1TSRA

P53 core domain in complex with dna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
196
structure length
196
Chain Sequence
b'SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*CP*CP*TP*AP*GP*AP*CP*TP*TP*GP*CP*CP*CP*A
publication title Crystal structure of a p53 tumor suppressor-DNA complex: understanding tumorigenic mutations.
pubmed rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
total genus 43
structure length 196
sequence length 196
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1tsrA00
1HJCA 1EAQA 3WTSA 3EXJA 5LAPA 1H9DA 2H1LM 2OCJA 2J1XA 4IBWA 4LOFA 3WTYA 3KZ8A 2IOOA 2AHIA 2BIOA 2IOIA 4IBSA 4IBVA 4HJEA 3Q05A 3QYMA 4MZIA 5LGYA 2MEJB 2J6WA 3IGKA 3WTUA 3D05A 3D0AA 4LOEA 2XWCA 2XWRA 3Q06A 2J20A 3WTXA 4XR8C 2IOMA 4AGOA 2J1ZA 2X0VA 5ECGA 4AGLA 4AGQA 3EXLA 1T4WA 2FEJA 3VD1A 2X0WA 4AGNA 3D08A 3IGLA 3KMDA 4L0YA 1GZHC 1TUPA 3VD2A 5G4OA 3D07A 1E50A 3D09A 2J21A 3ZMEA 5A7BA 3QYNA 2X0UA 2AC0A 2ADYA 1EANA 1EAOA 4QO1B 1CMOA 4IJTA 4GUOA 2BIMA 4IBUA 2GEQA 5BUAA 3WU1A 4LO9A 2J1YA 3VD0A 5AOMA 2P52A 1HJBC 4IBQA 4AGPA 4IBZA 2YBGA 5KBDA 5AOKA 5ABAA 1IO4C 4L18A 1KZYA 3TS8A 1UOLA 4A63A 4G82A 1TSRA 2WGXA 2J1WA 2PCXA 3WTWA 4KVPA 1GZHA 2VUKA 2BINA 4AGMA 3US1A 5AB9A 4G83A 4IBYA 4MZRA 4L0ZA 5AOIA 2BIPA 3WTTA 5AOJA 5G4MA 3WTVA 5AOLA 5G4NA 1YCSA 4IBTA 3D06A 3US0A 1CO1A 1LJMA 3Q01A 4GUQA 1HU8A 2BIQA 2RMNA 2ATAA
chains in the Genus database with same CATH superfamily
1IGMH 5FM4A 1OPGL 3MRIA 1FI8C 3DO3A 4GQQA 4LL1A 4PJHB 5ADOH 4JRXD 4CC4C 3W3BA 4KPHH 3CLFL 4PSPA 1X4XA 4CRPA 2CUHA 2CGYA 4LT7A 5HJGA 2XDHA 4MNQE 4M6OH 4X6DF 3FRUB 1ML0A 1CGXA 2FJUB 2R0WL 1IMHC 1MCIA 3M07A 2DH2A 1HN1A 3IDUA 2A83A 1AXSB 2VZ3A 1MFCH 3NFSH 4XRCB 5DJ0A 3EYFB 3RNQB 1RZJC 2YSSB 4MZ2A 4F57L 4Y9GA 2VOTA 5IHLB 3LEYL 3DIFB 3NJIA 4ZG1A 1J12A 4QHLB 2G30A 1R6VA 1ZHBA 3PWVA 1UQSB 4KY2A 2PPAA 4E5XG 4KX9A 4QY8A 3UL4A 2R0LH 2ED8A 2HJLA 4Q4EA 1CLZH 1G6VK 4H1LH 4PN6A 3ESVF 1U8OB 2O6PA 3Q6GH 1KELL 4G8AC 4OZGB 3V4UL 2YPVA 2YC1A 3FU5A 3IDGA 2VO8A 2DWTA 2ZG1A 5IK3A 1IEBA 4ONFH 5BQ7B 4OLZL 3G6DH 1IM3D 3U48A 4NWUL 3DK2A 4EIBA 3AY2A 1WA0X 5FYKU 5ISZB 1NLDL 3Q5TA 3L3IA 1NFIB 3ROOB 4BBWA 1FL6A 2A6KB 2VDKB 5SWZB 5C0FB 3QE5A 2CPUA 4UUJB 5D7LD 4FHKA 2DM7A 4O58H 4DPBX 3MCKA 3UTZA 3NN8B 3BP5B 4OZHE 4Q89A 3QORB 4RETB 1H6EA 4CDHA 4X5PA 2IMMA 5C08D 2E4TA 3QNYB 3NIFB 3DGDA 5FYKH 1CE6A 3TO2A 3KPSB 3ZKNC 1TOXA 4L5FL 1P4BH 4OF8A 5F6HJ 3B5HA 3M1BB 3MRPB 4F8TA 5F0PB 5I8KH 4CNIB 1E3XA 1IAKB 5E94A 4YVNA 1D5MB 4U1KB 1E2VA 1BJ1H 1NIDA 2V5RA 3WL9A 1JBJA 3R1GL 4KX7A 1BLNB 5EPMA 4KUZH 4N0UB 2DL2A 3MRHB 3P1VA 1ZWIB 3E0GA 4FL4C 2DQIH 2OXGA 3ILPA 5D1QA 4AYID 3JWOL 4UF7C 5CM1A 35C8H 2FCBA 1YYMH 3PAZA 3V9FA 3X12A 1X6LA 1SXSA 3CDFA 1C8QA 1TLKA 4WRLA 1GZPB 2ZXDA 3CK0H 3FAXA 2DWDB 3DMMA 3G5VA 4ELMA 4OCNC 3GMQA 1EWHA 3GMPA 4U6TA 2WXOA 3SKJL 2X4QA 3FAWA 5LGKA 1WIUA 1E9OA 1JRHI 2WVVA 3FU7B 4HUUB 2VC2L 4KXZI 1O9VA 5A2CA 1ZSDA 1EJFA 1HIMH 1WBZB 3G6JE 5CSGA 3UTSB 3AG1B 1PDKB 3D05A 4HIXL 1T66C 4RRPM 2D3JA 1XSJA 3WS3B 4YZWA 4LOUD 5EZIL 1TVHB 4GRLB 4DGIL 5CR1A 5FW6A 3IJHB 1E5AA 4POZD 2C34A 3O3AB 4FQ2L 3U4EB 2FATL 3MUY1 1KIUB 3P9MB 4AGQA 1LDPH 1YNTF 1FBIH 3ALWA 3JWDL 4XVTH 2QJDA 2WOYA 5IHZA 2YGOA 5FCUH 2PYEE 3CC1A 1IL1B 5E08L 1G4MA 1SYVA 4YR6A 3S36H 4DGUA 4KI5D 3VX1A 5F7EL 5B39A 4WU5B 4LSDA 4KDWA 1D5ZA 5A16B 5C0JB 1UA3A 1I82A 2NW2A 1HCFX 3F7KA 1PY0A 5B3JF 3MA7B 2FIKB 3TV3H 1KPVA 4OKVB 2APSA 1DL7H 4OFIA 4XCFL 3KS0J 2J25A 4DO4A 3RVTC 1UM4L 3BPCA 4PUBH 5L88H 2VDOB 5LBSH 2OYPA 5SV4A 2X4SA 5MHSD 2AJ3A 3SPIA 3NEEA 3BH8A 5C3IA 4GRMB 2HMIC 4QTFA 2ZWKA 4PJ8A 4D0BA 1WFNA 3GMMA 3QDME 1C08B 2X41A 4HUXA 4L4VA 5ALCH 5H4YA 1UVQB 3KCPA 4BXVA 1SUJA 2IGTA 3NIDE 4A6YH 1QBMH 2BINA 1JNLL 4BH7B 1UKQA 4UT6A 4UCFA 1CIDA 3Q43A 5D1QD 5I1IH 4EI6B 1SHXA 4S0TD 1O0VA 1EZLA 1VGKB 4MNGA 3CLWA 2JK5B 1A4BA 3IBOA 3FS9A 3BQVA 4NAMA 2XFGB 4P5MA 4O02L 4OJCA 4BFFA 3STZB 3VFRB 1ZCRA 2WPGA 3MXWH 5AVYB 1F3JA 3QDAA 4HULB 5JDSA 3LCYA 4LESA 4RWYH 3T1FB 4LRIA 4CW1B 2YGQA 1LNUA 3PL6C 1AZUA 2K4AA 3ESOA 4KMTL 1VADA 5C70A 4FOMA 1FYTB 4QAWA 1IAOB 2W9DH 4ZFGH 2XBTA 1IGTB 1JN6B 4HGWB 4NCC1 4X7TB 2QQKH 3MYZA 4KY1L 4JFPB 3QT2A 4FFYA 3EJYD 3EOAB 4V1DB 2P5PA 3M1CA 3VDBA 2DQEH 3L5WB 1T5WB 3MRCA 4NNPH 1PPIA 1BP3B 1CZ8L 2AERT 3LPWA 4B50A 4D3CH 4OGYL 2BM3A 4M1GH 4D0CB 3T1WA 3E3QC 1XR8B 4YFLF 2R8SH 5TF1H 3GLDA 4NGHL 3TNNB 1K4DB 4A39A 2Y5TA 4HWBA 4ODUA 1LP9F 1I7RA 1KTCA 1UCTA 3I6LE 3LZNA 5DLML 3ARBB 3DDFA 1PSKH 2E74C 4K3DL 3OJDA 2EO7A 3WJLA 3THMH 2Z0UA 2ITEA 1ZPUA 2RALA 5DJYA 2N4IA 5IBLC 5IFAL 4N2AA 1ERNA 3NCJL 1MHHA 2WXLA 5EZJA 1Q94B 2B14A 4R83A 2NTSP 4NO3B 3D39B 4LPXA 4XP4L 5EEYA 1M6OB 1ODAA 2GI0A 5L9DL 2P4AB 3O9WD 5LO7A 2WWNA 3CFTA 4Q0XL 2YUXA 4ZYKB 1BEXA 3AG4B 4NQDE 1XHHA 1N26A 3IMUA 3MYJB 2WB1A 3NACH 2Q8BH 1RU9L 2E6PA 2EDRA 2QQNL 4CKQA 5EOQH 5ITBH 4TVPE 1KJ2B 3G5ZA 3NCXA 1NKOA 1W72B 3DNKA 4DQAA 1VKXA 1XB3A 4KOBA 5INCB 5K9KB 2WNXA 4WCYL 4PI2A 5E24E 3JWOC 3LPPA 3DO4A 3ZDXF 1Q1JH 5BJTA 1BQHG 4KRLB 5CCGE 2VL5B 2XN9D 5CJOH 3QUZA 4OLUL 2XA8H 5D7SL 1NEUA 3DX6A 3EGXA 4PRBA 2R69L 