1TS8A

Structure of the pr cis planar intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
molecule keywords Photoactive yellow protein
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts8A00
3LI8A 4I39A 4R6LA 3F1OA 1S4SA 2QJ7A 1OJGA 2L4RA 2WKQA 4HH3A 2B02A 3RH8B 3SW1A 3BY9A 3G6OA 1T18A 4XT2A 4L9GA 4I3IA 3C2WA 4WL9A 3H82A 4GHIB 3E4PA 4EEUA 5G4YA 3CLOA 3OLOA 4I5SA 4I3AA 4F3LA 4WLAA 4WN5A 1N9NA 3ZQ5A 4HY8A 5F68A 2JHEA 4WF0A 2L1MA 4KUOA 3NOTC 1T19A 5J4EA 3F1PB 3UB8A 1TS6A 5J7EA 2D01A 5DJUA 4JGQA 4HP9A 2V1AA 4M4XA 2VV8A 2INWA 3GDIA 3UB9A 5KIZA 2QWSA 1GSVA 2BASA 1UGUA 2WKPA 2Z6DA 4NXBA 5HWVA 1OT9A 3ULFA 4B9OA 3MQQA 4GHIA 3GECA 1S66L 1XFNA 3UE6A 4JGRA 2VLGA 1OTIA 5HDCA 5EFWA 3FG8A 1TS8A 4LPZA 1DRMA 3PHYA 3VE4A 1LSVA 1JNUA 1MZUA 4GS9B 4BBVA 3B33A 3F1PA 4I38A 3HJIA 5F69A 1XJ4A 5HD5A 1UWNX 1LSXA 4GCZA 3FC7A 1P0ZA 1NWZA 3EEHA 1LSWA 2V0WA 2L0WA 1XJ3A 2PR6A 1T1BA 1V9ZA 4HJ4A 5DKKA 3EWKA 3H9WA 5AVFA 1S67L 2VV7A 3K3DA 2Z6CA 4HJ3A 2YKFA 3E4OA 5HSQA 3KX0X 1XJ2A 2KDKA 2QHKA 1VB6A 5HDSA 2YKHA 4WUJA 2P7JA 3LICA 2OWJA 3A0SA 3K3CA 2J80A 4I3JA 3UB7A 3RTYA 2VV6A 4HQAA 1BYWA 1OTBA 3A0RA 3IBRA 4KUKA 1N9LA 4GS9A 4HOIA 3MR0A 4R70A 3E4QA 2R78A 3IS2B 3UMDA 1DP9A 3LIBA 4L9FA 4EXOA 3NJAA 3UMEA 1F9IA 2K7SA 2V0UA 3LUQA 3UB6A 3MJQA 2ZBBA 4DJ3A 1OJ5A 4NXFA 3BY8A 3PYPA 2D02A 2CMNA 2PD7A 1D06A 1GSWA 5HWWA 4HJ6A 2A24B 3MFXA 4GW9A 4R38A 1F98A 3CAXA 1KOUA 1TS7A 2PDRA 4R3AA 5IU1A 3ICYA 5HZHA 1X0OA 5DKLA 4H6JB 2ZOHA 1TS0A 4HH2A 1OTEA 3IS2A 4JGOA 5J3WA 3H7WB 4JGPA 3LI9A 3NHQA 1UWPX 4YWZA 1ODVA 4PKYA 2KX6A 2JN7A 4EW7A 4LRYC 3P7NA 1EW0A 4EESA 4HI4A 1S4RA 5AVEA 2GJ3A 2ZOIA 3T50A 4LRXC 1N9OA 2PHYA 4EQ1A 3MXQA 4MN6A 1G28A 4NXGA 3C8CA 2A24A 4LLOB 3MQOA 1P97A 1V9YA 5IS1A 5F5YA 5F6AA 1OTAA 5DJTA 1OTDA 1WA9A 2WKRA 2I9VA 1LL8A 2PYRA 2QJ5A 5A8BA 4H6JA 3VE3A 2V9AA 5TBMB 1GSXA 2H28A 3H7WA 1OT6A 2OWHA 1DP8A 1S1YA 1S1ZA 3VOLA 3F1NB 2HV1A 2M1CA 2OOLA 4DJ2A 4L9EA 1T1AA 1XJ6A 2VEAA 3LYXA 3F1OB 3BWLA 4BBTA 1D7EA 2PR5A 4RQ9A 3NOUC 5HD3A 4PKYG 5HDDA 4HIAA 2PYPA 5I5LA 4HP4A 4EEPA 3D72A 4LRZE 5HWTA 4NXEA 4HHDA 1T1CA 1Y28A 4KQDA 1DP6A 4XT2B 2W0NA 3NOPC 2EA9A 2V1BA 4E04A 3H82B 1XFQA 2PD8A 3LIEA 2W27A 5G4ZA 5TBMA 3LIAA 3LIDA 3F1NA 4F3LB 3HJKA 4HNBA 3LIFA 2QKPA 1LT0A 3CWFA 4BBUA 4EETB 4K08A 4EERA 3A0VA 4MN5A
chains in the Genus database with same CATH superfamily
1SKOB 1YKDA 1S4SA 4OONA 2QJ7A 3SS3A 2L4RA 3Q7VA 3LR3A 3VOYA 3GRJA 2P74A 2WKQA 4N92A 3BLSA 3WRTA 4K0XA 1K55C 4ARZA 3TG9A 1H8ZA 3PXPA 3SW1A 4OH0A 3BY9A 1TVFA 2ZL1B 4LV0A 3TJZC 3KSFA 5JYOA 4HBUA 1Y4OA 4WL9A 5M19A 2WUQA 4ESPA 5AJGA 5FL3A 4OQGA 3JVUA 3O3VA 1KE4A 4P6ZS 4I5SA 4CLCA 4CJNA 4H8RA 3EQVA 4F3LA 4WLAA 4OP8A 2Y2JA 4CLCD 2WGVA 1ES4A 4RVAA 1LL9A 4KG6A 4BL3A 3ZDJA 3CHWP 4HY8A 1IYQA 2JHEA 5EVIC 3NOTC 4PM7A 3MXSA 5J4EA 3HLFA 2X71A 3UB8A 4KZ5A 5JYPA 3SH7A 4JGQA 2H5SA 1ES3A 3BW6A 2EX6A 3UB9A 3OOVA 2OSUA 2VGKA 4QPRA 2J3WA 2QWSA 1GSVA 2E8IA 1UGUA 2WKPA 2J3TD 1OT9A 1H8MA 2IA2A 1FOFA 2J7VA 3Q7ZA 5EM1A 4JPMA 1GHIA 3MFDA 5GLDA 3T1QB 4Q0IA 5F1GA 4GZBA 1XFNA 4DE3A 2HZ5A 1XA7A 4B93A 4OPYA 5EFWA 3PBQA 1DJBA 3R4KA 1YLPA 4IJGA 4PMAA 5M1AA 3PHYA 1LSVA 3KYEA 4ETXA 2XLNA 4FH4A 2EFUA 3BRMA 4WMCA 3WS5A 2Y2NA 5AQBA 5L09A 3F1PA 1G5UA 4WMCD 2DCFA 2Y2KA 3PBRA 3HJIA 1XJ4A 1MWUA 3MSHA 1NXYA 1LL5A 3FPWA 4S2NA 3G4PA 4LENA 3FKVA 4GCZA 1IFQA 2PBDP 3D3OA 3QP8A 2R9XA 1P0ZA 4R1GA 4ZJ2A 2WZXA 1LSWA 2V0WA 3LEZA 5D3OA 1N9BA 3H9WA 3N8RA 5FQ9A 4JXSA 2VV7A 3ZNTA 4KZ9A 4HJ3A 3D4FA 1BLPA 5HAPA 1ZG6A 3KX0X 1XJ2A 3OPHA 1PRQA 1IYSA 1ALQA 4U3TA 2OWJA 3QP1A 1E4DA 2J80A 4I3JA 4S2JA 5A90A 2VV6A 4MLLA 5KZHA 4HQAA 3IBRA 1FCMA 1I2SA 5HPIA 3LGOA 2OV5A 2R78A 4B88A 3UMDA 1K54C 1MWTA 4BQMA 2ZC5B 1PYYA 3A3JA 4QB8A 1SDNA 2EWVA 2C6WB 5FASA 4FH2A 2V0UA 1NRFA 1HD8A 1STZA 3NC8A 1PZOA 1PWCA 4OPZA 2ZBBA 2ZC6B 1OJ5A 3HLBA 4OQIA 2Z2MB 4X1MA 4S2LA 1JWPA 2D02A 2CMNA 2EX8A 2XSSA 5HWWA 1MWRA 2A24B 2ZQDA 3N8LA 3OZHA 4YFMA 1U60A 2VGLM 4G3VA 2P9VB 3A3IA 2LB5A 1JVJA 3NULA 3HLEA 4S2OA 2VX8A 4R3AA 3PAEA 3ZG9B 5HZHA 4BD0A 3BFEA 4H6JB 1ERMA 4EU0A 3IS2A 4GB7A 5CXWA 2Y79A 3NHQA 3HUMA 3V39A 2EX9A 5KSCA 4UA9A 5DFYA 3KYZA 5FAQA 5E43A 2H0YA 5DTKA 1IKIA 4HBTA 2VA0A 4EESA 3G32A 4P87A 1LLBA 2R9WA 2ZOIA 4JF6A 5GHZA 3T50A 4LRXC 5J8XA 2PHYA 4EQ1A 3LEQA 3BJNA 3MXQA 4RA7A 4EUZA 4NXGA 3C8CA 1M40A 1ZHHB 4FSFA 5FDSA 4ZJ1A 5F5YA 5F6AA 3UPOA 5EVIA 1O07A 4OP5A 2O9CA 4MBFA 5EVID 2WKRA 3WS4A 2XA7S 3OPRA 1CQAA 4LCMA 3O5YA 4WEKA 2QJ5A 1VETB 4B4XA 4FD8A 3OC2A 3VE3A 2H28A 3H7WA 1K57A 1NZOA 1S1YA 2GNXA 3G34A 4MNRA 1BUEA 4WZ5C 4BENA 3KSHA 3W4OA 1IEMA 4CLCC 4GOGA 3UE1A 3IF5A 5AQ7A 4WELA 3LYXA 3BWLA 2JKRM 4Y17A 5TR7A 3A3FA 3BFCA 4OOLA 1E3UA 3FPVA 3Q7VB 2ZLYA 5E2EA 5HD3A 2A2LA 3MF0A 3D9YA 1E3UD 5I5LA 1XXMA 3TSGA 1K0KA 4ARZB 5TGFA 4PAUA 1ES5A 4X1LA 2BTFP 1DP6A 1QMEA 2EA9A 2V1BA 3HREA 3HLDA 3LIEA 3UPNA 5MC7A 2W27A 5FQKA 4JKTA 3LIDA 3N7WA 4CLCB 2Y2HA 2XROA 2Y2QA 3CITA 1H5XA 4F3LB 1KE3A 1MY8A 3IX4A 4IBXA 2Y91A 4CQHA 3IWQA 4KQRA 4EERA 3A0VA 1GHMA 5CHUA 3LI8A 4CLCE 1FSYA 5EOOA 1TD5A 1OMEA 3UN7A 