1TS8A

Structure of the pr cis planar intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts8A00
2WKPA 5DJUA 2L4RA 4PKYG 2QHKA 3LUQA 2PD7A 2W27A 4R6LA 4HQAA 5F69A 2INWA 2OWHA 3BWLA 2EA9A 1ODVA 3LIDA 4MN5A 3PHYA 3F1PA 5AVEA 4I38A 5HDSA 1OT6A 2VLGA 3VE3A 1XJ2A 3F1OB 1N9LA 1TS7A 1D7EA 1UWNX 2QWSA 1NWZA 1T1CA 1XJ3A 1OTEA 3K3DA 5G4YA 3VOLA 1S1ZA 1F9IA 1OTBA 4JGPA 3PYPA 4YWZA 4XT2B 2A24A 2HV1A 1T18A 3FG8A 3OLOA 1D06A 1P0ZA 4LRZE 3CAXA 2M1CA 2Z6DA 3LYXA 1N9NA 4NXFA 2D02A 2V1AA 4PKYA 4BBTA 4I5SA 5HD3A 4HOIA 4R70A 2ZBBA 1LSWA 3A0VA 1XFQA 4H6JB 2J80A 3IS2B 3SW1A 2GJ3A 2H28A 4HJ3A 4EW7A 1OTAA 3F1NA 5J4EA 3C8CA 2ZOIA 4E04A 4MN6A 5DJTA 3UB6A 1TS6A 3CWFA 4EERA 4JGRA 2QKPA 4K08A 4WN5A 5F5YA 2OOLA 2ZOHA 4KQDA 1VB6A 3NHQA 4BBVA 3UB9A 3LI8A 3ULFA 4F3LB 3UE6A 1GSVA 2VEAA 4JGQA 3D72A 1OTIA 1WA9A 1OJ5A 1XFNA 1DP9A 4B9OA 5IU1A 3FC7A 4I39A 4I3IA 2JN7A 5EFWA 4EETB 3LIEA 4XT2A 1DRMA 1V9YA 1OJGA 3CLOA 1JNUA 4DJ2A 4EEUA 1GSXA 2WKRA 3H82B 3E4OA 3A0SA 1MZUA 4GS9B 4GHIB 3HJKA 1LSVA 3NOPC 4LPZA 3MJQA 3EEHA 5HDDA 4EESA 3EWKA 2BASA 1LSXA 1XJ6A 4NXEA 1DP8A 3GDIA 2D01A 3MQQA 4H6JA 4HY8A 3IS2A 4BBUA 4L9GA 2OWJA 1T19A 3UMDA 3G6OA 1EW0A 5KIZA 1Y28A 3H7WB 4L9EA 4HH3A 4HJ4A 3UB8A 4NXBA 1G28A 4I3JA 3RTYA 5J7EA 2PD8A 4WF0A 1GSWA 4NXGA 4F3LA 3BY9A 1S67L 5HDCA 2L1MA 3VE4A 1P97A 4HNBA 4HH2A 1T1AA 1LL8A 5HZHA 2I9VA 2VV8A 2QJ5A 3HJIA 1V9ZA 4DJ3A 2V9AA 2PHYA 2WKQA 1UWPX 1UGUA 4GCZA 4KUOA 5HWVA 3IBRA 4LLOB 2YKFA 4GW9A 4WUJA 3H82A 2KX6A 4R3AA 5G4ZA 3MXQA 4GHIA 4GS9A 4EEPA 1XJ4A 5F6AA 3F1OA 3LICA 1F98A 1OT9A 2V0WA 3RH8B 4HP4A 5F68A 1S4SA 2R78A 4EQ1A 2QJ7A 4HP9A 3ICYA 4HIAA 2VV6A 1BYWA 2PYPA 2Z6CA 4HI4A 1LT0A 3F1NB 3B33A 5J3WA 5TBMB 3H7WA 3ZQ5A 1T1BA 3MFXA 4M4XA 3BY8A 4R38A 3LIFA 2PDRA 3UMEA 1TS8A 4LRXC 1OTDA 3K3CA 2L0WA 2K7SA 4RQ9A 3H9WA 2PR6A 5DKKA 2VV7A 3T50A 2PR5A 2JHEA 5AVFA 4LRYC 2V1BA 5I5LA 3NOTC 1TS0A 2CMNA 3MR0A 3P7NA 4WLAA 5IS1A 4KUKA 4L9FA 4EXOA 5HWTA 3F1PB 3KX0X 2PYRA 3GECA 1N9OA 3E4PA 3LIAA 2B02A 2W0NA 5HSQA 4I3AA 4JGOA 5HD5A 4HHDA 3LIBA 4WL9A 2KDKA 2YKHA 1X0OA 3E4QA 3NJAA 1S1YA 1KOUA 5HWWA 2A24B 5TBMA 2P7JA 3UB7A 3LI9A 2V0UA 4HJ6A 3A0RA 1DP6A 1S66L 5A8BA 5DKLA 3NOUC 3MQOA 1S4RA 3C2WA
chains in the Genus database with same CATH superfamily
2WKPA 4PKYG 1IOUA 3OPRA 3V3RA 4IUHA 1J9MA 1YLPA 3VP1A 4ETXA 5F69A 1KE0A 2PAVP 2HP6A 2G2WA 2X01A 4QJGA 2HDUA 3LIDA 4GJ4A 4FTXA 1NZUA 4OP5A 1WYCA 3OZHA 4MDZA 1NXYA 2VX8A 1BLHA 2IWCA 2ZMAA 3VE3A 1XJ2A 5E2EA 5L2FA 1UWNX 1NWZA 2EXAA 4OPQA 1KGFA 3BYDA 1OTBA 2A3UA 4YWZA 4OOYA 1K57C 3R7WB 5EV0A 3W4OA 2XR0A 2H5SA 4XT2B 2HV1A 5FAQA 1FR1A 4KZ8A 2WKIA 5HX9A 3UY6A 4Y3IA 4WEJA 3HLEA 2JKTI 3QP4A 4BBTA 4I5SA 3LO7A 2WGIA 4R70A 1QMEA 2HGVA 3E98A 3KYQA 4GDNA 3IS2B 4X55A 1RGYA 1IEMA 3OBFA 4HJ3A 4EW7A 3F1NA 4PM7A 4LCMA 4U3TA 1PW8A 3HL9A 1SHVA 2Y91A 4F94A 4EBLA 4EERA 2QKPA 4K08A 2WZZA 5CERA 3A3IA 2WGWB 4KQDA 2ZOHA 3DTKA 1VB6A 2XEPA 1YLYA 2Y2HA 3UDFA 3UE6A 1GSVA 2JKTM 1ZG4A 4B9OA 2WK0A 4DXCA 3Q1FA 4DF6A 4KZ6A 1F5MA 1L0GA 3AGEA 4I39A 3E2LA 1RGZA 4G3VA 4EETB 2JBFA 4KZAA 3BECA 1BLSA 4DE1A 1DRMA 5TJJA 4XUXA 5AQ7A 3V5MA 4ZBEA 5EE8A 3WS2A 2HP5A 3LR5A 3CUEA 5A90A 1J3WA 4S2LA 2C6WB 1YPRA 1PW1A 2ZMVA 1W63Q 1HVBA 4D60A 2JKFA 3T1SA 4P6BA 3W2ZA 4N92A 1XX2A 4UEYA 1NLZA 5KSHA 3BJNA 2G2UA 4ID4A 4ZRRA 3MQQA 5DVAA 3EQUA 5AQ9A 1JTGA 4BBUA 3ZVTA 3P09A 4MNRA 3UPNA 3S22A 3T4TA 1K4EA 5M18A 1MY8A 2ZL1A 2VJWA 5TR7A 3UMDA 3CMZA 4R3JA 3KO6A 4OP8A 4HH3A 4QHCA 3RTYA 5J7EA 1PI5A 4BLMA 5JYOA 2ZQAA 1LL5A 5LBRA 2R9WA 1K0KA 1P97A 4HNBA 4HH2A 4LFUA 4UQIS 2VV8A 3OCLA 2A2LA 1V9ZA 4X53A 2V9AA 1E25A 5I94A 5FQ9A 2W3EA 2VK3A 4BD1A 1LL9A 3NY4A 1PWGA 1NZOA 2YKFA 4K0XA 4GW9A 2FH5A 3T4OA 1H8ZA 4GS9A 3OPLA 1NRFA 2XRNA 1FSWA 3LICA 3PBOA 2M7UA 4RA7A 2W3HA 3AGFA 4XXRA 5J8XA 4EQ1A 3TG9A 1K55A 2I72A 3C30A 3V50A 1ES3A 4LGWA 3SS4A 5F82A 2VGJA 4HI4A 3ZNTA 3F1NB 3B33A 4CJNA 2QYBA 1FCMA 5J3WA 3H7WA 2M7VA 2J9OA 4EUVA 3ZQ5A 2XD1A 2Y2IA 4X25A 2Y59A 1DJAA 3LIFA 1P9WA 1TS8A 4LRXC 2PBYA 3SH7A 2K7SA 4MBFA 4YOFA 3IX8A 3Q82A 4DDYA 4BENA 4RX3A 4QY5A 1I2SA 5E43A 3BW6A 2V1BA 3G30A 1ERMA 2BLSA 2DCFA 4ZAMA 3Q81A 5I5LA 4MBKA 1GHPA 1TS0A 2PU2A 4S2KA 3BFFA 3ZYTA 4ARZB 2OV5A 3WS1A 3IF6A 3P98A 4H8RA 5EM1A 3HVFA 4EXOA 5L8MA 1KGGA 4ZJ3A 1YT4A 3G35A 1DJBA 5CHJA 5L07A 3GECA 1TVFA 5FI2A 2X71A 2G7UA 5HAPA 1Z09A 1LHYA 2W0NA 4IJGA 4I3AA 5GHZA 1MXOA 5CX7A 4HHDA 2V1ZA 4Q0JA 3LIBA 5FAPA 2ZM8A 4CLCA 3FPVA 5GHYA 4KZ7A 3BRMA 1H3QA 3FKWA 4OQHA 2J9PA 3E4QA 4Y7PA 1YSQA 1CEFA 2V8CA 3C4OA 2FZ0A 3N8SA 4ME4A 5HWWA 2A24B 3CUEC 2XA7S 5EVIA 1H8MA 3G31A 2ZM0A 3UB7A 4X68A 3LI9A 3ZG9B 4N9LA 1N4OA 1FR6A 4X1LA 5C5KA 1DP6A 4MEZA 1S66L 2Y79A 3HLDA 3MXRA 5FEGA 4DMZA 1YAXA 2L4RA 3T4KA 3MZDA 4KG6A 3IWQA 4FSFA 1PFLA 3VFFA 2W27A 1L0EA 4FOFA 2J3TC 4R6LA 3M6HA 3P01A 4S2JA 1FILA 2INWA 2P04A 2OWHA 4S2NC 4QY6A 1CI9A 1OMEA 4IBRA 1VETA 4JPMA 1GCEA 4Y13A 4E3NA 1ODVA 3DWKA 3PHYA 3F1PA 3MZEA 1L0DA 4HEFA 4S2MA 3RFBA 5HFOA 4R23A 1N9LA 3W4QA 2O9CA 3V3SA 3IH9A 5FDSA 3EGDC 1XJ3A 2Y8HA 4YINA 5FI6A 3VOLA 1S1ZA 4BMWA 