1IEHA 3QEHA 5AEAA 4IRSA 2AXHA 3KL5A 2JSFA 2AQTA 3BYTA 3UJTL 1J5DA 1NGYB 2BS8A 2HB0A 3QI9A 3EUUA 1EZUA 3JV4B 3KYOB 1J8HD 2HRGA 2QV4A 5HYJB 1TJGH 1PGRB 2AQPA 3E8VA 1MCDA 4L8CB 3OPZL 4QXUH 2UX6A 3RUGB 3S96B 3VFNB 1MWOA 4F15C 1BSIA 3G6AA 4L8BA 3SQOH 5KN5B 3V0VA 4UQIM 3W0WB 4YHPA 4LL4A 2EVHA 1BZQK 4G11A 4F9PA 2ATKB 1DUYA 1UM5H 3OKDB 1DSYA 1DVFA 1SZNA 2MIZA 2X4OB 2X4PB 2DLIA 3QCUL 4JN1H 5JUEL 1KIRA 4I3RH 4F5CE 4KVNH 4UIKL 5DTFB 5KSAA 3LKQB 5IMMB 3WHE0 2WLYA 2G75A 1E90A 3JWDC 1AQKH 3N06B 1YY9C 1GYCA 1FFPB 2NY3C 3L3HB 3H9HA 3SDAA 2ADJB 1TETH 4JY6A 2H41A 3BVVA 4G8GA 5JQ6H 2MTAA 4JKPH 4PJFE 5LXGH 5IMOB 4C4KT 3F7VA 3GRWH 4MJHA 4XNQA 4LU5L 4ZPTB 3H7BA 1Y1UA 5IJDC 2O5YH 2X5PA 1USZA 2WYZA 4K5OA 5FCSH 4ZUWA 1KGWA 2FEJA 2O26U 1VESA 5IESL 3PPSA 3MBWA 5FYLH 4XPAH 3SD5A 1HAUA 3E3QE 5GGVL 4GAGL 1N3NB 1X5GA 1K9TA 2Y7SA 4ONGH 4Y5YA 3H2PA 4F8QA 4CKVX 4JZOB 3D09A 5E2TL 1E30A 4LLQA 3ZYIA 2Y5QA 4RFOL 4ZTPH 4BFEA 2DLTA 2ODHA 4WUKL 1NCDH 1KN4H 3GMLB 3TVMB 3DV6B 5G2NA 4W9LC 1S4IA 4LVEA 1RZ8A 2AP2A 2BOCA 2ICEA 3L16A 4GAJH 5CMAA 4JK0D 4LMQI 2F74A 2KS0A 4R90L 4LASH 5C3TA 1JNHA 5J89A 3BAJA 5EN2A 1Q0XH 4Y1TA 3T6WA 5KBDA 4X4ZA 1A4KA 3T3MF 5JIDA 2X3CA 3ES6A 4MSWB 5IT2H 1YC8A 2CK0L 1DBKH 1A21A 3QUZD 4Y4HB 5DD3H 5T1KA 3RIAF 1TVDA 2YA2A 4K71C 3CWGA 4N1HB 5EG6C 2V2TA 2CJ3A 4IRSD 5HHMD 3FCGA 1WTGT 4PP2A 2EUXA 3BVUA 3GSVA 3MNMA 4Z5RB 2HKHL 2WGNB 4HMDA 4C58B 3FUDA 3LXUX 1KIQB 2D3VA 1SJHA 3EOYG 5DJXB 1EAJA 2EECA 3NABH 4UYPA 1OV8A 4JRYD 2D31A 4QYOA 2M1KA 5CBAA 4WFHE 1LD9B 4FXGB 2GC7C 4NN6B 4KNUA 3VYOA 4PR5A 2XRAL 3FZUD 4YFLI 5GGSB 2WCPA 4KRPB 2IPUG 4N2GA 1DVFD 2G3XA 4XBMA 3KYNB 4NNYB 5KSAD 5CHNA 3BDYL 3BRGC 4ADJA 4NI3A 3F7RA 4LCCC 2BXZA 1TQCC 2ADGB 1KCVH 2UZIH 2V8LA 2GSIA 3RU8L 4MB5A 4PRDA 4LAQL 4U0RB 3SDAD 4ENEC 1JE6A 4DK3A 1IARB 5T3ZD 4G8GD 1MAMH 4P5TD 1NCCL 5AAWC 5IV2B 2I07A 4UM8A 1MJ7L 1YSOA 2AV7A 3KBHE 5ACZA 5ID0A 5GRWA 3EBIA 4AEIL 4OV5A 2AV1B 4L37A 5DHMC 3CSFA 5HHOE 5CSZB 3JWNG 1D7DA 1L6ZA 2MEJB 4D9RD 1ET7A 3AB0B 5IJVB 4AIZB 1MF2H 2RFXB 4P9ML 4ZUUA 4NHCH 4Z78A 2GHWB 4A1RA 1MREH 3T0EB 1PMYA 1PNDA 2AMUA 4U1NB 4MB3A 1X4ZA 3EYQC 3QCVL 3SPVB 1PL3A 1JSYA 3C2AH 1QSFA 5D1XA 1UZ6E 5HY9B 2UWEE 2GQHA 5F3HB 4UTBA 1MG3C 3P4LA 5AW2B 4WHTA 5HXMA 5IFJB 4PRAA 4LSTH 1CFNA 2Z8WC 3P2DA 3X11A 4RAVA 4NO5B 1J1OL 5JOPE 2DQTL 1OE3A 2LLNA 2PTVA 2DKUA 3DROB 1EXGA 4PJ7B 3C8KB 2UY7B 4OM1L 2VKXA 1A8JH 2BIMA 2X42A 4XN8A 4AT6B 1AIFA 1UM6L 2FLBT 3DV4A 5C09E 3OG6B 2FEEL 4QRBA 1LO4H 3CXHJ 3T8MA 5HI4C 4ABVA 2BERA 1A4JA 5DUBB 4KRMB 2BOBB 3MRQB 4X7DC 3BO8B 1I3GH 4GW1B 1OB1B 5IVXF 5EU3B 2P44B 3V6ZB 5EO1A 1A7RL 3GXMA 3QQ3A 4TOYH 5SWSB 2NY4C 4O5LH 2EYRA 1A8ZA 2PWGA 3FO9B 1YEEL 3DPBB 5LNDA 5JIKA 1OGSA 1OVZA 3STLB 1G7QB 2NZ9C 4TNEA 5FW8A 4OTXH 4LNVA 4KO9A 4W93A 3FPYA 3LQMA 4X7EC 2CIKA 1U2HA 5AOIA 5BZWA 3A67H 3TV8A 5J9PA 1T3FA 4NRYA 3RWEB 3LIZH 4NB7A 1A6TA 4NUGH 3FFCE 3DVNA 4L8SA 2FYYB 6PCYA 2DQHL 3CVHH 3T65B 4G2AA 4YHOH 1SDDA 1P53A 4IIQB 4EUPB 3JYBA 2AXJA 4FTVB 1IIKA 4WI2A 3IJEA 3T77B 1XF1A 1E5ZA 4ADIA 1H3PL 4IOSA 4X6EA 1CBJA 4B5ZA 3ARFA 1JPSH 1P4LB 5E1HB 3S88H 3HAEG 4I4WB 3HG2A 4ZZKA 2DMGA 3B7UX 4NBXB 3QXAA 3B8YA 1UKTA 5D93C 4DKEH 1FVDA 4HMCA 4ZQKA 1Q0YH 2IFFH 1UWFA 2E7DA 3CVCA 4JFUA 4UNUA 4WU7B 3U2SB 3ARGC 4FJZA 1QBLL 3VRJA 2UZXB 3BUIA 4OCYL 1FN4B 5IWLC 5GRJH 5E99L 3LD8C 3SPHA 1TITA 1KCKA 3BDXA 3QRGL 4UQ9A 4LBEA 3U9PH 4A37A 2F19H 2WLIA 1MUJA 4WV1A 1T1XB 4GXVH 4KTGA 5I8CB 1J9TA 4XBGB 5GGVY 2Z7YA 4ZSOB 4JFOB 3PP4H 5AW1B 3V7AE 4D0DA 4MX7A 2IH8A 1XD1A 3VD2A 1M7IA 5AAMA 5EUKA 2AQ1A 3MTRA 4J1UB 3FB6B 1NBVH 4Y5XA 3QAZB 1J18A 4LLDB 1KB3A 1IGIH 3LXCA 4MHHI 3CCHB 2BNQB 1E4WH 2VWEE 3L7FB 2LAAA 3V0IA 3K2MC 4XP6H 4F37K 5ACMA 4KK6C 2VSCA 4PJHE 1HSBB 4UBDD 2P8MB 4Y1AB 5H8DA 1AZVA 1JNJA 3CU7A 3U1SH 4JHVA 1Z9MA 1ZVHA 2IH3B 4IKNA 3KPPB 3BAYA 1ZEAH 4RAHA 1CQYA 4U4IA 4D7PA 2FJHA 3BIKB 5LJYH 3R06B 4TSAH 3OSKA 3QXVA 1KPRB 3P4NB 1OIOA 5HD8C 3QW9A 4Y0GA 4FXKC 2A6JB 1G9ML 4NO0D 2NY5H 4X99A 4M48H 2GUOA 4GQPH 4F9LA 5E70A 4A7UA 1JZ7A 3ABMB 3MRKB 1YY8B 1QVOA 1UENA 4WF7A 4H1LG 4UILL 4JMNA 5FO2A 1FHNA 5KSUA 4JHAL 4TKWA 3M7OA 5E8EA 3ZQXA 4M61B 2HP4A 3DI3B 3FHQA 2NNAB 4XMZA 1PBYA 4ZS6C 3P9WB 5DRWA 2YOAA 4CU6A 1M05B 1KCWA 4IOSD 5ITFB 3QIBC 3L81A 3WHXA 4LDCA 4MKTA 1FGNL 2OTWA 3ML9A 4QIRA 1Q9OA 4EN3C 1A3LL 4JG5A 1PLAA 5DHVA 1S78C 3F58H 3VXUE 3CLEL 3T5WA 4DZBB 2WKOF 2O5XL 2HKAA 1WBYA 2QR0A 3KPMA 3VGGA 1WV7T 4QRUA 1NMBL 1YAIA 5J1AB 2D7TH 2Y36L 2F2HA 4PSRA 4I18A 4YDJA 5EBWA 1HHKA 2AEPH 4M7ZB 4EIUA 4Z7OF 5GRUL 1QG3A 2VR9A 2F53D 2IMNA 5EORL 3L5IA 2ZUQC 2JIXA 4XCNB 3R19A 3VFTA 3BSZH 3BKYH 1AHWC 4NENB 4TNGA 2VE6B 1UA7A 5FFOA 2OYMA 3B37A 2J2ZA 5IQ9A 5I6PA 4MAYB 5HDWA 1MIEH 25C8H 5IVOA 3WD5H 3VI3B 4E41A 4NAJA 2VISB 4PTTB 4FNQA 3I9PA 3LKSB 5AVTB 2K9FB 5KVEH 4NQQA 4OLVH 1G7HB 5EWIH 4NQSA 5FB8B 4WI3A 1QI5A 3AS2A 4APQC 4X5XB 1I1AB 3FQNA 3BVNA 3H9SA 1U8LA 4PP1C 1C16B 4YVUA 2F0CA 5E9DE 1Y6KR 2IADB 1FHGA 3SO5A 1KSRA 2XQYG 4Z7WE 3CSTA 4DP0X 2R23B 4JHBA 1OT2A 3B9DA 4L9LB 2C3WA 2YHGA 3FXIC 4I3SL 2J43A 3GD1C 3DHJA 1O5PA 5CXPA 4MXWL 3PGFH 5CLZA 5BRZB 2D03L 3G5XA 