1TT1A

Crystal structure of the glur6 ligand binding core in complex with kainate 1.93 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 87
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A02
3O97A 1XC1A 3KJ7A 3OO7A 4JSDA 4DE8A 4KI0E 2P1SA 4GXSB 1JVYA 4R74A 1BKAA 4ZEBA 3T9HB 3UIFA 3PMWA 1Q1KA 2I0BA 4AQ4A 2QJEA 2G93A 1PBPA 2D5WA 3HHFA 3QYTA 4N13A 3ZSFA 1HSEA 4DZ1A 4ZZEA 5JTYA 3SESA 3O6IA 1Y9UA 3DP4A 3OEMA 3PV0E 4GWOA 3ZS6A 5AE4A 4DDDA 3M3FA 3EF7A 4NF8A 5FTHA 4YMBA 5AA4B 3IOTA 4DLDA 1FTLA 2D3IA 1HSLA 5CBRA 1EZ9A 4OFLA 3U92A 1EU8A 1R1NA 2HAUA 3KOTA 4G8HA 1WODA 3CFZA 3JZJA 5H8FA 1AMFA 5H8SA 3TODA 1B1XA 2X26A 4H1XA 4QFNA 2H99A 3JV9A 1EZOA 2VHAA 2ZXTA 1YAEA 1IQ7A 1MS7A 1TWYA 3SEUA 5HPQA 5ICQA 5ITOA 4U22A 1LCTA 5I57A 2IA4A 2V93A 4IO7A 4LZ5A 3USDA 4TLMB 1AOVA 1URDA 1NNTA 3IO4A 2O84X 4GXAA 4QSCA 3RY3A 4RXLA 1ZTYA 3QUJA 3EPEA 3MP1A 4R6KA 4RY1A 4KR5A 4OYVA 4KYEA 2O6AA 1DMBA 1LAHE 4NF4B 1TFDA 1EZPA 3PPOA 4F31B 3QAXA 5F7VA 1NL5A 1ZU0A 4BDQA 3PUVE 4ELQA 2H9BA 3LSLA 1MH4A 3EN3A 3R26A 4BDOA 2XD3A 3N6UA 1USYH 4DCXA 3K4UA 4KYSA 3S9NC 3MP8A 3QXMA 2V25A 1LGBC 2Y84A 3MQ9A 1JQFA 4ND9A 4QFLA 5BWJA 1SD3A 4O3AA 4OFJA 2W7YA 3ODBA 2ZYMA 3CR9A 3PPNA 2H98A 2XXYA 3FJ7A 3MW0A 2P0SA 1MM6A 1L5TA 3RUMA 1UTHA 4RPNA 3KSXA 1D9YA 1FCKA 1XHYA 4C0RA 4F1VA 1A54A 3GXAA 1XT8A 3IB1A 2DSFA 4IY6A 2AL5A 2GRVA 3MVWA 4YZZA 1R9QA 1URGA 5EHMA 4ZS9A 1SYHA 1MXWA 3ILTB 4OESA 3C36A 3KZGA 1IXIA 1POY1 4P0GA 5IKBA 2G29A 5AA2D 5ITPA 1H76A 2ONRA 5I58B 2Q89A 5DT6A 1IUDA 4EQBA 4OWDA 3TTLA 3I5OA 1GTKA 5H8NA 1ZMGA 4POWA 1SVXB 3W15C 4RNSA 5DEXB 1N0TA 4PFYA 2YPNA 3UORA 3PUYE 1P1WA 1LBBA 4EDPA 1IITA 1OQGA 4XKNA 4NEDA 5DYHA 4G68A 3AXFA 4L17A 4QFKA 4BDLA 3SEWA 5I59B 2UXAA 4U4XA 1B5HA 1UTBB 2D21A 5JEIA 5CMMA 4NMYA 4Q8RA 3L6GA 4KPTA 1O63A 4R9FA 4R6HA 5M2VA 3A3UA 3G3GA 3UK4A 1FTMA 3V89B 4YKKA 5B7DA 1H43A 2AYSA 4N07A 4X48A 2QPQA 4OEVA 3EHTA 5FHOA 2OZZA 2P2AA 1R9LA 1ZIUA 3O28A 4FE8A 2CMOA 2XXPA 4FORA 3BBRA 2DE2A 1B6HA 4LUBA 3RQTA 5HM4B 3K2DA 4F1YA 1FQDA 3U94A 1Y1ZA 2X7PA 3LC8A 3S9EA 4I8CA 4XKRA 1Y20A 2XXTA 2Y7PA 3O66A 1NNFA 3FJGA 2I0CA 1B7HA 3DM0A 4NE4A 4F22A 4F3PA 1POTA 4IO4A 3HSTA 2AL4A 3CI8A 3IX1A 3H6VA 1ATGA 3FVNA 5EHSA 2Q2AA 4G8MA 1JVXA 2I4BA 3IB2A 3IAZA 4Q30B 5KZTA 4H5GA 3T96B 3MBPA 3WAFA 3Q26A 3RT8A 3U8QA 3RLFE 2DWAA 3G3HA 3TELA 3U1OA 5I2NA 3FV2A 1SQYA 1B7UA 1VR5A 1ZBMA 4IO2A 1JW1A 1S9TA 3U93A 2HXWA 1SI0A 2ABHA 1B46A 4UA8A 1YPNA 3V83A 1B0LA 4G68B 3VDFA 1T0KA 3O29A 2I4CA 3H6TA 2QRYA 2R9JA 2VP1A 4GD5A 5TP9B 5A5XA 2XD2A 1ZLQA 2OLBA 1A8FA 1R6ZA 3TEPA 3PD8A 1LB9A 1N76A 4PP0A 5I57B 4NTLA 3OO8A 4HTGA 3T9VA 1DPEA 1Z7ME 3CRBA 1MQIA 4ZEKA 1H44A 3KN8A 2Q2CA 1MRPA 1SW5A 2XXIA 3GLBA 1B1HA 1HSJA 2VD3A 4OTEA 1OVTA 4PFTA 4F29A 2DQVA 2LAOA 4R75A 3VLVA 4RYAA 1RYOA 3N5LA 3G3KA 4GL8A 3K6UA 1BLFA 4R2BA 1IXGA 4ELRA 3OEKA 2DE4A 1P1OA 3B7DA 2DWJA 1QULA 3QUFA 3CSGA 4IGRA 2GHAA 4IY5A 1FQBA 1B9JA 1B2HA 4EUOA 2E0SA 3A3CA 2UVHA 1CE2A 1JETA 2GH9A 2XHDA 1YCJA 3FATA 2PT2A 5FHNA 3TKDA 2OWTA 2PVUA 3LSFB 3VLUA 4HW8A 1A99A 3DLNA 5CI5A 4OEUA 3E4RA 3IO6A 1MQJA 3IB0A 1MXYA 1H45A 3KG2A 3OOAA 4U21A 4XKPA 3DP8A 4HS7A 3IK6B 1D4NA 3OENA 3TCFA 3E9XA 1N3WA 2DXYA 1LAGE 3MC2A 1XOCA 4AB6A 4GQOA 4RA1A 3OD7A 4GRKA 3R7XA 1Y3NA 4ELPA 1LFIA 3RNNA 2DVZA 2Z22A 3KGCA 2I58A 5BUUA 3HN0A 1Y3QA 2B65A 4GLIA 3TTKA 3TDJA 3CSBA 2B3BA 4XTCQ 4ESWA 1QW0A 5TPAB 1Z7NE 2F5XA 4JSOA 4YKPA 4F3SA 3HO7A 1OIBA 3H7MA 3THIA 1AIVA 1FQCA 3FD3A 3PMXA 4YMAA 2HAVA 3T66A 1EH3A 2Z8EA 3KFMA 4IO6A 4EQ9A 5CC2A 4POXA 2F35A 3H4ZA 4GL0A 3MWBA 1A55A 2XX8A 3ZKKA 3N94A 4LATA 4XXUA 1MG1A 1B32A 2RKMA 2E1SA 3MZBA 3VXBA 4JDFA 3PUWE 2F8DA 1O7TA 4JBZA 3IORA 2GHBA 2THIA 3N6TA 4QFOA 2RINA 4KFQA 5AA1A 3VVDA 3MVZA 5JTYB 5CMBA 1ZKBA 4I1DA 1B3EA 3EHUA 2ONKE 3MAMA 2WKYA 4ECFA 1YTVA 5DEXA 4OMBA 1M5DA 2ESNA 2F7CA 2OWSA 1BTJA 2Y7RA 5J1DA 2Q8JA 3S9LC 4WKMA 4OQOA 1JEUA 2HZLA 3A09A 4GIZA 4IB2A 4KCDA 1MXXA 4OXVA 3G3FA 2M8CA 3K00A 4MH5A 3M3KA 4OETA 1MPBA 3E3KA 1IIWA 1SBPA 2Q9TA 3LSXA 2DYXA 1VSOA 2Y7IA 3C32A 4M4GA 5AA2B 3FXQA 2Y7KA 2XXUA 3MJNA 3MUQA 3PU5A 4YU0A 4U2RA 3TFLA 1B3LA 4DXCA 1SW4A 2VD2A 2B3FA 2QS2A 4PFWA 5JK4A 1DPPA 3W9WA 4H65A 1II5A 3WAEA 4ZEDA 4RK9A 4ZZAA 3UP9A 4C1TA 4EF1A 4U4SA 5H8HA 1MQHA 4NF5A 4LZ7A 1XS5A 1QKAA 2ZMBA 4RK2A 2NUVA 3K6WA 5L9OA 3PUZE 5DVFA 3ILUB 4KHZE 3H6UA 2A5TA 3RT6B 1MQGA 1QVSA 4KD5A 1QKBA 2PT1A 4NF6A 1S50A 2V3QA 1MY2A 2GFEA 5DVJA 3CFXA 3VLWA 5CM6A 1KWHA 2ZYNA 5TPAA 1B58A 4THIA 4NF4A 3DELB 4WEDA 3T93B 4MLVA 4Z7EA 3MPLA 4JWXA 3BFTA 4YICA 2I6EA 4U23A 1OLAA 2OCUA 1NFTA 3DP6A 1SW2A 2F78A 3OELA 2Y7WA 1QUKA 3OSQA 4YKJA 4MLQA 5EYFA 1MY4A 1OQHA 3IR1A 3K1NA 1MM7A 2RC8A 3QK6A 4KQPA 3TCGA 3L6HA 4RJZA 3TMGA 4BDRA 5AA2A 1N84A 2F36A 3JYRA 3MVYA 3VVEA 2O7UA 3OXNA 1B52A 4WXJA 3I6VA 2H25A 1B51A 5I56A 3K02A 4KCCA 1IXHA 3HCQA 3KSJA 1UQWA 4FEBA 4H67A 1UTBA 4H8JA 2O51A 2QSXA 3C31A 3GZGA 4GF8A 5F1QA 5H8FB 2DOJA 3S2VA 2YJPA 5AA4A 2X7QA 4NF8B 5B70A 5CBSA 3TCHA 3IOUA 5CMCA 3O6HA 3FZVA 4IO3A 5ISUA 4LVQA 4WEPA 4EQ7A 2RC7A 1NH8A 2IEEA 1FTOA 1RKMA 3B6TA 3FASA 3OMBA 4H6DA 3TYHA 4ZECA 3IOWA 1XVXA 5K2YA 2Z8DA 1PBQA 2A5SA 3PPPA 1ANFA 3OSRA 3O2AA 3CIJA 1XVYA 2RCAA 2XXVA 1MPDA 1MQDA 1Y1MA 4LP2B 2Z8FA 1Q35A 2HCAA 4QRZA 2XXXA 1JEVA 5KCJB 3UA8A 1NMUA 4YB7A 3KEIA 1B05A 4PETA 4EXKA 1NNPA 5TP9A 2VOZA 3LR1A 2H4IA 5A5XB 1Y4CA 2FA7A 3TQLA 1LBCA 1MXUA 3K6VA 4H5FA 4BDNA 4N6PA 1N3XA 1PB8A 5ELVA 2DXRA 4K3FA 4XIGQ 1MXVA 1QJMA 5KDTB 1I6AA 4Z0IA 4BDMA 2ZNTA 4X1BA 1N7XA 2DS9A 5I56B 3D4CA 1CB6A 1B4ZA 1MXZA 2F97A 3FXRA 4OHNA 5TU0A 5CMKA 1MY1A 2XXHA 5H8QB 4G8NA 4F2QA 2A5TB 4YB5A 4GVOA 1US4A 1B0HA 1D9VA 1B5IA 2O1MA 3H03A 4YKIA 1FQEA 4PQJA 4DCYA 4NF5B 4E0WA 4LZ8A 3B6WA 2DVCA 1B7ZA 3LSWA 3FVGA 3C9HA 3EQ1A 1GVCA 4FECA 4C1UA 1JW4A 4ELOA 1B4HA 4X9TA 4ZEFA 1MDP1 5K2XA 4H8IA 4FAJA 4MFIA 4QSEA 4F3GA 4R73A 3K0VA 1B3FA 3T9UA 5L9MA 3RGYA 1IZ1A 3FJMA 3VE1B 1ELJA 3Q29A 1SI1A 3CG1A 3FUZA 2UVGA 3K01A 1QUIA 3R6UA 2YLNA 1LAXA 3ONMA 4O3BA 3M8UA 5H8QA 2FNCA 4TQUQ 3V5AA 4P0IA 3TUSA 3FV1A 1VE4A 4OENA 1A40A 3H3GA 4F19A 1B3GA 1Y3PA 2HEUA 2I49A 3F11A 3QIMA 3ZKLA 4F18A 3B6QA 1TFAA 2DWHA 2PX1A 5H8HB 1TXFA 3MVXA 4F3BA 2OK2A 3N26A 1B3HA 4R72A 3VVFA 3GBAA 3P7IA 1PEBA 3PUXE 2NXOA 4FATA 3KN3A 3O6GA 1LB8A 3HV1A 1QUJA 4G68C 4NWCA 1S7YA 4MF3A 5DTBA 4ZEIA 1I69A 3ECRA 3RN8A 4EF2A 1NNKA 1SDXA 2AIXA 3SETA 1PDAA 5LOMA 2HFBA 5AA3A 2NOOA 1FQFA 5I2KB 2RC9A 4FJPA 1RYXA 1P99A 4LQ5A 1O64A 1M5CA 4TLLB 3SEXA 2ANJA 4OZ9A 5L9SA 1P1QA 3E13X 2UYFA 1TT1A 1JNFA 4QSDA 2Q88A 3K1PA 3Q25A 3BFUA 1LFHA 3K1MA 4TOZA 1M5EA 3TZAA 4ZE9A 1N7WA 4YAHX 2PMSA 4BLAA 2REJA 1FTKA 2ALUA 3SDFA 3V8XB 4MBPA 4G77A 3PGFA 1NH7A 3CVGA 3C35A 4AB5A 4F2OA 1MDQA 2ONSA 1M5BA 2UVIA 4X1DA 4QHQA 4ZE8A 5DVIA 3T9XB 1LLSA 3C4MA 4R6YA 2F34A 3SERA 2I3WA 1BP5A 4FIMA 1SYIA 3G3JA 4JWOA 3HHGA 4F39A 2R71A 2RCBA 3EHSA 2QMWA 3HPIA 1DSNA 4F1UA 2DWIA 3FVKA 2HZKA 3PD9A 3K6XA 4U1ZA 1LAFE 3TTNA 5I59A 3FIRA 3S9MC 4JWYA 1F9BA 1M5FA 1FQAA 3I3VA 3TQWA 4ESXA 2O68A 1P1UA 3C34A 3MZ1A 1IXCA 1LSTA 2PYYA 3GBBA 2HQ0A 