3BLMA 2G7UA 1TEMA 4UQIS 2LB9A 2V8CA 4FTXA 5CRFA 4GN2A 1BSGA 2XD1A 1YM1A 2BLSA 2JKTM 2B02A 3WS0A 4X69A 4YNRA 4NETA 2WKIA 1K25A 3RH8B 1SDEA 1S0WA 2J8YA 2ZJ9A 4UAAA 5EM0A 4S2NC 2FFYA 1T18A 3M2JA 1L3LA 4N9LA 3SH9A 2JKGA 1YMSA 4LFUA 4C3QA 1QMFA 3C7VA 4QHCA 3IXGA 3H82A 2Y2MA 2X01A 4D60A 3A3EA 1HZOA 3GTCA 4K0WA 3AGFA 5FI6A 1D1JA 4YINA 4N1HA 4X6TA 4WN5A 4DE1A 4MDZA 3KSIA 4OQHA 1YPRA 4E3IA 1Q2PA 3UO9A 2FFFB 3T4QA 3F1PB 4ZTKA 4BJPA 5G18A 2OAQ1 3E2KA 2D01A 3T1RA 4LV1A 2WGIA 1VQQA 4HP9A 5C5KA 2XD5A 2P04A 2NUPC 2PU2A 4ME4A 1JWZA 4WZ4A 4DN0A 4PM8A 4IEDA 4RYEA 5KIZA 4HESA 2BASA 5CERA 1XGIA 2Z6DA 3VP1A 3B42A 4E3KA 1P9RA 3JYIA 3MQQA 4GHIA 4E3LA 3G2ZA 2ZM0A 2HF6A 1W63Q 3AGEA 1YQSA 5HDCA 1PZPA 1VEUA 3FG8A 2VZWA 1DJAA 1W8QA 2ZD8A 1TS8A 2XK1A 5L2FA 1F2KA 2ZQAA 2O99A 1MZUA 2XDMA 3KYQA 4YOFA 3VSKA 3B33A 2Y2OA 3DAVA 5HD5A 2JKTI 1FR6A 1YMXA 3FC7A 1K4EA 5GHXA 3NDGA 3EEHA 1PIOA 2L0WA 1XJ3A 2PR6A 3MKFA 4HJ4A 1TDGA 5AVFA 1S67L 3S7NA 3K3DA 4MEZA 5KMWA 1BLCA 3E4OA 4DDYA 5HSQA 4OPQA 5DVAA 2OLUA 4IHQA 4OLGA 4WZ5A 4U0TA 2VGLS 3G35A 5DF8A 2OAP1 3K3CA 5EUAA 1SHVA 1MBLA 2B5RA 2PU4A 4Q8IA 4II7A 1VM1A 3A0RA 4KUKA 1N9LA 1PI5A 2BG1A 4GS9A 3CG5A 2NUTC 3MR0A 3IS2B 3HLGA 4WYYA 3UMEA 1NYYA 1CEFA 2K7SA 5CHMA 3A3DA 5KSHA 1K57C 4OOYA 1CI9A 2FZ0A 2MJ6A 4UEYA 5FSRA 4DJ3A 3WRZA 1MWSA 3MS6A 4E3MA 1WE4A 5IHVA 3P09A 4HJ6A 1K6RA 5EPHA 5F82A 3MFXA 4GW9A 4PM6A 1YLWA 3HUNA 3VMAA 3HBRA 1F98A 5EVIB 2ZMAA 4QD4A 1KOUA 3ZYTA 2XGNA 3MZEA 3OCNA 1TS7A 2PDRA 3TW8A 5IU1A 4EWFA 3QNCA 3S4XA 1EROA 1XKZA 4GJ4A 1L0EA 3M6HA 2PRFA 4E6WA 4M3KA 4HH2A 1OTEA 3C4PA 3H7WB 3HL9A 1ODVA 4X55A 3SS4A 3W8KA 2ZQCA 4GDNA 3BM6A 1HLUP 2JN7A 4LRYC 4OLDA 4HI4A 1S4RA 1N9OA 3OPLA 3V5MA 3NY4A 4G3KA 2PAVP 5DTSA 1G28A 1KDWA 4LV3A 3GVBA 1JWVA 4NK3A 3RFBA 3WS1A 1M6KA 3IXBA 1V9YA 2JKFA 1YLJA 4FUWA 4JF5A 2QMIA 3BECA 3W4PA 2GZAA 5DTTA 2M7VA 5E2GA 3Q81A 3BYDA 1GA0A 3CPTA 1BTLA 3NBLA 1C3BA 1FIKA 4XUZA 5I94A 3S7OA 1OT6A 4JF4A 2E8JA 4JXWA 1RP5A 2HV1A 2X02A 3RJUA 3C5AA 4GD8A 2EXAA 3OPPA 1H8YA 5AQAA 4O7DA 3IXDA 1W5DA 4PKYG 5HDDA 3G31A 4RX2A 3T4LA 5A92A 4KG5A 3C38A 3PBSA 4HHDA 4LGWA 1T1CA 3E2LA 5DFXA 2QZ6A 3BQ8A 1G6OA 3PBOA 4E04A 5TJJA 4P6ZM 3IBJA 3NDEA 1XGJA 3WS2A 3H82B 4DXCA 1XFQA 2PBYA 3CJMA 5EVLA 1DY6A 3CZDA 2HJEA 3LIAA 1IOUA 3L7HA 2JCHA 3F1NA 1LT0A 5DF9A 5A93A 3AGDA 2WAFA 4I39A 4X53A 4ETZA 1NLYA 4MCWA 2J9OA 2XF3A 5M18A 1OJGA 3UY6A 2ZMVA 1Y54A 4BWIA 4HH3A 1HTZA 3BFGA 3FZCA 3VOZA 4E3NA 4QWOA 2Y2IA 2Y2PA 1ERQA 2ZQ8A 5FQIA 4EUVA 1OPXA 5HAQA 4UA6A 4C6YA 2G2UA 5L10A 2HJ9C 3IH9A 3V67A 5FDHA 5EECA 4L9GA 4I3IA 4JXGA 4EBLA 3C2WA 2XRNA 3T4KA 3TE8A 3IWIA 2V8FA 4GHIB 1JTGA 3RXXA 1F5MA 4A5RA 4PHTA 3CLOA 5CGXA 2Q0OA 5EOEA 3JVVA 4Q0HA 5F68A 2EX2A 4Y3IA 3IQAA 4WF0A 2L1MA 2CC1A 4KUOA 1W63M 4KZ6A 3O87A 1K4FA 1J3WA 1TS6A 5J7EA 1XP4A 2HGVA 1AWIA 4FOFA 5FATA 1FCOA 5HL1A 1SKFA 4KZ8A 4Y7PA 4KG2A 4Z9QA 2V1AA 5GL9A 4ZJ3A 2INWA 3PTEA 5IT5A 2XFTA 4Y0TA 3KSGA 5E2FA 1RGYA 1BULA 3S22A 4MN7A 3MQ0A 4N1XA 4NXBA 5FQQA 4DKIA 3LCEA 4B9OA 4DMZA 2ZMFA 3IH8A 3P98A 1S66L 3UE6A 4JGRA 5HARA 4IVKA 2HDUA 1OTIA 3CMZA 5CGWA 4G3WA 4UHUA 3TRCA 1CEGA 1KVLA 1DRMA 5GLAA 3VE4A 4CPKA 3C4OA 1W8YA 4GS9B 3DBAA 1H0MA 1IYOA 1E25A 4I38A 2B18A 1FR1A 4QY6A 1PWDA 3LY3A 3GQZA 3MBZA 4WBGA 1UWNX 4BMWA 1LSXA 2JBFA 3LO7A 2J9PA 4XUXA 3QHYA 3EGDC 4S2MA 3MZFA 3UDXA 4OKPA 1Q2QA 2W1RA 1ZC2A 4DRTA 4ZBEA 1PWGA 3IWOA 2ZM2A 5DKKA 3EWKA 5FEGA 4B4ZA 2YKFA 3UDIA 2W3EA 3BFFA 4GD6A 1KVMA 3VV4A 3EQUA 1PW1A 4WUJA 3ZG0A 3T4TA 1BZAA 3DW0A 2P7JA 3ISGA 3LICA 3A0SA 5FI2A 4OVDA 1XPBA 4Y13A 3RTYA 1BYWA 1OTBA 4QJGA 3ITBA 2V20A 1I2WA 2Y4AA 4HOIA 1CK3A 4R70A 2Q9MA 1DP9A 3W4QA 4L9FA 4R3JA 2WZZA 1LI0A 1XX2A 5EVEA 4IBRA 4UA7A 1F9IA 5EV0A 2EFXA 3UB6A 2HPBA 2QPNA 4R4RA 3ZFZA 1MKMA 2UV0E 2ZQ9A 4NXFA 3FKWA 3UE3A 3PYPA 4KQQA 1BT5A 1BLSA 5FI7A 1D06A 3ZVWA 1GHPA 3QP5A 3ZGAB 1JTDA 5EE8A 4JLFA 1KGFA 2GX5A 3NI9A 3HCYA 3MXRA 1BLHA 4R38A 2EWWA 2WGWA 3GSGA 2G2WA 4LV2A 4R23A 1X0OA 2WK0A 5DKLA 3CPTB 1TS0A 1K6SA 4JGOA 4JXVA 5J3WA 4JGPA 2Y59A 3LI9A 3ZVTA 5FQMA 2IWDA 2KX6A 4EW7A 4K91A 4R3BA 1EW0A 2W3HA 3DWKA 4S2KA 4WEJA 1PFLA 3IX8A 3DTIA 3FV7A 4MN6A 3V3RA 4ZAMA 1IKGA 3MQOA 2P08A 1P97A 3QP4A 5IS1A 3IF6A 1KE0A 3IXHA 5DJTA 1OTDA 1PNEA 1MC0A 3N8SA 1PI4A 2IWBA 5HAIA 1SZVA 4ID4A 2V9AA 2W1TA 2M7UA 1GSXA 1DP8A 5CTNA 4NEED 1S1ZA 4EV4A 4S2PA 4Y0OA 3T4SA 3F1NB 3LR0A 3GV9A 2OOLA 4DJ2A 3EEAA 4DF6A 1CJFA 3S7QA 1G6AA 1EI5A 2DNSA 4L9EA 1XJ6A 4UQIM 2VEAA 1CI8A 4BBTA 5CEDA 4RQ9A 1S6RA 3NOUC 1NYMA 3OCLA 1FSWA 2EXBA 3QP2A 3M2KA 1ESIA 2Y2GA 3ZCZA 3TOIA 2PYPA 3CUEA 3B3XA 4O01A 3VFHA 4KZ3A 4NXEA 5HWTA 1WYCA 2RCXA 4JBFA 2A49A 2WKEA 4KQDA 1RCJA 2W0NA 2I72A 3R7WA 5CECA 4PM5A 4EQIA 1YSQA 4QY5A 1KGEA 1YLTA 1ESUA 3T4JA 4F94A 2H0TA 5FAPA 5GLBA 5TBMA 3UDFA 5BOHA 5FAOA 1ONHA 4PM9A 3I7JA 4Q0JA 4Z1WA 4AFIA 4DXBA 4HNBA 3QP6A 3ZNYA 3FWLA 3T1SA 3S7PA 2QKPA 4P0MA 3CWFA 4BBUA 5F83A 3VP0A 2VGJA 1K56A 1ES2A 4R6LA 1GA9A 1N4OA 3B47A 3F1OA 1K56D 1J9MA 2ZC7A 4MBHA 1CF0A 1FILA 4KZAA 2ZQ7A 5HL6A 1KDSA 4O0PA 3S1YA 3IHBA 2KOIA 4R0QA 2HDQA 2VJWA 