2NT0A 4L1HA 1G1OA 4RISH 5AOMA 5B22A 2ZX8A 3WMSA 2IAMC 5EEUA 4YK4B 1J0IA 4JVWA 4PJDA 1HDMA 4FCHA 3PWJA 4N24A 4R7DA 3GMNA 1G7IA 1KEGL 3RZWA 1WWBX 4HP5A 3I02B 2VZSA 3QC6X 4RGMC 3HZ3A 1IGYB 4JANB 1HVXA 4XPBH 2F08A 5DUPH 2EDBA 4QRFA 5FV2A 1JGUL 3ZE1F 3AADB 4XE5B 3T8VA 1BLIA 3HNTH 5L4FA 1Y6MR 2B1AL 4N8VB 1BREA 1UT1A 4LSVL 1RMFH 3KYAA 4FLOA 1GHFH 2ZKXA 4BHUI 1CFTA 1GH7A 2ENJA 1QR1A 1U8HB 1W6LA 5MI0C 2GYSA 4DJMA 1E6JL 2VW7A 5D7IB 3TBBA 4EJ1C 1UWEH 3RKDD 4CADB 1EHAA 2R2BA 1UH2A 3K8LA 4ODWB 3RWFA 3VUAA 1X7SA 2ZZUT 3VW3H 2CR6A 2WXQA 5FO9B 2SODB 3MBED 4ZFOA 3OM3B 1T6WA 3IXAB 1OF2A 5EUOB 4W81A 2CLRB 4E41D 3VSQA 5K9OB 1AO7A 1F6FB 2D2OA 4NBYB 4UT7L 1N0XL 3SDYH 1MRDH 1UXWB 2BPBA 3ZTNH 4XMWA 1JGVL 2WHVA 4P2AA 4ZFZA 1VHPA 2RCSL 2ZONA 3HG1D 1J11A 1YEWA 1HZKA 3ZHLA 1YQVH 4KKQA 1OD9A 4PLKD 5E0QA 2OSLA 1F3DH 3UZVA 3KWWA 4UT6H 3SKNB 3V6BR 1SXZA 4BE6A 5E2VH 5DMYA 5I2IB 3CH1B 3H9SD 1U9KA 2D7MA 2V17L 2R1XB 1EO8L 4L3FA 4PCYA 1QA9B 4RAUA 5HHQB 2WUCH 4XN9A 4DUVA 2E7CA 2HTKD 3GQFA 4RDQF 4JG0L 2VXTL 2AK4B 2R1YA 1UUNA 4U2YA 3NJMA 3RWJB 1JZ4A 2BVQB 1WYJA 1XAUA 2B5IC 4JFYA 3TP4A 1CICB 1IKNC 1QASA 1U30A 4ZNCD 1AG6A 1W91A 4YUEL 3S9DB 2IDTA 2Y07H 4Z7UF 1P5UA 1AIZA 2CXKA 2YPLA 1ILSA 4NZTL 5F9DC 5JOFB 1FYTE 1WZLA 1E5CA 3GSQB 4TPRH 2JJVA 3G04B 1NFDA 1B9ZA 4JFQB 4MKMA 4MA8L 4N2HA 3BFOA 3FSOA 5TDOB 4D2NA 1Z5LA 1GTNA 4BH8A 5LG1A 4Q4IA 1EEZA 3QZPA 4IU3B 4HH9A 2HT2C 1KLUA 1JXDA 2NXYD 4JAMA 2NXZB 3SCMB 1UD4A 1OM9A 5TDPB 5AOKA 2IALB 4PW4A 2CKBA 4PGBA 4XPTH 2ZWNA 5D6CA 5JHLH 4FQXA 4KZEH 2B2XH 1A7NL 3GO1H 4U6VL 4GG6F 3GJEA 1GYVA 4OAWB 1BVNP 1VFBA 1NCAH 3CIAA 4JM2B 3WIIL 3FMGH 4N0CD 1WWWX 1Y0LB 1L5GB 2ITCB 1PEWA 2IANE 3OSVA 3V4PH 3QFDA 1AGDB 5DFVD 4KHXH 2JKIS 3WMQA 3EHBD 2NYYC 2QPSA 5INDB 3RWHA 1BGXL 4EKJA 3BVXA 2MCPL 4U6YB 5MENB 5JO5A 1NSNH 5EH1A 1QBAA 1L0YA 3TA3B 4DSYA 4WW2B 4WO4B 2HYMA 1AY1H 1G7PB 1UZ8B 3TN0D 1HYSD 1AO7D 5T1JA 2I24N 3KW7A 2CSPA 2OW6A 3I75B 4KROD 3U6XS 2FAUA 3D39E 3V5DA 1LLAA 3MGOA 4CUCA 3CHQA 3DECA 3T6QC 4NUQA 3V55A 5KVFH 1ID2A 1XH3A 4BUQA 2JELL 3EG9A 4P05A 3UG5A 4F58L 1GZQB 5DK2B 1PTZA 1S3KL 3D9AL 3VXRE 3CFEB 2J56A 4YSOA 4KMQA 4OUUB 3B2UD 5DQJA 2V5TA 1G6RB 1QHPA 2VLKB 4MNQA 2LQRA 2NLJA 5T3XL 5A6LA 3BH9A 2EDHA 3IJYB 5FK9B 4B9PA 3TFKD 1JXFA 3ULSB 3U7WH 4HWEL 3BQUA 4HHWA 1C5DA 2Q7NA 1UADC 2VTFA 3EO0A 2DZEA 1EXUB 4Z3TA 3EBHA 4GFXA 2UVFA 1DJGA 1T80A 4JKMA 4UMGA 4YXKH 3X1GA 5K1JA 4R97C 3RVWD 2GUYA 3EOBB 3OX8A 2EIEA 3I74A 3CDGA 4PRPD 2G5RA 3CDYA 1X7QA 3LB6C 3OGOE 5CZVH 5HI5D 1R5VB 2FHBA 2W07B 3IGLA 5A2AA 3A6CL 5G4OA 4MLIA 2YGPA 1M9WA 4K3HA 4C4BA 2J21A 4ORGB 1QEXA 1JHKH 1KULA 2YAEA 4KTEL 1KPUB 2J8UF 1VERA 5AZ2L 3NVQA 3A22A 3GZOA 3VYPA 5BVJB 3OAZH 4JFFB 1R5IA 3I2CH 3U36A 3SN6N 4C4KO 1TMQA 3KLKA 3VRLE 5IQMA 2X9YA 4LO9A 1G0XA 2A77H 5DS2A 4LOVA 1NC2D 1NM4A 2YXWA 2J55A 4OZHA 4XP9H 2FWSA 2B1HL 3I9GL 3FBKA 5CLWA 4P23B 5AYUH 2YWYA 4RA0C 2XA3A 4S0SD 1HI6B 4I48A 1EZVY 2HRPH 5IEHB 4HLEA 2O6DA 5T3ZH 2PO6A 2WGXA 1NUFA 5BPPA 3WNLA 2PP7A 3DTXB 3B2PA 2H2SD 3Q1SL 3OGCA 4UOQA 5C0CE 4QGYA 1BVZA 1EHNA 3VAEA 1NICA 3X13A 2YK1L 3T3PF 5BMFL 3H53A 1G9NL 3SGJA 5JW4Q 4IMKC 1HXYB 1T1ZB 4MDRA 2PMZA 1E4XH 1Z2KA 3KWVA 1HL4A 5HYSG 5CJXA 1J10A 5KTEL 3DPDA 3VD7A 4I3GA 3VFUA 4GKNA 4HJJL 3BZ5A 5EU5A 2LLGA 4MNQD 3CVIH 4XB3A 1FNEA 1RD6A 4QRRE 2JB5L 3BQUD 1T22A 4MD4B 1JI2A 4CVWA 3FKUS 1ZLUH 1X5KA 4GKZA 2PLTA 1TQBC 1LMKA 2AEIT 3DETC 1AGEB 5DEGB 2F7QA 3L3DA 2FQFA 4AL8L 2KC0A 1EGJH 1PU0A 1VCBC 4HAGA 5K9QI 5I73C 4O2EA 5D8JH 3G6JA 2M8XA 1GR7A 1OWWA 4IEFB 5DCCA 4ADGA 2A38A 2OMVA 1TSHA 5JTWA 5LN8A 1E27B 1X7TA 5LAXA 4O4YL 5CILH 4JLRA 4N86A 3QA3B 2C3VB 4C56B 2HFGH 4Y4FA 4NYLB 3TT1L 4MS6A 4OSUH 4GAYB 3BHBA 4ERSL 1XBDA 4HALA 4I88A 1GGUA 1JZJA 2D4DA 4HA1A 3B34A 4ZXBC 4AGLA 5D7EA 2PYEA 3ZKXC 1I4FA 1BDYA 3PRZA 5I8OH 4NHUA 4F1ZA 1KOAA 2DI8A 2E6JA 4X5LA 5BNXD 4JQVC 4XVOA 1VFMA 1A9EB 2JQMA 1T03L 2E56A 3OL2A 4R9HA 3E9TA 3RNKB 4Z7QF 5BRPA 3WG7B 1PEZA 2VDQL 3GZPA 4NM4H 4F3FB 3AREB 4HMEA 3OKNB 3OLDA 2X4NA 1FJ1B 3G3LA 3O4LD 4XNXL 2ADFL 1KTKE 2E27H 4JN2B 3T2PA 1MHCB 1OL0A 1XMWA 4JKWA 3MV9D 1Z5YD 4NZUL 3Q8AA 1ZTXL 2FX8L 4OZIF 1OPOA 4KJPC 4OD2B 5D7JC 4ZD3L 4FRWA 2Q1EA 3QDMA 2BSSA 3OHXA 3LH9A 2VZOA 1FNGB 1KYOK 4ELDA 1CBVH 4P59L 2AKRA 3IN0A 5A2FA 3O41A 3GMOA 3S37X 3UDWA 4U1SB 2BVEA 1ORQA 4ONHB 4RFNB 3UYRH 4YHZL 2E5EA 4BRVA 4JFHD 2WQVA 4QDGA 5T1MA 5E1IA 4M93B 2UXVA 4P5KA 5FOJA 5IOKA 1DE4A 4YDLB 1NC4A 4ICWA 2VXSL 3QXTA 1N67A 5KYXB 1A7OH 4QHNB 3RL1A 1HILA 2DQCH 4W9FC 1F1DA 4OQTL 2ZYRA 3CZFB 2RGSA 3DGGA 2WZPA 2YQBA 5L4JA 1RK0A 4JDEA 3WY1A 1T7WA 3BW9A 5AW3B 4HPHA 2WLLB 2HLEB 2KKQA 1WSST 1UT2A 5G5DB 4JFZH 4B9JA 4YDKH 4MJJA 2JKLA 4WZ9A 1MCPL 3QULB 2QSTA 3R8QA 1AZRA 3HTLX 3ARTA 4QUOA 3U2JA 2VDMB 5IG7B 3TCXA 3F12B 4K55A 1A5FH 1MWAA 3B9AA 2CZNA 2I7OA 3QUXB 1VEMA 3D2UB 4YFDB 4Y2NA 5LB1A 4LVOC 4BUGA 3T6XA 4U4BA 1KCSL 1JGLL 3K0YA 1KNOB 2YBRB 2D7QA 4ESKA 4R7NB 3BAWA 4UDTA 4Y4FD 1ZV2A 2DLFL 4YXLH 5ENWB 3X1BA 2PCYA 3HS8A 1AGCB 7FABH 3KNBB 4MXQD 4L1SA 3ZLQC 1QLEH 4OFYA 4PJXF 2IQAA 5HP5A 4MCMA 2WAQA 4B96A 3EYSL 4MNHB 3EJRA 4GKOA 3HOGA 1L9PA 