3CPTA 3VP3A 1F9IA 4JGPA 1JTDA 2EX9A 3NI9A 3ZG5A 2E8IA 4Z1WA 3Q7VA 5HAIA 2EX2A 1FCNA 4MN7A 3PAEA 3T4JA 3FG8A 2R9XA 4GDBA 4OQGA 3UPOA 4Y0TA 2M1CA 2Z6DA 3CITA 3LYXA 2J3TD 2QZ6A 4RYEA 1DJCA 3VOYA 2EFUA 2D02A 2BTFP 4Q0IA 5GHXA 1KDWA 2Y2JA 3OPHA 3PBRA 4HOIA 1K56A 2ZBBA 1LSWA 3A0VA 1XFQA 4DRTA 4H6JB 5CTNA 1ZTUA 4JXGA 3SW1A 4ZJ1A 1XA1A 3VOZA 1VEUA 4OH0A 3O87A 2WAFA 1CF0A 1MPLA 4GZBA 4OPZA 2P9VA 5AQBA 4E04A 4OVDA 4MN6A 4O0PA 1MC0A 3O5YA 5A92A 3HCYA 1KE3A 1TS6A 5E2HA 4JGRA 4WN5A 3HLCA 3B3XA 4PPRA 3T4QA 5BOHA 3LR3A 4NKPA 3MSHA 4O7DA 4EU0A 1XFNA 5FSRA 4S2IA 5FA7A 5HAQA 4IVIA 5EPHA 3DTIA 4QU3A 2WADA 2XK1A 1ZC2A 4WZ5A 4CLCB 4I3IA 2JN7A 2P74A 5KZHA 4BQMA 1V9YA 3DTEA 3HBRA 3EEAA 2RL3A 3A3JA 2HF6A 1TDLA 1BULA 4EEUA 1S0WA 4N1HA 2OSUA 4GHIB 2O99A 4C75A 2XROA 3MJQA 5CEDA 4R0QA 5E2FA 1XJ6A 4CLCC 4DN0A 3KSHA 2Y2OA 4BJPA 3EQVA 1ONHA 4OQ0A 2Y2KA 1M6KA 4GB7A 4O01A 4GNUA 1BLCA 2PRFA 2VGLS 3DAVA 3VSLA 1HLUP 4JXSA 1K38A 4E3IA 1U60A 3CJMA 3WWXA 1H5XA 3G6OA 5FASA 3ZG8B 4U0TA 3IX3A 5MC7A 4HJ4A 2ZQ7A 3UB8A 4I3JA 2QMIA 1ES5A 4EUZA 2PD8A 3PBSA 1GSWA 3VP2A 2ZQ9A 2XLNA 4F3LA 1S67L 2A49A 2L1MA 3OC2A 3VE4A 4Q0HA 1Q2PA 2WYXA 1LL8A 5HZHA 2WZXA 4ETZA 4P85A 2QJ5A 5FAOA 3ZVWA 3HJIA 4DJ3A 1STZA 4MLLA 4CLCD 3T4LA 4GCZA 3CPTB 3FYZA 2VKSA 3C4PA 1AWIA 2WKHA 5FATA 3GVBA 4E6XA 3MXSA 3H82A 2KX6A 3UB5P 3T4SA 1NJ4A 2XA7M 1XA7A 4EEPA 3BLMA 2H10A 1XJ4A 1XP4A 1BUEA 4LENA 3F1OA 3QP1A 3NECA 3QNBA 5CGWA 1HTZA 1F98A 3PXPA 2Q0OA 2NUPC 2Z2LB 2KLIA 2Y2QA 2XDMA 4GOGA 3LEZA 1LLBA 2R78A 2QPNA 5FQJA 4JLFA 3IXDA 3KSIA 3LY4A 3G4PA 3IXGA 2EX6A 3QP6A 3UNWA 3ZG7B 3VP0A 2P9VB 4WEKA 1NLYA 3BY8A 2DRWA 4EWFA 5FDHA 3ZDJA 2PBDP 4PM5A 2AVXA 4R38A 2PDRA 3DWZA 5M19A 4GD8A 2Y2PA 3K3CA 4P0MA 1BZAA 2L0WA 5CTMA 5FQQA 2PR6A 5DKKA 3FV7A 2VV7A 2ACGA 3PR6A 5AVFA 4LRYC 4FH2A 1GHMA 4NG2A 1AXBA 4B4ZA 5AJGA 3IXBA 3CI6A 2XD5A 4CQHA 4CPKA 3MR0A 3G32A 5GLDA 4DDSA 2P08A 3LY3A 1N9BA 4JBFA 1XXMA 3DW0A 3JPUA 4R3BA 1TF1A 5HWTA 2X02A 2ZQDA 1LI0A 3BLSA 4G3KA 2EXBA 3LIAA 4GKUA 2EWVA 5HSQA 3TSGA 5HD5A 5F1GA 1YLJA 1RP5A 5CHUA 4N1XA 4WZ5C 4N9KA 3KSGA 1X0OA 4OLGA 5F1FA 2W1TA 3T12B 4LV2A 5K5BA 2MJ6A 5KMWA 4QD4A 1KOUA 2Y2GA 2HP9A 2HZ5A 1O7EA 5TBMA 5HW3A 1YLTA 4XUZA 3DBAA 1ES4A 4M3KA 4UA7A 2V0UA 4HJ6A 3MZFA 3QP5A 2IA2A 3LR0A 2ZQ8A 5A8BA 1I5QA 4IEDA 3NOUC 1NY0A 2XH9A 3U2AA 3MQOA 4GD6A 3C2WA 1SKOA 3UE0A 3PBQA 2GX5A 3C7UA 4CLCE 2V8FA 1YLWA 3HUNA 2PD7A 1YMSA 2WAEA 3I7JA 3RXXA 4HQAA 1ONGA 4OPYA 3BQAA 3VSKA 4QB8A 2DNSA 3UN7A 4E3MA 3SH8A 1L2SA 1P9RA 3HLFA 4I38A 3T1RA 4S2OA 1G6OA 3IQAA 3M6BA 1ES2A 4PAUA 2VLGA 2W3FA 5DF7A 3F1OB 3TE8A 1H8YA 2H0YA 4ESPA 3GTCA 4BD0A 5DF9A 1T1CA 3BEBA 4DE2A 2J7VA 1OTEA 4JXWA 5AQAA 3KYZA 3TJZC 1IKIA 2XSSA 4JF6A 3Q7ZA 2XGNA 4FD8A 1G6AA 2GNXA 3M2JA 2Y2NA 1Q2QA 2VGLM 1T18A 3OLOA 1D06A 1KDSA 4LRZE 3IWOA 3R4KA 2FFYA 1YSPA 2C5WB 4KZ3A 3L9KA 5GLBA 5DFXA 3M2KA 2OAP1 2V1AA 2WKEA 5TGFA 1WE4A 4KQRA 3L7HA 1W5DA 3N7WA 1YQSA 3MFDA 1IYQA 2J80A 1TD5A 4E3LA 2H28A 3C38A 3S7QA 1ACFA 3KSFA 1OTAA 3D3OA 4LV0A 1XGIA 5TFQA 2ZL1B 5J4EA 3C8CA 1W63M 2ZOIA 1H0MA 5DJTA 4E3JA 1VHMA 1CQAA 3CWFA 1K57A 2OLUA 3SZTA 1K4FA 5EECA 2IWBA 3W8KA 4P6ZS 5F5YA 4B93A 5IHVA 1PRQA 3SH9A 3UB9A 3LI8A 3A3DA 1L0FA 1IYOA 4JGQA 3BFDA 1NRJA 1OTIA 1WA9A 1OJ5A 4Y5FA 1PZPA 4IUKA 3A3EA 3GRJA 3QHYA 4UHUA 5EFWA 3R7WA 3UDIA 3NDGA 4XT2A 2Y4AA 4Y0OA 2ZQCA 2K31A 4Y15A 3ITAA 1JNUA 3RXWA 1GSXA 2WKRA 4A5RA 3E4OA 5HPFA 1BSGA 1MZUA 1GHIA 2W3DA 3HJKA 1LSVA 4GS9B 4LPZA 3EEHA 3IF5A 4EESA 3EWKA 3CHWP 2BASA 1LSXA 3S4XA 4NXEA 1ZG6A 1DP8A 4OQIA 2ZD8A 2D01A 3N4IA 4HY8A 3IS2A 5EVLA 1YMXA 1PIOA 3GQZA 3A3FA 4L9GA 3TRCA 4FUWA 4OLDA 2ZC6B 4OPRA 2OWJA 1T19A 3K2NA 4DKIA 2ZC3B 2LB9A 3BFGA 3WS0A 4GN2A 5EOEA 1Y28A 3H7WB 1GA9A 3O86A 1KE4A 1RCJA 1CI8A 2FFFB 1K54A 4NXBA 2Y2MA 3GV9A 2HDRA 4B88A 4NEED 3PTEA 1K55C 4P87A 4OOLA 5GLAA 4NXGA 1MWRA 2HJ9C 3BY9A 5HDCA 2PU4A 4WM9A 4DXBA 3VP4A 3LGOA 2VGKA 5KSCA 2XFSA 1T1AA 3S7NA 3S7OA 3GMWA 4JF5A 2WKQA 2V20A 1JWVA 5CHMA 2H0TA 3G34A 3NBLA 4KUOA 5HWVA 4KQOA 2VZWA 3IF6B 3IBRA 4LLOB 4OOMA 2Y2LA 1EROA 5L09A 3BFEA 5A93A 4R3AA 5G4ZA 3G2ZA 4Y2FA 3QP8A 4YNRA 1YKDA 2HPBA 1BTLA 1FSYA 1OT9A 3G2YA 4HP4A 4WELA 2HJEA 5F68A 2XFTA 3IF6C 3SS3A 3VMAA 2DMWA 4HP9A 3ICYA 4HIAA 2VV6A 2PYPA 4IBXA 4OONA 2WUQA 3ZCZA 1LT0A 4U0XA 5EVIB 2NUTC 4FH4A 1KGEA 1T1BA 4JKTA 3IT9A 3E0YA 4M4XA 1O07A 2JKRI 4X1MA 3ZG0A 1W79A 3UMEA 4K0WA 1E4DA 1L3LA 3V39A 3PBNA 3H9WA 1MKMA 5DF8A 2HDQA 2JHEA 5EVIC 3VFHA 2W1RA 2JCHA 2CMNA 4WZ4A 3QNCA 4WLAA 5DTKA 5IS1A 4YFMA 4L9FA 3N8LA 5CXWA 1CK3A 1VETB 3ISGA 2B5RA 3C7VA 3F1PB 2JE5A 3E4PA 4AFIA 1PZOA 1S6RA 1CEGA 1HZOA 2B02A 2JKRM 4R4SA 4JGOA 4KZBA 4E3KA 4WL9A 2KDKA 4EV4A 3HLGA 2BG1A 5E2GA 3HUMA 4JF4A 2YKHA 1IFQA 3TW8A 1WYBA 2O9AA 1W8QA 3Q7VB 4BWIA 3S7PA 4QPRA 4IVKA 5CRFA 2LB5A 3IHBA 5M1AA 2P7JA 2O0YA 1K6RA 5EVID 3B42A 4HBUA 3NC8A 1MKIA 2JKGA 3A0RA 3GSGA 2OAQ1 1Y54A 4X69A 1KVMA 5G18A 5DKLA 4Q8IA 5DTTA 3D4FA 5FI7A 1S4RA 4P6ZM 2VA0A 1XKZA 3O3VA 3UDXA 5DJUA 1E3UA 1PYYA 1JWZA 2QHKA 5CECA 3LUQA 4UA6A 1OPXA 1VEUB 5EVEA 