  3BRM A;  1SDN A;  4BL2 A;  2Y2M A;  2Y2G A;  1FSY A;  2WK0 A;  3MXQ A;  5HWW A;  4DJ3 A;  3Q07 A;  4L9E A;  2XFT A;  3BQ8 A;  1RGZ A;  3IX4 A;  4IJG A;  4QJG A;  4DE3 A;  2PU4 A;  4R6L A;  4UA6 A;  3HJI A;  1MY8 A;  2VLG A;  2ZLY A;  4JXG A;  4C6Y A;  1CF0 A;  5EE8 A;  1O07 A;  3A0S A;  3P7N A;  3T4Q A;  2QMI A;  3F1O A;  1PRQ A;  1E4D A;  1JVJ A;  1G28 A;  2P9V B;  1I5Q A;  3DWK A;  3GTC A;  3FYZ A;  2VV6 A;  5HD5 A;  1N9B A;  4MEZ A;  4OQH A;  5HW3 A;  3VP3 A;  3LY4 A;  4X56 A;  5CEC A;  1K55 A;  4BJP A;  4X69 A;  5FDH A;  4CLC D;  4WL9 A;  3ZG0 A;  3SS4 A;  3SH7 A;  4K91 A;  4HP9 A;  2I72 A;  4P85 A;  3GDI A;  5A93 A;  3E0Y A;  1P97 A;  1JWP A;  4NEE D;  4YFM A;  1K54 C;  4JPM A;  5DJU A;  2WUQ A;  3BLS A;  4CPK A;  1Q2P A;  2EX9 A;  3S1Y A;  5EVL A;  2FH5 A;  3CHW P;  2J9P A;  1BLS A;  5J7E A;  3MQQ A;  5FAP A;  1PWG A;  2PRF A;  2QPN A;  3NIA A;  4FH4 A;  3ZG7 B;  3SH8 A;  3RJU A;  4Y5F A;  4HH3 A;  4I3J A;  1GSW A;  1S66 L;  4WZ5 C;  2XRN A;  4QHC A;  2IWC A;  1LHY A;  4FD8 A;  2Y4A A;  3BY8 A;  1H8Y A;  5JYP A;  4WUJ A;  3HLG A;  3U2A A;  2Y79 A;  3OCL A;  4XT2 A;  1AWI A;  1KDS A;  4DE0 A;  3AGD A;  1LT0 A;  4E3J A;  1BZA A;  5FAT A;  1NRF A;  3VSK A;  3OPL A;  3UME A;  4XXR A;  2VGJ A;  3WS5 A;  2D02 A;  3O87 A;  4RX2 A;  5GHZ A;  4B4Z A;  1IYQ A;  3W4Q A;  4RA7 A;  3A3F A;  3AGE A;  4JBF A;  2O99 A;  2XEP A;  5HAP A;  1ES3 A;  4EQI A;  5TGF A;  4GHI A;  4K0X A;  3EWK A;  5F68 A;  3M2K A;  2ZQA A;  5AQ9 A;  3QP6 A;  2V8C A;  3GSG A;  3JYI A;  2G2W A;  3EGD C;  4E6W A;  3ITA A;  4ARZ B;  3HJK A;  1W7F A;  4S2L A;  1IKG A;  4HJ3 A;  2ZL1 B;  3KYQ A;  3CUE A;  5JYO A;  1XA1 A;  5F82 A;  4BBU A;  3BJN A;  4EET B;  3MFX A;  1G6A A;  3UDI A;  1LL8 A;  3OZH A;  5U47 A;  3MQ0 A;  4MBH A;  3RXW A;  5EPH A;  3UE1 A;  2GJ3 A;  3R7W A;  3VV4 A;  3MKE A;  4K08 A;  5HDC A;  3VMA A;  2QJ5 A;  1FSW A;  2AVX A;  3SS3 A;  2XF3 A;  1FQG A;  5J3W A;  3MZD A;  2ZQ9 A;  2DNS A;  2G2U A;  1ONH A;  2XFS