5L8DA 4RPOA 3G3IA 4HCYA 2REGA 2V84A 1AL3A 1I6BA 1WVJA 2O1LA 1A7LA 3H6WA 3IJOB 4EXLA 4OVJA 3TTMA 1WDNA 3QSLA 4LQ2A 3KJTA 4DIGA 4H0WA 1MH3A 4R2FA 2O7IA 1MY3A 2XX7A 2F6PA 2F7BA 3IL1B 4NF6B 2NWJA 2QS4A 4R9GA 3W9VA 4IGTA 1DOTA 1PB7A 2DE3A 1N04A 1VFEA 1B5JA 4I62A 4PE5B 2UYEA 4M1VA 5FTIA 2PBWA 4Q0CA 1LFGA 1P1NA 4OFOA 3FVOA 1GGGA 3LBSA 2QS1A 4FEDA 4I9DA 1UTHB 2XXQA 4NWDA 3VV5A 1FTJA 2H5YA 2RF1A 4ISUA 4G4PA 1MY0A 4XKQA 2ZNSA 5I84A 1OLCA 3M3LA 3Q28A 1VFDA 4LONB 3MPKA 1D3KA 3C33A 4QFPA 3G7WA 2V3TA 2OJTA 3H06B 2ZYKA 3VFJA 3RTWB 1MPCA 4JXIA 3TTRA 1ZJLA 2I48A 1FW0A 3CG3A 2BJJX 4OERA 3SKPA 5HBCA 3IOVA 4PFUA 3D4GA 4GFRA 4JB7A 3TAJA 2ZNUA 4E0XA 1I6QA 3UGWA 4Q5TA 5FHMA 5CRYA 4QF9A 3BKIB 1DTGA 1USYE 2F7AA 1GR2A 2F6GA 4HCWA 4DXBA 2OBGA 4YB6A 3RTFB 4KYDA 3KN7A 1SW1A 3VXCA 4IO5A 2QL3A 3KOSA 4ZDMA 4G2ZA 3UN6A 3T22A 2DP8A 2I3VA 2ZYOA 4GOTA 4P11A 3MP6A 1J1NA 5I2NB 2FYIA 1JW5A 3FXUA 3U72A 1PB9A 1IEJA 3SEYA 2QMXA 5ICTA 2CZLA 2UVJA 1LCFA 3SEVA 3OO9A 4U1OA 3S4UA 1US5A 3O9PA 1OVBA 4LA9A 3TPAA 4UACA 1BIYA 1NKXA 2Z23A 3MZ9A 5KDTA 3Q27A 1B40A 3OO6A 2V3UA 4DXUA 3KBRA 2KLFA 3PMVA 1OMPA 4O3CA 1GV8A 1UIUA 1URSA 5IAIA 1Y4TA 3LUYA 1UIVA 3IJXB 3PPQA 3PPRA 1PC3A 2XXRA 1AH5A 5KCJA 2O69A 1H3DA 1A8EA 3RPWA 5H8NB 4ONYA 2VGQA 2XXWA 2QS3A 3CFLA 3FGSA 2R6GE 5I2KA 1DTZA 5I58A 2NVUB 2XX9A
chains in the Genus database with same CATH superfamily
1IMFA 1XC1A 4DE8A 4JSDA 1FBCA 4GXSB 2QJEA 3HHFA 1Y9UA 4MNIA 4DLDA 2D3IA 1HSLA 3KOTA 2HAUA 3CFZA 4QXDA 3JV9A 4U22A 2IA4A 2V93A 4TLMB 1URDA 3QUJA 3CHGA 4KYEA 4NF4B 4NN3A 1LAHE 3PPOA 4F31B 5F7VA 1NL5A 3PUVE 4NHBA 1Q9DA 1MH4A 3EN3A 2XD3A 3K4UA 2Y84A 3MQ9A 2W7YA 3U72A 3RUMA 3T0JA 3KSXA 1FCKA 4C0RA 3IB1A 2CEYA 1R9QA 1SYHA 1MXWA 5IKBA 1QGXA 5AA2D 5ITPA 1NV1A 2Q89A 3TTLA 3I5OA 3UORA 2CZIA 4NEDA 5DYHA 4G68A 1DBZA 4NMYA 4R9FA 4R6HA 5M2VA 4N07A 4MEVA 5FHOA 3B8BA 2CMOA 3K2DA 4X8RA 1FQDA 1FPLA 1Y1ZA 2X7PA 3LC8A 4F3PA 4NE4A 1INPA 2OWZA 1ATGA 5EHSA 2Q2AA 4G8MA 2I4BA 4N17A 4Q30B 3T96B 3Q26A 1SQYA 1B0LA 3VDFA 3O29A 3H6TA 2QRYA 1A8FA 3PD8A 1FPKA 2XXKA 3T9VA 2OX3A 4FBPA 2XXIA 4PF6A 3RYDA 2VD3A 4OTEA 4PFTA 5IM2A 1IXGA 2DE4A 1P1OA 1QULA 2E0SA 1CE2A 2GH9A 4PFIA 1YCJA 5FHNA 2PVUA 3IO6A 1MQJA 4H46A 1FSAA 2F3BA 4U21A 4HS7A 1D4NA 3TCFA 2DXYA 4OA4A 1LAGE 4RA1A 3R7XA 1Y3NA 1IMDA 4P8BA 2F3DA 3KGCA 3HN0A 1Y3QA 3TTKA 1QW0A 4JSOA 1RDYA 2XWVA 3FD3A 4GWSA 4HE0A 2F35A 3H4ZA 4GWUA 1B32A 2F8DA 5AA1A 4ECFA 5DEXA 1M5DA 2OWSA 2Y7RA 4OXVA 3U65A 1FBGA 4MJOA 2M8CA 4MH5A 3THIA 3LSXA 4M4GA 1MPBA 3FXQA 2XXUA 2B3FA 1II5A 4RK9A 4C1TA 3K6WA 3PUZE 5DVFA 4KHZE 1MQGA 1QVSA 4KD5A 2GFEA 3VLWA 1FJ9A 1B58A 1DCUA 4NF4A 3DELB 4MLVA 3MPLA 4YICA 1NFTA 3DP6A 2RC8A 1RDZA 5AA2A 4OVRA 2F36A 3OXNA 1B52A 3I6VA 4PCDA 4H67A 3FXBA 2O51A 3C31A 3GZGA 3S2VA 2YJPA 5CBSA 3IOUA 3O6HA 3OMBA 4H6DA 1KA0A 4N8GA 2A5SA 1ANFA 3CIJA 1XVYA 2RCAA 2Y5LA 1Y1MA 2FIXA 3UA8A 4YB7A 4EXKA 1B05A 5TP9A 3LR1A 2FA7A 1LBCA 4H5FA 4BDNA 1N3XA 1MXVA 5KDTB 2WYPA 2ZNTA 4BDMA 2DS9A 3D4CA 1B4ZA 2F97A 5CMKA 1US4A 1B0HA 4JVCA 2DVCA 1B7ZA 4ELOA 4X9TA 4PFBA 5K2XA 4FAJA 4F3GA 3T9UA 4DI3D 3FJMA 3VE1B 2XWOA 1SI1A 3CG1A 2UVGA 1LEVA 4Z7EA 2FNCA 4TQUQ 3V5AA 1VE4A 4OENA 3F11A 2I49A 4F3BA 1B3HA 4O7IA 2NXOA 4NWCA 1S7YA 4MF3A 2DDKA 1NNKA 3SETA 4AS4A 4LQ5A 1O64A 5L9SA 5IZ3A 1LFHA 4BLAA 5IGAA 1NV5A 3PGFA 1MDQA 3SERA 2I3WA 1SYIA 4F39A 3HPIA 1DSNA 2Q8MA 3S9MC 3TTNA 3FIRA 1F9BA 4ESXA 1P1UA 2O1LA 4LQ2A 2XX7A 1DOTA 4MX6A 4I62A 2WEFA 1P1NA 4NWDA 1FTJA 4ISUA 4NX1A 1OLCA 3Q28A 3C33A 2V3TA 3H06B 3VFJA 3CG3A 2B4LA 5HBCA 4PFUA 4JB7A 3UGWA 2F7AA 4YB6A 3RTFB 4KYDA 3VXCA 2QL3A 4ZDMA 2ZYOA 1J1NA 2FYIA 1JW5A 1IEJA 2FVZA 4U1OA 3TPAA 1NKXA 4HE2A 1OMPA 1GV8A 4GBVA 3LUYA 3PPRA 3RPWA 4ONYA 5I2KA 3HO7A 4X1BA 1DTZA 2HHMA 2XX9A 3KJ7A 4KI0E 4R74A 3T9HB 1BKAA 3PMWA 2I0BA 4AQ4A 2G93A 3BIGA 5JTYA 1EYKA 3ZSFA 4N91A 4ZZEA 4XEQA 4DDDA 3M3FA 4NF8A 1FTLA 5CBRA 3U92A 1R1NA 5H8SA 3TODA 4QFNA 4X04A 4G61A 1YAEA 1IQ7A 2WYKA 1TWYA 5HPQA 4I40A 1LCTA 5I57A 4IO7A 3D1RA 2O84X 3RY3A 4RXLA 1ZTYA 3EPEA 4R6KA 4RY1A 5I7IA 4KR5A 4OYVA 2O6AA 4ELQA 4BDQA 1ZU0A 5LTCA 3LSLA 3N6UA 1USYH 4DCXA 3S9NC 4QFLA 4PE3A 4HE1A 4O3AA 3ODBA 3PPNA 1A54A 4YZZA 5EHMA 4I3EA 4P0GA 1IXIA 2G29A 5DT6A 1IUDA 1ZMGA 4POWA 5DEXB 2YPNA 3ROJA 1LBBA 4EDPA 3PTYA 4XKNA 4PF8A 5I59B 2UXAA 5CMMA 1DK4A 2FHYA 4KPTA 2AYSA 2OZZA 1ZIUA 3O28A 2XXPA 4FORA 3RQTA 3S9EA 4DZ1A 1B7HA 3DM0A 1G0IA 1POTA 4IO4A 3CI8A 1JVXA 5KZTA 3MBPA 1NUZA 1FBHA 3U8QA 3U1OA 2MKZA 4IO2A 3U93A 3V83A 4G68B 5EQAA 2R9JA 2VP1A 2OLBA 1R6ZA 4N6KA 1N76A 4HTGA 1DPEA 3CRBA 4ZEKA 1SW5A 3GLBA 1B1HA 4F29A 2LAOA 1RYOA 3N5LA 4GL8A 4R2BA 3B7DA 3CSGA 4EUOA 3TKDA 2XHDA 2OWTA 3LSFB 4HW8A 1A99A 5CI5A 2CEXA 1H45A 4XKPA 3OENA 1N3WA 1XOCA 3OD7A 4GRKA 4ELPA 1LBXA 1LFIA 2DVZA 2Z22A 5BUUA 4GLIA 4ESWA 5TPAB 4YKPA 1FBFA 3H7MA 1AIVA 2B4MA 3T66A 3KFMA 4POXA 2PCRA 3ZKKA 3N94A 4LATA 2RKMA 2E1SA 4JDFA 3MYUA 3PUWE 3IORA 4QFOA 4GX4A 2XA5A 5JTYB 1ZKBA 3EHUA 2ONKE 4OMBA 2F7CA 1BTJA 4WKMA 5DW8A 3A09A 4KCDA 3K00A 4OETA 3E3KA 2Y7IA 3C32A 5AA2B 2Y7KA 4YU0A 4DXCA 1B3LA 1SW4A 2QFLA 4ZZAA 1MQHA 1XS5A 2ZMBA 2NUVA 3H6UA 1QKBA 2VPNA 1S50A 1MY2A 3CFXA 4P3LA 2ZYNA 4WEDA 3T93B 2I6EA 2F78A 2Y7WA 1QUKA 2XWIA 3TCGA 3IR1A 3QK6A 4KQPA 4BDRA 1N84A 3MVYA 3VVEA 2H25A 5AA4A 2X7QA 3TCHA 1NV3A 5CMCA 3FZVA 4IO3A 5ISUA 2RC7A 3FASA 1RKMA 3IOWA 1XVXA 1PBQA 3OSRA 2XXVA 1MPDA 2Z8FA 2HCAA 5I3SA 1NMUA 4PETA 3TQLA 1PB8A 2DXRA 4K3FA 1QJMA 4Z0IA 1MXZA 4G8NA 4F2QA 4GVOA 2O1MA 4YKIA 1FQEA 4DCYA 4E0WA 3FVGA 3C9HA 3EQ1A 4C1UA 1B4HA 4ZEFA 1BK4A 5L9MA 3RGYA 1IZ1A 1ELJA 3FUZA 3K01A 3TAJA 3R6UA 2YLNA 4O3BA 5H8QA 3M8UA 4P0IA 3FV1A 1LBYA 1FPBA 3H3GA 1B3GA 2HEUA 3RPLA 2CZKA 2PX1A 4PC9A 1TXFA 4R72A 4PDHA 3P7IA 1PEBA 2GQ1A 3KN3A 1LB8A 4G68C 1I69A 3ECRA 5ET8A 3RN8A 4EF2A 1SDXA 1PDAA 5LOMA 2NOOA 2RC9A 4FJPA 1RYXA 1P99A 2ANJA 3E13X 1JNFA 4O8MA 4TOZA 1M5EA 1N7WA 4YAHX 1FTKA 4G77A 2ONSA 4ZE8A 1LLSA 1BP5A 4FIMA 4JWOA 4OVQA 2DWIA 1LAFE 2ZZXA 2PYYA 2HQ0A 2CZHA 1I6BA 1WVJA 1A7LA 3IJOB 3TTMA 1WDNA 3QSLA 4H0WA 1MH3A 1MY3A 2QS4A 4R9GA 1PB7A 2DE3A 1VFEA 1NI9A 4PE5B 5FTIA 4Q0CA 1LFGA 4OFOA 1GGGA 4NF0A 2Y5KA 4OANA 1LBZA 2RF1A 5I84A 3M3LA 4LONB 1D3KA 3TTRA 4JXIA 1FW0A 2BJJX 5CRYA 3BKIB 1DTGA 4P9KA 3KOSA 4N6DA 3UN6A 4P11A 4GWXA 3MP6A 3FXUA 5ICTA 1LCFA 3S4UA 1US5A 2QVVA 3MZ9A 3KC0A 2HXRA 3PMVA 1FJ6A 1UIUA 1UIVA 3MSTA 3PPQA 1PC3A 1H3DA 3A29A 5H8NB 2R6GE 3B50A 4I3YA 4AS5A 1K9YA 3O97A 3OO7A 2P1SA 4ZEBA 4O7MA 1PBPA 2D5WA 3QYTA 1HSEA 1YZ0A 2WBBA 3O6IA 5AE4A 5FTHA 4YMBA 3IOTA 4OFLA 1RDXA 1EU8A 1EZOA 2X26A 2HPGA 1KZ8A 1MS7A 1IMBA 4LZ5A 1AOVA 1NNTA 4NQ8A 4QSCA 3MP1A 1DMBA 3QAXA 4BDOA 3QXMA 2V25A 4ND9A 5BWJA 1JQFA 1SD3A 4OFJA 3EKIA 2ZYMA 3CR9A 2XXYA 3FJ7A 1L5TA 4RPNA 4F1VA 1XHYA 3GXAA 2DSFA 4ZS9A 2GRVA 1URGA 2JJKA 3ILTB 4OESA 3KZGA 2FBPA 1POY1 1H76A 1K9ZA 2ONRA 4EQBA 1GTKA 3W15C 4RNSA 4PFYA 3PUYE 1P1WA 1IITA 3AXFA 4L17A 4MHFA 1UTBB 2D21A 1EYJA 4Q8RA 3A3UA 3UK4A 5B7DA 1H43A 4X48A 2QPQA 4OEVA 3EHTA 4PGPA 3HFUA 4OVPA 2P2AA 4LUBA 1B6HA 1AWBA 2FIEA 3O66A 5JEIA 4PAKA 