3VQLA 1VPOH 3BSGA 3HRZC 4P2QD 1A9BB 4OCWL 3GNMH 2OMWA 4F37F 4ZMOA 7PCYA 3KLHC 3U46A 3PWNB 3GPSA 1JWMA 2OL3A 4X6DB 3UG4A 2Q6WA 3NAAH 3U7AA 5EO0B 2V9UA 1E6OH 1IGML 1TO5A 4ZMXA 1JWSA 3T4AC 4YHYB 2WKLA 3GHBH 3TPUA 1X5LA 3S8WA 3INOA 4YC2C 3RBSA 3QZWG 4E0RA 3TBSA 3OXRA 5CEXA 2ZSWA 5ADOL 2NY1B 1WWAX 2VR6A 5HBBA 2LU4A 3ME0A 1X5MA 4P4KB 3OLIA 3P4OB 3WN5A 4PG9B 4FQQA 2P45B 2WLJA 3MRFA 4R2GB 4FNSA 4TNVK 4JX0A 4ZK8A 5CZRA 3MRRA 4M6OL 1MJ8H 3TXAA 2YIHA 4BQCA 4NQDA 1HINH 1U58A 1MFCL 3NFSL 3A4EA 1IAIH 4UU9B 2CCLA 1YQ2A 1D5BA 2PKDA 5FGBC 5F1IA 4HX1A 1G9NC 1WC7B 1OP3K 3BEVB 1CQKA 1DVSA 4LLMA 3VXPB 2WC7A 4FKKA 1M6UA 3BUDA 1A1MA 4WK0B 2WZPD 1KDIA 5EA0H 5FXCH 4FQCL 4G5AA 2OI9B 5GZOC 2R0LL 4W9DC 3EFFA 1CLZL 1CB4A 2X38A 3Q6GL 4Y1SA 1ADQH 1BWMA 1H3TA 1NPJA 2H7WA 4GQZA 4RSYA 5DA4A 4KK5D 3P4MB 4ZSOE 4UOZA 3L95A 2CO1A 2XIBA 3L4TA 1ZS8B 4ONFL 3QEQE 3G6DL 3L6FA 3BKML 1PD0A 3FYEB 4AI7A 4DCQA 4KV5F 2VZVA 3N55A 1KWKA 4AL8C 1YEDA 2NQ3A 4PJIF 3ARDD 1CGUA 4AEHH 4OFYD 4XXCC 4HJSA 4Y1AE 3T04D 1NZRA 1P7QD 1TT6A 1BD2B 2WUBH 2Y22A 4CN6A 4U7SA 2M26A 5DK0B 4ZOEA 4N2IA 3S5LG 1JK9A 1G4RA 1B4RA 3PL6A 2P7TB 4F5CA 2Q76B 3RVVD 3FONB 4JFDB 5FYKL 5T3XE 4G43A 2NW3B 1UTDA 1P4BL 5C9JB 3Q48A 4X98B 4TQIA 4OF6A 1QTYT 1R3HB 4IKJA 5I8KL 3BWAB 3FB7A 3NDYE 5T8IA 4AYFA 1ZT4B 2X44D 3IGAB 4J8RA 3LXAA 1QHQA 4H20H 4PJFA 4HG4J 4N2BA 1LK2B 1SFHA 3O6KH 5ESVB 4KUZL 4DZ8A 1KB5A 2FB4H 3CHRA 1NMAL 4PVMA 1HZHH 4LNRB 3WAKA 3FFDB 4ANUA 4XCYA 5J5EA 1E8WA 3HN3A 4K8RH 4FKHA 4KDVA 5E2JA 2VM9A 3IDYC 35C8L 1YYML 2DM2A 3MZGB 3Q6FA 1QHOA 2R2HA 3O3UN 1R46A 4G9FB 2KUTA 4ORZC 4BSWA 2Z1PA 3VRIB 1RPKA 3CK0L 3IDJB 3OF6D 5IROD 2NUTB 1WQVT 3SDCC 4AYDC 4NQDD 1D7FA 4PLNC 1D6VH 4I0PB 1SJVA 1Z3GH 1YNTB 3NOIA 6CGTA 3TTYA 3QBTB 2L4OA 2Y7QA 4G8FA 4TVPD 4P3DA 1JDAA 1KXQE 1CLOH 4IBUA 1RZFH 2IVFC 1S46A 1HIML 5KYUA 4Y4KB 4ATWA 2NY0C 4N2NA 5D1ZI 1OAUH 4AGPA 5H37A 5KVMC 5KJRH 4QXTA 3RAJH 3WFEH 5JPMB 3DHMA 3AQXA 5D4QA 1U8PA 3TS8A 1IC5H 4RFEA 2Y25A 2G0KA 5HGHA 2BNRB 2WBXA 3VI3E 1RJZA 1AP2B 1INQA 1LDPL 2BVPA 1FBIL 3BKCL 5CD3B 3VQ1C 2QVKA 2QGBA 4XVTL 1HCYA 1BX2A 1II4E 5E2WH 5FCUL 5I5RA 4AVHA 3GSXA 4F2MB 1X9RA 3CTTA 3UP1A 4LSUH 3S36L 4PGJA 4IBYA 2HRHA 2CA4A 1M1SA 2EVFA 2BVUA 1WIPA 5AOJA 3HR6A 5F0MB 4NKOB 1CDBA 3OPUA 1UT9A 1ICTA 4NERA 5DI8A 3TV3L 3WFBH 1FAIH 3B7SA 3CGTA 3PL6D 4R3SA 5GGQH 5I1GH 4PUBL 3VA6A 5L88L 4DN4H 5LBSL 2Z92B 3A4DA 4XMKL 4F7TA 1UURA 1IIIA 1A6ZA 1TPXC 3UZQB 3ZT5A 3D0LA 3KD4A 4L3EB 1O6TA 4JRLA 3AUWB 3FUHA 1F5WA 2OBGA 1XCQB 1GL4B 2UUDK 3Q0HA 4LKCA 2O6FA 3KXFB 1KUMA 1WAPA 4HUCA 5L7XH 4DKTA 5HGBA 1QBML 3UBXI 5HHOA 3U0TA 3JWNE 5TE4H 3HB3C 5HPMB 4EOWH 2BP3A 5I1IL 1U3HB 12E8L 2FX7H 3VDCA 3AU1B 4NKQB 2OX5A 2Y24A 2XVKA 3OR6B 4FZEH 4XCEB 1XF3B 5J8OA 4N2KA 1NGPH 3NSJA 4Y19B 5AYTA 4R6UA 3TGXA 3MJ8A 1HSAB 1RZQA 5LXVA 2UWEA 4Y16C 5HJ3A 5LUMA 2C9PA 4RWYL 2LW3A 4UT9H 3EYOB 2HN7B 4M6NL 3FOMB 1AKJA 2YRLA 4MD5A 1KTDB 1CLCA 1FNLA 3UPAA 3PUUA 4LARH 1DN2A 3MRDA 3RWIB 3WYRA 3E9UA 3QWOA 4O2FB 3TJEH 3GB7A 4ZFGL 3D07A 5EEXA 3H42L 1ZE3H 3ARZA 4OT1H 3S35H 1ED3B 5I6XB 1JF1B 2QQKL 3UC2A 3AGVA 4OZ4A 4WKXA 2Q7YB 1LP9B 1U92A 2F9BT 1CMOA 5C09A 4YHKH 2WBJD 2VQ1B 5FECA 2GJPA 2MCAA 3CZGA 1MNUL 3IE9A 5GRVK 4BFOA 1EFXA 1QACA 2D7PA 2PTUA 3MLXL 4XO5A 4CSSA 5JIIA 4LCUA 4KQ3H 1GKOA 3HI1B 3RZCD 4DGVH 4M1GL 2ZWSA 4HZLB 4AQZA 2R8SL 5TF1L 1JCKA 3VYNA 4JNXA 2QPUA 4FI6A 3FHEA 4WFHD 3RVUC 3C60B 1BMGA 1A7QH 2EIZA 2B59B 1DQLH 4X0NA 2EEFA 3PWUA 5D7KE 3QIUC 4IRZA 2EUWA 1L9RA 1DN0A 1L0PA 3C6LC 2OSWA 3GSRA 1H15B 1PSKL 3KVPA 2ZKHH 3IFPB 3THML 2V3EA 3OJMB 3IFOA 4O02A 4DP5X 3POHA 5FM5O 3MRJB 4QLWA 2JKRM 2Z1KA 4M00A 5F7HA 2O6EA 3FFCA 4OBSA 5FGRA 3MBXH 2W0FB 3CNKA 4X5WB 5MEPA 4HK0A 1UOWA 2V3DA 4PJ5E 4KJQD 1UOVA 3HC0B 3ZDXB 4YBLC 5HHOD 3TTSA 4BM7A 4CGUB 1X3DA 3TEWA 5FV1L 2NNXA 2ATAA 1NEZA 1CE1H 3ULUF 3BZFB 2BLFA 2J3SA 2JMRA 3QHTC 4I1RA 4XH2A 3KE0A 3NACL 3O2WL 2CDGB 3QDGE 4ZPVB 3SJVB 1T0PB 3IE4A 3KEHA 1FORH 2OULB 5EOQL 5ITBL 3ZR5A 5KSVB 4KK8D 4AQ8C 1LMIA 1PY4A 4LCCA 1FO0L 1U8QA 1I8KB 4IBLT 2AHIA 4ZAKA 1HQ4B 2K7QA 2OMUB 1XGRA 3FTGA 5FA4B 1YJDH 2Q2EB 1BYNA 1C5BH 3EDEA 1DQMH 3Q3GB 2YXMA 5ETUB 1OK8A 3V10A 2Z6FA 3WEMA 5AAWA 1AKJD 1ZLDA 1INEH 4LEOA 5CJOL 1RJLA 1GAFH 2XA8L 3U83A 3KWXA 1JPGB 4GBXD 3SGEH 1T5XB 3ZIYA 4NQED 1I8AA 3C5ZC 2D7NA 1Q9KB 2XLLA 3FN3A 3O8XC 2XIDA 3QNZB 1FQ9C 2E9GA 3UIZA 1F41A 2XVBA 5MENE 4N8UA 2CDFB 4Z7VB 3AFLA 2EABA 1JZ3A 2DWEA 5ECGA 5C09D 4EVNA 5CF3A 2P5EE 1PKQB 2W59A 1NGXA 1TJGL 1EFXD 1FAKT 4CDGC 4QXUL 4P46C 4IRJA 3K74B 4YGAB 3WY3A 5EU6B 1AG0A 2QVMA 3ABZA 1QOKA 4XWOD 1UM5L 4G6AD 4JN1L 4H8WH 2YD1A 4I3RL 2ERJC 2P8LA 4UQCA 4PJHA 1ZJBA 3IK2A 4JG9A 4QJ4B 1I8MB 1ZOXA 3VE0B 4UYQA 2XTJE 3L1OH 1AQKL 1I7ZB 3WUWG 3CFIC 3S5LB 5I19H 1CGWA 2RH0A 3FRUA 1TETL 5T33L 3QWNA 3GXUB 4JKPL 4EEEA 5LXGL 2C4FU 4NDMB 4BCZA 4DKFH 1MCWW 3GRWL 1G7JB 4XXDA 4MLSA 1N18A 2VERA 4ZJ9A 4H0IA 2O5YL 2WSDA 3FFCD 3VXQA 1C1EH 4X4YB 2C7UA 2ZAHA 1A9VA 2DDQH 2Z31D 5F1OB 4XPAL 3WLBA 3WLWC 4NBZB 4ONGL 2RA1A 3T3MB 1UQSA 3L3OB 1NCWH 4E42B 1URLA 1J7VR 4ZTPL 2BDNH 1U8OA 5HDBF 4Y2OA 1RPUA 5F7KC 4KKPA 1PNCA 3MV7B 