A;  4O0P A;  5G18 A;  4E3L A;  3RXX A;  2V1Z A;  1FR6 A;  2A3U A;  4WM9 A;  2L1M A;  1E3U D;  2W0N A;  3PXP A;  4PM8 A;  1TS8 A;  1NLY A;  4LV0 A;  2B02 A;  4PPR A;  2GX5 A;  4B4X A;  1NZO A;  1QMF A;  4F3L A;  2ZM8 A;  2B95 A;  4XT2 B;  1GHM A;  5FI7 A;  2UV0 E;  5EEC A;  3IX8 A;  4I3A A;  3BFD A;  5G4Z A;  1KVL A;  4L9F A;  1QME A;  1PI4 A;  1IYP A;  4PAU A;  4MN6 A;  1VET A;  1ODV A;  1YKD A;  4X1L A;  3IH9 A;  1K0K A;  4P6Z S;  2PYP A;  2KOI A;  4PKY A;  4N92 A;  1MXO A;  3OLO A;  1CJF A;  5KSH A;  4KZ5 A;  1YPR A;  4RYE A;  3OOV A;  4U0X A;  2J80 A;  4X6T A;  3DWZ A;  2JBF A;  1XJ6 A;  3PBQ A;  1N4O A;  3ZQ5 A;  1ZC2 A;  1TDL A;  4ZJ3 A;  2NUP C;  4M4X A;  4O8G A;  2Z2L B;  3MZF A;  4DDY A;  1YLW A;  4HOI A;  4YIN A;  5G4Y A;  1W5D A;  4GDB A;  3HVF A;  1P9R A;  2EFU A;  2KX6 A;  3LIF A;  1BLP A;  1K54 A;  5AVE A;  3VE4 A;  3FZC A;  3L9K A;  3KSH A;  3PAE A;  1O7E A;  2JKF A;  3DBA A;  5KIZ A;  3FV7 A;  1VB6 A;  3ZG8 B;  2ZC5 B;  2ZC3 B;  1T18 A;  3BFC A;  1PZO A;  4RX3 A;  5TBM A;  3EEA A;  3FWL A;  3IXD A;  4ZJ1 A;  1WA9 A;  2H0Y A;  4KG5 A;  3EQU A;  4IUH A;  3M2J A;  1GSX A;  1FOF A;  4WZ5 A;  3GVB A;  1DJA A;  1K38 A;  4BBT A;  5L09 A;  3ZG9 B;  1IYS A;  2WAE A;  4IBR A;  4NK3 A;  2Z6C A;  3BWL A;  1K55 C;  1OT9 A;  3NI9 A;  2EXB A;  4PKY G;  1JTD A;  3T12 B;  5FL3 A;  2UWX A;  3WS1 A;  4HJ6 A;  2ZC4 B;  3OC2 A;  3T1Q B;  5CGX A;  4FOF A;  1UWP X;  3D9Y A;  1PNE A;  2JN7 A;  1OTB A;  1XJ2 A;  4L9G A;  4NXG A;  4JGO A;  2Y2P A;  2R9X A;  1FIK A;  3V39 A;  1M6K A;  1Y28 A;  5IU1 A;  1CEF A;  2Y2J A;  1D06 A;  3WS4 A;  1BLH A;  3LR4 A;  3NDE A;  4N1X A;  5HL1 A;  3FKV A;  3LI8 A;  1LL5 A;  3V5M A;  5BOH A;  2OLU A;  3A3E A;  1J9M A;  2C5W B;  1DP8 A;  3UN7 A;  2IWB A;  2JCH A;  4YOF A;  3D3O A;  4QD4 A;  4I39 A;  5L07 A;  1W63 M;  4LEN A;  5EVI B;  4PM7 A;  4R3B A;  1MKM A;  3QHY A;  2Y2L A;  5GLB A;  3IXB A;  1ACF A;  3C4O A;  3QP2 A;  3G35 A;  1T1A A;  1EWZ A;  4Q8I A;  1I2S A;  