2I0CA 4F22A 4IR8A 3HSTA 2AL4A 3IX1A 3FVNA 4H5GA 2L5VA 3WAFA 3RLFE 3G3HA 3TELA 1ZBMA 2HXWA 1SI0A 1B46A 5A5XA 2XD2A 5EYHA 1Z7ME 1MQIA 3KN8A 2Q74A 1HSJA 5T3JA 4RYAA 5FBPA 2P3NA 4ELRA 2DWJA 4IGRA 1B9JA 3A3CA 2UVHA 4ZE9A 3E4RA 3IB0A 3LUZA 4P56A 3KG2A 2VPOA 3DP8A 1IMEA 3E9XA 3LV0A 3MC2A 4GQOA 2I58A 2B65A 3TDJA 4XTCQ 1Z7NE 4F3SA 1FQCA 2Z8EA 5CC2A 3MWBA 1A55A 2XX8A 4NGUA 1MG1A 3VXBA 3MZBA 1O7TA 4JBZA 2GHBA 2THIA 2RINA 4GWYA 5CMBA 2KQZA 3MAMA 2WKYA 3S9LC 2ESNA 2Q8JA 2HZLA 4GIZA 4IB2A 4MAGA 3KC1A 1YYZA 4XF5A 3TFLA 4N15A 4LN5A 2VD2A 2QS2A 4PFWA 1D9QA 5JK4A 1DPPA 3W9WA 4ZEDA 4EF1A 4U4SA 5H8HA 4NF5A 4LZ7A 1QKAA 5L9OA 2PT1A 1KWHA 4THIA 5J16A 4U23A 1OLAA 2OCUA 1SW2A 3SZPA 1OQHA 3K1NA 3TMGA 2O7UA 3E78A 5I56A 3K02A 4KCCA 3HCQA 4FEBA 5LDZA 1UQWA 4H8JA 1UTBA 4GF8A 5F1QA 4N8YA 3IFCA 4NF8B 1FPEA 4LVQA 4WEPA 4EQ7A 1FTOA 3B6TA 5K2YA 3O2AA 4LP2B 4QRZA 2XXXA 1JP4A 1NUYA 5KCJB 3IFAA 3KEIA 1NNPA 1Y4CA 1MXUA 3K6VA 4N6PA 4XIGQ 4MNPA 1I6AA 1N7XA 1CB6A 3FXRA 4OHNA 1FRPA 2A5TB 2ZZVA 4YB5A 1D9VA 2VT5A 4PBHA 4NF5B 3B6WA 3LSWA 1GVCA 1JW4A 1MDP1 4MFIA 4QSEA 2PFYA 1B3FA 3K0VA 5IZ3B 3T1BA 5H8FB 3ONMA 1LAXA 1NUWA 2QVUA 1A40A 4MCOA 1Y3PA 3ZKLA 4F18A 1TFAA 5H8HB 2OK2A 3VVFA 3GBAA 3PUXE 4JVDA 4ZEIA 4PTKA 2HFBA 1FQFA 5I2KB 3SEXA 1TT1A 4QSDA 3Q25A 3TZAA 4MBPA 4N4UA 1NH7A 4F2OA 3C35A 4AB5A 4QHQA 5DVIA 4R6YA 4P47A 3HHGA 2R71A 1EYIA 2QMWA 2ZZWA 4GWZA 2HZKA 4U1ZA 5I59A 1M5FA 1FQAA 3I3VA 3TQWA 2O68A 1IXCA 1LSTA 3GBBA 4UABA 4QBAA 3G3IA 4HCYA 5ET6A 4OVJA 4DIGA 2O7IA 2F7BA 4NF6B 1N04A 1B5JA 4OVSA 4M1VA 1FTAA 2PBWA 3LBSA 4FEDA 4I9DA 2XXQA 3VV5A 1MY0A 4NAPA 2ZNSA 4XKQA 1VFDA 3G7WA 2I48A 3SKPA 4OERA 3IOVA 3D4GA 4E0XA 2ZNUA 4PAFA 4Q5TA 5FHMA 1USYE 2F6GA 4DXBA 2OBGA 3KN7A 4IO5A 2KR0A 3T22A 5I2NB 1PB9A 3SEYA 2XWKA 2QMXA 2CZLA 2UVJA 1FPJA 1BIYA 2Z23A 3Q27A 3OO6A 2V3UA 4HXVA 4DXUA 3KBRA 2KLFA 1URSA 4OVTA 3IJXB 1AH5A 5KCJA 1A8EA 2VGQA 3FGSA 2QS3A 3CFLA 3GYYA 2NVUB 1NUXA 1JVYA 3UIFA 1Q1KA 1SPIA 4N13A 3SESA 3OEMA 3DP4A 3PV0E 4GWOA 3ZS6A 5IZZA 3EF7A 3RPLB 5AA4B 1FBPA 1EZ9A 4G8HA 5EQ9A 1WODA 3JZJA 5H8FA 1AMFA 1B1XA 4H1XA 2H99A 2VHAA 2ZXTA 3SEUA 5ICQA 5ITOA 3USDA 3IO4A 4GXAA 1FPIA 1TFDA 4JVIA 1EZPA 2H9BA 3R26A 3BIHA 4KYSA 3MP8A 1LGBC 2H98A 3MW0A 2P0SA 1MM6A 2WBDA 1UTHA 1D9YA 1XT8A 4IY6A 2AL5A 2WX9A 3MVWA 1FBDA 3C36A 5I58B 1G0HA 4OWDA 5H8NA 1SVXB 1N0TA 1OQGA 4QFKA 4BDLA 3SEWA 4U4XA 1B5HA 2BJIA 3L6GA 1O63A 3G3GA 1FTMA 1NV6A 3V89B 4YKKA 2R8TA 1YXIA 4FE8A 1R9LA 3BBRA 2DE2A 5HM4B 4F1YA 3U94A 5ET7A 4I8CA 1Y20A 2XXTA 2Y7PA 4GX6A 1NNFA 3FJGA 4XFEA 3H6VA 4P1EA 5ET5A 3IB2A 3IAZA 3RT8A 2DWAA 5I2NA 3FV2A 4NG7A 1B7UA 1VR5A 1JW1A 1S9TA 2ABHA 4UA8A 1YPNA 1T0KA 2I4CA 4GD5A 5TP9B 1ZLQA 3TEPA 1LB9A 4PP0A 5I57B 2V4CA 4NTLA 3OO8A 5I5PA 1H44A 2Q2CA 1MRPA 1OVTA 3FBPA 2DQVA 4R75A 3VLVA 3G3KA 3K6UA 1BLFA 3OEKA 1IMCA 3QUFA 2GHAA 4IY5A 1FQBA 1B2HA 1JETA 3FATA 2PT2A 3VLUA 3DLNA 4OEUA 1MXYA 3OOAA 3IK6B 3NOHA 4AB6A 5EQ7A 3RNNA 3CSBA 5EQ8A 2B3BA 2F5XA 4H45A 1OIBA 3PMXA 4YMAA 2HAVA 4P1LA 1EH3A 4IO6A 4EQ9A 1FPFA 4GL0A 4XXUA 3N6TA 3VVDA 4KFQA 3MVZA 4I1DA 1B3EA 1NV4A 4MMPA 1YTVA 5J1DA 4OQOA 1JEUA 1MXXA 3G3FA 3M3KA 1IIWA 1SBPA 2Q9TA 2DYXA 1VSOA 4GX3A 3MJNA 3MUQA 3PU5A 4U2RA 4H65A 3WAEA 3UP9A 4RK2A 3ILUB 2A5TA 3RT6B 4PDDA 4GWWA 4NF6A 2P3VA 2V3QA 5DVJA 5CM6A 3QMFA 5A5LA 5TPAA 4PAIA 4JWXA 3BFTA 5EYFA 3OELA 3OSQA 4YKJA 4MLQA 1MY4A 1MM7A 3L6HA 4RJZA 3JYRA 4WXJA 4PFRA 5EYGA 1B51A 1IXHA 3KSJA 2QSXA 2DOJA 5B70A 1NH8A 2IEEA 3TYHA 4ZECA 4MNCA 2Z8DA 3PPPA 1MQDA 1Q35A 1JEVA 1FBEA 5A5XB 2VOZA 2H4IA 5ELVA 1CNQA 5I56B 2PFZA 4KXPA 5TU0A 1MY1A 2XXHA 5H8QB 1B5IA 3H03A 4PQJA 4LZ8A 5IZ1A 4FECA 4H8IA 4R73A 4MIJA 3Q29A 4XKRA 1QUIA 3TUSA 4DI4B 4F19A 3QIMA 5ESYA 1NV0A 3B6QA 2DWHA 3MVXA 3N26A 1KA1A 1LBVA 4FATA 3O6GA 5DTBA 3HV1A 1QUJA 2AIXA 5AA3A 1XI6A 3E79A 1M5CA 4TLLB 4OZ9A 1P1QA 2UYFA 1IMAA 2Q88A 3K1PA 3BFUA 3K1MA 2PMSA 2REJA 3SDFA 2ALUA 3V8XB 3CVGA 1M5BA 2UVIA 4X1DA 3T9XB 3C4MA 2F34A 5F24A 1FPDA 3G3JA 2RCBA 3EHSA 4F1UA 3FVKA 3PD9A 3K6XA 4JWYA 4GBWA 3C34A 3MZ1A 1LBWA 5L8DA 4RPOA 2REGA 2V84A 1AL3A 3H6WA 4EXLA 4O94A 3KJTA 4R2FA 2F6PA 3IL1B 3W9VA 2NWJA 4IGTA 2UYEA 1NV7A 3FVOA 2QS1A 3KBZA 1UTHB 2H5YA 4G4PA 3MPKA 4QFPA 1VDWA 2OJTA 2ZYKA 3RTWB 1MPCA 1ZJLA 4GFRA 1I6QA 1NV2A 4QF9A 4N81A 1GR2A 4HCWA 2QVRA 1SW1A 4G2ZA 2DP8A 2I3VA 4GOTA 3ISPA 3SEVA 3OO9A 4LA9A 3O9PA 1OVBA 4UACA 5KDTA 1B40A 4O3CA 5IAIA 1FPGA 1Y4TA 4PBQA 2XXRA 2O69A 2XXWA 4PGNA 5I58A
chains in the Genus database with same CATH topology
3O97A 1XC1A 3KJ7A 3OO7A 4JSDA 4DE8A 4KI0E 2P1SA 4GXSB 1JVYA 4R74A 1BKAA 4ZEBA 3T9HB 3UIFA 3PMWA 1Q1KA 2I0BA 4AQ4A 2QJEA 2G93A 1PBPA 2D5WA 3HHFA 3QYTA 4N13A 3ZSFA 1HSEA 4DZ1A 4ZZEA 5JTYA 3SESA 3O6IA 1Y9UA 3DP4A 3OEMA 3PV0E 4GWOA 3ZS6A 5AE4A 4DDDA 3M3FA 3EF7A 4NF8A 5FTHA 4YMBA 5AA4B 3IOTA 4DLDA 1FTLA 2D3IA 1HSLA 5CBRA 1EZ9A 4OFLA 3U92A 1EU8A 1R1NA 2HAUA 3KOTA 4G8HA 1WODA 3CFZA 3JZJA 5H8FA 1AMFA 5H8SA 3TODA 1B1XA 2X26A 4H1XA 4QFNA 2H99A 3JV9A 1EZOA 2VHAA 2ZXTA 1YAEA 1IQ7A 1MS7A 1TWYA 3SEUA 5HPQA 5ICQA 5ITOA 4U22A 1LCTA 5I57A 2IA4A 2V93A 4IO7A 4LZ5A 3USDA 4TLMB 1AOVA 1URDA 1NNTA 3IO4A 2O84X 4GXAA 4QSCA 3RY3A 4RXLA 1ZTYA 3QUJA 3EPEA 3MP1A 4R6KA 4RY1A 4KR5A 4OYVA 4KYEA 2O6AA 1DMBA 1LAHE 4NF4B 1TFDA 1EZPA 3PPOA 4F31B 3QAXA 5F7VA 1NL5A 1ZU0A 4BDQA 3PUVE 4ELQA 2H9BA 3LSLA 1MH4A 3EN3A 3R26A 4BDOA 2XD3A 3N6UA 1USYH 4DCXA 3K4UA 4KYSA 3S9NC 3MP8A 3QXMA 2V25A 1LGBC 2Y84A 3MQ9A 1JQFA 4ND9A 4QFLA 5BWJA 1SD3A 4O3AA 4OFJA 2W7YA 3ODBA 2ZYMA 3CR9A 3PPNA 2H98A 2XXYA 3FJ7A 3MW0A 2P0SA 1MM6A 1L5TA 3RUMA 1UTHA 4RPNA 3KSXA 1D9YA 1FCKA 1XHYA 4C0RA 4F1VA 1A54A 3GXAA 1XT8A 3IB1A 2DSFA 4IY6A 2AL5A 2GRVA 3MVWA 4YZZA 1R9QA 1URGA 5EHMA 4ZS9A 1SYHA 1MXWA 3ILTB 4OESA 3C36A 3KZGA 1IXIA 1POY1 4P0GA 5IKBA 2G29A 5AA2D 5ITPA 1H76A 2ONRA 5I58B 2Q89A 5DT6A 1IUDA 4EQBA 4OWDA 3TTLA 3I5OA 1GTKA 5H8NA 1ZMGA 4POWA 1SVXB 3W15C 4RNSA 5DEXB 1N0TA 4PFYA 2YPNA 3UORA 3PUYE 1P1WA 1LBBA 4EDPA 1IITA 1OQGA 4XKNA 4NEDA 5DYHA 4G68A 3AXFA 4L17A 4QFKA 4BDLA 3SEWA 5I59B 2UXAA 4U4XA 1B5HA 1UTBB 2D21A 5JEIA 5CMMA 4NMYA 4Q8RA 3L6GA 4KPTA 1O63A 4R9FA 4R6HA 5M2VA 3A3UA 3G3GA 3UK4A 1FTMA 3V89B 4YKKA 5B7DA 1H43A 2AYSA 4N07A 4X48A 2QPQA 4OEVA 3EHTA 5FHOA 2OZZA 2P2AA 1R9LA 1ZIUA 3O28A 4FE8A 2CMOA 2XXPA 4FORA 3BBRA 2DE2A 1B6HA 4LUBA 3RQTA 5HM4B 3K2DA 4F1YA 1FQDA 3U94A 1Y1ZA 2X7PA 3LC8A 3S9EA 4I8CA 4XKRA 1Y20A 2XXTA 2Y7PA 3O66A 1NNFA 3FJGA 2I0CA 1B7HA 3DM0A 4NE4A 4F22A 4F3PA 1POTA 4IO4A 3HSTA 2AL4A 3CI8A 3IX1A 3H6VA 1ATGA 3FVNA 5EHSA 2Q2AA 4G8MA 1JVXA 2I4BA 3IB2A 3IAZA 4Q30B 5KZTA 4H5GA 3T96B 3MBPA 3WAFA 3Q26A 3RT8A 3U8QA 3RLFE 2DWAA 3G3HA 3TELA 3U1OA 5I2NA 3FV2A 1SQYA 1B7UA 1VR5A 1ZBMA 4IO2A 1JW1A 1S9TA 3U93A 2HXWA 1SI0A 2ABHA 1B46A 4UA8A 1YPNA 3V83A 1B0LA 4G68B 3VDFA 1T0KA 3O29A 2I4CA 3H6TA 2QRYA 2R9JA 2VP1A 4GD5A 5TP9B 5A5XA 2XD2A 1ZLQA 2OLBA 1A8FA 1R6ZA 3TEPA 3PD8A 1LB9A 1N76A 4PP0A 5I57B 4NTLA 3OO8A 4HTGA 3T9VA 1DPEA 1Z7ME 3CRBA 1MQIA 4ZEKA 1H44A 3KN8A 2Q2CA 1MRPA 1SW5A 2XXIA 3GLBA 1B1HA 1HSJA 2VD3A 4OTEA 