4EQIA 4GLQA 1KVLA 1ZHHB 5EOOA 3UO9A 4LV1A 4Y0UA 4ARZA 4R4RA 3BWLA 3MMHA 5EM0A 1K54C 5GL9A 2EA9A 4MN5A 4D2OA 3NIAA 1C3BA 4Z9QA 3WS5A 4FCFA 4NETA 5AVEA 2B18A 5HDSA 2Q9NA 3Q07A 3NULA 3IH8A 1GA0A 2CC1A 1OT6A 3ZHHA 3IBJA 3OOVA 4KENB 4ZDXA 1TS7A 4WMCA 3SS5A 1D7EA 2QWSA 5CEBA 1W7FA 3K3DA 5G4YA 1ESUA 5HPIA 5DFYA 3PYPA 1G5UA 1DY6A 1K25A 4MMNA 1IYSA 4ZJ2A 2A24A 1A0KA 2GZAA 5CGSA 5HL6A 1P0ZA 4C3QA 4Y17A 3CAXA 3NDEA 1I2WA 2K2NA 4S2NA 1N9NA 2Q9MA 4NXFA 2ZC4B 2V2FF 2GDNA 4L0LA 4PKYA 2J8YA 1IELA 5HD3A 3JYIA 1ERQA 1PNEA 1K56D 3UE3A 1SZVA 2GJ3A 1FQGA 2PT7A 3ITBA 2ZLYA 2UWXA 2EX8A 3PBTA 4KG5A 2OLVA 1ZKJA 1Z6FA 2XF3A 3C5AA 3FWLA 3WRZA 3UB6A 2E8JA 3VV4A 1F2KA 2ZM2A 3MBZA 3FKVA 2OOLA 3NHQA 5FQKA 2HDSA 4BBVA 3IWIA 3BQ8A 3ULFA 4F3LB 2VEAA 4BL2A 3B47A 4PM9A 3D72A 3UE1A 1DP9A 1BT5A 2XQZA 4B4XA 5IU1A 4KQQA 3FC7A 5FEFA 1FCOA 3MQ0A 5DTSA 3U4LP 3LIEA 4X56A 5EUAA 1OJGA 3TOIA 3PAGA 3FPWA 1BLPA 3BFCA 3CLOA 1YLZA 4DJ2A 2O9BA 3OPPA 1PI4A 3H82B 3A0SA 3NOPC 5FQIA 1IYPA 5HDDA 3V67A 3EGXC 3JVVA 4OKPA 4QWOA 3N8RA 5FQMA 3GDIA 4E3OA 1FOFA 4H6JA 2ZJ9A 1HD8A 3MKFA 3HLWA 4MBHA 3WS4A 4DE0A 2JC7A 1CJFA 3LCEA 4EBNA 4X6TA 3CG5A 1EW0A 5KIZA 4L9EA 4NK3A 5HARA 1ESIA 1G28A 3W4PA 4WF0A 4EBPA 4RVAA 2W3GA 2EWWA 3RJUA 3LFVA 4G3WA 3KYEA 4KZ9A 3E2KA 4DE3A 2I9VA 4K91A 3D9YA 5F83A 3MF0A 5JYPA 2PHYA 4WYYA 4PMAA 1UWPX 2ZC5B 1UGUA 1G68A 5D3OA 1NYMA 4WUJA 3MXQA 5L10A 3DTMA 2B95A 4GHIA 3S1YA 1IKGA 5F6AA 1M40A 1SCWA 4RX2A 5CGXA 3MKEA 1ALQA 4IHQA 5GLCA 2V0WA 1JVJA 3FZCA 4O8GA 3RH8B 2UV0E 1XGJA 5FL3A 1S4SA 2Y55A 4PHTA 4S2PA 3BM6A 2QJ7A 2W1TB 5A91A 1JWPA 1BYWA 1E3UD 2Z6CA 3NCKA 1W8YA 4UA9A 2EFXA 4KG2A 5TBMB 3ZNYA 4MCWA 1FIKA 3MFXA 2Z2MB 3JVUA 1OTDA 1VQQA 4II7A 4RQ9A 1MWUA 1SKOB 4WBGA 3T50A 2PR5A 2WGVA 3UPPA 3HUOA 3EOIA 4WMCD 3NOTC 1TDGA 3WRTA 3HLBA 3P7NA 4JXVA 1QMFA 4LCLA 4C6YA 4KUKA 1SDEA 5U47A 2ZC7A 1TEMA 3QP2A 2WGWA 1VM1A 3SOIA 3GR2A 1NYYA 5IT5A 3ZFZA 3KX0X 2PYRA 3AGDA 1MBLA 1N9OA 3IXHA 2ZMFA 3OCNA 3T1XA 3IHAA 5HL1A 1XPBA 4KZ4A 3IX4A 1SKFA 3LR4A 4E6WA 2J3WA 1YM1A 4PM6A 1MWTA 1Y4OA 3NJAA 1S1YA 1PWDA 4R1GA 3ZGAB 3MS6A 4HESA 4UAAA 1D1JA 3CZDA 3N6IA 1MWSA 4PM8A 4UQIM 4KZ5A 1LI9A 4LV3A 2KOIA 3HREA 1EI5A 1K6SA 4ZTKA 2RCXA 3T1QB 3O88A 4BL3A 1SDNA 3LEQA 4HBTA 1EWZA 2IWDA 1PWCA
chains in the Genus database with same CATH topology
2WKPA 2GX5A 4CLCE 5DJUA 1YAXA 2L4RA 3T4KA 4PKYG 1IOUA 2QHKA 3LUQA 2PD7A 4FSFA 4IUHA 1OPXA 2W27A 4FOFA 4ETXA 2J3TC 4GLQA 4R6LA 4HQAA 1ZHHB 3P01A 5F69A 2INWA 3BQAA 4ARZA 2P04A 2OWHA 3BWLA 3MMHA 2EA9A 1ODVA 3LIDA 4GJ4A 1P9RA 4MN5A 3PHYA 3F1PA 5AVEA 4I38A 2B18A 5HDSA 1G6OA 4MDZA 2VX8A 4PAUA 1OT6A 2VLGA 3RFBA 2W3FA 3VE3A 1XJ2A 3F1OB 3IBJA 3OOVA 3TE8A 1N9LA 1TS7A 1D7EA 2O9CA 1UWNX 5DF9A 2QWSA 1NWZA 1T1CA 3EGDC 1XJ3A 2Y8HA 1OTEA 3K3DA 5G4YA 5HPIA 3VOLA 1S1ZA 3KYZA 4BMWA 1F9IA 1OTBA 2XSSA 4JGPA 5DFYA 3TJZC 3PYPA 4YWZA 4Z1WA 3R7WB 4MMNA 4MN7A 2GNXA 4XT2B 2A24A 2HV1A 2VGLM 1T18A 2GZAA 3FG8A 3T4JA 3OLOA 1D06A 5HL6A 1P0ZA 4LRZE 3CAXA 2M1CA 3R4KA 2Z6DA 3CITA 1YSPA 3LYXA 2J3TD 4Y3IA 4WEJA 5DFXA 2K2NA 1N9NA 4NXFA 2OAP1 2D02A 4L0LA 2JKTI 2V1AA 4PKYA 4Q0IA 4BBTA 4I5SA 5HD3A 3PBRA 4HOIA 4R70A 2ZBBA 1LSWA 2HGVA 3A0VA 3E98A 1XFQA 4H6JB 3UE3A 1ZTUA 2J80A 3KYQA 3IS2B 3SW1A 1TD5A 2GJ3A 3OBFA 2H28A 3C38A 2PT7A 4HJ3A 3S7QA 4EW7A 3KSFA 3D3OA 1OTAA 3F1NA 3PBTA 5J4EA 3C8CA 1W63M 2ZOIA 4E04A 4MN6A 4O0PA 1MC0A 3O5YA 5DJTA 3UB6A 1VHMA 3HCYA 1TS6A 3CWFA 4EERA 4JGRA 3VV4A 2QKPA 4K08A 4WN5A 4P6ZS 5F5YA 2OOLA 2ZOHA 4KQDA 1VB6A 3NHQA 3T4QA 4B93A 4BBVA 3UB9A 3LI8A 3BQ8A 3ULFA 3LR3A 4F3LB 4NKPA 3UE6A 1GSVA 2VEAA 3B47A 4JGQA 3D72A 2JKTM 1NRJA 1OTIA 1WA9A 1OJ5A 1XFNA 4Y5FA 4EU0A 1DP9A 4B9OA 1F5MA 5IU1A 3FC7A 4IUKA 4I39A 4CLCB 3MQ0A 4I3IA 2JN7A 5EFWA 3R7WA 4G3VA 4EETB 3LIEA 4XT2A 1DRMA 1V9YA 1OJGA 5TJJA 3EEAA 3FPWA 2HF6A 2K31A 3CLOA 1JNUA 4DJ2A 4EEUA 1GSXA 2O9BA 2WKRA 3LR5A 3CUEA 3H82B 3E4OA 2ZMVA 1W63Q 5HPFA 3A0SA 1MZUA 2O99A 2W3DA 3HJKA 1LSVA 4GHIB 4GS9B 3NOPC 2XROA 4LPZA 3MJQA 3EEHA 5HDDA 3V67A 3W2ZA 3EGXC 4EESA 3EWKA 2BASA 1LSXA 3JVVA 1NLZA 4UEYA 4CLCC 1XJ6A 5KSHA 4NXEA 4DN0A 3KSHA 3BJNA 1DP8A 4BJPA 3GDIA 3EQVA 2D01A 4ZRRA 3MQQA 4H6JA 3EQUA 4HY8A 3IS2A 4O01A 4BBUA 3T4TA 2VGLS 4L9GA 3TRCA 2VJWA 2OWJA 1T19A 3K2NA 3UMDA 3G6OA 1EW0A 2LB9A 5KIZA 3KO6A 1Y28A 3H7WB 4L9EA 4HH3A 5MC7A 4HJ4A 3UB8A 4NXBA 1G28A 4I3JA 3RTYA 5J7EA 2PD8A 3PBSA 4WF0A 1GSWA 4NEED 4OOLA 4NXGA 2W3GA 2EWWA 4F3LA 3LFVA 4G3WA 2HJ9C 3BY9A 5LBRA 1S67L 5HDCA 2L1MA 3OC2A 3VE4A 4Q0HA 1P97A 4HNBA 4HH2A 1T1AA 1LL8A 5HZHA 2I9VA 3S7NA 4UQIS 3S7OA 4ETZA 2VV8A 2QJ5A 3OCLA 2A2LA 3HJIA 3MF0A 1V9ZA 4DJ3A 1STZA 2V9AA 2PHYA 2WKQA 4CLCD 1UWPX 3T4LA 1UGUA 4GCZA 2W3EA 4KUOA 5HWVA 4KQOA 2VKSA 2VZWA 3IBRA 4LLOB 2YKFA 4OOMA 4GW9A 4WUJA 2FH5A 3H82A 2KX6A 4R3AA 5G4ZA 3MXQA 4Y2FA 3T4SA 3T4OA 2XA7M 4GHIA 4GS9A 4EEPA 1XJ4A 2XRNA 5F6AA 3F1OA 3LICA 4YNRA 1YKDA 3PBOA 2M7UA 2W3HA 1F98A 1OT9A 4IHQA 2V0WA 3PXPA 4O8GA 3RH8B 2NUPC 4HP4A 4WELA 2HJEA 2KLIA 5F68A 5FL3A 1S4SA 4PHTA 2R78A 4EQ1A 3C30A 2QJ7A 2W1TB 2DMWA 4HP9A 3ICYA 