3LFVA 2WKHA 2B95A 3G6OA 4ZDXA 5F1FA 3UB5P 5A91A 2Y2LA 3BEBA 4XT2A 4Y15A 1L0FA 3IT9A 1SCWA 1YLYA 3L9KA 3E4PA 5L07A 1ZG4A 2O0YA 4EEUA 5G4YA 4E6XA 2O9AA 3OLOA 3Q1FA 3U4LP 4I3AA 1RGZA 5FEFA 1L0DA 3FYZA 2ZC3B 4XXRA 1N9NA 4DDSA 3ZQ5A 3T1XA 3LR4A 3DTMA 3SS5A 1VHMA 3EGXC 2K2NA 5E2HA 4X25A 1T19A 1SKOA 3HVFA 5HFOA 2Z2LB 1AXBA 5CEBA 1PW8A 2IWCA 3KO6A 4D2OA 5DJUA 3GR2A 2KLIA 2HP6A 3SOIA 4M4XA 2VV8A 1LI9A 1A0KA 3GDIA 4KQOA 4E3JA 5CHJA 2ZL1A 1W7FA 3N4IA 1YT4A 1EWZA 5HWVA 5HX9A 2WADA 5HPFA 3ULFA 4WM9A 4GKUA 2HP9A 4KZ7A 3GECA 3LR5A 1KGGA 4BD1A 4ZRRA 2W3GA 3ZG8B 4BLMA 2VLGA 3PBTA 3O86A 4MBKA 5L8MA 3DTKA 4LPZA 4P85A 1JNUA 4BBVA 1NY0A 1K55A 2WYXA 3MMHA 5F69A 1ZTUA 3IX3A 3CI6A 4KZBA 4X68A 2ZM8A 2C5WB 3NCKA 3RXWA 1HVBA 2RL3A 1ACFA 4IUHA 4Y5FA 4U0XA 5FA7A 3NIAA 1NRJA 2DRWA 1IYPA 1NWZA 1FQGA 4OPRA 1T1BA 1V9ZA 2HDSA 2H10A 2GDNA 2Z6CA 4LCLA 4KZ4A 4IUKA 2PT7A 2KDKA 4OOMA 3MKEA 2QHKA 1MXOA 3W2ZA 1VB6A 5HDSA 2YKHA 1VEUB 2WGWB 3O88A 3UB7A 3OBFA 1YSPA 4S2IA 4C75A 3IF6C 3G30A 4RX3A 3E4QA 3PBNA 3C7UA 3VFFA 3LIBA 4EXOA 3NJAA 2XEPA 4GNUA 3UPPA 2V1ZA 5AQ9A 4IVIA 4NKPA 3LUQA 4X56A 3HUOA 1P9WA 2JC7A 3MJQA 2Q9NA 2XFSA 3EOIA 5CGSA 3PAGA 3BY8A 3VP3A 3ITAA 1GCEA 2PD7A 5LBRA 1GSWA 1FCNA 4DE2A 4BL2A 2XH9A 1O7EA 1W79A 2Y55A 3DTEA 2XR0A 3CUEC 1NJ4A 3CAXA 3BQAA 3IF6B 1Z6FA 1K38A 3ICYA 3M6BA 5U47A 1L2SA 1ONGA 3SZTA 2J3TC 2ZOHA 4GDBA 2W1TB 1NLZA 5CTMA 4R4SA 2WAEA 4DE0A 5DF7A 1UWPX 4YWZA 2XQZA 3Q82A 4PKYA 2O9BA 1XA1A 1I5QA 2VK3A 3P7NA 3C30A 4N9KA 3UNWA 3WWXA 4OQ0A 3K2NA 1MPLA 4Y2FA 5AVEA 2GJ3A 2ACGA 2ZC4B 3VP2A 4E3OA 1L0GA 3T12B 1ZKJA 2QYBA 1TDLA 3MZDA 2VKSA 3SH8A 3HLCA 3JPUA 2A24A 4LLOB 3E0YA 2K31A 2P9VA 5HW3A 3QNBA 2W3DA 1OTAA 3R7WB 1WA9A 4L0LA 1K54A 3P01A 2I9VA 1LL8A 2PYRA 2W3FA 5A8BA 3V3SA 1IELA 4H6JA 3ZG7B 5TBMB 3LY4A 2V2FF 3E98A 2OWHA 3VOLA 3UE0A 1TF1A 3N6IA 3VSLA 2M1CA 1G68A 3GMWA 5FQJA 4QU3A 4Y0UA 1WYBA 3IHAA 3HLWA 1T1AA 1Z09A 2A3UA 2JKRI 5GLCA 3VP4A 3F1OB 4P6BA 4PPRA 1D7EA 2PR5A 1MKIA 3BFDA 4KENB 3NECA 3ZG5A 2Y8HA 4FCFA 4HIAA 5GHYA 4HP4A 4EEPA 1LHYA 2FH5A 3DWZA 3T4OA 3D72A 4LRZE 4O8GA 2UWXA 3U2AA 5TFQA 4GLQA 4MMNA 1Y28A 2XA7M 4XT2B 3Q07A 3NOPC 3PR6A 2HP5A 3ZHHA 2PD8A 1VETA 2JE5A 3G2YA 5G4ZA 1DJCA 4EBNA 5CX7A 1YLZA 2AVXA 3HJKA 2OLVA 1YAXA 3LIFA 3V50A 4EBPA 4EETB 2HDRA 4K08A 4NG2A 4MN5A 2DMWA 1H3QA 1NZUA 5K5BA 4HEFA
chains in the Genus database with same CATH topology
3LI8A 4I39A 4ETZA 1NLYA 4MCWA 4R6LA 4CLCE 3B47A 3F1OA 1TD5A 1YKDA 2G7UA 1S4SA 2QJ7A 1OJGA 2L4RA 3LR3A 2LB9A 4UQIS 5HL6A 2WKQA 2ZMVA 4O0PA 4BWIA 4HH3A 2JKTM 2KOIA 2B02A 3LFVA 2VJWA 4YNRA 4ARZA 3RH8B 3PXPA 3SW1A 3BY9A 4EUVA 1OPXA 3G6OA 3TJZC 3KSFA 2HJ9C 1T18A 4XT2A 3V67A 4L9GA 4I3IA 3C2WA 2XRNA 3T4KA 4WL9A 3H82A 3TE8A 5AJGA 4GHIB 5FL3A 3JVUA 3E4PA 2O0YA 4EEUA 4P6ZS 1F5MA 4PHTA 5G4YA 3CLOA 2O9AA 3OLOA 4I5SA 4CLCA 4I3AA 3EQVA 4F3LA 4WLAA 4WN5A 4CLCD 3JVVA 1N9NA 3ZQ5A 4Q0HA 4MDZA 3LR4A 3KSIA 4HY8A 5F68A 4Y3IA 1VHMA 3EGXC 2K2NA 2JHEA 4WF0A 2L1MA 4KUOA 3NOTC 1T19A 1W63M 5J4EA 3T4QA 3F1PB 4BJPA 3UB8A 2OAQ1 1TS6A 5J7EA 2D01A 3KO6A 2HGVA 4FOFA 5DJUA 4JGQA 2KLIA 4HP9A 3BW6A 2V1AA 4M4XA 5C5KA 2VV8A 2INWA 5IT5A 2P04A 3GDIA 4KQOA 2NUPC 4ME4A 3UB9A 4DN0A 3OOVA 5KIZA 4QPRA 2J3WA 2QWSA 1GSVA 3KSGA 2BASA 1UGUA 4MN7A 3MQ0A 2WKPA 2Z6DA 4NXBA 2J3TD 5HWVA 1OT9A 1H8MA 5HPFA 3ULFA 2IA2A 3B42A 1P9RA 4B9OA 4DMZA 2ZMFA 3MQQA 4GHIA 3GECA 4Q0IA 3LR5A 1S66L 1XFNA 4ZRRA 2W3GA 3UE6A 4JGRA 2VLGA 2HF6A 1W63Q 3PBTA 1OTIA 5L8MA 4B93A 5HDCA 5EFWA 3FG8A 2VZWA 4G3WA 3PBQA 3TRCA 3R4KA 1TS8A 4LPZA 4IJGA 1DRMA 3PHYA 3VE4A 1LSVA 4ETXA 1JNUA 2O99A 1MZUA 3KYQA 4GS9B 4YOFA 3DBAA 4BBVA 3B33A 3F1PA 4I38A 2B18A 3HJIA 3MMHA 1XJ4A 3PBRA 1ZTUA 5F69A 3CI6A 5HD5A 2JKTI 3FPWA 1UWNX 4BMWA 1LSXA 4GCZA 1IFQA 4IUHA 3FC7A 4Y5FA 3D3OA 1NRJA 1P0ZA 1NWZA 3EEHA 3EGDC 1LSWA 2V0WA 2L0WA 1XJ3A 2PR6A 2W1RA 1T1BA 1V9ZA 4HJ4A 5DKKA 3EWKA 3H9WA 5AVFA 1S67L 3S7NA 2VV7A 3K3DA 2Z6CA 4HJ3A 4IUKA 2YKFA 2W3EA 3E4OA 5HSQA 3KX0X 1XJ2A 2KDKA 2PT7A 4OOMA 4IHQA 3VV4A 2QHKA 3EQUA 3W2ZA 1VB6A 5HDSA 2YKHA 4WUJA 3T4TA 2P7JA 2VGLS 3LICA 2OAP1 2OWJA 3A0SA 3K3CA 2J80A 4I3JA 3UB7A 3OBFA 3RTYA 1YSPA 2VV6A 4HQAA 1BYWA 1OTBA 4II7A 3A0RA 3IBRA 4KUKA 1N9LA 4GS9A 5HPIA 4HOIA 2NUTC 3MR0A 4R70A 3E4QA 2R78A 3PBNA 3IS2B 3UMDA 1DP9A 3LIBA 4L9FA 4EXOA 3NJAA 3UMEA 1F9IA 2EWVA 2K7SA 5KSHA 2V0UA 4NKPA 2FZ0A 3LUQA 3UB6A 2MJ6A 1STZA 4UEYA 1P9WA 3MJQA 1MKMA 2ZBBA 4DJ3A 1OJ5A 3EOIA 4NXFA 3BY8A 3UE3A 3PYPA 2D02A 2CMNA 2PD7A 5LBRA 1D06A 1GSWA 2XSSA 5HWWA 4HJ6A 2A24B 3MFXA 4GW9A 2GX5A 2VGLM 4G3VA 3HCYA 2LB5A 4R38A 3CUEC 1F98A 2EWWA 3CAXA 3BQAA 1KOUA 3ZYTA 3OCNA 1TS7A 2PDRA 3TW8A 2VX8A 4R3AA 5IU1A 3ICYA 5HZHA 1X0OA 2J3TC 5DKLA 4H6JB 2ZOHA 4GJ4A 2W1TB 1NLZA 4EU0A 1TS0A 4HH2A 1OTEA 3IS2A 4JGOA 5J3WA 3H7WB 4JGPA 2Y79A 3LI9A 3NHQA 1UWPX 4YWZA 1ODVA 4PKYA 2O9BA 2KX6A 5DFYA 3KYZA 2JN7A 4EW7A 4LRYC 3P7NA 3C30A 1EW0A 2VA0A 4EESA 2W3HA 3K2NA 4HI4A 4Y2FA 1S4RA 5AVEA 2GJ3A 2ZOIA 4WEJA 3T50A 4LRXC 1N9OA 4G3KA 2QYBA 2PHYA 4EQ1A 3BJNA 3MXQA 2VKSA 4MN6A 1G28A 4NXGA 3C8CA 2A24A 4LLOB 