1OVTA 4PFTA 4F29A 2DQVA 2LAOA 4R75A 3VLVA 4RYAA 1RYOA 3N5LA 3G3KA 4GL8A 3K6UA 1BLFA 4R2BA 1IXGA 4ELRA 3OEKA 2DE4A 1P1OA 3B7DA 2DWJA 1QULA 3QUFA 3CSGA 4IGRA 2GHAA 4IY5A 1FQBA 1B9JA 1B2HA 4EUOA 2E0SA 3A3CA 2UVHA 1CE2A 1JETA 2GH9A 2XHDA 1YCJA 3FATA 2PT2A 5FHNA 3TKDA 2OWTA 2PVUA 3LSFB 3VLUA 4HW8A 1A99A 3DLNA 5CI5A 4OEUA 3E4RA 3IO6A 1MQJA 3IB0A 1MXYA 1H45A 3KG2A 3OOAA 4U21A 4XKPA 3DP8A 4HS7A 3IK6B 1D4NA 3OENA 3TCFA 3E9XA 1N3WA 2DXYA 1LAGE 3MC2A 1XOCA 4AB6A 4GQOA 4RA1A 3OD7A 4GRKA 3R7XA 1Y3NA 4ELPA 1LFIA 3RNNA 2DVZA 2Z22A 3KGCA 2I58A 5BUUA 3HN0A 1Y3QA 2B65A 4GLIA 3TTKA 3TDJA 3CSBA 2B3BA 4XTCQ 4ESWA 1QW0A 5TPAB 1Z7NE 2F5XA 4JSOA 4YKPA 4F3SA 3HO7A 1OIBA 3H7MA 3THIA 1AIVA 1FQCA 3FD3A 3PMXA 4YMAA 2HAVA 3T66A 1EH3A 2Z8EA 3KFMA 4IO6A 4EQ9A 5CC2A 4POXA 2F35A 3H4ZA 4GL0A 3MWBA 1A55A 2XX8A 3ZKKA 3N94A 4LATA 4XXUA 1MG1A 1B32A 2RKMA 2E1SA 3MZBA 3VXBA 4JDFA 3PUWE 2F8DA 1O7TA 4JBZA 3IORA 2GHBA 2THIA 3N6TA 4QFOA 2RINA 4KFQA 5AA1A 3VVDA 3MVZA 5JTYB 5CMBA 1ZKBA 4I1DA 1B3EA 3EHUA 2ONKE 3MAMA 2WKYA 4ECFA 1YTVA 5DEXA 4OMBA 1M5DA 2ESNA 2F7CA 2OWSA 1BTJA 2Y7RA 5J1DA 2Q8JA 3S9LC 4WKMA 4OQOA 1JEUA 2HZLA 3A09A 4GIZA 4IB2A 4KCDA 1MXXA 4OXVA 3G3FA 2M8CA 3K00A 4MH5A 3M3KA 4OETA 1MPBA 3E3KA 1IIWA 1SBPA 2Q9TA 3LSXA 2DYXA 1VSOA 2Y7IA 3C32A 4M4GA 5AA2B 3FXQA 2Y7KA 2XXUA 3MJNA 3MUQA 3PU5A 4YU0A 4U2RA 3TFLA 1B3LA 4DXCA 1SW4A 2VD2A 2B3FA 2QS2A 4PFWA 5JK4A 1DPPA 3W9WA 4H65A 1II5A 3WAEA 4ZEDA 4RK9A 4ZZAA 3UP9A 4C1TA 4EF1A 4U4SA 5H8HA 1MQHA 4NF5A 4LZ7A 1XS5A 1QKAA 2ZMBA 4RK2A 2NUVA 3K6WA 5L9OA 3PUZE 5DVFA 3ILUB 4KHZE 3H6UA 2A5TA 3RT6B 1MQGA 1QVSA 4KD5A 1QKBA 2PT1A 4NF6A 1S50A 2V3QA 1MY2A 2GFEA 5DVJA 3CFXA 3VLWA 5CM6A 1KWHA 2ZYNA 5TPAA 1B58A 4THIA 4NF4A 3DELB 4WEDA 3T93B 4MLVA 4Z7EA 3MPLA 4JWXA 3BFTA 4YICA 2I6EA 4U23A 1OLAA 2OCUA 1NFTA 3DP6A 1SW2A 2F78A 3OELA 2Y7WA 1QUKA 3OSQA 4YKJA 4MLQA 5EYFA 1MY4A 1OQHA 3IR1A 3K1NA 1MM7A 2RC8A 3QK6A 4KQPA 3TCGA 3L6HA 4RJZA 3TMGA 4BDRA 5AA2A 1N84A 2F36A 3JYRA 3MVYA 3VVEA 2O7UA 3OXNA 1B52A 4WXJA 3I6VA 2H25A 1B51A 5I56A 3K02A 4KCCA 1IXHA 3HCQA 3KSJA 1UQWA 4FEBA 4H67A 1UTBA 4H8JA 2O51A 2QSXA 3C31A 3GZGA 4GF8A 5F1QA 5H8FB 2DOJA 3S2VA 2YJPA 5AA4A 2X7QA 4NF8B 5B70A 5CBSA 3TCHA 3IOUA 5CMCA 3O6HA 3FZVA 4IO3A 5ISUA 4LVQA 4WEPA 4EQ7A 2RC7A 1NH8A 2IEEA 1FTOA 1RKMA 3B6TA 3FASA 3OMBA 4H6DA 3TYHA 4ZECA 3IOWA 1XVXA 5K2YA 2Z8DA 1PBQA 2A5SA 3PPPA 1ANFA 3OSRA 3O2AA 3CIJA 1XVYA 2RCAA 2XXVA 1MPDA 1MQDA 1Y1MA 4LP2B 2Z8FA 1Q35A 2HCAA 4QRZA 2XXXA 1JEVA 5KCJB 3UA8A 1NMUA 4YB7A 3KEIA 1B05A 4PETA 4EXKA 1NNPA 5TP9A 2VOZA 3LR1A 2H4IA 5A5XB 1Y4CA 2FA7A 3TQLA 1LBCA 1MXUA 3K6VA 4H5FA 4BDNA 4N6PA 1N3XA 1PB8A 5ELVA 2DXRA 4K3FA 4XIGQ 1MXVA 1QJMA 5KDTB 1I6AA 4Z0IA 4BDMA 2ZNTA 4X1BA 1N7XA 2DS9A 5I56B 3D4CA 1CB6A 1B4ZA 1MXZA 2F97A 3FXRA 4OHNA 5TU0A 5CMKA 1MY1A 2XXHA 5H8QB 4G8NA 4F2QA 2A5TB 4YB5A 4GVOA 1US4A 1B0HA 1D9VA 1B5IA 2O1MA 3H03A 4YKIA 1FQEA 4PQJA 4DCYA 4NF5B 4E0WA 4LZ8A 3B6WA 2DVCA 1B7ZA 3LSWA 3FVGA 3C9HA 3EQ1A 1GVCA 4FECA 4C1UA 1JW4A 4ELOA 1B4HA 4X9TA 4ZEFA 1MDP1 5K2XA 4H8IA 4FAJA 4MFIA 4QSEA 4F3GA 4R73A 3K0VA 1B3FA 3T9UA 5L9MA 3RGYA 1IZ1A 3FJMA 3VE1B 1ELJA 3Q29A 1SI1A 3CG1A 3FUZA 2UVGA 3K01A 1QUIA 3R6UA 2YLNA 1LAXA 3ONMA 4O3BA 3M8UA 5H8QA 2FNCA 4TQUQ 3V5AA 4P0IA 3TUSA 3FV1A 1VE4A 4OENA 1A40A 3H3GA 4F19A 1B3GA 1Y3PA 2HEUA 2I49A 3F11A 3QIMA 3ZKLA 4F18A 3B6QA 1TFAA 2DWHA 2PX1A 5H8HB 1TXFA 3MVXA 4F3BA 2OK2A 3N26A 1B3HA 4R72A 3VVFA 3GBAA 3P7IA 1PEBA 3PUXE 2NXOA 4FATA 3KN3A 3O6GA 1LB8A 3HV1A 1QUJA 4G68C 4NWCA 1S7YA 4MF3A 5DTBA 4ZEIA 1I69A 3ECRA 3RN8A 4EF2A 1NNKA 1SDXA 2AIXA 3SETA 1PDAA 5LOMA 2HFBA 5AA3A 2NOOA 1FQFA 5I2KB 2RC9A 4FJPA 1RYXA 1P99A 4LQ5A 1O64A 1M5CA 4TLLB 3SEXA 2ANJA 4OZ9A 5L9SA 1P1QA 3E13X 2UYFA 1TT1A 1JNFA 4QSDA 2Q88A 3K1PA 3Q25A 3BFUA 1LFHA 3K1MA 4TOZA 1M5EA 3TZAA 4ZE9A 1N7WA 4YAHX 2PMSA 4BLAA 2REJA 1FTKA 2ALUA 3SDFA 3V8XB 4MBPA 4G77A 3PGFA 1NH7A 3CVGA 3C35A 4AB5A 4F2OA 1MDQA 2ONSA 1M5BA 2UVIA 4X1DA 4QHQA 4ZE8A 5DVIA 3T9XB 1LLSA 3C4MA 4R6YA 2F34A 3SERA 2I3WA 1BP5A 4FIMA 1SYIA 3G3JA 4JWOA 3HHGA 4F39A 2R71A 2RCBA 3EHSA 2QMWA 3HPIA 1DSNA 4F1UA 2DWIA 3FVKA 2HZKA 3PD9A 3K6XA 4U1ZA 1LAFE 3TTNA 5I59A 3FIRA 3S9MC 4JWYA 1F9BA 1M5FA 1FQAA 3I3VA 3TQWA 4ESXA 2O68A 1P1UA 3C34A 3MZ1A 1IXCA 1LSTA 2PYYA 3GBBA 2HQ0A 5L8DA 4RPOA 3G3IA 4HCYA 2REGA 2V84A 1AL3A 1I6BA 1WVJA 2O1LA 1A7LA 3H6WA 3IJOB 4EXLA 4OVJA 3TTMA 1WDNA 3QSLA 4LQ2A 3KJTA 4DIGA 4H0WA 1MH3A 4R2FA 2O7IA 1MY3A 2XX7A 2F6PA 2F7BA 3IL1B 4NF6B 2NWJA 2QS4A 4R9GA 3W9VA 4IGTA 1DOTA 1PB7A 2DE3A 1N04A 1VFEA 1B5JA 4I62A 4PE5B 2UYEA 4M1VA 5FTIA 2PBWA 4Q0CA 1LFGA 1P1NA 4OFOA 3FVOA 1GGGA 3LBSA 2QS1A 4FEDA 4I9DA 1UTHB 2XXQA 4NWDA 3VV5A 1FTJA 2H5YA 2RF1A 4ISUA 4G4PA 1MY0A 4XKQA 2ZNSA 5I84A 1OLCA 3M3LA 3Q28A 1VFDA 4LONB 3MPKA 1D3KA 3C33A 4QFPA 3G7WA 2V3TA 2OJTA 3H06B 2ZYKA 3VFJA 3RTWB 1MPCA 4JXIA 3TTRA 1ZJLA 2I48A 1FW0A 3CG3A 2BJJX 4OERA 3SKPA 5HBCA 3IOVA 4PFUA 3D4GA 4GFRA 4JB7A 3TAJA 2ZNUA 4E0XA 1I6QA 3UGWA 4Q5TA 5FHMA 5CRYA 4QF9A 3BKIB 1DTGA 1USYE 2F7AA 1GR2A 2F6GA 4HCWA 4DXBA 2OBGA 4YB6A 3RTFB 4KYDA 3KN7A 1SW1A 3VXCA 4IO5A 2QL3A 3KOSA 4ZDMA 4G2ZA 3UN6A 3T22A 2DP8A 2I3VA 2ZYOA 4GOTA 4P11A 3MP6A 1J1NA 5I2NB 2FYIA 1JW5A 3FXUA 3U72A 1PB9A 1IEJA 3SEYA 2QMXA 5ICTA 2CZLA 2UVJA 1LCFA 3SEVA 3OO9A 4U1OA 3S4UA 1US5A 3O9PA 1OVBA 4LA9A 3TPAA 4UACA 1BIYA 1NKXA 2Z23A 3MZ9A 5KDTA 3Q27A 1B40A 3OO6A 2V3UA 4DXUA 3KBRA 2KLFA 3PMVA 1OMPA 4O3CA 1GV8A 1UIUA 1URSA 5IAIA 1Y4TA 3LUYA 1UIVA 3IJXB 3PPQA 3PPRA 1PC3A 2XXRA 1AH5A 5KCJA 2O69A 1H3DA 1A8EA 3RPWA 5H8NB 4ONYA 2VGQA 2XXWA 2QS3A 3CFLA 3FGSA 2R6GE 5I2KA 1DTZA 5I58A 2NVUB 2XX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O97 A;  1XC1 A;  3KJ7 A;  3OO7 A;  4JSD A;  4DE8 A;  4KI0 E;  2P1S A;  4GXS B;  1JVY A;  4R74 A;  1BKA A;  4ZEB A;  3T9H B;  3UIF A;  3PMW A;  1Q1K A;  2I0B A;  4AQ4 A;  2QJE A;  2G93 A;  1PBP A;  2D5W A;  3HHF A;  3QYT A;  4N13 A;  3ZSF A;  1HSE A;  4DZ1 A;  4ZZE A;  5JTY A;  3SES A;  3O6I A;  1Y9U A;  3DP4 A;  3OEM A;  3PV0 E;  4GWO A;  3ZS6 A;  5AE4 A;  4DDD A;  3M3F A;  3EF7 A;  4NF8 A;  5FTH A;  4YMB A;  5AA4 B;  3IOT A;  4DLD A;  1FTL A;  2D3I A;  1HSL A;  5CBR A;  1EZ9 A;  4OFL A;  3U92 A;  1EU8 A;  1R1N A;  2HAU A;  3KOT A;  4G8H A;  1WOD A;  3CFZ A;  3JZJ A;  5H8F A;  1AMF A;  5H8S A;  3TOD A;  1B1X A;  2X26 A;  4H1X A;  4QFN A;  2H99 A;  3JV9 A;  1EZO A;  2VHA A;  2ZXT A;  1YAE A;  1IQ7 A;  1MS7 A;  1TWY A;  3SEU A;  5HPQ A;  5ICQ A;  5ITO A;  4U22 A;  1LCT A;  5I57 A;  2IA4 A;  2V93 A;  4IO7 A;  4LZ5 A;  3USD A;  4TLM B;  1AOV A;  1URD A;  1NNT A;  3IO4 A;  2O84 X;  4GXA A;  4QSC A;  3RY3 A;  4RXL A;  1ZTY A;  3QUJ A;  3EPE A;  3MP1 A;  4R6K A;  4RY1 A;  4KR5 A;  4OYV A;  4KYE A;  2O6A A;  1DMB A;  1LAH E;  4NF4 B;  1TFD A;  1EZP A;  3PPO A;  4F31 B;  3QAX A;  5F7V A;  1NL5 A;  1ZU0 A;  4BDQ A;  3PUV E;  4ELQ A;  2H9B A;  3LSL A;  1MH4 A;  3EN3 A;  3R26 A;  4BDO A;  2XD3 A;  3N6U A;  1USY H;  4DCX A;  3K4U A;  4KYS A;  3S9N C;  3MP8 A;  3QXM A;  2V25 A;  1LGB C;  2Y84 A;  3MQ9 A;  1JQF A;  4ND9 A;  4QFL A;  5BWJ A;  1SD3 A;  4O3A A;  4OFJ A;  2W7Y A;  3ODB A;  2ZYM A;  3CR9 A;  3PPN A;  2H98 A;  2XXY A;  3FJ7 A;  3MW0 A;  2P0S A;  1MM6 A;  1L5T A;  3RUM A;  1UTH A;  4RPN A;  3KSX A;  1D9Y A;  1FCK A;  1XHY A;  4C0R A;  4F1V A;  1A54 A;  3GXA A;  1XT8 A;  3IB1 A;  2DSF A;  4IY6 A;  2AL5 A;  2GRV A;  3MVW A;  4YZZ A;  1R9Q A;  1URG A;  5EHM A;  4ZS9 A;  1SYH A;  1MXW A;  3ILT B;  4OES A;  3C36 A;  3KZG A;  1IXI A;  1POY 1;  4P0G A;  5IKB A;  2G29 A;  5AA2 D;  5ITP A;  1H76 A;  2ONR A;  5I58 B;  2Q89 A;  5DT6 A;  1IUD A;  4EQB A;  4OWD A;  3TTL A;  3I5O A;  1GTK A;  5H8N A;  1ZMG A;  4POW A;  1SVX B;  3W15 C;  4RNS A;  5DEX B;  1N0T A;  4PFY A;  2YPN A;  3UOR A;  3PUY E;  1P1W A;  1LBB A;  4EDP A;  1IIT A;  1OQG A;  4XKN A;  4NED A;  5DYH A;  4G68 A;  3AXF A;  4L17 A;  4QFK A;  4BDL A;  3SEW A;  5I59 B;  2UXA A;  4U4X A;  1B5H A;  1UTB B;  2D21 A;  5JEI A;  5CMM A;  4NMY A;  4Q8R A;  3L6G A;  4KPT A;  1O63 A;  4R9F A;  4R6H A;  5M2V A;  3A3U A;  3G3G A;  3UK4 A;  1FTM A;  3V89 B;  4YKK A;  5B7D A;  1H43 A;  2AYS A;  4N07 A;  4X48 A;  2QPQ A;  4OEV A;  3EHT A;  5FHO A;  2OZZ A;  2P2A A;  1R9L A;  1ZIU A;  3O28 A;  4FE8 A;  2CMO A;  2XXP A;  4FOR A;  3BBR A;  2DE2 A;  1B6H A;  4LUB A;  3RQT A;  5HM4 B;  3K2D A;  4F1Y A;  1FQD A;  3U94 A;  1Y1Z A;  2X7P A;  3LC8 A;  3S9E A;  4I8C A;  4XKR A;  1Y20 A;  2XXT A;  2Y7P A;  3O66 A;  1NNF A;  3FJG A;  2I0C A;  1B7H A;  3DM0 A;  4NE4 A;  4F22 A;  4F3P A;  1POT A;  4IO4 A;  3HST A;  2AL4 A;  3CI8 A;  3IX1 A;  3H6V A;  1ATG A;  3FVN A;  5EHS A;  2Q2A A;  4G8M A;  1JVX A;  2I4B A;  3IB2 A;  3IAZ A;  4Q30 B;  5KZT A;  4H5G A;  3T96 B;  3MBP A;  3WAF A;  3Q26 A;  3RT8 A;  3U8Q A;  3RLF E;  2DWA A;  3G3H A;  3TEL A;  3U1O A;  5I2N A;  3FV2 A;  1SQY A;  1B7U A;  1VR5 A;  1ZBM A;  4IO2 A;  1JW1 A;  1S9T A;  3U93 A;  2HXW A;  1SI0 A;  2ABH A;  1B46 A;  4UA8 A;  1YPN A;  3V83 A;  1B0L A;  4G68 B;  3VDF A;  1T0K A;  3O29 A;  2I4C A;  3H6T A;  2QRY A;  2R9J A;  2VP1 A;  4GD5 A;  5TP9 B;  5A5X A;  2XD2 A;  1ZLQ A;  2OLB A;  1A8F A;  1R6Z A;  3TEP A;  3PD8 A;  1LB9 A;  1N76 A;  4PP0 A;  5I57 B;  4NTL A;  3OO8 A;  4HTG A;  3T9V A;  1DPE A;  1Z7M E;  3CRB A;  1MQI A;  4ZEK A;  1H44 A;  3KN8 A;  2Q2C A;  1MRP A;  1SW5 A;  2XXI A;  3GLB A;  1B1H A;  1HSJ A;  2VD3 A;  4OTE A;  1OVT A;  4PFT A;  4F29 A;  2DQV A;  2LAO A;  4R75 A;  3VLV A;  4RYA A;  1RYO A;  3N5L A;  3G3K A;  4GL8 A;  3K6U A;  1BLF A;  4R2B A;  1IXG A;  4ELR A;  3OEK A;  2DE4 A;  1P1O A;  3B7D A;  2DWJ A;  1QUL A;  3QUF A;  3CSG A;  4IGR A;  2GHA A;  4IY5 A;  1FQB A;  1B9J A;  1B2H A;  4EUO A;  2E0S A;  3A3C A;  2UVH A;  1CE2 A;  1JET A;  2GH9 A;  2XHD A;  1YCJ A;  3FAT A;  2PT2 A;  5FHN A;  3TKD A;  2OWT A;  2PVU A;  3LSF B;  3VLU A;  4HW8 A;  1A99 A;  3DLN A;  5CI5 A;  4OEU A;  3E4R A;  3IO6 A;  1MQJ A;  3IB0 A;  1MXY A;  1H45 A;  3KG2 A;  3OOA A;  4U21 A;  4XKP A;  3DP8 A;  4HS7 A;  3IK6 B;  1D4N A;  3OEN A;  3TCF A;  3E9X A;  1N3W A;  2DXY A;  1LAG E;  3MC2 A;  1XOC A;  4AB6 A;  4GQO A;  4RA1 A;  3OD7 A;  4GRK A;  3R7X A;  1Y3N A;  4ELP A;  1LFI A;  3RNN A;  2DVZ A;  2Z22 A;  3KGC A;  2I58 A;  5BUU A;  3HN0 A;  1Y3Q A;  2B65 A;  4GLI A;  3TTK A;  3TDJ A;  3CSB A;  2B3B A;  4XTC Q;  4ESW A;  1QW0 A;  5TPA B;  1Z7N E;  2F5X A;  4JSO A;  4YKP A;  4F3S A;  3HO7 A;  1OIB A;  3H7M A;  3THI A;  1AIV A;  1FQC A;  3FD3 A;  3PMX A;  4YMA A;  2HAV A;  3T66 A;  1EH3 A;  2Z8E A;  3KFM A;  4IO6 A;  4EQ9 A;  5CC2 A;  4POX A;  2F35 A;  3H4Z A;  4GL0 A;  3MWB A;  1A55 A;  2XX8 A;  3ZKK A;  3N94 A;  4LAT A;  4XXU A;  1MG1 A;  1B32 A;  2RKM A;  2E1S A;  3MZB A;  3VXB A;  4JDF A;  3PUW E;  2F8D A;  1O7T A;  4JBZ A;  3IOR A;  2GHB A;  2THI A;  3N6T A;  4QFO A;  2RIN A;  4KFQ A;  5AA1 A;  3VVD A;  3MVZ A;  5JTY B;  5CMB A;  1ZKB A;  4I1D A;  1B3E A;  3EHU A;  2ONK E;  3MAM A;  2WKY A;  4ECF A;  1YTV A;  5DEX A;  4OMB A;  1M5D A;  2ESN A;  2F7C A;  2OWS A;  1BTJ A;  2Y7R A;  5J1D A;  2Q8J A;  3S9L C;  4WKM A;  4OQO A;  1JEU A;  2HZL A;  3A09 A;  4GIZ A;  4IB2 A;  4KCD A;  1MXX A;  4OXV A;  3G3F A;  2M8C A;  3K00 A;  4MH5 A;  3M3K A;  4OET A;  1MPB A;  3E3K A;  1IIW A;  1SBP A;  2Q9T A;  3LSX A;  2DYX A;  1VSO A;  2Y7I A;  3C32 A;  4M4G A;  5AA2 B;  3FXQ A;  2Y7K A;  2XXU A;  3MJN A;  3MUQ A;  3PU5 A;  4YU0 A;  4U2R A;  3TFL A;  1B3L A;  4DXC A;  1SW4 A;  2VD2 A;  2B3F A;  2QS2 A;  4PFW A;  5JK4 A;  1DPP A;  3W9W A;  4H65 A;  1II5 A;  3WAE A;  4ZED A;  4RK9 A;  4ZZA A;  3UP9 A;  4C1T A;  4EF1 A;  4U4S A;  5H8H A;  1MQH A;  4NF5 A;  4LZ7 A;  1XS5 A;  1QKA A;  2ZMB A;  4RK2 A;  2NUV A;  3K6W A;  5L9O A;  3PUZ E;  5DVF A;  3ILU B;  4KHZ E;  3H6U A;  2A5T A;  3RT6 B;  1MQG A;  1QVS A;  4KD5 A;  1QKB A;  2PT1 A;  4NF6 A;  1S50 A;  2V3Q A;  1MY2 A;  2GFE A;  5DVJ A;  3CFX A;  3VLW A;  5CM6 A;  1KWH A;  2ZYN A;  5TPA A;  1B58 A;  4THI A;  4NF4 A;  3DEL B;  4WED A;  3T93 B;  4MLV A;  4Z7E A;  3MPL A;  4JWX A;  3BFT A;  4YIC A;  2I6E A;  4U23 A;  1OLA A;  2OCU A;  1NFT A;  3DP6 A;  1SW2 A;  2F78 A;  3OEL A;  2Y7W A;  1QUK A;  3OSQ A;  4YKJ A;  4MLQ A;  5EYF A;  1MY4 A;  1OQH A;  3IR1 A;  3K1N A;  1MM7 A;  2RC8 A;  3QK6 A;  4KQP A;  3TCG A;  3L6H A;  4RJZ A;  3TMG A;  4BDR A;  5AA2 A;  1N84 A;  2F36 A;  3JYR A;  3MVY A;  3VVE A;  2O7U A;  3OXN A;  1B52 A;  4WXJ A;  3I6V A;  2H25 A;  1B51 A;  5I56 A;  3K02 A;  4KCC A;  1IXH A;  3HCQ A;  3KSJ A;  1UQW A;  4FEB A;  4H67 A;  1UTB A;  4H8J A;  2O51 A;  2QSX A;  3C31 A;  3GZG A;  4GF8 A;  5F1Q A;  5H8F B;  2DOJ A;  3S2V A;  2YJP A;  5AA4 A;  2X7Q A;  4NF8 B;  5B70 A;  5CBS A;  3TCH A;  3IOU A;  5CMC A;  3O6H A;  3FZV A;  4IO3 A;  5ISU A;  4LVQ A;  4WEP A;  4EQ7 A;  2RC7 A;  1NH8 A;  2IEE A;  1FTO A;  1RKM A;  3B6T A;  3FAS A;  3OMB A;  4H6D A;  3TYH A;  4ZEC A;  3IOW A;  1XVX A;  5K2Y A;  2Z8D A;  1PBQ A;  2A5S A;  3PPP A;  1ANF A;  3OSR A;  3O2A A;  3CIJ A;  1XVY A;  2RCA A;  2XXV A;  1MPD A;  1MQD A;  1Y1M A;  4LP2 B;  2Z8F A;  1Q35 A;  2HCA A;  4QRZ A;  2XXX A;  1JEV A;  5KCJ B;  3UA8 A;  1NMU A;  4YB7 A;  3KEI A;  1B05 A;  4PET A;  4EXK A;  1NNP A;  5TP9 A;  2VOZ A;  3LR1 A;  2H4I A;  5A5X B;  1Y4C A;  2FA7 A;  3TQL A;  1LBC A;  1MXU A;  3K6V A;  4H5F A;  4BDN A;  4N6P A;  1N3X A;  1PB8 A;  5ELV A;  2DXR A;  4K3F A;  4XIG Q;  1MXV A;  1QJM A;  5KDT B;  1I6A A;  4Z0I A;  4BDM A;  2ZNT A;  4X1B A;  1N7X A;  2DS9 A;  5I56 B;  3D4C A;  1CB6 A;  1B4Z A;  1MXZ A;  2F97 A;  3FXR A;  4OHN A;  5TU0 A;  5CMK A;  1MY1 A;  2XXH A;  5H8Q B;  4G8N A;  4F2Q A;  2A5T B;  4YB5 A;  4GVO A;  1US4 A;  1B0H A;  1D9V A;  1B5I A;  2O1M A;  3H03 A;  4YKI A;  1FQE A;  4PQJ A;  4DCY A;  4NF5 B;  4E0W A;  4LZ8 A;  3B6W A;  2DVC A;  1B7Z A;  3LSW A;  3FVG A;  3C9H A;  3EQ1 A;  1GVC A;  4FEC A;  4C1U A;  1JW4 A;  4ELO A;  1B4H A;  4X9T A;  4ZEF A;  1MDP 1;  5K2X A;  