4HIAA 2VV6A 1BYWA 2PYPA 2Z6CA 3KSIA 4HI4A 1LT0A 3F1NB 3B33A 2QYBA 2NUTC 5J3WA 5TBMB 3H7WA 2M7VA 4EUVA 4MCWA 3ZQ5A 4WEKA 1T1BA 3MFXA 3E0YA 4M4XA 1NLYA 2JKRI 3BY8A 3JVUA 4R38A 3LIFA 2PDRA 1P9WA 3UMEA 1TS8A 4LRXC 1OTDA 3PBNA 3K3CA 2L0WA 4II7A 2K7SA 4RQ9A 3H9WA 4YOFA 2PR6A 1MKMA 5DKKA 2VV7A 3T50A 2PR5A 2JHEA 3PR6A 5AVFA 3BW6A 4LRYC 2V1BA 3EOIA 5I5LA 2W1RA 5AJGA 3NOTC 1TS0A 3CI6A 4CQHA 2CMNA 3MR0A 3P7NA 2P08A 3ZYTA 4WLAA 4ARZB 5IS1A 4KUKA 4L9FA 4EXOA 5L8MA 1TF1A 5HWTA 5IT5A 3F1PB 3KX0X 2PYRA 3GECA 1N9OA 4G3KA 2ZMFA 3E4PA 4AFIA 2G7UA 3LIAA 3OCNA 2B02A 2JKRM 2W0NA 2EWVA 4IJGA 5HSQA 4I3AA 4JGOA 5HD5A 5CX7A 4HHDA 4Q0JA 3LIBA 3LR4A 4WL9A 2KDKA 2J3WA 4CLCA 3FPVA 2YKHA 3KSGA 1H3QA 1X0OA 1IFQA 3E4QA 3TW8A 2W1TA 3NJAA 1YSQA 1S1YA 2O9AA 5K5BA 2MJ6A 1KOUA 2FZ0A 4BWIA 4ME4A 3S7PA 5HWWA 2A24B 4QPRA 3CUEC 2XA7S 5TBMA 1H8MA 2LB5A 2P7JA 4UQIM 2O0YA 3UB7A 3DBAA 3B42A 2KOIA 3LI9A 2V0UA 4HJ6A 2IA2A 3A0RA 5C5KA 1DP6A 2OAQ1 3LR0A 1S66L 2Y79A 5A8BA 5DKLA 3NOUC 3U2AA 3MQOA 1S4RA 3C2WA 4P6ZM 2VA0A 4DMZA 3PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKP A;  5DJU A;  2L4R A;  4PKY G;  2QHK A;  3LUQ A;  2PD7 A;  2W27 A;  4R6L A;  4HQA A;  5F69 A;  2INW A;  2OWH A;  3BWL A;  2EA9 A;  1ODV A;  3LID A;  4MN5 A;  3PHY A;  3F1P A;  5AVE A;  4I38 A;  5HDS A;  1OT6 A;  2VLG A;  3VE3 A;  1XJ2 A;  3F1O B;  1N9L A;  1TS7 A;  1D7E A;  1UWN X;  2QWS A;  1NWZ A;  1T1C A;  1XJ3 A;  1OTE A;  3K3D A;  5G4Y A;  3VOL A;  1S1Z A;  1F9I A;  1OTB A;  4JGP A;  3PYP A;  4YWZ A;  4XT2 B;  2A24 A;  2HV1 A;  1T18 A;  3FG8 A;  3OLO A;  1D06 A;  1P0Z A;  4LRZ E;  3CAX A;  2M1C A;  2Z6D A;  3LYX A;  1N9N A;  4NXF A;  2D02 A;  2V1A A;  4PKY A;  4BBT A;  4I5S A;  5HD3 A;  4HOI A;  4R70 A;  2ZBB A;  1LSW A;  3A0V A;  1XFQ A;  4H6J B;  2J80 A;  3IS2 B;  3SW1 A;  2GJ3 A;  2H28 A;  4HJ3 A;  4EW7 A;  1OTA A;  3F1N A;  5J4E A;  3C8C A;  2ZOI A;  4E04 A;  4MN6 A;  5DJT A;  3UB6 A;  1TS6 A;  3CWF A;  4EER A;  4JGR A;  2QKP A;  4K08 A;  4WN5 A;  5F5Y A;  2OOL A;  2ZOH A;  4KQD A;  1VB6 A;  3NHQ A;  4BBV A;  3UB9 A;  3LI8 A;  3ULF A;  4F3L B;  3UE6 A;  1GSV A;  2VEA A;  4JGQ A;  3D72 A;  1OTI A;  1WA9 A;  1OJ5 A;  1XFN A;  1DP9 A;  4B9O A;  5IU1 A;  3FC7 A;  4I39 A;  4I3I A;  2JN7 A;  5EFW A;  4EET B;  3LIE A;  4XT2 A;  1DRM A;  1V9Y A;  1OJG A;  3CLO A;  1JNU A;  4DJ2 A;  4EEU A;  1GSX A;  2WKR A;  3H82 B;  3E4O A;  3A0S A;  1MZU A;  4GS9 B;  4GHI B;  3HJK A;  1LSV A;  3NOP C;  4LPZ A;  3MJQ A;  3EEH A;  5HDD A;  4EES A;  3EWK A;  2BAS A;  1LSX A;  1XJ6 A;  4NXE A;  1DP8 A;  3GDI A;  2D01 A;  3MQQ A;  4H6J A;  4HY8 A;  3IS2 A;  4BBU A;  4L9G A;  2OWJ A;  1T19 A;  3UMD A;  3G6O A;  1EW0 A;  5KIZ A;  1Y28 A;  3H7W B;  4L9E A;  4HH3 A;  4HJ4 A;  3UB8 A;  4NXB A;  1G28 A;  4I3J A;  3RTY A;  5J7E A;  2PD8 A;  4WF0 A;  1GSW A;  4NXG A;  4F3L A;  3BY9 A;  1S67 L;  5HDC A;  2L1M A;  3VE4 A;  1P97 A;  4HNB A;  4HH2 A;  1T1A A;  1LL8 A;  5HZH A;  2I9V A;  2VV8 A;  2QJ5 A;  3HJI A;  1V9Z A;  4DJ3 A;  2V9A A;  2PHY A;  2WKQ A;  1UWP X;  1UGU A;  4GCZ A;  4KUO A;  5HWV A;  3IBR A;  4LLO B;  2YKF A;  4GW9 A;  4WUJ A;  3H82 A;  2KX6 A;  4R3A A;  5G4Z A;  3MXQ A;  4GHI A;  4GS9 A;  4EEP A;  1XJ4 A;  5F6A A;  3F1O A;  3LIC A;  1F98 A;  1OT9 A;  2V0W A;  3RH8 B;  4HP4 A;  5F68 A;  1S4S A;  2R78 A;  4EQ1 A;  2QJ7 A;  4HP9 A;  3ICY A;  4HIA A;  2VV6 A;  1BYW A;  2PYP A;  2Z6C A;  4HI4 A;  1LT0 A;  3F1N B;  3B33 A;  5J3W A;  5TBM B;  3H7W A;  3ZQ5 A;  1T1B A;  3MFX A;  4M4X A;  3BY8 A;  4R38 A;  3LIF A;  2PDR A;  3UME A;  1TS8 A;  4LRX C;  1OTD A;  3K3C A;  2L0W A;  2K7S A;  4RQ9 A;  3H9W A;  2PR6 A;  5DKK A;  2VV7 A;  3T50 A;  2PR5 A;  2JHE A;  5AVF A;  4LRY C;  2V1B A;  5I5L A;  3NOT C;  1TS0 A;  2CMN A;  3MR0 A;  3P7N A;  4WLA A;  5IS1 A;  4KUK A;  4L9F A;  4EXO A;  5HWT A;  3F1P B;  3KX0 X;  2PYR A;  3GEC A;  1N9O A;  3E4P A;  3LIA A;  2B02 A;  2W0N A;  5HSQ A;  4I3A A;  4JGO A;  5HD5 A;  4HHD A;  3LIB A;  4WL9 A;  2KDK A;  2YKH A;  1X0O A;  3E4Q A;  3NJA A;  1S1Y A;  1KOU A;  5HWW A;  2A24 B;  5TBM A;  2P7J A;  3UB7 A;  3LI9 A;  2V0U A;  4HJ6 A;  3A0R A;  1DP6 A;  1S66 L;  5A8B A;  5DKL A;  3NOU C;  3MQO A;  1S4R A;  3C2W A; 
#chains in the Genus database with same CATH topology