3RFBA 3E0YA 1ZHHB 2K31A 3MQOA 2P08A 1P97A 4FSFA 1V9YA 5IS1A 5F5YA 2W3DA 5F6AA 1OTAA 5DJTA 1OTDA 2O9CA 3R7WB 1WA9A 1MC0A 2WKRA 4L0LA 2XA7S 2GZAA 3P01A 3O5YA 2I9VA 1LL8A 2PYRA 2QJ5A 2W3FA 4WEKA 5A8BA 4H6JA 2M7VA 3OC2A 3VE3A 2V9AA 2W1TA 5TBMB 2M7UA 1GSXA 2H28A 3E98A 3S7OA 3H7WA 1OT6A 2OWHA 1DP8A 1S1YA 4NEED 1S1ZA 3VOLA 3T4SA 1TF1A 3F1NB 3LR0A 2HV1A 2GNXA 2M1CA 2OOLA 4DJ2A 3EEAA 3KSHA 3S7QA 4CLCC 4L9EA 1T1AA 1XJ6A 4UQIM 4WELA 2VEAA 3LYXA 2JKRI 3F1OB 3BWLA 2JKRM 4BBTA 1D7EA 2PR5A 4RQ9A 3NOUC 3OCLA 4OOLA 3FPVA 5HD3A 4PKYG 2A2LA 5HDDA 3MF0A 2Y8HA 4HIAA 2PYPA 3CUEA 4O01A 5I5LA 4HP4A 4EEPA 3T4LA 2FH5A 3T4OA 3D72A 4LRZE 4NXEA 4O8GA 5HWTA 4ARZB 3C38A 3U2AA 3PBSA 4HHDA 4GLQA 4PAUA 4MMNA 1T1CA 1Y28A 4KQDA 2XA7M 5DFXA 1DP6A 4XT2B 2W0NA 3R7WA 3NOPC 2EA9A 3PR6A 2V1BA 1YSQA 3BQ8A 1G6OA 3PBOA 4E04A 5TJJA 4P6ZM 3IBJA 3H82B 1XFQA 2PD8A 3LIEA 5MC7A 3T4JA 2W27A 5G4ZA 5TBMA 2HJEA 3LIAA 3LIDA 1IOUA 5CX7A 4CLCB 2XROA 3F1NA 3CITA 4Q0JA 4Z1WA 4F3LB 4AFIA 3HJKA 4HNBA 1YAXA 4CQHA 3S7PA 3LIFA 2QKPA 1LT0A 3CWFA 5DF9A 4BBUA 4EETB 4K08A 4EERA 3A0VA 4MN5A 2DMWA 1H3QA 5K5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI8 A;  4I39 A;  4R6L A;  3F1O A;  1S4S A;  2QJ7 A;  1OJG A;  2L4R A;  2WKQ A;  4HH3 A;  2B02 A;  3RH8 B;  3SW1 A;  3BY9 A;  3G6O A;  1T18 A;  4XT2 A;  4L9G A;  4I3I A;  3C2W A;  4WL9 A;  3H82 A;  4GHI B;  3E4P A;  4EEU A;  5G4Y A;  3CLO A;  3OLO A;  4I5S A;  4I3A A;  4F3L A;  4WLA A;  4WN5 A;  1N9N A;  3ZQ5 A;  4HY8 A;  5F68 A;  2JHE A;  4WF0 A;  2L1M A;  4KUO A;  3NOT C;  1T19 A;  5J4E A;  3F1P B;  3UB8 A;  1TS6 A;  5J7E A;  2D01 A;  5DJU A;  4JGQ A;  4HP9 A;  2V1A A;  4M4X A;  2VV8 A;  2INW A;  3GDI A;  3UB9 A;  5KIZ A;  2QWS A;  1GSV A;  2BAS A;  1UGU A;  2WKP A;  2Z6D A;  4NXB A;  5HWV A;  1OT9 A;  3ULF A;  4B9O A;  3MQQ A;  4GHI A;  3GEC A;  1S66 L;  1XFN A;  3UE6 A;  4JGR A;  2VLG A;  1OTI A;  5HDC A;  5EFW A;  3FG8 A;  1TS8 A;  4LPZ A;  1DRM A;  3PHY A;  3VE4 A;  1LSV A;  1JNU A;  1MZU A;  4GS9 B;  4BBV A;  3B33 A;  3F1P A;  4I38 A;  3HJI A;  5F69 A;  1XJ4 A;  5HD5 A;  1UWN X;  1LSX A;  4GCZ A;  3FC7 A;  1P0Z A;  1NWZ A;  3EEH A;  1LSW A;  2V0W A;  2L0W A;  1XJ3 A;  2PR6 A;  1T1B A;  1V9Z A;  4HJ4 A;  5DKK A;  3EWK A;  3H9W A;  5AVF A;  1S67 L;  2VV7 A;  3K3D A;  2Z6C A;  4HJ3 A;  2YKF A;  3E4O A;  5HSQ A;  3KX0 X;  1XJ2 A;  2KDK A;  2QHK A;  1VB6 A;  5HDS A;  2YKH A;  4WUJ A;  2P7J A;  3LIC A;  2OWJ A;  3A0S A;  3K3C A;  2J80 A;  4I3J A;  3UB7 A;  3RTY A;  2VV6 A;  4HQA A;  1BYW A;  1OTB A;  3A0R A;  3IBR A;  4KUK A;  1N9L A;  4GS9 A;  4HOI A;  3MR0 A;  4R70 A;  3E4Q A;  2R78 A;  3IS2 B;  3UMD A;  1DP9 A;  3LIB A;  4L9F A;  4EXO A;  3NJA A;  3UME A;  1F9I A;  2K7S A;  2V0U A;  3LUQ A;  3UB6 A;  3MJQ A;  2ZBB A;  4DJ3 A;  1OJ5 A;  4NXF A;  3BY8 A;  3PYP A;  2D02 A;  2CMN A;  2PD7 A;  1D06 A;  1GSW A;  5HWW A;  4HJ6 A;  2A24 B;  3MFX A;  4GW9 A;  4R38 A;  1F98 A;  3CAX A;  1KOU A;  1TS7 A;  2PDR A;  4R3A A;  5IU1 A;  3ICY A;  5HZH A;  1X0O A;  5DKL A;  4H6J B;  2ZOH A;  1TS0 A;  4HH2 A;  1OTE A;  3IS2 A;  4JGO A;  5J3W A;  3H7W B;  4JGP A;  3LI9 A;  3NHQ A;  1UWP X;  4YWZ A;  1ODV A;  4PKY A;  2KX6 A;  2JN7 A;  4EW7 A;  4LRY C;  3P7N A;  1EW0 A;  4EES A;  4HI4 A;  1S4R A;  5AVE A;  2GJ3 A;  2ZOI A;  3T50 A;  4LRX C;  1N9O A;  2PHY A;  4EQ1 A;  3MXQ A;  4MN6 A;  1G28 A;  4NXG A;  3C8C A;  2A24 A;  4LLO B;  3MQO A;  1P97 A;  1V9Y A;  5IS1 A;  5F5Y A;  5F6A A;  1OTA A;  5DJT A;  1OTD A;  1WA9 A;  2WKR A;  2I9V A;  1LL8 A;  2PYR A;  2QJ5 A;  5A8B A;  4H6J A;  3VE3 A;  2V9A A;  5TBM B;  1GSX A;  2H28 A;  3H7W A;  1OT6 A;  2OWH A;  1DP8 A;  1S1Y A;  1S1Z A;  3VOL A;  3F1N B;  2HV1 A;  2M1C A;  2OOL A;  4DJ2 A;  4L9E A;  1T1A A;  1XJ6 A;  2VEA A;  3LYX A;  3F1O B;  3BWL A;  4BBT A;  1D7E A;  2PR5 A;  4RQ9 A;  3NOU C;  5HD3 A;  4PKY G;  5HDD A;  4HIA A;  2PYP A;  5I5L A;  4HP4 A;  4EEP A;  3D72 A;  4LRZ E;  5HWT A;  4NXE A;  4HHD A;  1T1C A;  1Y28 A;  4KQD A;  1DP6 A;  4XT2 B;  2W0N A;  3NOP C;  2EA9 A;  2V1B A;  4E04 A;  3H82 B;  1XFQ A;  2PD8 A;  3LIE A;  2W27 A;  5G4Z A;  5TBM A;  3LIA A;  3LID A;  3F1N A;  4F3L B;  3HJK A;  4HNB A;  3LIF A;  2QKP A;  1LT0 A;  3CWF A;  4BBU A;  4EET B;  4K08 A;  4EER A;  3A0V A;  4MN5 A; 
#chains in the Genus database with same CATH topology