3D72 A;  1JTG A;  1BSG A;  1JWV A;  2HP6 A;  1MWR A;  2JC7 A;  2P9V A;  1NZU A;  1W8Y A;  1ES5 A;  5GLD A;  1T1C A;  2CMN A;  4WEL A;  1HTZ A;  4OP8 A;  5E2F A;  2Y91 A;  3N8R A;  4G3W A;  5CED A;  1HZO A;  3G2Z A;  3NEC A;  4E6X A;  1MWT A;  2HF6 A;  1VM1 A;  2OAQ 1;  2HP5 A;  1GA9 A;  3N6I A;  5CGS A;  4DJ2 A;  1SKO A; 
#chains in the Genus database with same CATH homology
 3NOU C;  4B93 A;  3GDI A;  4ETZ A;  3E0Y A;  4L0L A;  1P97 A;  3PBR A;  3LID A;  2VKS A;  1OTA A;  4NEE D;  2VV7 A;  2W27 A;  3UB7 A;  2W3H A;  4GCZ A;  3K2N A;  5DJU A;  3NJA A;  4YNR A;  1V9Y A;  2VGL S;  3EQV A;  3UE6 A;  5HSQ A;  2G7U A;  2FH5 A;  3A0V A;  4Y2F A;  5F6A A;  4EEP A;  4LRX C;  5J7E A;  3PYP A;  2HJ9 C;  3MQQ A;  1XFQ A;  1XJ4 A;  5DFX A;  3H82 A;  4QPR A;  2INW A;  4R3A A;  2PYR A;  4Y5F A;  4Q0H A;  4HH3 A;  4JGP A;  3IS2 A;  1T1B A;  4I3J A;  3ICY A;  2PR6 A;  1GSW A;  4II7 A;  1S66 L;  2PD8 A;  2W1T A;  4LRY C;  1XJ3 A;  2XRN A;  4NXB A;  3T4S A;  4HHD A;  3BY8 A;  2I9V A;  4WUJ A;  3OBF A;  3VOL A;  3U2A A;  3LFV A;  2QKP A;  2Y79 A;  3OCL A;  4XT2 A;  3T4O A;  1D7E A;  3LIA A;  5IT5 A;  4Q0I A;  2L0W A;  2GNX A;  1LT0 A;  3RFB A;  2P7J A;  2Z6D A;  2K2N A;  2NUT C;  4KUK A;  3CAX A;  2V0W A;  4GW9 A;  3UME A;  2D02 A;  3P01 A;  1UGU A;  3E4O A;  4HQA A;  2JHE A;  3EOI A;  2KLI A;  1TF1 A;  5C5K A;  4O01 A;  4LLO B;  3CWF A;  2O99 A;  4EUV A;  2VA0 A;  4GHI B;  4I38 A;  3PR6 A;  3LIB A;  4GHI A;  2JKR I;  2P04 A;  1DP6 A;  3EWK A;  5F68 A;  2VGL M;  5DF9 A;  3T50 A;  2WKQ A;  3S7N A;  2EWW A;  3PBO A;  2J3W A;  2M1C A;  3C38 A;  4EQ1 A;  3EGD C;  1LSV A;  1UWN X;  3UE3 A;  2ZOH A;  3TE8 A;  4HI4 A;  3BY9 A;  4ARZ B;  5AVF A;  3HJK A;  5HZH A;  3B33 A;  1LSX A;  1S1Z A;  4HJ3 A;  4UQI S;  4ARZ A;  4IUK A;  3BQA A;  3S7O A;  5HDD A;  2O0Y A;  2O9C A;  2WKR A;  3CUE A;  3KYQ A;  2VJW A;  4BBU A;  1NWZ A;  2DMW A;  3BJN A;  4WEJ A;  4EET B;  4EXO A;  3MFX A;  2XA7 S;  4FSF A;  1LL8 A;  1TS7 A;  5F69 