 2WKP A;  4PKY G;  1IOU A;  3OPR A;  3V3R A;  4IUH A;  1J9M A;  1YLP A;  3VP1 A;  4ETX A;  5F69 A;  1KE0 A;  2PAV P;  2HP6 A;  2G2W A;  2X01 A;  4QJG A;  2HDU A;  3LID A;  4GJ4 A;  4FTX A;  1NZU A;  4OP5 A;  1WYC A;  3OZH A;  4MDZ A;  1NXY A;  2VX8 A;  1BLH A;  2IWC A;  2ZMA A;  3VE3 A;  1XJ2 A;  5E2E A;  5L2F A;  1UWN X;  1NWZ A;  2EXA A;  4OPQ A;  1KGF A;  3BYD A;  1OTB A;  2A3U A;  4YWZ A;  4OOY A;  1K57 C;  3R7W B;  5EV0 A;  3W4O A;  2XR0 A;  2H5S A;  4XT2 B;  2HV1 A;  5FAQ A;  1FR1 A;  4KZ8 A;  2WKI A;  5HX9 A;  3UY6 A;  4Y3I A;  4WEJ A;  3HLE A;  2JKT I;  3QP4 A;  4BBT A;  4I5S A;  3LO7 A;  2WGI A;  4R70 A;  1QME A;  2HGV A;  3E98 A;  3KYQ A;  4GDN A;  3IS2 B;  4X55 A;  1RGY A;  1IEM A;  3OBF A;  4HJ3 A;  4EW7 A;  3F1N A;  4PM7 A;  4LCM A;  4U3T A;  1PW8 A;  3HL9 A;  1SHV A;  2Y91 A;  4F94 A;  4EBL A;  4EER A;  2QKP A;  4K08 A;  2WZZ A;  5CER A;  3A3I A;  2WGW B;  4KQD A;  2ZOH A;  3DTK A;  1VB6 A;  2XEP A;  1YLY A;  2Y2H A;  3UDF A;  3UE6 A;  1GSV A;  2JKT M;  1ZG4 A;  4B9O A;  2WK0 A;  4DXC A;  3Q1F A;  4DF6 A;  4KZ6 A;  1F5M A;  1L0G A;  3AGE A;  4I39 A;  3E2L A;  1RGZ A;  4G3V A;  4EET B;  2JBF A;  4KZA A;  3BEC A;  1BLS A;  4DE1 A;  1DRM A;  5TJJ A;  4XUX A;  5AQ7 A;  3V5M A;  4ZBE A;  5EE8 A;  3WS2 A;  2HP5 A;  3LR5 A;  3CUE A;  5A90 A;  1J3W A;  4S2L A;  2C6W B;  1YPR A;  1PW1 A;  2ZMV A;  1W63 Q;  1HVB A;  4D60 A;  2JKF A;  3T1S A;  4P6B A;  3W2Z A;  4N92 A;  1XX2 A;  4UEY A;  1NLZ A;  5KSH A;  3BJN A;  2G2U A;  4ID4 A;  4ZRR A;  3MQQ A;  5DVA A;  3EQU A;  5AQ9 A;  1JTG A;  4BBU A;  3ZVT A;  3P09 A;  4MNR A;  3UPN A;  3S22 A;  3T4T A;  1K4E A;  5M18 A;  1MY8 A;  2ZL1 A;  2VJW A;  5TR7 A;  3UMD A;  3CMZ A;  4R3J A;  3KO6 A;  4OP8 A;  4HH3 A;  4QHC A;  3RTY A;  5J7E A;  1PI5 A;  4BLM A;  5JYO A;  2ZQA A;  1LL5 A;  5LBR A;  2R9W A;  1K0K A;  1P97 A;  4HNB A;  4HH2 A;  4LFU A;  4UQI S;  2VV8 A;  3OCL A;  2A2L A;  1V9Z A;  4X53 A;  2V9A A;  1E25 A;  5I94 A;  5FQ9 A;  2W3E A;  2VK3 A;  4BD1 A;  1LL9 A;  3NY4 A;  1PWG A;  1NZO A;  2YKF A;  4K0X A;  4GW9 A;  2FH5 A;  3T4O A;  1H8Z A;  4GS9 A;  3OPL A;  1NRF A;  2XRN A;  1FSW A;  3LIC A;  3PBO A;  2M7U A;  4RA7 A;  2W3H A;  3AGF A;  4XXR A;  5J8X A;  4EQ1 A;  3TG9 A;  1K55 A;  2I72 A;  3C30 A;  3V50 A;  1ES3 A;  4LGW A;  3SS4 A;  5F82 A;  2VGJ A;  4HI4 A;  3ZNT A;  3F1N B;  3B33 A;  4CJN A;  2QYB A;  1FCM A;  5J3W A;  3H7W A;  2M7V A;  2J9O A;  4EUV A;  3ZQ5 A;  2XD1 A;  2Y2I A;  4X25 A;  2Y59 A;  1DJA A;  3LIF A;  1P9W A;  1TS8 A;  4LRX C;  2PBY A;  3SH7 A;  2K7S A;  4MBF A;  4YOF A;  3IX8 A;  3Q82 A;  4DDY A;  4BEN A;  4RX3 A;  4QY5 A;  1I2S A;  5E43 A;  3BW6 A;  2V1B A;  3G30 A;  1ERM A;  2BLS A;  2DCF A;  4ZAM A;  3Q81 A;  5I5L A;  4MBK A;  1GHP A;  1TS0 A;  2PU2 A;  4S2K A;  3BFF A;  3ZYT A;  4ARZ B;  2OV5 A;  3WS1 A;  3IF6 A;  3P98 A;  4H8R A;  5EM1 A;  3HVF A;  4EXO A;  5L8M A;  1KGG A;  4ZJ3 A;  1YT4 A;  3G35 A;  1DJB A;  5CHJ A;  5L07 A;  3GEC A;  1TVF A;  5FI2 A;  2X71 A;  2G7U A;  5HAP A;  1Z09 A;  1LHY A;  2W0N A;  4IJG A;  4I3A A;  5GHZ A;  1MXO A;  5CX7 A;  4HHD A;  2V1Z A;  4Q0J A;  3LIB A;  5FAP A;  2ZM8 A;  4CLC A;  3FPV A;  5GHY A;  4KZ7 A;  3BRM A;  1H3Q A;  3FKW A;  4OQH A;  2J9P A;  3E4Q A;  4Y7P A;  1YSQ A;  1CEF A;  2V8C A;  3C4O A;  2FZ0 A;  3N8S A;  4ME4 A;  5HWW A;  2A24 B;  3CUE C;  2XA7 S;  5EVI A;  1H8M A;  3G31 A;  2ZM0 A;  3UB7 A;  4X68 A;  3LI9 A;  3ZG9 B;  4N9L A;  1N4O A;  1FR6 A;  4X1L A;  5C5K A;  1DP6 A;  4MEZ A;  1S66 L;  2Y79 A;  3HLD A;  3MXR A;  5FEG A;  4DMZ A;  1YAX A;  2L4R A;  3T4K A;  3MZD A;  4KG6 A;  3IWQ A;  4FSF A;  1PFL A;  3VFF A;  2W27 A;  1L0E A;  4FOF A;  2J3T C;  4R6L A;  3M6H A;  3P01 A;  4S2J A;  1FIL A;  2INW A;  2P04 A;  2OWH A;  4S2N C;  4QY6 A;  1CI9 A;  1OME A;  4IBR A;  1VET A;  4JPM A;  1GCE A;  4Y13 A;  4E3N A;  1ODV A;  3DWK A;  3PHY A;  3F1P A;  3MZE A;  1L0D A;  4HEF A;  4S2M A;  3RFB A;  5HFO A;  4R23 A;  1N9L A;  3W4Q A;  2O9C A;  3V3S A;  3IH9 A;  5FDS A;  3EGD C;  1XJ3 A;  2Y8H A;  4YIN A;  5FI6 A;  3VOL A;  1S1Z A;  4BMW A;  3CPT A;  3VP3 A;  1F9I A;  4JGP A;  1JTD A;  2EX9 A;  3NI9 A;  3ZG5 A;  2E8I A;  4Z1W A;  3Q7V A;  5HAI A;  2EX2 A;  1FCN A;  4MN7 A;  3PAE A;  3T4J A;  3FG8 A;  2R9X A;  4GDB A;  4OQG A;  3UPO A;  4Y0T A;  2M1C A;  2Z6D A;  3CIT A;  3LYX A;  2J3T D;  2QZ6 A;  4RYE A;  1DJC A;  3VOY A;  2EFU A;  2D02 A;  2BTF P;  4Q0I A;  5GHX A;  1KDW A;  2Y2J A;  3OPH A;  3PBR A;  4HOI A;  1K56 A;  2ZBB A;  1LSW A;  3A0V A;  1XFQ A;  4DRT A;  4H6J B;  5CTN A;  1ZTU A;  4JXG A;  3SW1 A;  4ZJ1 A;  1XA1 A;  3VOZ A;  1VEU A;  4OH0 A;  3O87 A;  2WAF A;  1CF0 A;  1MPL A;  4GZB A;  4OPZ A;  2P9V A;  5AQB A;  4E04 A;  4OVD A;  4MN6 A;  4O0P A;  1MC0 A;  3O5Y A;  5A92 A;  3HCY A;  1KE3 A;  1TS6 A;  5E2H A;  4JGR A;  4WN5 A;  3HLC A;  3B3X A;  4PPR A;  3T4Q A;  5BOH A;  3LR3 A;  4NKP A;  3MSH A;  4O7D A;  4EU0 A;  1XFN A;  5FSR A;  4S2I A;  5FA7 A;  5HAQ A;  4IVI A;  5EPH A;  3DTI A;  4QU3 A;  2WAD A;  2XK1 A;  1ZC2 A;  4WZ5 A;  4CLC B;  4I3I A;  2JN7 A;  2P74 A;  5KZH A;  4BQM A;  1V9Y A;  3DTE A;  3HBR A;  3EEA A;  2RL3 A;  3A3J A;  2HF6 A;  1TDL A;  1BUL A;  4EEU A;  1S0W A;  4N1H A;  2OSU A;  4GHI B;  2O99 A;  4C75 A;  2XRO A;  3MJQ A;  5CED A;  4R0Q A;  5E2F A;  1XJ6 A;  4CLC C;  4DN0 A;  3KSH A;  2Y2O A;  4BJP A;  3EQV A;  1ONH A;  4OQ0 A;  2Y2K A;  1M6K A;  4GB7 A;  4O01 A;  4GNU A;  1BLC A;  2PRF A;  2VGL S;  3DAV A;  3VSL A;  1HLU P;  4JXS A;  1K38 A;  4E3I A;  1U60 A;  3CJM A;  3WWX A;  1H5X A;  3G6O A;  5FAS A;  3ZG8 B;  4U0T A;  3IX3 A;  5MC7 A;  4HJ4 A;  2ZQ7 A;  3UB8 A;  4I3J A;  2QMI A;  1ES5 A;  