 1SKO B;  1YKD A;  1S4S A;  4OON A;  2QJ7 A;  3SS3 A;  2L4R A;  3Q7V A;  3LR3 A;  3VOY A;  3GRJ A;  2P74 A;  2WKQ A;  4N92 A;  3BLS A;  3WRT A;  4K0X A;  1K55 C;  4ARZ A;  3TG9 A;  1H8Z A;  3PXP A;  3SW1 A;  4OH0 A;  3BY9 A;  1TVF A;  2ZL1 B;  4LV0 A;  3TJZ C;  3KSF A;  5JYO A;  4HBU A;  1Y4O A;  4WL9 A;  5M19 A;  2WUQ A;  4ESP A;  5AJG A;  5FL3 A;  4OQG A;  3JVU A;  3O3V A;  1KE4 A;  4P6Z S;  4I5S A;  4CLC A;  4CJN A;  4H8R A;  3EQV A;  4F3L A;  4WLA A;  4OP8 A;  2Y2J A;  4CLC D;  2WGV A;  1ES4 A;  4RVA A;  1LL9 A;  4KG6 A;  4BL3 A;  3ZDJ A;  3CHW P;  4HY8 A;  1IYQ A;  2JHE A;  5EVI C;  3NOT C;  4PM7 A;  3MXS A;  5J4E A;  3HLF A;  2X71 A;  3UB8 A;  4KZ5 A;  5JYP A;  3SH7 A;  4JGQ A;  2H5S A;  1ES3 A;  3BW6 A;  2EX6 A;  3UB9 A;  3OOV A;  2OSU A;  2VGK A;  4QPR A;  2J3W A;  2QWS A;  1GSV A;  2E8I A;  1UGU A;  2WKP A;  2J3T D;  1OT9 A;  1H8M A;  2IA2 A;  1FOF A;  2J7V A;  3Q7Z A;  5EM1 A;  4JPM A;  1GHI A;  3MFD A;  5GLD A;  3T1Q B;  4Q0I A;  5F1G A;  4GZB A;  1XFN A;  4DE3 A;  2HZ5 A;  1XA7 A;  4B93 A;  4OPY A;  5EFW A;  3PBQ A;  1DJB A;  3R4K A;  1YLP A;  4IJG A;  4PMA A;  5M1A A;  3PHY A;  1LSV A;  3KYE A;  4ETX A;  2XLN A;  4FH4 A;  2EFU A;  3BRM A;  4WMC A;  3WS5 A;  2Y2N A;  5AQB A;  5L09 A;  3F1P A;  1G5U A;  4WMC D;  2DCF A;  2Y2K A;  3PBR A;  3HJI A;  1XJ4 A;  1MWU A;  3MSH A;  1NXY A;  1LL5 A;  3FPW A;  4S2N A;  3G4P A;  4LEN A;  3FKV A;  4GCZ A;  1IFQ A;  2PBD P;  3D3O A;  3QP8 A;  2R9X A;  1P0Z A;  4R1G A;  4ZJ2 A;  2WZX A;  1LSW A;  2V0W A;  3LEZ A;  5D3O A;  1N9B A;  3H9W A;  3N8R A;  5FQ9 A;  4JXS A;  2VV7 A;  3ZNT A;  4KZ9 A;  4HJ3 A;  3D4F A;  1BLP A;  5HAP A;  1ZG6 A;  3KX0 X;  1XJ2 A;  3OPH A;  1PRQ A;  1IYS A;  1ALQ A;  4U3T A;  2OWJ A;  3QP1 A;  1E4D A;  2J80 A;  4I3J A;  4S2J A;  5A90 A;  2VV6 A;  4MLL A;  5KZH A;  4HQA A;  3IBR A;  1FCM A;  1I2S A;  5HPI A;  3LGO A;  2OV5 A;  2R78 A;  4B88 A;  3UMD A;  1K54 C;  1MWT A;  4BQM A;  2ZC5 B;  1PYY A;  3A3J A;  4QB8 A;  1SDN A;  2EWV A;  2C6W B;  5FAS A;  4FH2 A;  2V0U A;  1NRF A;  1HD8 A;  1STZ A;  3NC8 A;  1PZO A;  1PWC A;  4OPZ A;  2ZBB A;  2ZC6 B;  1OJ5 A;  3HLB A;  4OQI A;  2Z2M B;  4X1M A;  4S2L A;  1JWP A;  2D02 A;  2CMN A;  2EX8 A;  2XSS A;  5HWW A;  1MWR A;  2A24 B;  2ZQD A;  3N8L A;  3OZH A;  4YFM A;  1U60 A;  2VGL M;  4G3V A;  2P9V B;  3A3I A;  2LB5 A;  1JVJ A;  3NUL A;  3HLE A;  4S2O A;  2VX8 A;  4R3A A;  3PAE A;  3ZG9 B;  5HZH A;  4BD0 A;  3BFE A;  4H6J B;  1ERM A;  4EU0 A;  3IS2 A;  4GB7 A;  5CXW A;  2Y79 A;  3NHQ A;  3HUM A;  3V39 A;  2EX9 A;  5KSC A;  4UA9 A;  5DFY A;  3KYZ A;  5FAQ A;  5E43 A;  2H0Y A;  5DTK A;  1IKI A;  4HBT A;  2VA0 A;  4EES A;  3G32 A;  4P87 A;  1LLB A;  2R9W A;  2ZOI A;  4JF6 A;  5GHZ A;  3T50 A;  4LRX C;  5J8X A;  2PHY A;  4EQ1 A;  3LEQ A;  3BJN A;  3MXQ A;  4RA7 A;  4EUZ A;  4NXG A;  3C8C A;  1M40 A;  1ZHH B;  4FSF A;  5FDS A;  4ZJ1 A;  5F5Y A;  5F6A A;  3UPO A;  5EVI A;  1O07 A;  4OP5 A;  2O9C A;  4MBF A;  5EVI D;  2WKR A;  3WS4 A;  2XA7 S;  3OPR A;  1CQA A;  4LCM A;  3O5Y A;  4WEK A;  2QJ5 A;  1VET B;  4B4X A;  4FD8 A;  3OC2 A;  3VE3 A;  2H28 A;  3H7W A;  1K57 A;  1NZO A;  1S1Y A;  2GNX A;  3G34 A;  4MNR A;  1BUE A;  4WZ5 C;  4BEN A;  3KSH A;  3W4O A;  1IEM A;  4CLC C;  4GOG A;  3UE1 A;  3IF5 A;  5AQ7 A;  4WEL A;  3LYX A;  3BWL A;  2JKR M;  4Y17 A;  5TR7 A;  3A3F A;  3BFC A;  4OOL A;  1E3U A;  3FPV A;  3Q7V B;  2ZLY A;  5E2E A;  5HD3 A;  2A2L A;  3MF0 A;  3D9Y A;  1E3U D;  5I5L A;  1XXM A;  3TSG A;  1K0K A;  4ARZ B;  5TGF A;  4PAU A;  1ES5 A;  4X1L A;  2BTF P;  1DP6 A;  1QME A;  2EA9 A;  2V1B A;  3HRE A;  3HLD A;  3LIE A;  3UPN A;  5MC7 A;  2W27 A;  5FQK A;  4JKT A;  3LID A;  3N7W A;  4CLC B;  2Y2H A;  2XRO A;  2Y2Q A;  3CIT A;  1H5X A;  4F3L B;  1KE3 A;  1MY8 A;  3IX4 A;  4IBX A;  2Y91 A;  4CQH A;  3IWQ A;  4KQR A;  4EER A;  3A0V A;  1GHM A;  5CHU A;  3LI8 A;  4CLC E;  1FSY A;  5EOO A;  1TD5 A;  1OME A;  3UN7 A;  3BLM A;  2G7U A;  1TEM A;  4UQI S;  2LB9 A;  2V8C A;  4FTX A;  5CRF A;  4GN2 A;  1BSG A;  2XD1 A;  1YM1 A;  2BLS A;  2JKT M;  2B02 A;  3WS0 A;  4X69 A;  4YNR A;  4NET A;  2WKI A;  1K25 A;  3RH8 B;  1SDE A;  1S0W A;  2J8Y A;  2ZJ9 A;  4UAA A;  5EM0 A;  4S2N C;  2FFY A;  1T18 A;  3M2J A;  1L3L A;  4N9L A;  3SH9 A;  2JKG A;  1YMS A;  4LFU A;  4C3Q A;  1QMF A;  3C7V A;  4QHC A;  3IXG A;  3H82 A;  2Y2M A;  2X01 A;  4D60 A;  3A3E A;  1HZO A;  3GTC A;  4K0W A;  3AGF A;  5FI6 A;  1D1J A;  4YIN A;  4N1H A;  4X6T A;  4WN5 A;  4DE1 A;  4MDZ A;  3KSI A;  4OQH A;  1YPR A;  4E3I A;  1Q2P A;  3UO9 A;  2FFF B;  3T4Q A;  3F1P B;  4ZTK A;  4BJP A;  5G18 A;  2OAQ 1;  3E2K A;  2D01 A;  3T1R A;  4LV1 A;  2WGI A;  1VQQ A;  4HP9 A;  5C5K A;  2XD5 A;  2P04 A;  2NUP C;  2PU2 A;  4ME4 A;  1JWZ A;  4WZ4 A;  4DN0 A;  4PM8 A;  4IED A;  4RYE A;  5KIZ A;  4HES A;  2BAS A;  5CER A;  1XGI A;  2Z6D A;  3VP1 A;  3B42 A;  4E3K A;  1P9R A;  3JYI A;  3MQQ A;  4GHI A;  4E3L A;  3G2Z A;  2ZM0 A;  2HF6 A;  1W63 Q;  3AGE A;  1YQS A;  5HDC A;  1PZP A;  1VEU A;  3FG8 A;  2VZW A;  1DJA A;  1W8Q A;  2ZD8 A;  1TS8 A;  2XK1 A;  5L2F A;  1F2K A;  2ZQA A;  2O99 A;  1MZU A;  2XDM A;  3KYQ A;  4YOF A;  3VSK A;  3B33 A;  2Y2O A;  3DAV A;  5HD5 A;  2JKT I;  1FR6 A;  1YMX A;  3FC7 A;  1K4E A;  5GHX A;  3NDG A;  3EEH A;  1PIO A;  2L0W A;  1XJ3 A;  2PR6 A;  3MKF A;  4HJ4 A;  1TDG A;  5AVF A;  1S67 L;  3S7N A;  3K3D A;  4MEZ A;  5KMW A;  1BLC A;  3E4O A;  4DDY A;  5HSQ A;  4OPQ A;  5DVA A;  2OLU A;  4IHQ A;  4OLG A;  4WZ5 A;  4U0T A;  2VGL S;  3G35 A;  5DF8 A;  2OAP 1;  3K3C A;  5EUA A;  1SHV A;  1MBL A;  2B5R A;  2PU4 A;  4Q8I A;  4II7 A;  