4H8I A;  4FAJ A;  4MFI A;  4QSE A;  4F3G A;  4R73 A;  3K0V A;  1B3F A;  3T9U A;  5L9M A;  3RGY A;  1IZ1 A;  3FJM A;  3VE1 B;  1ELJ A;  3Q29 A;  1SI1 A;  3CG1 A;  3FUZ A;  2UVG A;  3K01 A;  1QUI A;  3R6U A;  2YLN A;  1LAX A;  3ONM A;  4O3B A;  3M8U A;  5H8Q A;  2FNC A;  4TQU Q;  3V5A A;  4P0I A;  3TUS A;  3FV1 A;  1VE4 A;  4OEN A;  1A40 A;  3H3G A;  4F19 A;  1B3G A;  1Y3P A;  2HEU A;  2I49 A;  3F11 A;  3QIM A;  3ZKL A;  4F18 A;  3B6Q A;  1TFA A;  2DWH A;  2PX1 A;  5H8H B;  1TXF A;  3MVX A;  4F3B A;  2OK2 A;  3N26 A;  1B3H A;  4R72 A;  3VVF A;  3GBA A;  3P7I A;  1PEB A;  3PUX E;  2NXO A;  4FAT A;  3KN3 A;  3O6G A;  1LB8 A;  3HV1 A;  1QUJ A;  4G68 C;  4NWC A;  1S7Y A;  4MF3 A;  5DTB A;  4ZEI A;  1I69 A;  3ECR A;  3RN8 A;  4EF2 A;  1NNK A;  1SDX A;  2AIX A;  3SET A;  1PDA A;  5LOM A;  2HFB A;  5AA3 A;  2NOO A;  1FQF A;  5I2K B;  2RC9 A;  4FJP A;  1RYX A;  1P99 A;  4LQ5 A;  1O64 A;  1M5C A;  4TLL B;  3SEX A;  2ANJ A;  4OZ9 A;  5L9S A;  1P1Q A;  3E13 X;  2UYF A;  1TT1 A;  1JNF A;  4QSD A;  2Q88 A;  3K1P A;  3Q25 A;  3BFU A;  1LFH A;  3K1M A;  4TOZ A;  1M5E A;  3TZA A;  4ZE9 A;  1N7W A;  4YAH X;  2PMS A;  4BLA A;  2REJ A;  1FTK A;  2ALU A;  3SDF A;  3V8X B;  4MBP A;  4G77 A;  3PGF A;  1NH7 A;  3CVG A;  3C35 A;  4AB5 A;  4F2O A;  1MDQ A;  2ONS A;  1M5B A;  2UVI A;  4X1D A;  4QHQ A;  4ZE8 A;  5DVI A;  3T9X B;  1LLS A;  3C4M A;  4R6Y A;  2F34 A;  3SER A;  2I3W A;  1BP5 A;  4FIM A;  1SYI A;  3G3J A;  4JWO A;  3HHG A;  4F39 A;  2R71 A;  2RCB A;  3EHS A;  2QMW A;  3HPI A;  1DSN A;  4F1U A;  2DWI A;  3FVK A;  2HZK A;  3PD9 A;  3K6X A;  4U1Z A;  1LAF E;  3TTN A;  5I59 A;  3FIR A;  3S9M C;  4JWY A;  1F9B A;  1M5F A;  1FQA A;  3I3V A;  3TQW A;  4ESX A;  2O68 A;  1P1U A;  3C34 A;  3MZ1 A;  1IXC A;  1LST A;  2PYY A;  3GBB A;  2HQ0 A;  5L8D A;  4RPO A;  3G3I A;  4HCY A;  2REG A;  2V84 A;  1AL3 A;  1I6B A;  1WVJ A;  2O1L A;  1A7L A;  3H6W A;  3IJO B;  4EXL A;  4OVJ A;  3TTM A;  1WDN A;  3QSL A;  4LQ2 A;  3KJT A;  4DIG A;  4H0W A;  1MH3 A;  4R2F A;  2O7I A;  1MY3 A;  2XX7 A;  2F6P A;  2F7B A;  3IL1 B;  4NF6 B;  2NWJ A;  2QS4 A;  4R9G A;  3W9V A;  4IGT A;  1DOT A;  1PB7 A;  2DE3 A;  1N04 A;  1VFE A;  1B5J A;  4I62 A;  4PE5 B;  2UYE A;  4M1V A;  5FTI A;  2PBW A;  4Q0C A;  1LFG A;  1P1N A;  4OFO A;  3FVO A;  1GGG A;  3LBS A;  2QS1 A;  4FED A;  4I9D A;  1UTH B;  2XXQ A;  4NWD A;  3VV5 A;  1FTJ A;  2H5Y A;  2RF1 A;  4ISU A;  4G4P A;  1MY0 A;  4XKQ A;  2ZNS A;  5I84 A;  1OLC A;  3M3L A;  3Q28 A;  1VFD A;  4LON B;  3MPK A;  1D3K A;  3C33 A;  4QFP A;  3G7W A;  2V3T A;  2OJT A;  3H06 B;  2ZYK A;  3VFJ A;  3RTW B;  1MPC A;  4JXI A;  3TTR A;  1ZJL A;  2I48 A;  1FW0 A;  3CG3 A;  2BJJ X;  4OER A;  3SKP A;  5HBC A;  3IOV A;  4PFU A;  3D4G A;  4GFR A;  4JB7 A;  3TAJ A;  2ZNU A;  4E0X A;  1I6Q A;  3UGW A;  4Q5T A;  5FHM A;  5CRY A;  4QF9 A;  3BKI B;  1DTG A;  1USY E;  2F7A A;  1GR2 A;  2F6G A;  4HCW A;  4DXB A;  2OBG A;  4YB6 A;  3RTF B;  4KYD A;  3KN7 A;  1SW1 A;  3VXC A;  4IO5 A;  2QL3 A;  3KOS A;  4ZDM A;  4G2Z A;  3UN6 A;  3T22 A;  2DP8 A;  2I3V A;  2ZYO A;  4GOT A;  4P11 A;  3MP6 A;  1J1N A;  5I2N B;  2FYI A;  1JW5 A;  3FXU A;  3U72 A;  1PB9 A;  1IEJ A;  3SEY A;  2QMX A;  5ICT A;  2CZL A;  2UVJ A;  1LCF A;  3SEV A;  3OO9 A;  4U1O A;  3S4U A;  1US5 A;  3O9P A;  1OVB A;  4LA9 A;  3TPA A;  4UAC A;  1BIY A;  1NKX A;  2Z23 A;  3MZ9 A;  5KDT A;  3Q27 A;  1B40 A;  3OO6 A;  2V3U A;  4DXU A;  3KBR A;  2KLF A;  3PMV A;  1OMP A;  4O3C A;  1GV8 A;  1UIU A;  1URS A;  5IAI A;  1Y4T A;  3LUY A;  1UIV A;  3IJX B;  3PPQ A;  3PPR A;  1PC3 A;  2XXR A;  1AH5 A;  5KCJ A;  2O69 A;  1H3D A;  1A8E A;  3RPW A;  5H8N B;  4ONY A;  2VGQ A;  2XXW A;  2QS3 A;  3CFL A;  3FGS A;  2R6G E;  5I2K A;  1DTZ A;  5I58 A;  2NVU B;  2XX9 A; 
#chains in the Genus database with same CATH topology
 1IMF A;  1XC1 A;  4DE8 A;  4JSD A;  1FBC A;  4GXS B;  2QJE A;  3HHF A;  1Y9U A;  4MNI A;  4DLD A;  2D3I A;  1HSL A;  3KOT A;  2HAU A;  3CFZ A;  4QXD A;  3JV9 A;  4U22 A;  2IA4 A;  2V93 A;  4TLM B;  1URD A;  3QUJ A;  3CHG A;  4KYE A;  4NF4 B;  4NN3 A;  1LAH E;  3PPO A;  4F31 B;  5F7V A;  1NL5 A;  3PUV E;  4NHB A;  1Q9D A;  1MH4 A;  3EN3 A;  2XD3 A;  3K4U A;  2Y84 A;  3MQ9 A;  2W7Y A;  3U72 A;  3RUM A;  3T0J A;  3KSX A;  1FCK A;  4C0R A;  3IB1 A;  2CEY A;  1R9Q A;  1SYH A;  1MXW A;  5IKB A;  1QGX A;  5AA2 D;  5ITP A;  1NV1 A;  2Q89 A;  3TTL A;  3I5O A;  3UOR A;  2CZI A;  4NED A;  5DYH A;  4G68 A;  1DBZ A;  4NMY A;  4R9F A;  4R6H A;  5M2V A;  4N07 A;  4MEV A;  5FHO A;  3B8B A;  2CMO A;  3K2D A;  4X8R A;  1FQD A;  1FPL A;  1Y1Z A;  2X7P A;  3LC8 A;  4F3P A;  4NE4 A;  1INP A;  2OWZ A;  1ATG A;  5EHS A;  2Q2A A;  4G8M A;  2I4B A;  4N17 A;  4Q30 B;  3T96 B;  3Q26 A;  1SQY A;  1B0L A;  3VDF A;  3O29 A;  3H6T A;  2QRY A;  1A8F A;  3PD8 A;  1FPK A;  2XXK A;  3T9V A;  2OX3 A;  4FBP A;  2XXI A;  4PF6 A;  3RYD A;  2VD3 A;  4OTE A;  4PFT A;  5IM2 A;  1IXG A;  2DE4 A;  1P1O A;  1QUL A;  2E0S A;  1CE2 A;  2GH9 A;  4PFI A;  1YCJ A;  5FHN A;  2PVU A;  3IO6 A;  1MQJ A;  4H46 A;  1FSA A;  2F3B A;  4U21 A;  4HS7 A;  1D4N A;  3TCF A;  2DXY A;  4OA4 A;  1LAG E;  4RA1 A;  3R7X A;  1Y3N A;  1IMD A;  4P8B A;  2F3D A;  3KGC A;  3HN0 A;  1Y3Q A;  3TTK A;  1QW0 A;  4JSO A;  1RDY A;  2XWV A;  3FD3 A;  4GWS A;  4HE0 A;  2F35 A;  3H4Z A;  4GWU A;  1B32 A;  2F8D A;  5AA1 A;  4ECF A;  5DEX A;  1M5D A;  2OWS A;  2Y7R A;  4OXV A;  3U65 A;  1FBG A;  4MJO A;  2M8C A;  4MH5 A;  3THI A;  3LSX A;  4M4G A;  1MPB A;  3FXQ A;  2XXU A;  2B3F A;  1II5 A;  4RK9 A;  4C1T A;  3K6W A;  3PUZ E;  5DVF A;  4KHZ E;  1MQG A;  1QVS A;  4KD5 A;  2GFE A;  3VLW A;  1FJ9 A;  1B58 A;  1DCU A;  4NF4 A;  3DEL B;  4MLV A;  3MPL A;  4YIC A;  1NFT A;  3DP6 A;  2RC8 A;  1RDZ A;  5AA2 A;  4OVR A;  2F36 A;  3OXN A;  1B52 A;  3I6V A;  4PCD A;  4H67 A;  3FXB A;  2O51 A;  3C31 A;  3GZG A;  3S2V A;  2YJP A;  5CBS A;  3IOU A;  3O6H A;  3OMB A;  4H6D A;  1KA0 A;  4N8G A;  2A5S A;  1ANF A;  3CIJ A;  1XVY A;  2RCA A;  2Y5L A;  1Y1M A;  2FIX A;  3UA8 A;  4YB7 A;  4EXK A;  1B05 A;  5TP9 A;  3LR1 A;  2FA7 A;  1LBC A;  4H5F A;  4BDN A;  1N3X A;  1MXV A;  5KDT B;  2WYP A;  2ZNT A;  4BDM A;  2DS9 A;  3D4C A;  1B4Z A;  2F97 A;  5CMK A;  1US4 A;  1B0H A;  4JVC A;  2DVC A;  1B7Z A;  4ELO A;  4X9T A;  4PFB A;  5K2X A;  4FAJ A;  4F3G A;  3T9U A;  4DI3 D;  3FJM A;  3VE1 B;  2XWO A;  1SI1 A;  3CG1 A;  2UVG A;  1LEV A;  4Z7E A;  2FNC A;  4TQU Q;  3V5A A;  1VE4 A;  4OEN A;  3F11 A;  2I49 A;  4F3B A;  1B3H A;  4O7I A;  2NXO A;  4NWC A;  1S7Y A;  4MF3 A;  2DDK A;  1NNK A;  3SET A;  4AS4 A;  4LQ5 A;  1O64 A;  5L9S A;  5IZ3 A;  1LFH A;  4BLA A;  5IGA A;  1NV5 A;  3PGF A;  1MDQ A;  3SER A;  2I3W A;  1SYI A;  4F39 A;  3HPI A;  1DSN A;  2Q8M A;  3S9M C;  3TTN A;  3FIR A;  1F9B A;  4ESX A;  1P1U A;  2O1L A;  4LQ2 A;  2XX7 A;  1DOT A;  4MX6 A;  4I62 A;  2WEF A;  1P1N A;  4NWD A;  1FTJ A;  4ISU A;  4NX1 A;  1OLC A;  3Q28 A;  3C33 A;  2V3T A;  3H06 B;  3VFJ A;  3CG3 A;  2B4L A;  5HBC A;  4PFU A;  4JB7 A;  3UGW A;  2F7A A;  4YB6 A;  3RTF B;  4KYD A;  3VXC A;  2QL3 A;  4ZDM A;  2ZYO A;  1J1N A;  2FYI A;  1JW5 A;  1IEJ A;  2FVZ A;  4U1O A;  3TPA A;  1NKX A;  4HE2 A;  1OMP A;  1GV8 A;  4GBV A;  3LUY A;  3PPR A;  3RPW A;  4ONY A;  5I2K A;  3HO7 A;  4X1B A;  1DTZ A;  2HHM A;  2XX9 A;  3KJ7 A;  4KI0 E;  4R74 A;  3T9H B;  1BKA A;  3PMW A;  2I0B A;  4AQ4 A;  2G93 A;  3BIG A;  5JTY A;  1EYK A;  3ZSF A;  4N91 A;  4ZZE A;  4XEQ A;  4DDD A;  3M3F A;  4NF8 A;  1FTL A;  5CBR A;  3U92 A;  1R1N A;  5H8S A;  3TOD A;  4QFN A;  4X04 A;  4G61 A;  1YAE A;  1IQ7 A;  2WYK A;  1TWY A;  5HPQ A;  4I40 A;  1LCT A;  5I57 A;  4IO7 A;  3D1R A;  2O84 X;  3RY3 A;  4RXL A;  1ZTY A;  3EPE A;  4R6K A;  4RY1 A;  5I7I A;  4KR5 A;  4OYV A;  2O6A A;  4ELQ A;  4BDQ A;  1ZU0 A;  5LTC A;  3LSL A;  3N6U A;  1USY H;  4DCX A;  3S9N C;  4QFL A;  4PE3 A;  4HE1 A;  4O3A A;  3ODB A;  3PPN A;  1A54 A;  4YZZ A;  5EHM A;  4I3E A;  4P0G A;  1IXI A;  2G29 A;  5DT6 A;  1IUD A;  1ZMG A;  4POW A;  5DEX B;  2YPN A;  3ROJ A;  1LBB A;  4EDP A;  3PTY A;  4XKN A;  4PF8 A;  5I59 B;  2UXA A;  5CMM A;  1DK4 A;  2FHY A;  4KPT A;  2AYS A;  2OZZ A;  1ZIU A;  3O28 A;  2XXP A;  4FOR A;  3RQT A;  3S9E A;  4DZ1 A;  1B7H A;  3DM0 A;  1G0I A;  1POT A;  4IO4 A;  3CI8 A;  1JVX A;  5KZT A;  3MBP A;  1NUZ A;  1FBH A;  3U8Q A;  3U1O A;  2MKZ A;  4IO2 A;  3U93 A;  3V83 A;  4G68 B;  5EQA A;  2R9J A;  2VP1 A;  2OLB A;  1R6Z A;  4N6K A;  1N76 A;  4HTG A;  1DPE A;  3CRB A;  4ZEK A;  1SW5 A;  3GLB A;  1B1H A;  4F29 A;  2LAO A;  1RYO A;  3N5L A;  4GL8 A;  4R2B A;  3B7D A;  3CSG A;  4EUO A;  3TKD A;  2XHD A;  2OWT A;  3LSF B;  4HW8 A;  1A99 A;  5CI5 A;  2CEX A;  1H45 A;  4XKP A;  3OEN A;  1N3W A;  1XOC A;  3OD7 A;  4GRK A;  4ELP A;  1LBX A;  1LFI A;  2DVZ A;  2Z22 A;  5BUU A;  4GLI A;  4ESW A;  5TPA B;  4YKP A;  1FBF A;  3H7M A;  1AIV A;  2B4M A;  3T66 A;  3KFM A;  4POX A;  2PCR A;  3ZKK A;  3N94 A;  4LAT A;  2RKM A;  2E1S A;  4JDF A;  3MYU A;  3PUW E;  3IOR A;  4QFO A;  4GX4 A;  2XA5 A;  5JTY B;  1ZKB A;  3EHU A;  2ONK E;  4OMB A;  2F7C A;  1BTJ A;  4WKM A;  5DW8 A;  3A09 A;  4KCD A;  3K00 A;  4OET A;  3E3K A;  2Y7I A;  3C32 A;  5AA2 B;  2Y7K A;  4YU0 A;  4DXC A;  1B3L A;  1SW4 A;  2QFL A;  4ZZA A;  1MQH A;  1XS5 A;  2ZMB A;  2NUV A;  3H6U A;  1QKB A;  2VPN A;  1S50 A;  1MY2 A;  3CFX A;  4P3L A;  2ZYN A;  4WED A;  3T93 B;  2I6E A;  2F78 A;  2Y7W A;  1QUK A;  2XWI A;  3TCG A;  3IR1 A;  3QK6 A;  4KQP A;  4BDR A;  1N84 A;  3MVY A;  3VVE A;  2H25 A;  5AA4 A;  2X7Q A;  3TCH A;  1NV3 A;  5CMC A;  3FZV A;  4IO3 A;  5ISU A;  2RC7 A;  3FAS A;  1RKM A;  3IOW A;  1XVX A;  1PBQ A;  3OSR A;  2XXV A;  1MPD A;  2Z8F A;  2HCA A;  5I3S A;  1NMU A;  4PET A;  3TQL A;  1PB8 A;  2DXR A;  4K3F A;  1QJM A;  4Z0I A;  1MXZ A;  4G8N A;  4F2Q A;  4GVO A;  2O1M A;  4YKI A;  1FQE A;  4DCY A;  4E0W A;  3FVG A;  3C9H A;  3EQ1 A;  4C1U A;  1B4H A;  4ZEF A;  1BK4 A;  5L9M A;  3RGY A;  1IZ1 A;  1ELJ A;  3FUZ A;  3K01 A;  3TAJ A;  3R6U A;  2YLN A;  4O3B A;  5H8Q A;  3M8U A;  4P0I A;  3FV1 A;  1LBY A;  1FPB A;  3H3G A;  1B3G A;  2HEU A;  3RPL A;  2CZK A;  2PX1 A;  4PC9 A;  1TXF A;  4R72 A;  4PDH A;  3P7I A;  1PEB A;  2GQ1 A;  3KN3 A;  1LB8 A;  4G68 C;  1I69 A;  3ECR A;  5ET8 A;  3RN8 A;  4EF2 A;  1SDX A;  1PDA A;  5LOM A;  2NOO A;  2RC9 A;  4FJP A;  1RYX A;  1P99 A;  2ANJ A;  3E13 X;  1JNF A;  4O8M A;  4TOZ A;  1M5E A;  1N7W A;  4YAH X;  1FTK A;  4G77 A;  2ONS A;  4ZE8 A;  1LLS A;  1BP5 A;  4FIM A;  4JWO A;  4OVQ A;  2DWI A;  1LAF E;  2ZZX A;  2PYY A;  2HQ0 A;  2CZH A;  1I6B A;  1WVJ A;  1A7L A;  3IJO B;  3TTM A;  1WDN A;  3QSL A;  4H0W A;  1MH3 A;  1MY3 A;  2QS4 A;  4R9G A;  1PB7 A;  2DE3 A;  1VFE A;  1NI9 A;  4PE5 B;  5FTI A;  4Q0C A;  1LFG A;  4OFO A;  1GGG A;  4NF0 A;  2Y5K A;  4OAN A;  1LBZ A;  2RF1 A;  5I84 A;  3M3L A;  4LON B;  1D3K A;  3TTR A;  4JXI A;  1FW0 A;  2BJJ X;  5CRY A;  3BKI B;  1DTG A;  4P9K A;  3KOS A;  4N6D A;  3UN6 A;  4P11 A;  4GWX A;  3MP6 A;  3FXU A;  5ICT A;  1LCF A;  3S4U A;  1US5 A;  2QVV A;  3MZ9 A;  3KC0 A;  2HXR A;  3PMV A;  1FJ6 A;  1UIU A;  1UIV A;  3MST A;  3PPQ A;  1PC3 A;  1H3D A;  3A29 A;  5H8N B;  2R6G E;  3B50 A;  4I3Y A;  4AS5 A;  1K9Y A;  3O97 A;  3OO7 A;  2P1S A;  4ZEB A;  4O7M A;  1PBP A;  2D5W A;  3QYT A;  1HSE A;  1YZ0 A;  2WBB A;  3O6I A;  5AE4 A;  5FTH A;  4YMB A;  3IOT A;  4OFL A;  1RDX A;  1EU8 A;  1EZO A;  2X26 A;  2HPG A;  1KZ8 A;  1MS7 A;  1IMB A;  4LZ5 A;  1AOV A;  1NNT A;  4NQ8 A;  4QSC A;  3MP1 A;  1DMB A;  3QAX A;  4BDO A;  3QXM A;  2V25 A;  4ND9 A;  5BWJ A;  1JQF A;  1SD3 A;  4OFJ A;  3EKI A;  2ZYM A;  3CR9 A;  2XXY A;  3FJ7 A;  1L5T A;  4RPN A;  4F1V A;  1XHY A;  3GXA A;  2DSF A;  4ZS9 A;  2GRV A;  1URG A;  2JJK A;  3ILT B;  4OES A;  3KZG A;  2FBP A;  1POY 1;  1H76 A;  1K9Z A;  2ONR A;  4EQB A;  1GTK A;  3W15 C;  4RNS A;  4PFY A;  3PUY E;  1P1W A;  1IIT A;  3AXF A;  4L17 A;  4MHF A;  1UTB B;  2D21 A;  1EYJ A;  4Q8R A;  3A3U A;  3UK4 A;  5B7D A;  1H43 A;  4X48 A;  2QPQ A;  4OEV A;  3EHT A;  4PGP A;  3HFU A;  4OVP A;  2P2A A;  4LUB A;  1B6H A;  1AWB A;  2FIE A;  3O66 A;  5JEI A;  4PAK A;  2I0C A;  4F22 A;  4IR8 A;  3HST A;  2AL4 A;  3IX1 A;  3FVN A;  4H5G A;  2L5V A;  3WAF A;  3RLF E;  3G3H A;  3TEL A;  1ZBM A;  2HXW A;  1SI0 A;  1B46 A;  5A5X A;  2XD2 A;  5EYH A;  1Z7M E;  1MQI A;  3KN8 A;  2Q74 A;  1HSJ A;  5T3J A;  4RYA A;  5FBP A;  2P3N A;  4ELR A;  2DWJ A;  4IGR A;  1B9J A;  3A3C A;  2UVH A;  4ZE9 A;  3E4R A;  3IB0 A;  3LUZ A;  4P56 A;  3KG2 A;  2VPO A;  3DP8 A;  1IME A;  3E9X A;  3LV0 A;  3MC2 A;  4GQO A;  2I58 A;  2B65 A;  3TDJ A;  4XTC Q;  1Z7N E;  4F3S A;  1FQC A;  2Z8E A;  5CC2 A;  3MWB A;  1A55 A;  2XX8 A;  4NGU A;  1MG1 A;  3VXB A;  3MZB A;  1O7T A;  4JBZ A;  2GHB A;  2THI A;  2RIN A;  4GWY A;  5CMB A;  2KQZ A;  3MAM A;  2WKY A;  3S9L C;  2ESN A;  2Q8J A;  2HZL A;  4GIZ A;  4IB2 A;  4MAG A;  3KC1 A;  1YYZ A;  4XF5 A;  3TFL A;  4N15 A;  4LN5 A;  2VD2 A;  2QS2 A;  4PFW A;  1D9Q A;  5JK4 A;  1DPP A;  3W9W A;  4ZED A;  4EF1 A;  4U4S A;  5H8H A;  4NF5 A;  4LZ7 A;  1QKA A;  5L9O A;  2PT1 A;  1KWH A;  4THI A;  5J16 A;  4U23 A;  1OLA A;  2OCU A;  1SW2 A;  3SZP A;  1OQH A;  3K1N A;  3TMG A;  2O7U A;  3E78 A;  5I56 A;  3K02 A;  4KCC A;  3HCQ A;  4FEB A;  5LDZ A;  1UQW A;  4H8J A;  1UTB A;  4GF8 A;  5F1Q A;  4N8Y A;  3IFC A;  4NF8 B;  1FPE A;  4LVQ A;  4WEP A;  4EQ7 A;  1FTO A;  3B6T A;  5K2Y A;  3O2A A;  4LP2 B;  4QRZ A;  2XXX A;  1JP4 A;  1NUY A;  5KCJ B;  3IFA A;  3KEI A;  1NNP A;  1Y4C A;  1MXU A;  3K6V A;  4N6P A;  4XIG Q;  4MNP A;  1I6A A;  1N7X A;  1CB6 A;  3FXR A;  4OHN A;  1FRP A;  2A5T B;  2ZZV A;  4YB5 A;  1D9V A;  2VT5 A;  4PBH A;  4NF5 B;  3B6W A;  3LSW A;  1GVC A;  1JW4 A;  1MDP 1;  4MFI A;  4QSE A;  2PFY A;  1B3F A;  3K0V A;  5IZ3 B;  3T1B