4EUZ A;  2PD8 A;  3PBS A;  1GSW A;  3VP2 A;  2ZQ9 A;  2XLN A;  4F3L A;  1S67 L;  2A49 A;  2L1M A;  3OC2 A;  3VE4 A;  4Q0H A;  1Q2P A;  2WYX A;  1LL8 A;  5HZH A;  2WZX A;  4ETZ A;  4P85 A;  2QJ5 A;  5FAO A;  3ZVW A;  3HJI A;  4DJ3 A;  1STZ A;  4MLL A;  4CLC D;  3T4L A;  4GCZ A;  3CPT B;  3FYZ A;  2VKS A;  3C4P A;  1AWI A;  2WKH A;  5FAT A;  3GVB A;  4E6X A;  3MXS A;  3H82 A;  2KX6 A;  3UB5 P;  3T4S A;  1NJ4 A;  2XA7 M;  1XA7 A;  4EEP A;  3BLM A;  2H10 A;  1XJ4 A;  1XP4 A;  1BUE A;  4LEN A;  3F1O A;  3QP1 A;  3NEC A;  3QNB A;  5CGW A;  1HTZ A;  1F98 A;  3PXP A;  2Q0O A;  2NUP C;  2Z2L B;  2KLI A;  2Y2Q A;  2XDM A;  4GOG A;  3LEZ A;  1LLB A;  2R78 A;  2QPN A;  5FQJ A;  4JLF A;  3IXD A;  3KSI A;  3LY4 A;  3G4P A;  3IXG A;  2EX6 A;  3QP6 A;  3UNW A;  3ZG7 B;  3VP0 A;  2P9V B;  4WEK A;  1NLY A;  3BY8 A;  2DRW A;  4EWF A;  5FDH A;  3ZDJ A;  2PBD P;  4PM5 A;  2AVX A;  4R38 A;  2PDR A;  3DWZ A;  5M19 A;  4GD8 A;  2Y2P A;  3K3C A;  4P0M A;  1BZA A;  2L0W A;  5CTM A;  5FQQ A;  2PR6 A;  5DKK A;  3FV7 A;  2VV7 A;  2ACG A;  3PR6 A;  5AVF A;  4LRY C;  4FH2 A;  1GHM A;  4NG2 A;  1AXB A;  4B4Z A;  5AJG A;  3IXB A;  3CI6 A;  2XD5 A;  4CQH A;  4CPK A;  3MR0 A;  3G32 A;  5GLD A;  4DDS A;  2P08 A;  3LY3 A;  1N9B A;  4JBF A;  1XXM A;  3DW0 A;  3JPU A;  4R3B A;  1TF1 A;  5HWT A;  2X02 A;  2ZQD A;  1LI0 A;  3BLS A;  4G3K A;  2EXB A;  3LIA A;  4GKU A;  2EWV A;  5HSQ A;  3TSG A;  5HD5 A;  5F1G A;  1YLJ A;  1RP5 A;  5CHU A;  4N1X A;  4WZ5 C;  4N9K A;  3KSG A;  1X0O A;  4OLG A;  5F1F A;  2W1T A;  3T12 B;  4LV2 A;  5K5B A;  2MJ6 A;  5KMW A;  4QD4 A;  1KOU A;  2Y2G A;  2HP9 A;  2HZ5 A;  1O7E A;  5TBM A;  5HW3 A;  1YLT A;  4XUZ A;  3DBA A;  1ES4 A;  4M3K A;  4UA7 A;  2V0U A;  4HJ6 A;  3MZF A;  3QP5 A;  2IA2 A;  3LR0 A;  2ZQ8 A;  5A8B A;  1I5Q A;  4IED A;  3NOU C;  1NY0 A;  2XH9 A;  3U2A A;  3MQO A;  4GD6 A;  3C2W A;  1SKO A;  3UE0 A;  3PBQ A;  2GX5 A;  3C7U A;  4CLC E;  2V8F A;  1YLW A;  3HUN A;  2PD7 A;  1YMS A;  2WAE A;  3I7J A;  3RXX A;  4HQA A;  1ONG A;  4OPY A;  3BQA A;  3VSK A;  4QB8 A;  2DNS A;  3UN7 A;  4E3M A;  3SH8 A;  1L2S A;  1P9R A;  3HLF A;  4I38 A;  3T1R A;  4S2O A;  1G6O A;  3IQA A;  3M6B A;  1ES2 A;  4PAU A;  2VLG A;  2W3F A;  5DF7 A;  3F1O B;  3TE8 A;  1H8Y A;  2H0Y A;  4ESP A;  3GTC A;  4BD0 A;  5DF9 A;  1T1C A;  3BEB A;  4DE2 A;  2J7V A;  1OTE A;  4JXW A;  5AQA A;  3KYZ A;  3TJZ C;  1IKI A;  2XSS A;  4JF6 A;  3Q7Z A;  2XGN A;  4FD8 A;  1G6A A;  2GNX A;  3M2J A;  2Y2N A;  1Q2Q A;  2VGL M;  1T18 A;  3OLO A;  1D06 A;  1KDS A;  4LRZ E;  3IWO A;  3R4K A;  2FFY A;  1YSP A;  2C5W B;  4KZ3 A;  3L9K A;  5GLB A;  5DFX A;  3M2K A;  2OAP 1;  2V1A A;  2WKE A;  5TGF A;  1WE4 A;  4KQR A;  3L7H A;  1W5D A;  3N7W A;  1YQS A;  3MFD A;  1IYQ A;  2J80 A;  1TD5 A;  4E3L A;  2H28 A;  3C38 A;  3S7Q A;  1ACF A;  3KSF A;  1OTA A;  3D3O A;  4LV0 A;  1XGI A;  5TFQ A;  2ZL1 B;  5J4E A;  3C8C A;  1W63 M;  2ZOI A;  1H0M A;  5DJT A;  4E3J A;  1VHM A;  1CQA A;  3CWF A;  1K57 A;  2OLU A;  3SZT A;  1K4F A;  5EEC A;  2IWB A;  3W8K A;  4P6Z S;  5F5Y A;  4B93 A;  5IHV A;  1PRQ A;  3SH9 A;  3UB9 A;  3LI8 A;  3A3D A;  1L0F A;  1IYO A;  4JGQ A;  3BFD A;  1NRJ A;  1OTI A;  1WA9 A;  1OJ5 A;  4Y5F A;  1PZP A;  4IUK A;  3A3E A;  3GRJ A;  3QHY A;  4UHU A;  5EFW A;  3R7W A;  3UDI A;  3NDG A;  4XT2 A;  2Y4A A;  4Y0O A;  2ZQC A;  2K31 A;  4Y15 A;  3ITA A;  1JNU A;  3RXW A;  1GSX A;  2WKR A;  4A5R A;  3E4O A;  5HPF A;  1BSG A;  1MZU A;  1GHI A;  2W3D A;  3HJK A;  1LSV A;  4GS9 B;  4LPZ A;  3EEH A;  3IF5 A;  4EES A;  3EWK A;  3CHW P;  2BAS A;  1LSX A;  3S4X A;  4NXE A;  1ZG6 A;  1DP8 A;  4OQI A;  2ZD8 A;  2D01 A;  3N4I A;  4HY8 A;  3IS2 A;  5EVL A;  1YMX A;  1PIO A;  3GQZ A;  3A3F A;  4L9G A;  3TRC A;  4FUW A;  4OLD A;  2ZC6 B;  4OPR A;  2OWJ A;  1T19 A;  3K2N A;  4DKI A;  2ZC3 B;  2LB9 A;  3BFG A;  3WS0 A;  4GN2 A;  5EOE A;  1Y28 A;  3H7W B;  1GA9 A;  3O86 A;  1KE4 A;  1RCJ A;  1CI8 A;  2FFF B;  1K54 A;  4NXB A;  2Y2M A;  3GV9 A;  2HDR A;  4B88 A;  4NEE D;  3PTE A;  1K55 C;  4P87 A;  4OOL A;  5GLA A;  4NXG A;  1MWR A;  2HJ9 C;  3BY9 A;  5HDC A;  2PU4 A;  4WM9 A;  4DXB A;  3VP4 A;  3LGO A;  2VGK A;  5KSC A;  2XFS A;  1T1A A;  3S7N A;  3S7O A;  3GMW A;  4JF5 A;  2WKQ A;  2V20 A;  1JWV A;  5CHM A;  2H0T A;  3G34 A;  3NBL A;  4KUO A;  5HWV A;  4KQO A;  2VZW A;  3IF6 B;  3IBR A;  4LLO B;  4OOM A;  2Y2L A;  1ERO A;  5L09 A;  3BFE A;  5A93 A;  4R3A A;  5G4Z A;  3G2Z A;  4Y2F A;  3QP8 A;  4YNR A;  1YKD A;  2HPB A;  1BTL A;  1FSY A;  1OT9 A;  3G2Y A;  4HP4 A;  4WEL A;  2HJE A;  5F68 A;  2XFT A;  3IF6 C;  3SS3 A;  3VMA A;  2DMW A;  4HP9 A;  3ICY A;  4HIA A;  2VV6 A;  2PYP A;  4IBX A;  4OON A;  2WUQ A;  3ZCZ A;  1LT0 A;  4U0X A;  5EVI B;  2NUT C;  4FH4 A;  1KGE A;  1T1B A;  4JKT A;  3IT9 A;  3E0Y A;  4M4X A;  1O07 A;  2JKR I;  4X1M A;  3ZG0 A;  1W79 A;  3UME A;  4K0W A;  1E4D A;  1L3L A;  3V39 A;  3PBN A;  3H9W A;  1MKM A;  5DF8 A;  2HDQ A;  2JHE A;  5EVI C;  3VFH A;  2W1R A;  2JCH A;  2CMN A;  4WZ4 A;  3QNC A;  4WLA A;  5DTK A;  5IS1 A;  4YFM A;  4L9F A;  3N8L A;  5CXW A;  1CK3 A;  1VET B;  3ISG A;  2B5R A;  3C7V A;  3F1P B;  2JE5 A;  3E4P A;  4AFI A;  1PZO A;  1S6R A;  1CEG A;  1HZO A;  2B02 A;  2JKR M;  4R4S A;  4JGO A;  4KZB A;  4E3K A;  4WL9 A;  2KDK A;  4EV4 A;  3HLG A;  2BG1 A;  5E2G A;  3HUM A;  4JF4 A;  2YKH A;  1IFQ A;  3TW8 A;  1WYB A;  2O9A A;  1W8Q A;  3Q7V B;  4BWI A;  3S7P A;  4QPR A;  4IVK A;  5CRF A;  2LB5 A;  3IHB A;  5M1A A;  2P7J A;  2O0Y A;  1K6R A;  5EVI D;  3B42 A;  4HBU A;  3NC8 A;  1MKI A;  2JKG A;  3A0R A;  3GSG A;  2OAQ 1;  1Y54 A;  4X69 A;  1KVM A;  5G18 A;  5DKL A;  4Q8I A;  5DTT A;  3D4F A;  5FI7 A;  1S4R A;  4P6Z M;  2VA0 A;  1XKZ A;  3O3V A;  3UDX A;  5DJU A;  1E3U A;  1PYY A;  1JWZ A;  2QHK A;  5CEC A;  3LUQ A;  4UA6 A;  1OPX A;  1VEU B;  5EVE A;  4EQI A;  4GLQ A;  1KVL A;  1ZHH B;  5EOO A;  3UO9 A;  4LV1 A;  4Y0U A;  4ARZ A;  4R4R A;  3BWL A;  3MMH A;  5EM0 A;  1K54 C;  5GL9 A;  2EA9 A;  4MN5 A;  4D2O A;  3NIA A;  1C3B A;  4Z9Q A;  3WS5 A;  4FCF A;  4NET A;  5AVE A;  2B18 A;  5HDS A;  2Q9N A;  3Q07 A;  3NUL A;  3IH8 A;  1GA0 A;  2CC1 A;  1OT6 A;  3ZHH A;  3IBJ A;  3OOV A;  4KEN B;  4ZDX A;  1TS7 A;  4WMC A;  3SS5 A;  1D7E A;  2QWS A;  5CEB A;  1W7F A;  3K3D A;  5G4Y A;  1ESU A;  5HPI A;  5DFY A;  3PYP A;  1G5U A;  1DY6 A;  1K25 A;  4MMN A;  1IYS A;  4ZJ2 A;  2A24 A;  1A0K A;  2GZA A;  5CGS A;  5HL6 A;  1P0Z A;  4C3Q A;  4Y17 A;  3CAX A;  3NDE A;  1I2W A;  2K2N A;  4S2N A;  1N9N A;  2Q9M A;  4NXF A;  2ZC4 B;  2V2F F;  2GDN A;  4L0L A;  4PKY A;  2J8Y A;  1IEL A;  5HD3 A;  3JYI A;  1ERQ A;  1PNE A;  1K56 D;  3UE3 A;  1SZV A;  2GJ3 A;  1FQG A;  2PT7 A;  3ITB A;  2ZLY A;  2UWX A;  2EX8 A;  3PBT A;  4KG5 A;  2OLV A;  1ZKJ A;  1Z6F A;  2XF3 A;  3C5A A;  3FWL A;  3WRZ A;  3UB6 A;  2E8J A;  3VV4 A;  1F2K A;  2ZM2 A;  3MBZ A;  3FKV A;  2OOL A;  3NHQ A;  5FQK A;  2HDS A;  4BBV A;  3IWI A;  3BQ8 A;  3ULF A;  4F3L B;  2VEA A;  4BL2 A;  3B47 A;  4PM9 A;  3D72 A;  3UE1 A;  1DP9 A;  1BT5 A;  2XQZ A;  4B4X A;  5IU1 A;  4KQQ A;  3FC7 A;  5FEF A;  1FCO A;  3MQ0 A;  5DTS A;  3U4L P;  3LIE A;  4X56 A;  5EUA A;  1OJG A;  3TOI A;  3PAG A;  3FPW A;  1BLP A;  3BFC A;  3CLO A;  1YLZ A;  4DJ2 A;  2O9B A;  3OPP A;  1PI4 A;  3H82 B;  3A0S A;  3NOP C;  5FQI A;  1IYP A;  5HDD A;  3V67 A;  3EGX C;  3JVV A;  4OKP A;  4QWO A;  3N8R A;  5FQM A;  3GDI A;  4E3O A;  1FOF A;  4H6J A;  2ZJ9 A;  1HD8 A;  3MKF A;  3HLW A;  4MBH A;  3WS4 A;  4DE0 A;  2JC7 A;  1CJF A;  3LCE A;  4EBN A;  4X6T A;  3CG5 A;  1EW0 A;  5KIZ A;  4L9E A;  4NK3 A;  5HAR A;  1ESI A;  1G28 A;  3W4P A;  4WF0 A;  4EBP A;  4RVA A;  2W3G A;  2EWW A;  3RJU A;  3LFV A;  4G3W A;  3KYE A;  4KZ9 A;  3E2K A;  4DE3 A;  2I9V A;  4K91 A;  3D9Y A;  5F83 A;  3MF0 A;  5JYP A;  2PHY A;  4WYY A;  4PMA A;  1UWP X;  2ZC5 B;  1UGU A;  1G68 A;  5D3O A;  1NYM A;  4WUJ A;  3MXQ A;  5L10 A;  3DTM A;  2B95 A;  4GHI A;  3S1Y A;  1IKG A;  5F6A A;  1M40 A;  1SCW A;  4RX2 A;  5CGX A;  3MKE A;  1ALQ A;  4IHQ A;  5GLC A;  2V0W A;  1JVJ A;  3FZC A;  4O8G A;  3RH8 B;  2UV0 E;  1XGJ A;  5FL3 A;  1S4S A;  2Y55 A;  4PHT A;  4S2P A;  3BM6 A;  2QJ7 A;  2W1T B;  5A91 A;  1JWP A;  1BYW A;  1E3U D;  2Z6C A;  3NCK A;  1W8Y A;  4UA9 A;  2EFX A;  4KG2 A;  5TBM B;  3ZNY A;  4MCW A;  1FIK A;  3MFX A;  2Z2M B;  3JVU A;  1OTD A;  1VQQ A;  4II7 A;  4RQ9 A;  1MWU A;  1SKO B;  4WBG A;  3T50 A;  2PR5 A;  2WGV A;  3UPP A;  3HUO A;  3EOI A;  4WMC D;  3NOT C;  1TDG A;  3WRT A;  3HLB A;  3P7N A;  4JXV A;  1QMF A;  4LCL A;  4C6Y A;  4KUK A;  1SDE A;  5U47 A;  2ZC7 A;  1TEM A;  3QP2 A;  2WGW A;  1VM1 A;  3SOI A;  3GR2 A;  1NYY A;  5IT5 A;  3ZFZ A;  3KX0 X;  2PYR A;  3AGD A;  1MBL A;  1N9O A;  3IXH A;  2ZMF A;  3OCN A;  3T1X A;  3IHA A;  5HL1 A;  1XPB A;  4KZ4 A;  3IX4 A;  1SKF A;  3LR4 A;  4E6W A;  2J3W A;  1YM1 A;  4PM6 A;  1MWT A;  1Y4O A;  3NJA A;  1S1Y A;  1PWD A;  4R1G A;  3ZGA B;  3MS6 A;  4HES A;  4UAA A;  1D1J A;  3CZD A;  3N6I A;  1MWS A;  4PM8 A;  4UQI M;  4KZ5 A;  1LI9 A;  4LV3 A;  2KOI A;  3HRE A;  1EI5 A;  1K6S A;  4ZTK A;  2RCX A;  3T1Q B;  3O88 A;  4BL3 A;  1SDN A;  3LEQ A;  4HBT A;  1EWZ A;  2IWD A;  1PWC A; 
#chains in the Genus database with same CATH homology