1VM1 A;  3A0R A;  4KUK A;  1N9L A;  1PI5 A;  2BG1 A;  4GS9 A;  3CG5 A;  2NUT C;  3MR0 A;  3IS2 B;  3HLG A;  4WYY A;  3UME A;  1NYY A;  1CEF A;  2K7S A;  5CHM A;  3A3D A;  5KSH A;  1K57 C;  4OOY A;  1CI9 A;  2FZ0 A;  2MJ6 A;  4UEY A;  5FSR A;  4DJ3 A;  3WRZ A;  1MWS A;  3MS6 A;  4E3M A;  1WE4 A;  5IHV A;  3P09 A;  4HJ6 A;  1K6R A;  5EPH A;  5F82 A;  3MFX A;  4GW9 A;  4PM6 A;  1YLW A;  3HUN A;  3VMA A;  3HBR A;  1F98 A;  5EVI B;  2ZMA A;  4QD4 A;  1KOU A;  3ZYT A;  2XGN A;  3MZE A;  3OCN A;  1TS7 A;  2PDR A;  3TW8 A;  5IU1 A;  4EWF A;  3QNC A;  3S4X A;  1ERO A;  1XKZ A;  4GJ4 A;  1L0E A;  3M6H A;  2PRF A;  4E6W A;  4M3K A;  4HH2 A;  1OTE A;  3C4P A;  3H7W B;  3HL9 A;  1ODV A;  4X55 A;  3SS4 A;  3W8K A;  2ZQC A;  4GDN A;  3BM6 A;  1HLU P;  2JN7 A;  4LRY C;  4OLD A;  4HI4 A;  1S4R A;  1N9O A;  3OPL A;  3V5M A;  3NY4 A;  4G3K A;  2PAV P;  5DTS A;  1G28 A;  1KDW A;  4LV3 A;  3GVB A;  1JWV A;  4NK3 A;  3RFB A;  3WS1 A;  1M6K A;  3IXB A;  1V9Y A;  2JKF A;  1YLJ A;  4FUW A;  4JF5 A;  2QMI A;  3BEC A;  3W4P A;  2GZA A;  5DTT A;  2M7V A;  5E2G A;  3Q81 A;  3BYD A;  1GA0 A;  3CPT A;  1BTL A;  3NBL A;  1C3B A;  1FIK A;  4XUZ A;  5I94 A;  3S7O A;  1OT6 A;  4JF4 A;  2E8J A;  4JXW A;  1RP5 A;  2HV1 A;  2X02 A;  3RJU A;  3C5A A;  4GD8 A;  2EXA A;  3OPP A;  1H8Y A;  5AQA A;  4O7D A;  3IXD A;  1W5D A;  4PKY G;  5HDD A;  3G31 A;  4RX2 A;  3T4L A;  5A92 A;  4KG5 A;  3C38 A;  3PBS A;  4HHD A;  4LGW A;  1T1C A;  3E2L A;  5DFX A;  2QZ6 A;  3BQ8 A;  1G6O A;  3PBO A;  4E04 A;  5TJJ A;  4P6Z M;  3IBJ A;  3NDE A;  1XGJ A;  3WS2 A;  3H82 B;  4DXC A;  1XFQ A;  2PBY A;  3CJM A;  5EVL A;  1DY6 A;  3CZD A;  2HJE A;  3LIA A;  1IOU A;  3L7H A;  2JCH A;  3F1N A;  1LT0 A;  5DF9 A;  5A93 A;  3AGD A;  2WAF A;  4I39 A;  4X53 A;  4ETZ A;  1NLY A;  4MCW A;  2J9O A;  2XF3 A;  5M18 A;  1OJG A;  3UY6 A;  2ZMV A;  1Y54 A;  4BWI A;  4HH3 A;  1HTZ A;  3BFG A;  3FZC A;  3VOZ A;  4E3N A;  4QWO A;  2Y2I A;  2Y2P A;  1ERQ A;  2ZQ8 A;  5FQI A;  4EUV A;  1OPX A;  5HAQ A;  4UA6 A;  4C6Y A;  2G2U A;  5L10 A;  2HJ9 C;  3IH9 A;  3V67 A;  5FDH A;  5EEC A;  4L9G A;  4I3I A;  4JXG A;  4EBL A;  3C2W A;  2XRN A;  3T4K A;  3TE8 A;  3IWI A;  2V8F A;  4GHI B;  1JTG A;  3RXX A;  1F5M A;  4A5R A;  4PHT A;  3CLO A;  5CGX A;  2Q0O A;  5EOE A;  3JVV A;  4Q0H A;  5F68 A;  2EX2 A;  4Y3I A;  3IQA A;  4WF0 A;  2L1M A;  2CC1 A;  4KUO A;  1W63 M;  4KZ6 A;  3O87 A;  1K4F A;  1J3W A;  1TS6 A;  5J7E A;  1XP4 A;  2HGV A;  1AWI A;  4FOF A;  5FAT A;  1FCO A;  5HL1 A;  1SKF A;  4KZ8 A;  4Y7P A;  4KG2 A;  4Z9Q A;  2V1A A;  5GL9 A;  4ZJ3 A;  2INW A;  3PTE A;  5IT5 A;  2XFT A;  4Y0T A;  3KSG A;  5E2F A;  1RGY A;  1BUL A;  3S22 A;  4MN7 A;  3MQ0 A;  4N1X A;  4NXB A;  5FQQ A;  4DKI A;  3LCE A;  4B9O A;  4DMZ A;  2ZMF A;  3IH8 A;  3P98 A;  1S66 L;  3UE6 A;  4JGR A;  5HAR A;  4IVK A;  2HDU A;  1OTI A;  3CMZ A;  5CGW A;  4G3W A;  4UHU A;  3TRC A;  1CEG A;  1KVL A;  1DRM A;  5GLA A;  3VE4 A;  4CPK A;  3C4O A;  1W8Y A;  4GS9 B;  3DBA A;  1H0M A;  1IYO A;  1E25 A;  4I38 A;  2B18 A;  1FR1 A;  4QY6 A;  1PWD A;  3LY3 A;  3GQZ A;  3MBZ A;  4WBG A;  1UWN X;  4BMW A;  1LSX A;  2JBF A;  3LO7 A;  2J9P A;  4XUX A;  3QHY A;  3EGD C;  4S2M A;  3MZF A;  3UDX A;  4OKP A;  1Q2Q A;  2W1R A;  1ZC2 A;  4DRT A;  4ZBE A;  1PWG A;  3IWO A;  2ZM2 A;  5DKK A;  3EWK A;  5FEG A;  4B4Z A;  2YKF A;  3UDI A;  2W3E A;  3BFF A;  4GD6 A;  1KVM A;  3VV4 A;  3EQU A;  1PW1 A;  4WUJ A;  3ZG0 A;  3T4T A;  1BZA A;  3DW0 A;  2P7J A;  3ISG A;  3LIC A;  3A0S A;  5FI2 A;  4OVD A;  1XPB A;  4Y13 A;  3RTY A;  1BYW A;  1OTB A;  4QJG A;  3ITB A;  2V20 A;  1I2W A;  2Y4A A;  4HOI A;  1CK3 A;  4R70 A;  2Q9M A;  1DP9 A;  3W4Q A;  4L9F A;  4R3J A;  2WZZ A;  1LI0 A;  1XX2 A;  5EVE A;  4IBR A;  4UA7 A;  1F9I A;  5EV0 A;  2EFX A;  3UB6 A;  2HPB A;  2QPN A;  4R4R A;  3ZFZ A;  1MKM A;  2UV0 E;  2ZQ9 A;  4NXF A;  3FKW A;  3UE3 A;  3PYP A;  4KQQ A;  1BT5 A;  1BLS A;  5FI7 A;  1D06 A;  3ZVW A;  1GHP A;  3QP5 A;  3ZGA B;  1JTD A;  5EE8 A;  4JLF A;  1KGF A;  2GX5 A;  3NI9 A;  3HCY A;  3MXR A;  1BLH A;  4R38 A;  2EWW A;  2WGW A;  3GSG A;  2G2W A;  4LV2 A;  4R23 A;  1X0O A;  2WK0 A;  5DKL A;  3CPT B;  1TS0 A;  1K6S A;  4JGO A;  4JXV A;  5J3W A;  4JGP A;  2Y59 A;  3LI9 A;  3ZVT A;  5FQM A;  2IWD A;  2KX6 A;  4EW7 A;  4K91 A;  4R3B A;  1EW0 A;  2W3H A;  3DWK A;  4S2K A;  4WEJ A;  1PFL A;  3IX8 A;  3DTI A;  3FV7 A;  4MN6 A;  3V3R A;  4ZAM A;  1IKG A;  3MQO A;  2P08 A;  1P97 A;  3QP4 A;  5IS1 A;  3IF6 A;  1KE0 A;  3IXH A;  5DJT A;  1OTD A;  1PNE A;  1MC0 A;  3N8S A;  1PI4 A;  2IWB A;  5HAI A;  1SZV A;  4ID4 A;  2V9A A;  2W1T A;  2M7U A;  1GSX A;  1DP8 A;  5CTN A;  4NEE D;  1S1Z A;  4EV4 A;  4S2P A;  4Y0O A;  3T4S A;  3F1N B;  3LR0 A;  3GV9 A;  2OOL A;  4DJ2 A;  3EEA A;  4DF6 A;  1CJF A;  3S7Q A;  1G6A A;  1EI5 A;  2DNS A;  4L9E A;  1XJ6 A;  4UQI M;  2VEA A;  1CI8 A;  4BBT A;  5CED A;  4RQ9 A;  1S6R A;  3NOU C;  1NYM A;  3OCL A;  1FSW A;  2EXB A;  3QP2 A;  3M2K A;  1ESI A;  2Y2G A;  3ZCZ A;  3TOI A;  2PYP A;  3CUE A;  3B3X A;  4O01 A;  3VFH A;  4KZ3 A;  4NXE A;  5HWT A;  1WYC A;  2RCX A;  4JBF A;  2A49 A;  2WKE A;  4KQD A;  1RCJ A;  2W0N A;  2I72 A;  3R7W A;  5CEC A;  4PM5 A;  4EQI A;  1YSQ A;  4QY5 A;  1KGE A;  1YLT A;  1ESU A;  3T4J A;  4F94 A;  2H0T A;  5FAP A;  5GLB A;  5TBM A;  3UDF A;  5BOH A;  5FAO A;  1ONH A;  4PM9 A;  3I7J A;  4Q0J A;  4Z1W A;  4AFI A;  4DXB A;  4HNB A;  3QP6 A;  3ZNY A;  3FWL A;  3T1S A;  3S7P A;  2QKP A;  4P0M A;  3CWF A;  4BBU A;  5F83 A;  3VP0 A;  2VGJ A;  1K56 A;  1ES2 A;  4R6L A;  1GA9 A;  1N4O A;  3B47 A;  3F1O A;  1K56 D;  1J9M A;  2ZC7 A;  4MBH A;  1CF0 A;  1FIL A;  4KZA A;  2ZQ7 A;  5HL6 A;  1KDS A;  4O0P A;  3S1Y A;  3IHB A;  2KOI A;  4R0Q A;  2HDQ A;  2VJW A;  3LFV A;  2WKH A;  2B95 A;  3G6O A;  4ZDX A;  5F1F A;  3UB5 P;  5A91 A;  2Y2L A;  3BEB A;  4XT2 A;  4Y15 A;  1L0F A;  3IT9 A;  1SCW A;  1YLY A;  3L9K A;  3E4P A;  5L07 A;  1ZG4 A;  2O0Y A;  4EEU A;  5G4Y A;  4E6X A;  2O9A A;  3OLO A;  3Q1F A;  3U4L P;  4I3A A;  1RGZ A;  5FEF A;  1L0D A;  3FYZ A;  2ZC3 B;  4XXR A;  1N9N A;  4DDS A;  3ZQ5 A;  3T1X A;  3LR4 A;  3DTM A;  3SS5 A;  1VHM A;  3EGX C;  2K2N A;  5E2H A;  4X25 A;  1T19 A;  1SKO A;  3HVF A;  5HFO A;  2Z2L B;  1AXB A;  5CEB A;  1PW8 A;  2IWC A;  3KO6 A;  4D2O A;  5DJU A;  3GR2 A;  2KLI A;  2HP6 A;  3SOI A;  4M4X A;  2VV8 A;  1LI9 A;  1A0K A;  3GDI A;  4KQO A;  4E3J A;  5CHJ A;  2ZL1 A;  1W7F A;  3N4I A;  1YT4 A;  1EWZ A;  5HWV A;  5HX9 A;  2WAD A;  5HPF A;  3ULF A;  4WM9 A;  4GKU A;  2HP9 A;  4KZ7 A;  3GEC A;  3LR5 A;  1KGG A;  4BD1 A;  4ZRR A;  2W3G A;  3ZG8 B;  4BLM A;  2VLG A;  3PBT A;  3O86 A;  4MBK A;  5L8M A;  3DTK A;  4LPZ A;  4P85 A;  1JNU A;  4BBV A;  1NY0 A;  1K55 A;  2WYX A;  3MMH A;  5F69 A;  1ZTU A;  3IX3 A;  3CI6 A;  4KZB A;  4X68 A;  2ZM8 A;  2C5W B;  3NCK A;  3RXW A;  1HVB A;  2RL3 A;  1ACF A;  4IUH A;  4Y5F A;  4U0X A;  5FA7 A;  3NIA A;  1NRJ A;  2DRW A;  1IYP A;  1NWZ A;  1FQG A;  4OPR A;  1T1B A;  1V9Z A;  2HDS A;  2H10 A;  2GDN A;  2Z6C A;  4LCL A;  4KZ4 A;  4IUK A;  2PT7 A;  2KDK A;  4OOM A;  3MKE A;  2QHK A;  1MXO A;  3W2Z A;  1VB6 A;  5HDS A;  2YKH A;  1VEU B;  2WGW B;  3O88 A;  3UB7 A;  3OBF A;  1YSP A;  4S2I A;  4C75 A;  3IF6 C;  3G30 A;  4RX3 A;  3E4Q A;  3PBN A;  3C7U A;  3VFF A;  3LIB A;  4EXO A;  3NJA A;  2XEP A;  4GNU A;  3UPP A;  2V1Z A;  5AQ9 A;  4IVI A;  4NKP A;  3LUQ A;  4X56 A;  3HUO A;  1P9W A;  2JC7 A;  3MJQ A;  2Q9N A;  2XFS A;  3EOI A;  5CGS A;  3PAG A;  3BY8 A;  3VP3 A;  3ITA A;  1GCE A;  2PD7 A;  5LBR A;  1GSW A;  1FCN A;  4DE2 A;  4BL2 A;  2XH9 A;  1O7E A;  1W79 A;  2Y55 A;  3DTE A;  2XR0 A;  3CUE C;  1NJ4 A;  3CAX A;  3BQA A;  3IF6 B;  1Z6F A;  1K38 A;  3ICY A;  3M6B A;  5U47 A;  1L2S A;  1ONG A;  3SZT A;  2J3T C;  2ZOH A;  4GDB A;  2W1T B;  1NLZ A;  5CTM A;  4R4S A;  2WAE A;  4DE0 A;  5DF7 A;  1UWP X;  4YWZ A;  2XQZ A;  3Q82 A;  4PKY A;  2O9B A;  1XA1 A;  1I5Q A;  2VK3 A;  3P7N A;  3C30 A;  4N9K A;  3UNW A;  3WWX A;  4OQ0 A;  3K2N A;  1MPL A;  4Y2F A;  5AVE A;  2GJ3 A;  2ACG A;  2ZC4 B;  3VP2 A;  4E3O A;  1L0G A;  3T12 B;  1ZKJ A;  2QYB A;  1TDL A;  3MZD A;  2VKS A;  3SH8 A;  3HLC A;  3JPU A;  2A24 A;  4LLO B;  3E0Y A;  2K31 A;  2P9V A;  5HW3 A;  3QNB A;  2W3D A;  1OTA A;  3R7W B;  1WA9 A;  4L0L A;  1K54 A;  3P01 A;  2I9V A;  1LL8 A;  2PYR A;  2W3F A;  5A8B A;  3V3S A;  1IEL A;  4H6J A;  3ZG7 B;  5TBM B;  3LY4 A;  2V2F F;  3E98 A;  2OWH A;  3VOL A;  3UE0 A;  1TF1 A;  3N6I A;  3VSL A;  2M1C A;  1G68 A;  3GMW A;  5FQJ A;  4QU3 A;  4Y0U A;  1WYB A;  3IHA A;  3HLW A;  1T1A A;  1Z09 A;  2A3U A;  2JKR I;  5GLC A;  3VP4 A;  3F1O B;  4P6B A;  4PPR A;  1D7E A;  2PR5 A;  1MKI A;  3BFD A;  4KEN B;  3NEC A;  3ZG5 A;  2Y8H A;  4FCF A;  4HIA A;  5GHY A;  4HP4 A;  4EEP A;  1LHY A;  2FH5 A;  3DWZ A;  3T4O A;  3D72 A;  4LRZ E;  4O8G A;  2UWX A;  3U2A A;  5TFQ A;  4GLQ A;  4MMN A;  1Y28 A;  2XA7 M;  4XT2 B;  3Q07 A;  3NOP C;  3PR6 A;  2HP5 A;  3ZHH A;  2PD8 A;  1VET A;  2JE5 A;  3G2Y A;  5G4Z A;  1DJC A;  4EBN A;  5CX7 A;  1YLZ A;  2AVX A;  3HJK A;  2OLV A;  1YAX A;  3LIF A;  3V50 A;  4EBP A;  4EET B;  2HDR A;  4K08 A;  4NG2 A;  4MN5 A;  2DMW A;  1H3Q A;  1NZU A;  5K5B A;  4HEF A; 
#chains in the Genus database with same CATH homology