A;  4KQD A;  2HV1 A;  3MQ0 A;  3R7W B;  5DKL A;  3A0R A;  1S4R A;  2PDR A;  1OTD A;  4HNB A;  2GJ3 A;  3R7W A;  4MN7 A;  3LUQ A;  4CLC C;  3VV4 A;  2WKP A;  4KQO A;  2K7S A;  3O5Y A;  4K08 A;  5HDC A;  5A8B A;  2L4R A;  2QJ5 A;  1DP9 A;  3JVV A;  2P08 A;  2H28 A;  5AJG A;  5K5B A;  5J3W A;  2K31 A;  1T19 A;  2QYB A;  3K3C A;  2EWV A;  4EER A;  3FC7 A;  4O0P A;  3H82 B;  3HCY A;  4HP4 A;  2ZBB A;  2B18 A;  3OCN A;  5F5Y A;  1IFQ A;  3GEC A;  3F1P B;  3IS2 B;  5HL6 A;  2OAP 1;  1MZU A;  2KDK A;  3W2Z A;  2V9A A;  3F1P A;  3KSF A;  3KSI A;  2L1M A;  3UMD A;  2W0N A;  2W1T B;  3PXP A;  1TS8 A;  4ZRR A;  2JKR M;  1NLY A;  1EW0 A;  2B02 A;  2W1R A;  4F3L B;  1F9I A;  2GX5 A;  2PT7 A;  3ULF A;  3CLO A;  4RQ9 A;  4F3L A;  1X0O A;  2W3E A;  3B42 A;  4XT2 B;  2O9A A;  1N9N A;  4JGR A;  5DFY A;  4I3A A;  3TRC A;  5LBR A;  4UQI M;  1OT6 A;  2OWJ A;  3LR0 A;  5DJT A;  3UB9 A;  3KX0 X;  5G4Z A;  3T4L A;  4L9F A;  4ETX A;  4Y3I A;  1STZ A;  3BW6 A;  4PAU A;  3UB8 A;  4MN6 A;  1G6O A;  5HPI A;  1BYW A;  1ODV A;  1YKD A;  2VX8 A;  3KSG A;  2XA7 M;  4P6Z S;  3R4K A;  3H9W A;  4EES A;  1XFN A;  3JVU A;  4EEU A;  2D01 A;  4G3V A;  2W3D A;  2QJ7 A;  4MN5 A;  1P9W A;  1TD5 A;  4WF0 A;  3MF0 A;  1LSW A;  2V0U A;  2GZA A;  4HIA A;  2PYP A;  2KOI A;  4PKY A;  5DKK A;  1S1Y A;  3OLO A;  4BWI A;  5KSH A;  4CLC E;  1OPX A;  3S7Q A;  1S4S A;  4MCW A;  3OOV A;  2J80 A;  3PBN A;  4WEK A;  2XSS A;  3KYZ A;  3FPW A;  2QHK A;  2V1B A;  1XJ6 A;  1ZTU A;  3PBQ A;  4ME4 A;  3UB6 A;  4DMZ A;  3MJQ A;  3ZQ5 A;  3E4Q A;  2VEA A;  4LPZ A;  4I5S A;  5MC7 A;  3LYX A;  3RTY A;  5J4E A;  2NUP C;  4M4X A;  4I3I A;  1OJ5 A;  4O8G A;  3PBS A;  4HOI A;  5EFW A;  3NHQ A;  3LIC A;  4HH2 A;  5G4Y A;  1P9R A;  2KX6 A;  3LIF A;  5AVE A;  3H7W B;  3VE4 A;  3EEH A;  3H7W A;  4OOL A;  4IHQ A;  3KSH A;  4HJ4 A;  4Z1W A;  1TS6 A;  3K3D A;  2JKT M;  3DBA A;  5KIZ A;  2O9B A;  1ZHH B;  5IS1 A;  1VB6 A;  2OWH A;  1NLZ A;  4BBV A;  4GS9 B;  4JGQ A;  