4A2MA 4Z95L 1PKOA 5M7QA 2NY2B 4GAJL 2NPLX 1T89C 4UANA 2HFFA 5IR1B 2JVUA 5E5MB 2VR7A 4BDVA 5BQ7A 3I3DA 2PTTB 3VXUA 2ZIDA 1LO0H 4LASL 2NSQA 4XO8A 2EXTA 5IM7B 3QB7C 1Q0XL 4ZAKD 1HAWA 1T04B 4HS6A 4JFFE 3SY0A 4LVHB 1KEMH 2A7BA 1AGBA 1E9QB 4UUJA 5FLUA 3B3BA 4YIQA 3MUGB 5IT2L 3D85B 4ZODA 5FYKE 3BP5A 1F90L 2G9HA 2Q7AA 5DD3L 2E9IA 5FGCB 2CO7A 4TULH 2ARJA 3RIFK 2IWGA 5JXEC 5IY5B 2YN5A 4PS7A 5LGJB 4FQHB 2HX8A 3GBDA 1IVLA 1I9EA 4BFJA 1MQKL 1LL1A 1S7SB 2EXYC 3NABL 4GMSH 3MRPA 2GAZB 3OC5A 3X3GL 4Q6KA 4CNIA 1IAKA 3U1QA 5F7AA 4RMUA 1ZIAA 3GHEH 3NPZB 2EEAA 3BE1H 4IRJD 1OAQH 3MLZH 4K9EH 3DSNB 1YMHA 2X40A 3LRLA 1BLNA 3GS7A 3S48A 5F72S 4BV1A 2C5DC 3MLWL 1N4XH 3AWEA 3MRHA 1JGDB 3MRBB 4XR8C 4QKTA 3AZUA 4JUTA 3PWPB 1IE4A 1XIWC 5FDWB 3BLBA 4CBPA 1BOYA 5C6WH 5E9DA 2UZIL 1KCVL 4ANVA 3ISYA 2YKLL 3NPSC 4Z7WA 4DVBA 4AWJC 1JOIA 2DWDA 1MAML 4X4KA 5I9QC 4U3XA 1BYOA 1UXLA 1LWRA 4WI0A 4U1JB 3GJFH 1MPAL 5DO2D 4EZKA 4X0KB 4Q9QH 5BUPA 4I0KA 4KAQL 2MQ3A 3FU7A 4G6JH 2DQMA 4HUUA 5D2LE 3NK3A 3PJSB 1W8EA 3MKGA 2YD4A 5B4MD 4U1HB 5B38A 2XZZA 1MFEH 3DBXB 2VIRA 4NHCL 1WEJH 1PDKA 3VWJB 4HV8B 1IJ9A 3BKJL 1MREL 3WS3A 2HX9A 4FDWA 1TVHA 4H8QA 3FB8A 3IJHA 5AVUB 3VG9B 1JXKA 2BW4A 2GT9A 3C2AL 3GKWH 2ZCKL 4W9JC 4B9FA 4C56E 3EFOB 5AAPA 3CDZA 2HPTA 3J27A 1KIUA 3T4YA 3ARVA 2EUZA 3L17A 1U8IB 2PCPB 1D2PA 4ELMF 4FXKA 5TPWH 5IVXB 3EJJX 1E65A 3P2BA 2DYPB 4OGZA 5ISZD 4FJ6A 1AQHA 3NJGA 5B1BB 1PZ2A 3MREB 5SWZD 1KGUA 1E0OB 3OKEB 2FL5A 1Y7VA 4NIYE 4R26H 1QSEB 3OB0K 2MKWA 3HJ0A 3BT0A 4WTZA 1FNFA 1G1YA 2VZUA 1RULH 1TEGA 4R4FL 1N6VA 1PQZA 3S5ZA 3HI6H 3F64A 3CC5A 3QORD 3MA7A 4HIHA 1LO4L 5GJSH 2AI0H 1OAKH 4N5UA 4CA4A 4ZRGA 4AXWB 1N64L 3T0BA 2OR8A 5ICZB 3QIBA 3C2SA 5IMLB 3KPSD 1DZ0A 1LK3H 1I3GL 1XGPB 3MJ9A 4TXVB 1OTUC 4OF0A 3L4CA 1AMYA 1QQDA 1MI5B 3QIWC 2YXVA 1FV1A 4APXB 3TZVC 3D51A 5AW5B 1B3IA 1UVQA 3IMVA 2H9GA 2COQA 1U6AL 5AKVA 4OTXL 1HZLA 1MLCA 1OGPA 2WIIB 2H6OA 4U05A 4XNMB 2CIIB 1DQJB 2EQDA 4WNQA 5SWQB 2ICWJ 2O61B 4HJUA 3PP3H 4Z0XA 3CVHL 2X6CA 1R47A 4TNVF 1UJ3A 3UBHA 4ZBJA 5C0DB 2J1ZA 5D9SA 4XN2A 1E8XA 5DD1H 3HC2A 2W9EL 4B7IA 4CW1A 3GMRB 3D30A 4OLYH 2IH1A 4LAJH 5EOTB 3CG8A 5D96C 3ZRSA 2D7OA 4OGAC 1C7SA 1FYTA 4P07A 1O5DT 5DHYB 1E9PA 1HS6A 1IAOA 3UTSD 1FFTB 1NUDA 1MWAH 4KK6D 3VXMB 5JW4M 4HGWA 4APQA 1DANU 5CBEA 1F42A 1IGCH 5AD0B 4NS0A 1WJ3A 3QCTL 4DKEL 3EOAA 1Q0YL 2IFFL 4TLUA 3L5WA 3RBGA 4K5MA 3B9KC 4IBQA 3QPXH 4R4BB 3QH3B 1EDYA 3EGDB 3NJXA 1F13A 1E43A 1N2RA 3QQXA 5GRJL 4S2SB 1BJ8A 1F3DJ 2DRUA 5EMYA 2F19L 2KMWA 2IAMA 2I69A 4NFDA 2QELA 3SQBB 1J1XH 1E2ZA 2IANA 4YEFA 4X6DE 3RP1A 2OL3H 1JZFA 3C8DA 2WY3B 1KIPA 1EHLH 1TQUA 3ARBA 3FTSA 3QIBD 1HHHB 1TYRA 1TZAA 1HH9B 3OD3A 1KXTA 1WCBB 2B8OT 4O51A 2PR9A 2DY2A 1R3LA 1E4WL 3QPQD 1NIAA 2BP8A 4XHJC 4XP6L 5E4EB 3D39A 5EIVA 4NAQA 3U1SL 1BZ9B 2MFNA 2BIQA 4A38A 2RIKA 3IPBA 4AH2B 1ZEAL 1JF5A 1SJEA 2SEBA 4XVJH 5F70A 4DPCX 1PIGA 1R1CA 2A0LC 2VRAA 3VXRA 3MAWA 3S4SB 2NY5L 4EQ3A 4M48L 2X6MA 4ETQB 5CP3A 2WYTA 1E42A 1M2OA 3OKMA 1WUNT 5I66A 2CUAA 4JO4H 1I9JH 4TVPH 3GBNH 1W72A 4Z3IA 5INCA 3AG3B 4W1TA 2ZYIA 2W81C 2WN2A 1KN2H 3GSNB 3V5HB 1T5KA 2M83A 1CL7I 1F02I 2CHNA 4GXFA 4XPFH 2C9SA 4Z7OB 3O6FB 5ESQA 4GH7B 3QXDA 3HE6A 3KM1A 1FYTD 3CU1A 1RPQA 3Q06A 2YPVL 1SJXA 3LAFA 3N42F 1U8CB 3MLUL 4JPQA 4KMLB 4WNJA 3RL2A 4E5XA 2VMEA 4FNTA 2EUVA 4APQD 4Y5VB 3IXTB 5JHMA 1MHEA 1Q9WB 4LHUB 5DMGD 1HHIB 4N2MA 4ZDHA 3O2VH 2MOVA 4M9OA 4U0QB 3JV4A 3LEXA 5EBLB 3KYOA 3E6HB 2C8NA 1ZGLB 2D7TL 3LKPB 1QUNB 4L8CA 3VFNA 3VD9A 3S96A 3HRZB 2K45A 3K2IA 4GFTB 5JPNA 1IKNA 4FNLH 3IU4L 5JZ7D 1PJ9A 1AE6H 5HGDA 1NH6A 3A3YB 3GIZH 3TOPA 4HS3B 3BSZL 2IAMD 3ELAT 5DUMH 3BKYL 1YG9A 1FZOB 2Z64C 5E5UB 3A24A 2O1AA 5C92A 2PETA 1MIEL 25C8L 2GJ6B 1AHKA 2IDCA 2ZCZA 3AM8A 3WD5L 2H6UA 3ARBD 3ILQD 4F7PB 4G9DB 1WK0A 1TZHA 2ADJA 3DJSA 3LV3B 5EO9B 1CL7L 3BPNC 3OZ9L 5DD6B 4D8PB 5FYLE 3MLVH 5KVEL 1NEPA 1J9SA 1F1AA 1UACH 4OLVL 1P69B 5D55A 4ZPTA 5CCHE 5GS1B 5EWIL 1FGVH 2DEXX 5E6ZA 5C0CA 2R51A 3BZEB 3OR7B 3D39D 5C6TH 2VSKB 4XI5D 3MRLA 3UTPE 3HVDA 3EJPA 1WA2X 2EAEA 4CU7A 5I17B 4D7BA 2C4FT 4XAWL 4DESA 1FIGH 3KYKH 1TCRA 3GMLA 4P2OB 1YYLL 3A0OA 4HFWB 3RY5A 4NUPA 2ORBH 5CD5C 3IKCA 4PJEF 3PGFL 1A6AA 2DJMA 1K85A 3ZE1B 4QRRA 3QS2A 1CFQA 2Z8VC 3DRQB 3P77A 5MP6H 4UIMA 2AANA 4EO5A 2CMRH 1KLGB 1DJHA 1Y1DA 1YHPA 4L05A 4L2YA 3EOTH 1U8MB 1RK7A 3LS5H 4YXHH 2NNFA 3UCRA 5SX5K 1R24B 5DMIH 4MSWA 3HE6D 5B3JE 3IDNA 4JREB 4Y4HA 4BK8A 1E7VA 1KFAH 1W15A 4LOFA 1E28A 3S2CA 3F7QA 3PJLA 4XPBL 4AYGA 2B4CL 4PGEB 5DUPL 5EDXA 1BMZA 1EV2E 1S2EA 4FS0A 4Z5RA 5I30L 1BOGA 5BZDA 4M5ZH 1S7TB 1F11B 3JZYA 4OM0H 3N44F 2EE6A 5DJXA 4D9LH 2V37A 2HJFB 1AGFB 3SE3C 4H5SA 1H0DB 1RMFL 3BT2L 3N1GC 4WENB 1L9MA 1WCQA 4QOKB 1D6EA 1WS8A 5GGSA 2JKWA 4GW4B 2BMKA 4TTDD 2GK0B 1LEKA 2ZXBA 4CJ0A 3VW3L 2EE9A 2DV6A 3KYNA 4MDIB 1ZHKB 3HZVA 2X4UB 3BJLA 3BLPX 4YAQA 2OTPA 3SBWA 2FLRT 1OY3B 3WOVA 3R7QA 5IVZB 1GOGA 5DF0A 5EC1A 3ETSA 2FBJH 5FHAH 2GABA 3IBEA 4L3EE 5AKSA 5J11C 3ULVF 4DOHE 4EXKA 3E8UL 3SDYL 1MRDL 5IV2A 1CLYH 3OQ3B 4PGCA 4KGJA 2MCG1 4UAOB 5IB2A 3VH8B 4Z7UB 1MEXH 3KXFE 4X8JB 5CIPB 3KJ4C 3BJ91 1NDGB 