 3LI8 A;  4I39 A;  4ETZ A;  1NLY A;  4MCW A;  4R6L A;  4CLC E;  3B47 A;  3F1O A;  1TD5 A;  1YKD A;  2G7U A;  1S4S A;  2QJ7 A;  1OJG A;  2L4R A;  3LR3 A;  2LB9 A;  4UQI S;  5HL6 A;  2WKQ A;  2ZMV A;  4O0P A;  4BWI A;  4HH3 A;  2JKT M;  2KOI A;  2B02 A;  3LFV A;  2VJW A;  4YNR A;  4ARZ A;  3RH8 B;  3PXP A;  3SW1 A;  3BY9 A;  4EUV A;  1OPX A;  3G6O A;  3TJZ C;  3KSF A;  2HJ9 C;  1T18 A;  4XT2 A;  3V67 A;  4L9G A;  4I3I A;  3C2W A;  2XRN A;  3T4K A;  4WL9 A;  3H82 A;  3TE8 A;  5AJG A;  4GHI B;  5FL3 A;  3JVU A;  3E4P A;  2O0Y A;  4EEU A;  4P6Z S;  1F5M A;  4PHT A;  5G4Y A;  3CLO A;  2O9A A;  3OLO A;  4I5S A;  4CLC A;  4I3A A;  3EQV A;  4F3L A;  4WLA A;  4WN5 A;  4CLC D;  3JVV A;  1N9N A;  3ZQ5 A;  4Q0H A;  4MDZ A;  3LR4 A;  3KSI A;  4HY8 A;  5F68 A;  4Y3I A;  1VHM A;  3EGX C;  2K2N A;  2JHE A;  4WF0 A;  2L1M A;  4KUO A;  3NOT C;  1T19 A;  1W63 M;  5J4E A;  3T4Q A;  3F1P B;  4BJP A;  3UB8 A;  2OAQ 1;  1TS6 A;  5J7E A;  2D01 A;  3KO6 A;  2HGV A;  4FOF A;  5DJU A;  4JGQ A;  2KLI A;  4HP9 A;  3BW6 A;  2V1A A;  4M4X A;  5C5K A;  2VV8 A;  2INW A;  5IT5 A;  2P04 A;  3GDI A;  4KQO A;  2NUP C;  4ME4 A;  3UB9 A;  4DN0 A;  3OOV A;  5KIZ A;  4QPR A;  2J3W A;  2QWS A;  1GSV A;  3KSG A;  2BAS A;  1UGU A;  4MN7 A;  3MQ0 A;  2WKP A;  2Z6D A;  4NXB A;  2J3T D;  5HWV A;  1OT9 A;  1H8M A;  5HPF A;  3ULF A;  2IA2 A;  3B42 A;  1P9R A;  4B9O A;  4DMZ A;  2ZMF A;  3MQQ A;  4GHI A;  3GEC A;  4Q0I A;  3LR5 A;  1S66 L;  1XFN A;  4ZRR A;  2W3G A;  3UE6 A;  4JGR A;  2VLG A;  2HF6 A;  1W63 Q;  3PBT A;  1OTI A;  5L8M A;  4B93 A;  5HDC A;  5EFW A;  3FG8 A;  2VZW A;  4G3W A;  3PBQ A;  3TRC A;  3R4K A;  1TS8 A;  4LPZ A;  4IJG A;  1DRM A;  3PHY A;  3VE4 A;  1LSV A;  4ETX A;  1JNU A;  2O99 A;  1MZU A;  3KYQ A;  4GS9 B;  4YOF A;  3DBA A;  4BBV A;  3B33 A;  3F1P A;  4I38 A;  2B18 A;  3HJI A;  3MMH A;  1XJ4 A;  3PBR A;  1ZTU A;  5F69 A;  3CI6 A;  5HD5 A;  2JKT I;  3FPW A;  1UWN X;  4BMW A;  1LSX A;  4GCZ A;  1IFQ A;  4IUH A;  3FC7 A;  4Y5F A;  3D3O A;  1NRJ A;  1P0Z A;  1NWZ A;  3EEH A;  3EGD C;  1LSW A;  2V0W A;  2L0W A;  1XJ3 A;  2PR6 A;  2W1R A;  1T1B A;  1V9Z A;  4HJ4 A;  5DKK A;  3EWK A;  3H9W A;  5AVF A;  1S67 L;  3S7N A;  2VV7 A;  3K3D A;  2Z6C A;  4HJ3 A;  4IUK A;  2YKF A;  2W3E A;  3E4O A;  5HSQ A;  3KX0 X;  1XJ2 A;  2KDK A;  2PT7 A;  4OOM A;  4IHQ A;  3VV4 A;  2QHK A;  3EQU A;  3W2Z A;  1VB6 A;  5HDS A;  2YKH A;  4WUJ A;  3T4T A;  2P7J A;  2VGL S;  3LIC A;  2OAP 1;  2OWJ A;  3A0S A;  3K3C A;  2J80 A;  4I3J A;  3UB7 A;  3OBF A;  3RTY A;  1YSP A;  2VV6 A;  4HQA A;  1BYW A;  1OTB A;  4II7 A;  3A0R A;  3IBR A;  4KUK A;  1N9L A;  4GS9 A;  5HPI A;  4HOI A;  2NUT C;  3MR0 A;  4R70 A;  3E4Q A;  2R78 A;  3PBN A;  3IS2 B;  3UMD A;  1DP9 A;  3LIB A;  4L9F A;  4EXO A;  3NJA A;  3UME A;  1F9I A;  2EWV A;  2K7S A;  5KSH A;  2V0U A;  4NKP A;  2FZ0 A;  3LUQ A;  3UB6 A;  2MJ6 A;  1STZ A;  4UEY A;  1P9W A;  3MJQ A;  1MKM A;  2ZBB A;  4DJ3 A;  1OJ5 A;  3EOI A;  4NXF A;  3BY8 A;  3UE3 A;  3PYP A;  2D02 A;  2CMN A;  2PD7 A;  5LBR A;  1D06 A;  1GSW A;  2XSS A;  5HWW A;  4HJ6 A;  2A24 B;  3MFX A;  4GW9 A;  2GX5 A;  2VGL M;  4G3V A;  3HCY A;  2LB5 A;  4R38 A;  3CUE C;  1F98 A;  2EWW A;  3CAX A;  3BQA A;  1KOU A;  3ZYT A;  3OCN A;  1TS7 A;  2PDR A;  3TW8 A;  2VX8 A;  4R3A A;  5IU1 A;  3ICY A;  5HZH A;  1X0O A;  2J3T C;  5DKL A;  4H6J B;  2ZOH A;  4GJ4 A;  2W1T B;  1NLZ A;  4EU0 A;  1TS0 A;  4HH2 A;  1OTE A;  3IS2 A;  4JGO A;  5J3W A;  3H7W B;  4JGP A;  2Y79 A;  3LI9 A;  3NHQ A;  1UWP X;  4YWZ A;  1ODV A;  4PKY A;  2O9B A;  2KX6 A;  5DFY A;  3KYZ A;  2JN7 A;  4EW7 A;  4LRY C;  3P7N A;  3C30 A;  1EW0 A;  2VA0 A;  4EES A;  2W3H A;  3K2N A;  4HI4 A;  4Y2F A;  1S4R A;  5AVE A;  2GJ3 A;  2ZOI A;  4WEJ A;  3T50 A;  4LRX C;  1N9O A;  4G3K A;  2QYB A;  2PHY A;  4EQ1 A;  3BJN A;  3MXQ A;  2VKS A;  4MN6 A;  1G28 A;  4NXG A;  3C8C A;  2A24 A;  4LLO B;  3RFB A;  3E0Y A;  1ZHH B;  2K31 A;  3MQO A;  2P08 A;  1P97 A;  4FSF A;  1V9Y A;  5IS1 A;  5F5Y A;  2W3D A;  5F6A A;  1OTA A;  5DJT A;  1OTD A;  2O9C A;  3R7W B;  1WA9 A;  1MC0 A;  2WKR A;  4L0L A;  2XA7 S;  2GZA A;  3P01 A;  3O5Y A;  2I9V A;  1LL8 A;  2PYR A;  2QJ5 A;  2W3F A;  4WEK A;  5A8B A;  4H6J A;  2M7V A;  3OC2 A;  3VE3 A;  2V9A A;  2W1T A;  5TBM B;  2M7U A;  1GSX A;  2H28 A;  3E98 A;  3S7O A;  3H7W A;  1OT6 A;  2OWH A;  1DP8 A;  1S1Y A;  4NEE D;  1S1Z A;  3VOL A;  3T4S A;  1TF1 A;  3F1N B;  3LR0 A;  2HV1 A;  2GNX A;  2M1C A;  2OOL A;  4DJ2 A;  3EEA A;  3KSH A;  3S7Q A;  4CLC C;  4L9E A;  1T1A A;  1XJ6 A;  4UQI M;  4WEL A;  2VEA A;  3LYX A;  2JKR I;  3F1O B;  3BWL A;  2JKR M;  4BBT A;  1D7E A;  2PR5 A;  4RQ9 A;  3NOU C;  3OCL A;  4OOL A;  3FPV A;  5HD3 A;  4PKY G;  2A2L A;  5HDD A;  3MF0 A;  2Y8H A;  4HIA A;  2PYP A;  3CUE A;  4O01 A;  5I5L A;  4HP4 A;  4EEP A;  3T4L A;  2FH5 A;  3T4O A;  3D72 A;  4LRZ E;  4NXE A;  4O8G A;  5HWT A;  4ARZ B;  3C38 A;  3U2A A;  3PBS A;  4HHD A;  4GLQ A;  4PAU A;  4MMN A;  1T1C A;  1Y28 A;  4KQD A;  2XA7 M;  5DFX A;  1DP6 A;  4XT2 B;  2W0N A;  3R7W A;  3NOP C;  2EA9 A;  3PR6 A;  2V1B A;  1YSQ A;  3BQ8 A;  1G6O A;  3PBO A;  4E04 A;  5TJJ A;  4P6Z M;  3IBJ A;  3H82 B;  1XFQ A;  2PD8 A;  3LIE A;  5MC7 A;  3T4J A;  2W27 A;  5G4Z A;  5TBM A;  2HJE A;  3LIA A;  3LID A;  1IOU A;  5CX7 A;  4CLC B;  2XRO A;  3F1N A;  3CIT A;  4Q0J A;  4Z1W A;  4F3L B;  4AFI A;  3HJK A;  4HNB A;  1YAX A;  4CQH A;  3S7P A;  3LIF A;  2QKP A;  1LT0 A;  3CWF A;  5DF9 A;  4BBU A;  4EET B;  4K08 A;  4EER A;  3A0V A;  4MN5 A;  2DMW A;  1H3Q A;  5K5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...