5TBM B;  2ZMV A;  3PHY A;  1MC0 A;  1T18 A;  3S7P A;  4GS9 A;  1DRM A;  2J3T C;  5TBM A;  3EEA A;  1WA9 A;  5HD3 A;  1IOU A;  3EQU A;  1V9Z A;  4IUH A;  4OOM A;  3MR0 A;  1GSX A;  4YWZ A;  4P6Z M;  1H8M A;  1S67 L;  4BBT A;  4MMN A;  3E98 A;  2VV8 A;  3LR3 A;  3CUE C;  3PBT A;  4MDZ A;  5HPF A;  1OTI A;  2HJE A;  2Z6C A;  3BWL A;  4LRZ E;  1OT9 A;  5HWT A;  1KOU A;  2EA9 A;  3TW8 A;  2R78 A;  4PKY G;  5FL3 A;  4BMW A;  3KO6 A;  3SW1 A;  1TS0 A;  4EW7 A;  4HJ6 A;  3EGX C;  5L8M A;  2JKT I;  4NXE A;  2W3G A;  5HWV A;  3OC2 A;  2LB9 A;  4EU0 A;  3MQO A;  2A2L A;  1P0Z A;  1UWP X;  4FOF A;  3C2W A;  4KUO A;  4R38 A;  3RH8 B;  2JN7 A;  1OTB A;  1W63 Q;  3ZYT A;  3LR5 A;  1XJ2 A;  4L9G A;  4NXG A;  4WLA A;  4JGO A;  2MJ6 A;  3IBR A;  4WN5 A;  2M7V A;  2XRO A;  3F1N B;  3FPV A;  2ZMF A;  2PD7 A;  3F1N A;  1Y28 A;  2ZOI A;  5IU1 A;  3FG8 A;  2IA2 A;  1D06 A;  3LIE A;  4NKP A;  3C8C A;  2LB5 A;  4UEY A;  3B47 A;  1YSP A;  4GJ4 A;  1OTE A;  3LR4 A;  2PR5 A;  3E4P A;  3LI8 A;  4G3K A;  2HGV A;  3NOT C;  3V67 A;  4NXF A;  3C30 A;  4PHT A;  5I5L A;  2W3F A;  3TJZ C;  3VE3 A;  1DP8 A;  1OJG A;  3MXQ A;  5HWW A;  2YKH A;  4DJ3 A;  1VHM A;  3T4K A;  4DN0 A;  4YOF A;  3D3O A;  4L9E A;  4I39 A;  3BQ8 A;  2Y8H A;  4IJG A;  1W63 M;  2PHY A;  4R6L A;  3HJI A;  4CLC B;  1MKM A;  4R70 A;  2VLG A;  1YAX A;  2V1A A;  1JNU A;  4CLC A;  2YKF A;  3T4T A;  1YSQ A;  3F1O B;  1GSV A;  3A0S A;  3P7N A;  2M7U A;  3T4Q A;  4E04 A;  4AFI A;  1T1A A;  3F1O A;  2OOL A;  4H6J B;  1G28 A;  4H6J A;  3D72 A;  2A24 B;  3CI6 A;  1F5M A;  1NRJ A;  2A24 A;  3CIT A;  3T4J A;  5HDS A;  2BAS A;  2VZW A;  3MMH A;  2VV6 A;  3LI9 A;  5HD5 A;  3G6O A;  1N9L A;  4GLQ A;  1T1C A;  2CMN A;  5TJJ A;  4WEL A;  4G3W A;  1H3Q A;  4B9O A;  4BJP A;  4CLC D;  2HF6 A;  3IBJ A;  1F98 A;  4WL9 A;  4CQH A;  3NOP C;  2J3T D;  1N9O A;  5CX7 A;  2FZ0 A;  2OAQ 1;  4HY8 A;  4Q0J A;  4HP9 A;  4DJ2 A;  2QWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...