3QG7L 4A7TA 3PE9A 4UT6L 5FGSA 1ZLVK 5CJ8A 1DBMH 5AW0B 4MWFB 4ZMQA 2OA9A 4U1GC 3PHSA 2DM4A 5CN1A 1LO3L 2RFXA 4NSKB 4J28A 4LSSL 3BOVA 2G60H 2RHEA 2WUCL 3NJKA 2Y1YA 4JFXB 4BGLA 3SPVA 3UGXA 3RX9A 1G43A 1XSKA 4HKXB 3D7PA 5T5NF 5HY9A 2NY6B 1A6PA 3LN4B 1D7BA 4QRRD 4B9KC 5DJ2B 1YEGH 4RRPG 3X17A 4GG6B 3MXVH 3O2DH 3EH5B 1KGCE 4Y9BA 4HPYH 2HWZH 4Y2DB 5E0FA 4MJ4A 4LQFH 3ZE2E 3GWJA 2FWLB 2NY5C 3VFPA 1NANI 3C8KA 4QI3A 1LP9E 4Q9CA 1DBAH 4Y4HD 3REVB 4AT6A 1SOQA 5EHFA 3V4VH 4KUCD 1A6UH 1J05B 3E6FB 3QWRA 3KPLB 4WW1B 4ZW5A 4ANXA 4XPTL 3ZHFA 2BOBA 3GXTA 3MRQA 4E9YA 4KZEL 2PPEA 2B2XL 3GO1L 1XTMA 1MCOH 4F7KA 4LOUC 2H1LM 2F8XC 1NCAL 4JRXE 2H45A 3V6ZA 1I9RH 4MJ5B 4ZMLA 4POZC 5I71B 5FUCE 5EU7C 2IBGA 4X2UA 5DJZA 2ED7A 3V4PL 1HNFA 1LM8V 3SPGA 3SKOA 5T1DH 4G1MA 2Y0SA 4KRPD 4TSCH 5I0YA 1RHHB 1TZIA 3KR3H 1G7QA 3ZDYF 1NPUA 1QLFB 3OAYK 4ZX6A 3OKKB 4KI5C 4FLRA 3F7YB 1QWUA 2ZAIA 1DJWA 1AY1L 1S7VB 2RJMA 3LB6D 4PRNA 5LWYH 2FYYA 4PWGA 3A5VA 3RGVB 2GY7B 4BWTA 5C0RL 3ZYZA 4MRCA 3EYUH 4R8WL 2EVGA 4P5RA 5B1AB 2V9TA 1HH6B 4NQVA 4FYQA 3JTSA 3VX0A 5B1CA 5KVFL 1R34A 1YMMB 1T20B 4RMRA 3VFWB 4B9YA 1MJUH 1W0WB 3W39B 3OKLA 3A23A 4M62L 4N6QA 1J0ZA 2D0GA 3AMKA 2AC0A 2YA0A 3O3BA 1S9WB 3LH8A 4JQVA 3SJVE 1I3RB 2PWHA 1PZCA 3KH4A 4A66A 4I4WA 2QKIB 5BO0D 3U7WL 3JUYA 3CPLB 1FC1A 3V0EA 3ZTEA 2XXMB 2ZUVA 1HJBC 4WU7A 5D1QC 2J8UB 2VDPB 5DDHA 2F7RA 4LP4A 1XGQB 4YXKL 2R0ZH 1AJ7H 3NFNB 4DP2X 3LTVA 5D7JA 3PYCA 3TYGH 3QO1A 5AOZA 4N6RB 5C0GB 4WI5A 2M2DA 5HTSA 1T1XA 5JORA 1IGJB 1NAMH 2K70A 2QADC 3RDTB 4TF4A 3TPKA 2QPFA 2OMZA 4ZSOA 3NZ8A 3V5KA 3EJQA 3PP3K 3BH4A 3IB4A 4JKKA 4AITA 3Q5OA 1JHKL 3ZGIA 3FUIA 3ATFA 2Q3ZA 3H56A 3QEQA 1B6UA 5AUMB 4J1UA 4M3HA 2IGFH 3X2QB 3LQAH 4OGXH 1K6QH 4LLDA 5DJ8B 3CCHA 2GIMA 2ESVB 1WZMA 2QSCH 2IIJA 2XJLA 3US0A 3I2CL 2BIHA 3L7FA 1DDHA 4M03A 2E6QA 4NPYA 1NGQH 1RURH 2A77L 1HSBA 3EJYC 4KJYA 3T3PB 4FA6A 1T1WB 2P8MA 4Y1AA 4XP9L 1N8ZB 2WZAA 3U9WA 4X4XB 4K94L 2IH3A 3KPPA 4RBPH 2HRPL 3R06A 3CFKA 4GRWF 2OSXA 1XGYL 2CUIA 5T3ZL 3S34H 3TBYA 2F54B 4HK3N 4QRSB 1E8ZA 3VTAA 4MDJB 4J3OF 2PXYB 4X83A 4FEIA 2HTLD 5B8CC 1KV3A 3GGWB 3MODH 3STBA 5JW5B 1UWXK 3KPTA 4K7PH 3ATAA 2R4RH 4WSJA 5JHAA 4ICXA 3MRKA 4UM9B 4YBLB 2D3NA 1FVEB 4NQCB 5F9AC 1YEKH 4R5XA 3UABA 4PJCE 1S9YA 1BEYH 4HCRA 4A7QA 1D5IL 1L9NA 5DR5H 2WXRA 4NRXB 1GJWA 2OSYA 4WNSA 3T3ME 4FTVD 1NGWB 5EU7E 4JDVB 2GTQA 3WNMA 1HX0A 1EUUA 3K80A 2EIKB 4Q2ZB 5ITFA 3FTZA 3M88A 1J5CA 3H0TA 3CFUA 4TMPA 4P2CG 2X05A 4KO6A 2V2XB 1XR9B 3BZ4A 4I1NB 3CVIL 5GPRA 3WXVL 3QQDA 1T2XA 4WY7L 1OGAB 3S7GA 4XNDA 3PPEA 2EDMA 2DS4A 2YJLA 3O9WC 2H6PB 4N2CA 3ROLA 2W9LA 4N2OA 4Q58C 2VDKH 4CVXB 1G7LA 5F0LB 5L8LB 5E1QA 1EGJL 1MCRA 3T4AA 1KXQA 3H9YA 3P9LB 5D8JL 2HVJB 1U21A 3LN5B 5FOBA 4AZUA 3EGSB 3NCCB 1IEAA 1B4LA 1SFDA 2CGRH 3V0WL 2FECI 2E8YA 2C1PB 3MR9B 4Z7QB 3GZQA 3WFCH 1WFIA 1CD8A 2VE6A 4PBWD 3LQZA 1U95A 4GW5B 4W4OC 5GS3A 5TK2A 5CEYA 3TNMB 4LRIC 2OP4H 3O6ML 1HHJB 5HHNB 2E3VA 4OSUL 5LNEA 3VI3A 2CG9X 5C0AB 5IB4B 3ZTCC 4PTTA 5JQHC 4KU1A 4G80B 4OZIB 4X4ME 5I8OL 1L4IA 4F80A 3P11H 1S5IL 3WKQA 4E9XA 2UV3A 3P3UA 5BS0B 4JRWA 2MNUA 1MCSA 3PFUA 5FB8A 2KDGA 4Y1AD 2BSEA 4X5XA 1I1AA 3RHWK 3VWKB 4L0ZA 4NM4L 2IADA 4GSDH 5GZOA 2YD9A 1EEUA 1RJYB 3EFDL 1TTBA 1JHLH 3L1EA 3O0LA 4MBRA 3UO1H 4PY8I 2R23A 2A74B 4ZOBA 1DFBH 4PCKA 3DHPA 5I0DA 3WFZA 3KDMB 1I8UA 5DVLA 3TYFA 5DJ6A 2FECL 2WXJA 4ZO9A 1P84K 4Y7MA 2L7UA 4HHAA 4BZ1A 3DC0A 2ZJSH 5FM5M 2GFBB 2WMPB 1CBVL 5D1ZB 3UAFA 1SEBB 4XXCA 3TBCA 3TJHD 4CMHB 1A66A 2QL1A 3B9EA 4NOBA 3EAKA 4JDTH 2OXHA 4NXSA 3HN5A 3KBFA 4H2AA 3DSFH 5E56A 1OW0C 2ADIA 2APWA 3BI9X 4A7GA 1WDAA 3MUZ1 2MJWA 4UDUA 1A7OL 1DQQA 4UB0H 1XH0A 1ETB1 1MFVA 1S8DB 3C08L 4M02A 5F1NB 3VQMA 3ZZ1A 1TTUA 2O93L 1ECZA 4DK5A 3IF1B 3LRMA 2KLSA 1JVKA 4MJ2A 3GF8A 4YDKL 1SYSB 1QSEE 4JFZL 1CR9H 2VJ0A 2MNWA 3U6RB 2EH8H 1HT6A 1U8HA 5KZCB 2P5WB 3H6JA 3QFJB 5DYOA 5GSVA 2OR7A 3NCBB 1A5FL 3QZMA 4PJDF 4K3JH 1TFPA 1G5GA 3PF2A 1OM3H 5CP7B 4GG8B 3FT3B 4N0RA 1OB0A 3NCYP 6PAZA 2J7LA 3BWZA 3PIQB 5DWUL 3ZHNA 5C07B 3SQRA 2P28B 2VDOH 1GYWA 1NCJA 3DO7B 1FFOB 4G5ZH 2VDNB 4MAYD 4YXLL 1KBWA 3KJ6H 3QUZC 3VCLB 7FABL 5BQDA 3SDCA 1CDIA 3MROB 1IAII 3KPNB 5ESAA 4IRSC 3T0VA 4F8OA 2IGLA 2L3BA 2OLDA 3CX5K 3UBXB 1VZIA 1P6WA 1VPOL 3I85A 2X70B 3UH8A 1COBA 2BSED 3VXOB 1I1AD 3I9IA 3CH1A 4K3EH 1PG7H 3IDIB 1QPPA 3GNML 2R1XA 5I9QB 3JTTA 4M4PA 5KVDH 5HHQA 1K3IA 2V3FA 2OYKA 4AM0A 4MMXB 1WITA 1KLFB 3NAAL 3FZUC 2IEPA 4PJ9B 3QUHA 5CWSB 2HVKB 3RWJA 1DVFC 1XSIA 5DQ9B 4ZS7L 3TIEB 1ZA3A 2J5WA 4MD0B 5I26A 2XN9E 4OQTA 3C87A 4RQQB 4JG1H 5BRZD 1FZMB 3FCTB 3FU3A 4C59B 4K94C 2QSVA 4FN0A 4ZO6A 2XACC 4PJ5A 4FG6C 1SBBA 4PJGF 4EXPX 3OWEA 3SDAC 1BQUA 4P5TC 2X6VA 1X6NA 4M1CD 3G04A 5DS8B 1J8HE 1MJ8L 2XG5B 2NRDA 3BGFC 3IMRA 4KK9D 1HU8A 5TDOA 5J12B 3W9EB 3FK3A 1IAIL 1B0RA 4IU3A 4XNUL 2I60L 3QDGA 1QRNB 3NP3A 4KXAA 1H8NA 2IWFA 3HAEA 5DMJB 1S9VB 3GXIA 5DZPA 5FUOL 5IBUB 4Y5YC 2A2QT 4QTHA 4YHIB 4YLCA 4OAWA 1AXTH 5DZLA 2EYSB 2XG4B 4F7CA 2ICEC 4OCXL 1FO0B 2FSEB 2WYIA 1ADQL 2DJ4A 1BVKB 3AT0A 4KH9A 1I1YB 1AGDA 1F4XH 5CLYA 2WKGA 1S9XB 4JJHA 4B6ZA 4U6YA 5MENA 4D94A 3TA4D 