 2WKP A;  2GX5 A;  4CLC E;  5DJU A;  1YAX A;  2L4R A;  3T4K A;  4PKY G;  1IOU A;  2QHK A;  3LUQ A;  2PD7 A;  4FSF A;  4IUH A;  1OPX A;  2W27 A;  4FOF A;  4ETX A;  2J3T C;  4GLQ A;  4R6L A;  4HQA A;  1ZHH B;  3P01 A;  5F69 A;  2INW A;  3BQA A;  4ARZ A;  2P04 A;  2OWH A;  3BWL A;  3MMH A;  2EA9 A;  1ODV A;  3LID A;  4GJ4 A;  1P9R A;  4MN5 A;  3PHY A;  3F1P A;  5AVE A;  4I38 A;  2B18 A;  5HDS A;  1G6O A;  4MDZ A;  2VX8 A;  4PAU A;  1OT6 A;  2VLG A;  3RFB A;  2W3F A;  3VE3 A;  1XJ2 A;  3F1O B;  3IBJ A;  3OOV A;  3TE8 A;  1N9L A;  1TS7 A;  1D7E A;  2O9C A;  1UWN X;  5DF9 A;  2QWS A;  1NWZ A;  1T1C A;  3EGD C;  1XJ3 A;  2Y8H A;  1OTE A;  3K3D A;  5G4Y A;  5HPI A;  3VOL A;  1S1Z A;  3KYZ A;  4BMW A;  1F9I A;  1OTB A;  2XSS A;  4JGP A;  5DFY A;  3TJZ C;  3PYP A;  4YWZ A;  4Z1W A;  3R7W B;  4MMN A;  4MN7 A;  2GNX A;  4XT2 B;  2A24 A;  2HV1 A;  2VGL M;  1T18 A;  2GZA A;  3FG8 A;  3T4J A;  3OLO A;  1D06 A;  5HL6 A;  1P0Z A;  4LRZ E;  3CAX A;  2M1C A;  3R4K A;  2Z6D A;  3CIT A;  1YSP A;  3LYX A;  2J3T D;  4Y3I A;  4WEJ A;  5DFX A;  2K2N A;  1N9N A;  4NXF A;  2OAP 1;  2D02 A;  4L0L A;  2JKT I;  2V1A A;  4PKY A;  4Q0I A;  4BBT A;  4I5S A;  5HD3 A;  3PBR A;  4HOI A;  4R70 A;  2ZBB A;  1LSW A;  2HGV A;  3A0V A;  3E98 A;  1XFQ A;  4H6J B;  3UE3 A;  1ZTU A;  2J80 A;  3KYQ A;  3IS2 B;  3SW1 A;  1TD5 A;  2GJ3 A;  3OBF A;  2H28 A;  3C38 A;  2PT7 A;  4HJ3 A;  3S7Q A;  4EW7 A;  3KSF A;  3D3O A;  1OTA A;  3F1N A;  3PBT A;  5J4E A;  3C8C A;  1W63 M;  2ZOI A;  4E04 A;  4MN6 A;  4O0P A;  1MC0 A;  3O5Y A;  5DJT A;  3UB6 A;  1VHM A;  3HCY A;  1TS6 A;  3CWF A;  4EER A;  4JGR A;  3VV4 A;  2QKP A;  4K08 A;  4WN5 A;  4P6Z S;  5F5Y A;  2OOL A;  2ZOH A;  4KQD A;  1VB6 A;  3NHQ A;  3T4Q A;  4B93 A;  4BBV A;  3UB9 A;  3LI8 A;  3BQ8 A;  3ULF A;  3LR3 A;  4F3L B;  4NKP A;  3UE6 A;  1GSV A;  2VEA A;  3B47 A;  4JGQ A;  3D72 A;  2JKT M;  1NRJ A;  1OTI A;  1WA9 A;  1OJ5 A;  1XFN A;  4Y5F A;  4EU0 A;  1DP9 A;  4B9O A;  1F5M A;  5IU1 A;  3FC7 A;  4IUK A;  4I39 A;  4CLC B;  3MQ0 A;  4I3I A;  2JN7 A;  5EFW A;  3R7W A;  4G3V A;  4EET B;  3LIE A;  4XT2 A;  1DRM A;  1V9Y A;  1OJG A;  5TJJ A;  3EEA A;  3FPW A;  2HF6 A;  2K31 A;  3CLO A;  1JNU A;  4DJ2 A;  4EEU A;  1GSX A;  2O9B A;  2WKR A;  3LR5 A;  3CUE A;  3H82 B;  3E4O A;  2ZMV A;  1W63 Q;  5HPF A;  3A0S A;  1MZU A;  2O99 A;  2W3D A;  3HJK A;  1LSV A;  4GHI B;  4GS9 B;  3NOP C;  2XRO A;  4LPZ A;  3MJQ A;  3EEH A;  5HDD A;  3V67 A;  3W2Z A;  3EGX C;  4EES A;  3EWK A;  2BAS A;  1LSX A;  3JVV A;  1NLZ A;  4UEY A;  4CLC C;  1XJ6 A;  5KSH A;  4NXE A;  4DN0 A;  3KSH A;  3BJN A;  1DP8 A;  4BJP A;  3GDI A;  3EQV A;  2D01 A;  4ZRR A;  3MQQ A;  4H6J A;  3EQU A;  4HY8 A;  3IS2 A;  4O01 A;  4BBU A;  3T4T A;  2VGL S;  4L9G A;  3TRC A;  2VJW A;  2OWJ A;  1T19 A;  3K2N A;  3UMD A;  3G6O A;  1EW0 A;  2LB9 A;  5KIZ A;  3KO6 A;  1Y28 A;  3H7W B;  4L9E A;  4HH3 A;  5MC7 A;  4HJ4 A;  3UB8 A;  4NXB A;  1G28 A;  4I3J A;  3RTY A;  5J7E A;  2PD8 A;  3PBS A;  4WF0 A;  1GSW A;  4NEE D;  4OOL A;  4NXG A;  2W3G A;  2EWW A;  4F3L A;  3LFV A;  4G3W A;  2HJ9 C;  3BY9 A;  5LBR A;  1S67 L;  5HDC A;  2L1M A;  3OC2 A;  3VE4 A;  4Q0H A;  1P97 A;  4HNB A;  4HH2 A;  1T1A A;  1LL8 A;  5HZH A;  2I9V A;  3S7N A;  4UQI S;  3S7O A;  4ETZ A;  2VV8 A;  2QJ5 A;  3OCL A;  2A2L A;  3HJI A;  3MF0 A;  1V9Z A;  4DJ3 A;  1STZ A;  2V9A A;  2PHY A;  2WKQ A;  4CLC D;  1UWP X;  3T4L A;  1UGU A;  4GCZ A;  2W3E A;  4KUO A;  5HWV A;  4KQO A;  2VKS A;  2VZW A;  3IBR A;  4LLO B;  2YKF A;  4OOM A;  4GW9 A;  4WUJ A;  2FH5 A;  3H82 A;  2KX6 A;  4R3A A;  5G4Z A;  3MXQ A;  4Y2F A;  3T4S A;  3T4O A;  2XA7 M;  4GHI A;  4GS9 A;  4EEP A;  1XJ4 A;  2XRN A;  5F6A A;  3F1O A;  3LIC A;  4YNR A;  1YKD A;  3PBO A;  2M7U A;  2W3H A;  1F98 A;  1OT9 A;  4IHQ A;  2V0W A;  3PXP A;  4O8G A;  3RH8 B;  2NUP C;  4HP4 A;  4WEL A;  2HJE A;  2KLI A;  5F68 A;  5FL3 A;  1S4S A;  4PHT A;  2R78 A;  4EQ1 A;  3C30 A;  2QJ7 A;  2W1T B;  2DMW A;  4HP9 A;  3ICY A;  4HIA A;  2VV6 A;  1BYW A;  2PYP A;  2Z6C A;  3KSI A;  4HI4 A;  1LT0 A;  3F1N B;  3B33 A;  2QYB A;  2NUT C;  5J3W A;  5TBM B;  3H7W A;  2M7V A;  4EUV A;  4MCW A;  3ZQ5 A;  4WEK A;  1T1B A;  3MFX A;  3E0Y A;  4M4X A;  1NLY A;  2JKR I;  3BY8 A;  3JVU A;  4R38 A;  3LIF A;  2PDR A;  1P9W A;  3UME A;  1TS8 A;  4LRX C;  1OTD A;  3PBN A;  3K3C A;  2L0W A;  4II7 A;  2K7S A;  4RQ9 A;  3H9W A;  4YOF A;  2PR6 A;  1MKM A;  5DKK A;  2VV7 A;  3T50 A;  2PR5 A;  2JHE A;  3PR6 A;  5AVF A;  3BW6 A;  4LRY C;  2V1B A;  3EOI A;  5I5L A;  2W1R A;  5AJG A;  3NOT C;  1TS0 A;  3CI6 A;  4CQH A;  2CMN A;  3MR0 A;  3P7N A;  2P08 A;  3ZYT A;  4WLA A;  4ARZ B;  5IS1 A;  4KUK A;  4L9F A;  4EXO A;  5L8M A;  1TF1 A;  5HWT A;  5IT5 A;  3F1P B;  3KX0 X;  2PYR A;  3GEC A;  1N9O A;  4G3K A;  2ZMF A;  3E4P A;  4AFI A;  2G7U A;  3LIA A;  3OCN A;  2B02 A;  2JKR M;  2W0N A;  2EWV A;  4IJG A;  5HSQ A;  4I3A A;  4JGO A;  5HD5 A;  5CX7 A;  4HHD A;  4Q0J A;  3LIB A;  3LR4 A;  4WL9 A;  2KDK A;  2J3W A;  4CLC A;  3FPV A;  2YKH A;  3KSG A;  1H3Q A;  1X0O A;  1IFQ A;  3E4Q A;  3TW8 A;  2W1T A;  3NJA A;  1YSQ A;  1S1Y A;  2O9A A;  5K5B A;  2MJ6 A;  1KOU A;  2FZ0 A;  4BWI A;  4ME4 A;  3S7P A;  5HWW A;  2A24 B;  4QPR A;  3CUE C;  2XA7 S;  5TBM A;  1H8M A;  2LB5 A;  2P7J A;  4UQI M;  2O0Y A;  3UB7 A;  3DBA A;  3B42 A;  2KOI A;  3LI9 A;  2V0U A;  4HJ6 A;  2IA2 A;  3A0R A;  5C5K A;  1DP6 A;  2OAQ 1;  3LR0 A;  1S66 L;  2Y79 A;  5A8B A;  5DKL A;  3NOU C;  3U2A A;  3MQO A;  1S4R A;  3C2W A;  4P6Z M;  2VA0 A;  4DMZ A;  3PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...