4E2OA 3AAZB 2LR4A 3KPQB 3D25A 3ZZLA 2D73A 3TA3A 3S3BB 4WW2A 1JK8A 3U7YL 2IOMA 2P5EA 1G7PA 4YHNA 1GC1H 5KYYA 3U0PB 3BP7B 5J3HD 4XMLH 5KVFE 2Y7LA 4AEHL 1KGIA 1FNAA 2VLJB 1X5YA 5I24A 3GM0A 1MCFA 4Y16A 1V5JA 4RGNB 4YBHA 4FCAA 3SE9L 1RUKH 2KQNA 5DK2A 1EANA 3PUCA 1FG9C 2XCMC 1ASQA 1NBYB 2XWTA 1S7WB 1G7MB 1TR7A 1QFHA 2BFVH 4WWKB 5D7KD 2JFCA 3O3EA 3B1TA 3OKYA 3ARUA 2AK4D 5CO1A 2WLMA 3PHAA 2EH7H 4U6XA 1KJ2H 1PX3A 1W72H 4H20L 3KPRB 4NC1C 4TLTA 2NQCA 1CICD 2FB4L 1TTFA 1C12B 1HZHL 3QNXA 3NQIA 4MCZB 2VR8A 3QUKB 4Z7OE 3PABB 4GS7B 3VGDA 5IB3A 4H1LA 4PJ5D 5HHME 2ZXWB 1H5BB 3K6DA 3QEGH 1AVAA 2VABA 4AC4A 3EOBA 5IOPB 2AAAA 5CJQH 2OZ4A 3K8KA 4RIRB 1NBQA 4HQQH 4JRYE 1JZGA 4FI8A 4YSEA 3QIUA 1D5RA 1FZJA 5HJBA 5KSBF 1XEUA 2B20A 3C6LA 1A3RH 4N0YH 2NXZD 4KQ4H 3SCMD 4LHQB 3K2KA 3MQIA 4XNAA 2B77A 2FJFB 43C9B 1ETZB 1CLOL 2IDSA 1RZFL 2Q3AA 5BVJA 4S1QH 4TUKL 3I6KB 3GRBA 3JV0A 4JFFA 3L1GA 4JM2D 4XC3L 3RX7A 3BPOB 2OQJB 3P73A 4QR7A 3D33A 1OAUL 3LHPH 3LMJH 1CDHA 3ECVA 3FOLB 2FJSA 5KJRL 2VZTA 3WFEL 2X4TA 4Y9EA 1TQSA 4MA1B 2X4RA 2XV2A 3N91A 5ES4B 2KZKA 4P23A 4JFWA 3V52H 3LPGA 4S1SH 5LCVH 1DQDH 1K8IB 5MEND 2L0DA 1N5AA 1WZKA 4I85A 1GVIA 5E2WL 4D9RE 3TA3D 1ACYL 2LV4A 1FLTX 1YN7A 2OMTA 3B6SA 4JQIH 4WO4D 4LSUL 2BXYA 4BQBA 1PZSA 3IETA 3IPFA 4ZFQA 2IG2H 3HLAA 3EO1A 4AQ8A 1ZDQA 2MWCA 2YLKA 4M3JA 2VMCA 2EIJB 5HVHC 1F6AA 1SVZA 2Y6SC 4B9CA 4QHPA 1BPVA 3C5JB 3NJVA 2FT7A 1HXYA 4JR9H 5DT1H 3WFBL 1FAIL 1KYUA 4ODTH 5GGQL 5GGUA 4YNYB 4YGVB 3WI9A 2HCZX 2XTJD 4NN7C 4OZHF 3US9A 2FNWA 3C5ZA 3O8XA 3U4BH 5L2JB 1MIML 2VLKD 4UBDC 2X7LA 2XQYA 3ZE1E 1QRKA 2NX5B 4FYRA 2N59A 3J07A 2AXGB 2AGJH 1T0MB 3DXAB 5L7XL 4P46A 5KANI 5D2LA 4WHYH 4H8PA 4I2XB 5TE4L 2WK2A 3VFVA 4GUCA 2FX7L 1X9UA 2DQDH 4F8NA 4PV8B 2IH9A 4MQXD 2JXMA 3DTUB 3NJNA 3ZMNA 1RKRA 5DFTA 2J1YA 5F1SA 5E6UB 2XXFA 4FZEL 3ECBB 3RTQB 3SE4A 5FIEA 1I85A 4MRBA 1NGPL 2CHWA 3AMLA 2NR6C 4G59C 4H8VA 5HDOA 3FQ2A 3UC0H 3ZRFC 4Z76A 3C6LD 3IDMB 3QA3A 4C56A 3FTXA 4XN5A 1T0NB 2I26N 3SPCA 4X6FA 4NZRH 3VFGL 4UT9L 3IJ7A 4X6BA 1KGXA 3TWCH 2GJJA 4EI5B 1CDCA 4PYGA 1A02N 4WI8A 2ZOOA 4JFFD 4ZW8A 3V0FA 3TJEL 3VD4A 3HHMA 2A4EA 2EEXA 3BVDB 3ETBF 4OT1L 1SMDA 2R39A 5FYJU 1A9EA 4I87A 1V3JA 1YVLA 3RNKA 3W82A 2YKKA 4F3FA 2VGLM 1QMUA 3BPNB 2DLHA 4P23D 1KG0A 15C8H 4AK1A 4HDIB 1SN5A 4JE0A 3SDDB 5E6IC 4B5EA 1V7MH 3KLAA 4JN2A 5EZOH 2JWYA 2LGNA 3HUJB 4LLAA 1MHCA 3TBWB 4HKJA 4AYBA 3CZNA 4Z7UE 4Z8FL 3WDIA 5CCKH 4A6YA 1V3LA 1N19A 4NPJA 1ET8A 5ANHA 1UCBL 2RACA 4YL9A 2HLAB 2W8CA 5IUCA 3HEIB 1FG2B 1A7QL 1H9DA 1DQLL 1ZS2A 5AAMC 3N5AA 1FNGA 4NKDB 3ZU8A 1MCHA 1OD7A 4K15A 3MNDA 4JGMA 1ZVNA 4N5EC 5DRNB 2XWBA 1EHKB 1OAXH 5JIMA 3M45A 2BC4A 2ZKHL 4ONHA 3QUMB 3Q7JA 4B9ZA 4X9BA 3H3PL 4RNRB 3UTTE 3LJ3A 4BE5A 3SGEI 3C5ZD 4EIZC 4JHWH 1P7BA 1UWGH 4JY4B 2A6DB 3AWFA 3SYPA 1SY6H 4YO0B 5KYXA 2X10A 2YN3A 3D3VB 4YWGH 4FMVA 1R5WA 2NMSA 3IYLW 2WWMD 1DCEA 2BSDA 4DAGL 1GGTA 2ROXA 4W6XB 4XPHH 5D4IA 4ANKA 5IW6B 4OB5H 2ALAA 2DWYA 2MH4A 2XBDA 3EBAA 2EYTB 3HG4A 5G5DA 4U7MA 3LEVH 1DP0A 3QUYA 4F9LC 1JPTH 5E6RB 2CHZA 3KMDA 5IG7A 1Z0NA 2CGZA 4X8CA 4A2DA 1MFDH 5GISH 3NIDF 4S1RH 1XIWA 5A7BA 3QUXA 1BM3H 2C7FA 1MQ8A 2IV9A 1O7VA 4J3UA 4F33B 3D69A 2G4GA 4YSUA 4F93B 4K8RC 4R7NA 4C56D 4JZNB 5CGBA 1YJDL 5ENWA 2F7IA 4FFZH 1DUZA 3KNBA 4IK7A 4ZW6A 1PS3A 1INEL 4GB9A 1GAFL 3G7TA 2XPZA 5ABAA 3NRFA 3I50H 4CVZB 3GINA 3P3RA 4NLHA 1A9BA 2ZX6A 1MH5B 5M94B 1BIIA 5TE6H 1EDQA 1P6AB 2GG1A 2Y3AA 2PUQT 2YMTA 1F0LA 3VB8A 3F05A 3F8UB 2FUQA 4X6DA 4JMXA 5C08B 4K2UH 2OM5A 4J3VA 1M7DB 3KJ4B 5EO0A 3U4AA 5EULV 1RERA 1N12A 1OTSC 3RKDC 4XAKD 1KCRH 3SKUD 1XCTB 2EKSA 4EUPH 4R4ND 5HYQB 1ZGLP 3MBEC 1J9RA 3EZJB 2VAAB 4X9HA 6FABH 3MRIB 4UQ2B 4BIKA 3P4OA 4WI4A 4H26A 3V0DA 5HDBB 2LFGA 1QX1A 2VSDA 4N90E 3DJRA 3MCLL 2OKMA 3O0RH 2MCMA 4JPIA 5F97E 4J2XA 1M3IA 2NQDA 4DKFL 4PLKC 4UU9A 4AV4A 3P0VH 4NT6B 3MOBH 1ZGLM 4G6FB 3MV01 4DEPB 1SGKA 2F53E 1C1EL 4UQEA 3DIDA 5DJ0B 3VXPA 1CXLA 4JO2H 2HTKC 3HLKA 1RSYA 1U93B 3RPKA 1NL0H 4BCXA 1NCWL 2A73A 4XMPL 3WJMA 1QFUL 1RV6X 3TZVA 3QUYD 4JZJB 1HEZA 1SLVA 2KHAA 1ZHBB 3PWVB 4FADA 3P4MA 1HHGA 4QY8B 2WWKT 4BFBD 2HJLB 5JR1H 3BN9D 2HJKA 2W0PA 4LOEA 4K5NA 4IGBC 4OW6A 4DQOH 1X5FA 1BVOA 3QUXD 1MVUA 1NCIA 1LO0L 4Q6YA 4DN3H 2I5YL 5JQIB 3A6OA 4AKPA 5AQ0A 1IEBB 1KEML 3IU3B 5F9WC 5IW1A 4N9GB 3GLZA 3I3EA 2KYIA 4MYWB 3NA9H 2NXYC 4NKIH 3S0PA 3Q2NA 3L3IB 1FVCA 1L9QA 4TULL 1ES0A 4HD5A 4JO1L 4NPKA 1DQIA 3UGUA 43CAB 1J0YA 3ZUCA 2Q76A 1TXKA 3T2NH 2F54E 2DB8A 3NZHH 2FK9A 2B7DT 4MQ7A 4N0CC 1FH5L 2J72A 1R3HA 4GMSL 2VR4A 3RHWF 3BWAA 3SDXE 3GI8H 5DFVC 3RWCA 1CE6B 1XAKA 3TO2B 3EHBC 3GHEL 1BM7A 2YBGA 3DURB 1ZE3C 3MLZL 3F85A 3TFBA 3RWGA 4ES9A 1YEHH 4U1LA 5ESVA 1LWHA 5E94B 1CC3A 1AS6A 4LNRA 5JYLA 2XQBH 3B9KA 2XWXA 2NY1D 3WL9B 3CFDA 5EPMB 3WKPA 1HYSC 3TN0C 4BFRA 4P4KD 1DSWA 1IBBA 4HU8A 3IVKB 4RLDA 2ZF8A 2C3XA 4HSCX 1MZYA 4PS3A 3FT4B 4KROC 4PLJD 1WTLA 3VRIA 4ABUA 1GA2A 2OXGB 3IDJA 3ILPB 4FQLH 2C9UA 5EF1A 3K6SB 5HYSA 2Q20A 3PS6A 2D8KA 4JKLA 1CD9B 4PV1C 4Q9QL 3QR1A 4D9QD 4PRIB 3DMMB 3G5VB 5HHVH 4G6JL 2Q9OA 4ELMB 3GMQB 3FQWA 4GXUN 3RKPA 2DF3A 2BO0A 3ZE0E 3QNFA 1MFEL 4YJZL 2X4QB 3FQ1A 5GHWL 3TFKC 1E9OB 3GK8H 4Y4KA 4EDWH 1WEJL 5F7DB 3WFHA 1YECH 1OT4A 4Z7QE 5CZKA 3QP3A 1IKFH 3T8XA 5JPMA 2B16A 3WEXB 4LL9A 2YD7A 4QXGH 5M95B 1Z9LA 2Y06H 3ELQA 3HHSB 5T1LA 1AZNA 5E1AB 2V7NB 3HG1E 1N59B 3VJ6B 2IJ0C 3VGAB 4W9KC 2ICES 5JW4R 3X1FA 5TPWL 3IMWA 1RZJL 4OZIE 3GLEA 3MFFA 4LLUB 5L4MA 5HI5C 3PDDA 5DJDA 1WHOA 4RESB 3CAFA 3L9EA 1RULL 4HF5H 4NFBA 1SYVB 4YR6B 3ARRA 4K0OA 3QAQA 5IP4A 3QR2A 1Q38A 5B39B 5GJSL 2AI0L 1OAKL 4YSSA 4JFDD 5AKTA 1YJDC 1SNRA 1DYZA 3QJFB 1WFTA 3FT2A 3UYOD 3MOQA 2OTUA 2Z92A 1LK3L 1OSPL 1MW0A 1KPVB 2VW6A 4ILDA 4NN5C 5FA3A 5GSRA 3FN9A 1AFVH 4G8IB 3UZQA 2Q5BA 4L3EA 4PIRF 3QUGA 5F0JB 3BPCB 1NCGA 2X4SB 3WENA 2O72A 2X9ZA 5FYLD 2AJ3B 3GSUA 3KXFA 3Q9PA 1FSKB 5FO8B 3SD2A 3B9KD 3DIVA 4PJ8B 3GMMB 4HUXB 4BFKA 1OK0A 4L4VB 2GTZB 1AZZC 4TSBH 5AKRA 2H2SC 3CX2A 1QUPA 2O5ZH 5E9NA 3UTPD 2ENQA 3DUSB 5E2UH 5E8DL 3KPOA 2BY0A 3OR6A 2K3TA 4OFPA 4M6MH 1C7TA 1B9KA 4H0GA 4H8WC 3U82B 3LDBC 4I0PD 5I75C 2AQSA 4PJXE 3ZTDC 4ONOA 2D9QB 2HN7A 4G3YH 2GVYA 2L7QA 2BSRA 5DEJA 1Q4NX 1F3JB 3RWIA 5JDSB 4Y4KD 1RJCA 5KJ7E 1BXUA 1YEFH 1MWAL 3BQUC 1PD6A 3OJ2C 4AVKA 3BD3A 1O7SA 1SRDA 3MLRH 4NJAH 3K71B 2Q7YA 1IGCL 1LP9A 4TM9A 4S11A 4BZYA 2VL4A 4H0HB 4IOIA 1EO7A 1BECA 2BNRD 2VQ1A 4MJIB 1SQMA 5BV7B 1NIEA 2UZYB 2OMBA 2H1XA 1F2XK 1MFNA 2H0FA 4XNZC 4YS4A 4ZTEA 5J13C 4YEEA 3KLQA 4HSAC 4HIEA 2UWEF 3EUDA 3L4WA 1UGKA 4JRXA 1HJCA 5BOPA 1O9ZA 1J1XL 2IF7A 3PWLA 3EF4A 2Q3XA 4Z0BH 5E8NB 4B9GA 1XZ0A 2OL3L 3QYMA 1JDCA 3HZMA 3LIZA 1H15A 1EHLL 2Y5TB 1M57B 4LIQH 4TUJB 4XBEH 1XV8A 4ODUB 1I7RB 2G5BA 2P1YA 3J7HA 3MRJA 1R17A 4NM8H 4L3ED 1A47A 1BFOA 4A2LA 4FABL 2VXVH 4X5WA 1H3UA 3ECQA 4PRPE 2D9CA 5DJYB 2J20A 1TENA 1BFTA 2QGEA 4GLRH 2X87A 3SE3A 3HC0A 3KXFD 1KCUH 1NCOA 3CXHK 5ABZA 1MHHB 5EZJB 4AEEA 5ALBH 3NEXA 1ETJA 2BHUA 2IPTL 5K93A 2LE9A 1FDLH 1JP5A 1EJ6A 2YAQA 3N42B 2OMNA 3MRGB 3BZFA 1IM3A 5KBLA 3DX4A 4J3BA 1QRNE 3SJVA 3H55A 4JCWA 4QO1B 1IX2A 4JO4L 3S98A 3SGJC 1I9JL 1K8DA 1G9HA 3GBNL 3JVFC 4TVPL 5KSVA 1OQOA 1I8KA 4PJIE 1KN2L 4XE0A 4LE8A 2PR4H 3WO4C 2PYFB 4P57A 5KVGE 4XPFL 4AQ1C 5DZAA 1VKXB 5IQ7H 2AW2A 1T83C 1NMCC 1KGCD 5JMOC 5JLZA 3HZKA 1ZMYA 4LSQH 5F7LB 4BWWA 3WN6A 2VLLA 3K5RA 4BKLA 5BJTB 4I77H 3QNZA 3V8CA 3ESMA 1JL8A 5TQ2H 4G7YL 2J4WH 4J3OG 3D50A 4Y9CA 2G3NA 3O2VL 3EGXB 1P7KB 4IKKA 2WIMA 3QEHB 1Z9NA 3CQQA 4IRSB 4M7LL 3UBGA 2XZCH 1H3XA 3QI9B 4JM4H 1PCXA 3K7UA 4G1EA 5CD5D 1OGTB 3LKNB 4FNLL 1VAHA 5AOLA 3M1OA 3NGBC 5I74B 4X6CE 1QKZH 2OMXB 1AE6L 3P2TA 4M7JH 3GIZL 3KLSA 3G6AB 3ASOB 3C60D 1OPGH 3QFGA 1JPEA 4UINH 1RZ7H 4Y4FC 3V0VB 1I8MA 4Y7OC 3WHE1 4GO9A 1DUYB 4MXQC 2VXQH 2DIJA 2Y2WA 1KIRB 1G6RH 1TU2A 1RZGB 5BZXA 3S5LA 5KSAB 3CVDA 2YA1A 3IS1X 5AW4B 4ACTA 5AWNH 2G75B 2GSGB 3O6LL 4HFUH 3KPRE 1L3NA 4PY7B 2AZAA 3MLVL 4H44C 2KQMA 4PJEB 1FCGA 4K3GA 1KB5L 1UACL 1I3UA 4JY6B 4L4TB 5LVEA 3I3BA 1FGVL 5KAQF 5J1SC 4X4YA 1NUNB 1CF1A 4HUWA 2C3HA 4MXVE 5C6TL 1GGCH 4XNQB 5BXFA 4PJCA 2A3TA 3D4CA 2VZ1A 3N1QC 3H7BB 3QGVA 4JO3L 4RGOH 4XC1L 5DVKA 4F57H 4XP1H 3INUL 3BPLC 3L3OA 4E42A 3FCBA 2XY2A 4P2RB 2OZ4H 3ALPA 1FIGL 2JJSA 3KYKL 4DEUA 4POYA 1BQLL 2TAAA 1ZD6A 3MO1A 2F1BA 4F7MB 2OJEA 1N68A 2ORBL 3SJVD 2P8PA 4LLQB 1MZZA 5E5MA 3KL0A 1UD5A 3OHXC 1K3ZA 3GEWB 3RFZC 4KOCA 4AW4A 1RZ8B 2O30A 3Q5YA 2ICEB 3N44B 1E40A 5CMAB 3V4UH 4AZ8A 5MP6L 2EXWD 2CMRL 1IQDB 3UDWC 2VERN 2MSPA 3ABKB 4XGZA 4AUYA 2CJUH 3EOTL 3NYKA 3EYVB 3LS5L 1GRWA 4YXHL 4NWUH 3O4LE 5C7XL 3MUGA 5DMIL 3BSZA 4JUSA 1NLDH 1YAZA 4WEBL 2X1XR 1KFAL 5B7FA 1A4KB 3MV9E 3TO4A 2N0MA 3VXSE 2WINB 4Y9FA 2X1WL 5T1KB 2W60B 3L3KB 3WFDH 5EOCJ 2V2TB 4OM0L 2R83A 5I6OA 4EQ2A 4BFIB 4PP2B 2F5AH 3D4GA 3OVUB 4IBZA 1NLBH 3GSVB 4Q52A 3C75A 4KK5C 3DUHA 4FULA 2AQ3A 3DGCR 2XZAH 1SJHB 4OGQC 5EU6D 4HXBL 3H3KA 2D31B 4QWWD 1MG2C 4X4MA 4JFHE 1HWGB 2VO5A 5E51A 5H4ZA 4QYOB 3MRBA 1JGDA 5CBAB 1BF5A 4AQAB 4AMKL 5D2NC 5DD0H 4ZW3A 4LLWB 2HLFD 1WGOA 5ICXA 3G08A 5F6IC 3ARDC 1CG9A 5EEZA 2KZBA 5FKAA 4Z7NB 1NCHA 2WLKA 1B4JH 4MMZC 2FBJL 2MTPA 5FHAL 4WHYG 1DHKA 5HVGB 4GSUA 1I7TA 2YAHA 4U1JA 4BEIA 1X5JA 4PB9H 5L6YL 2GSIB 1ECYA 1MEXL 1D9KA 2YARA 3GDCA 4PRDB 3DXAE 3LOWA 1OLLA 3RVVC 3RVXD 1ZDSA 2I07B 1ZJAA 4JBSA 4OFQA 2AV7B 4U1HA 5ID0B 2X1OA 2Z7WA 3DBXA 3UTOA 3SKJH 3UPRA 1KY6A 2WQUA 4LPTA 3GXPA 2KPNA 3L13A 2G60L 3FL7A 3AY4C 1KENH 4U6HA 3TH4T 2BVYA 2ICWA 2WXKA 4NZFA 4E9WA 4PGDB 3DOSA 4Q6IC 3MA9L 2PWEA 3RI5F 5BW7A 3ARSA 3LS4H 2NY2D 4ZUUB 4P99A 3BEWA 4Z78B 3W56A 2BIOA 1X5AA 2ZX7A 4ELKB 4Z7WF 4DGIH 2PCPA 1OSZA 1MFBH 1YEGL 3VU1A 3WN5C 3MXVL 3SZ6A 4ACPA 1E3FA 1QSFB 4P2QE 5D1XB 5B8CA 2HWZL 4OJFH 2FATH 1AD9B 1DO6A 4LQFL 1EAPA 2BOLA 5IROC 2R0KL 3MREA 4G7VH 3A4AA 1QSEA 4G42B 4WHTB 4PRAB 1CFNB 4PJAE 3D85D 4UQ3A 2ZCHH 3VXNA 1FNSH 1DBAL 4RAVB 4DUXA 5CEZD 3TEYA 3PDOA 1VRSA 3ZDYB 2P24B 4OIAA 2BVOB 4Y2LA 5F7EH 3V4VL 4PW3A 3TO4D 3EXLA 1MJJA 1RSFA 4GIOA 1R4XA 1ROWA 5ICZA 5EZLA 1H3VA 1AIFB 2EEDA 3OKOA 3VNYA 1LO2L 2VDLB 2ZXQA 3GSWB 1FPTH 1MCOL 3MUUA 4YBQD 2PCFB 4EZJA 4UMSA 1JJUA 2JKTM 4XCFH 4YSDA 1A4JB 1JRHH 4X5QA 1UM4H 4JJOA 4DVRH 4ZUSA 4KXZH 4TUOB 3PLYA 2OJZH 3O9WA 2BJMH 3HRPA 4FNRA 3PG2A 1E4HA 5D