A;  5H8F B;  3ONM A;  1LAX A;  1NUW A;  2QVU A;  1A40 A;  4MCO A;  1Y3P A;  3ZKL A;  4F18 A;  1TFA A;  5H8H B;  2OK2 A;  3VVF A;  3GBA A;  3PUX E;  4JVD A;  4ZEI A;  4PTK A;  2HFB A;  1FQF A;  5I2K B;  3SEX A;  1TT1 A;  4QSD A;  3Q25 A;  3TZA A;  4MBP A;  4N4U A;  1NH7 A;  4F2O A;  3C35 A;  4AB5 A;  4QHQ A;  5DVI A;  4R6Y A;  4P47 A;  3HHG A;  2R71 A;  1EYI A;  2QMW A;  2ZZW A;  4GWZ A;  2HZK A;  4U1Z A;  5I59 A;  1M5F A;  1FQA A;  3I3V A;  3TQW A;  2O68 A;  1IXC A;  1LST A;  3GBB A;  4UAB A;  4QBA A;  3G3I A;  4HCY A;  5ET6 A;  4OVJ A;  4DIG A;  2O7I A;  2F7B A;  4NF6 B;  1N04 A;  1B5J A;  4OVS A;  4M1V A;  1FTA A;  2PBW A;  3LBS A;  4FED A;  4I9D A;  2XXQ A;  3VV5 A;  1MY0 A;  4NAP A;  2ZNS A;  4XKQ A;  1VFD A;  3G7W A;  2I48 A;  3SKP A;  4OER A;  3IOV A;  3D4G A;  4E0X A;  2ZNU A;  4PAF A;  4Q5T A;  5FHM A;  1USY E;  2F6G A;  4DXB A;  2OBG A;  3KN7 A;  4IO5 A;  2KR0 A;  3T22 A;  5I2N B;  1PB9 A;  3SEY A;  2XWK A;  2QMX A;  2CZL A;  2UVJ A;  1FPJ A;  1BIY A;  2Z23 A;  3Q27 A;  3OO6 A;  2V3U A;  4HXV A;  4DXU A;  3KBR A;  2KLF A;  1URS A;  4OVT A;  3IJX B;  1AH5 A;  5KCJ A;  1A8E A;  2VGQ A;  3FGS A;  2QS3 A;  3CFL A;  3GYY A;  2NVU B;  1NUX A;  1JVY A;  3UIF A;  1Q1K A;  1SPI A;  4N13 A;  3SES A;  3OEM A;  3DP4 A;  3PV0 E;  4GWO A;  3ZS6 A;  5IZZ A;  3EF7 A;  3RPL B;  5AA4 B;  1FBP A;  1EZ9 A;  4G8H A;  5EQ9 A;  1WOD A;  3JZJ A;  5H8F A;  1AMF A;  1B1X A;  4H1X A;  2H99 A;  2VHA A;  2ZXT A;  3SEU A;  5ICQ A;  5ITO A;  3USD A;  3IO4 A;  4GXA A;  1FPI A;  1TFD A;  4JVI A;  1EZP A;  2H9B A;  3R26 A;  3BIH A;  4KYS A;  3MP8 A;  1LGB C;  2H98 A;  3MW0 A;  2P0S A;  1MM6 A;  2WBD A;  1UTH A;  1D9Y A;  1XT8 A;  4IY6 A;  2AL5 A;  2WX9 A;  3MVW A;  1FBD A;  3C36 A;  5I58 B;  1G0H A;  4OWD A;  5H8N A;  1SVX B;  1N0T A;  1OQG A;  4QFK A;  4BDL A;  3SEW A;  4U4X A;  1B5H A;  2BJI A;  3L6G A;  1O63 A;  3G3G A;  1FTM A;  1NV6 A;  3V89 B;  4YKK A;  2R8T A;  1YXI A;  4FE8 A;  1R9L A;  3BBR A;  2DE2 A;  5HM4 B;  4F1Y A;  3U94 A;  5ET7 A;  4I8C A;  1Y20 A;  2XXT A;  2Y7P A;  4GX6 A;  1NNF A;  3FJG A;  4XFE A;  3H6V A;  4P1E A;  5ET5 A;  3IB2 A;  3IAZ A;  3RT8 A;  2DWA A;  5I2N A;  3FV2 A;  4NG7 A;  1B7U A;  1VR5 A;  1JW1 A;  1S9T A;  2ABH A;  4UA8 A;  1YPN A;  1T0K A;  2I4C A;  4GD5 A;  5TP9 B;  1ZLQ A;  3TEP A;  1LB9 A;  4PP0 A;  5I57 B;  2V4C A;  4NTL A;  3OO8 A;  5I5P A;  1H44 A;  2Q2C A;  1MRP A;  1OVT A;  3FBP A;  2DQV A;  4R75 A;  3VLV A;  3G3K A;  3K6U A;  1BLF A;  3OEK A;  1IMC A;  3QUF A;  2GHA A;  4IY5 A;  1FQB A;  1B2H A;  1JET A;  3FAT A;  2PT2 A;  3VLU A;  3DLN A;  4OEU A;  1MXY A;  3OOA A;  3IK6 B;  3NOH A;  4AB6 A;  5EQ7 A;  3RNN A;  3CSB A;  5EQ8 A;  2B3B A;  2F5X A;  4H45 A;  1OIB A;  3PMX A;  4YMA A;  2HAV A;  4P1L A;  1EH3 A;  4IO6 A;  4EQ9 A;  1FPF A;  4GL0 A;  4XXU A;  3N6T A;  3VVD A;  4KFQ A;  3MVZ A;  4I1D A;  1B3E A;  1NV4 A;  4MMP A;  1YTV A;  5J1D A;  4OQO A;  1JEU A;  1MXX A;  3G3F A;  3M3K A;  1IIW A;  1SBP A;  2Q9T A;  2DYX A;  1VSO A;  4GX3 A;  3MJN A;  3MUQ A;  3PU5 A;  4U2R A;  4H65 A;  3WAE A;  3UP9 A;  4RK2 A;  3ILU B;  2A5T A;  3RT6 B;  4PDD A;  4GWW A;  4NF6 A;  2P3V A;  2V3Q A;  5DVJ A;  5CM6 A;  3QMF A;  5A5L A;  5TPA A;  4PAI A;  4JWX A;  3BFT A;  5EYF A;  3OEL A;  3OSQ A;  4YKJ A;  4MLQ A;  1MY4 A;  1MM7 A;  3L6H A;  4RJZ A;  3JYR A;  4WXJ A;  4PFR A;  5EYG A;  1B51 A;  1IXH A;  3KSJ A;  2QSX A;  2DOJ A;  5B70 A;  1NH8 A;  2IEE A;  3TYH A;  4ZEC A;  4MNC A;  2Z8D A;  3PPP A;  1MQD A;  1Q35 A;  1JEV A;  1FBE A;  5A5X B;  2VOZ A;  2H4I A;  5ELV A;  1CNQ A;  5I56 B;  2PFZ A;  4KXP A;  5TU0 A;  1MY1 A;  2XXH A;  5H8Q B;  1B5I A;  3H03 A;  4PQJ A;  4LZ8 A;  5IZ1 A;  4FEC A;  4H8I A;  4R73 A;  4MIJ A;  3Q29 A;  4XKR A;  1QUI A;  3TUS A;  4DI4 B;  4F19 A;  3QIM A;  5ESY A;  1NV0 A;  3B6Q A;  2DWH A;  3MVX A;  3N26 A;  1KA1 A;  1LBV A;  4FAT A;  3O6G A;  5DTB A;  3HV1 A;  1QUJ A;  2AIX A;  5AA3 A;  1XI6 A;  3E79 A;  1M5C A;  4TLL B;  4OZ9 A;  1P1Q A;  2UYF A;  1IMA A;  2Q88 A;  3K1P A;  3BFU A;  3K1M A;  2PMS A;  2REJ A;  3SDF A;  2ALU A;  3V8X B;  3CVG A;  1M5B A;  2UVI A;  4X1D A;  3T9X B;  3C4M A;  2F34 A;  5F24 A;  1FPD A;  3G3J A;  2RCB A;  3EHS A;  4F1U A;  3FVK A;  3PD9 A;  3K6X A;  4JWY A;  4GBW A;  3C34 A;  3MZ1 A;  1LBW A;  5L8D A;  4RPO A;  2REG A;  2V84 A;  1AL3 A;  3H6W A;  4EXL A;  4O94 A;  3KJT A;  4R2F A;  2F6P A;  3IL1 B;  3W9V A;  2NWJ A;  4IGT A;  2UYE A;  1NV7 A;  3FVO A;  2QS1 A;  3KBZ A;  1UTH B;  2H5Y A;  4G4P A;  3MPK A;  4QFP A;  1VDW A;  2OJT A;  2ZYK A;  3RTW B;  1MPC A;  1ZJL A;  4GFR A;  1I6Q A;  1NV2 A;  4QF9 A;  4N81 A;  1GR2 A;  4HCW A;  2QVR A;  1SW1 A;  4G2Z A;  2DP8 A;  2I3V A;  4GOT A;  3ISP A;  3SEV A;  3OO9 A;  4LA9 A;  3O9P A;  1OVB A;  4UAC A;  5KDT A;  1B40 A;  4O3C A;  5IAI A;  1FPG A;  1Y4T A;  4PBQ A;  2XXR A;  2O69 A;  2XXW A;  4PGN A;  5I58 A; 
#chains in the Genus database with same CATH homology
 3O97 A;  1XC1 A;  3KJ7 A;  3OO7 A;  4JSD A;  4DE8 A;  4KI0 E;  2P1S A;  4GXS B;  1JVY A;  4R74 A;  1BKA A;  4ZEB A;  3T9H B;  3UIF A;  3PMW A;  1Q1K A;  2I0B A;  4AQ4 A;  2QJE A;  2G93 A;  1PBP A;  2D5W A;  3HHF A;  3QYT A;  4N13 A;  3ZSF A;  1HSE A;  4DZ1 A;  4ZZE A;  5JTY A;  3SES A;  3O6I A;  1Y9U A;  3DP4 A;  3OEM A;  3PV0 E;  4GWO A;  3ZS6 A;  5AE4 A;  4DDD A;  3M3F A;  3EF7 A;  4NF8 A;  5FTH A;  4YMB A;  5AA4 B;  3IOT A;  4DLD A;  1FTL A;  2D3I A;  1HSL A;  5CBR A;  1EZ9 A;  4OFL A;  3U92 A;  1EU8 A;  1R1N A;  2HAU A;  3KOT A;  4G8H A;  1WOD A;  3CFZ A;  3JZJ A;  5H8F A;  1AMF A;  5H8S A;  3TOD A;  1B1X A;  2X26 A;  4H1X A;  4QFN A;  2H99 A;  3JV9 A;  1EZO A;  2VHA A;  2ZXT A;  1YAE A;  1IQ7 A;  1MS7 A;  1TWY A;  3SEU A;  5HPQ A;  5ICQ A;  5ITO A;  4U22 A;  1LCT A;  5I57 A;  2IA4 A;  2V93 A;  4IO7 A;  4LZ5 A;  3USD A;  4TLM B;  1AOV A;  1URD A;  1NNT A;  3IO4 A;  2O84 X;  4GXA A;  4QSC A;  3RY3 A;  4RXL A;  1ZTY A;  3QUJ A;  3EPE A;  3MP1 A;  4R6K A;  4RY1 A;  4KR5 A;  4OYV A;  4KYE A;  2O6A A;  1DMB A;  1LAH E;  4NF4 B;  1TFD A;  1EZP A;  3PPO A;  4F31 B;  3QAX A;  5F7V A;  1NL5 A;  1ZU0 A;  4BDQ A;  3PUV E;  4ELQ A;  2H9B A;  3LSL A;  1MH4 A;  3EN3 A;  3R26 A;  4BDO A;  2XD3 A;  3N6U A;  1USY H;  4DCX A;  3K4U A;  4KYS A;  3S9N C;  3MP8 A;  3QXM A;  2V25 A;  1LGB C;  2Y84 A;  3MQ9 A;  1JQF A;  4ND9 A;  4QFL A;  5BWJ A;  1SD3 A;  4O3A A;  4OFJ A;  2W7Y A;  3ODB A;  2ZYM A;  3CR9 A;  3PPN A;  2H98 A;  2XXY A;  3FJ7 A;  3MW0 A;  2P0S A;  1MM6 A;  1L5T A;  3RUM A;  1UTH A;  4RPN A;  3KSX A;  1D9Y A;  1FCK A;  1XHY A;  4C0R A;  4F1V A;  1A54 A;  3GXA A;  1XT8 A;  3IB1 A;  2DSF A;  4IY6 A;  2AL5 A;  2GRV A;  3MVW A;  4YZZ A;  1R9Q A;  1URG A;  5EHM A;  4ZS9 A;  1SYH A;  1MXW A;  3ILT B;  4OES A;  3C36 A;  3KZG A;  1IXI A;  1POY 1;  4P0G A;  5IKB A;  2G29 A;  5AA2 D;  5ITP A;  1H76 A;  2ONR A;  5I58 B;  2Q89 A;  5DT6 A;  1IUD A;  4EQB A;  4OWD A;  3TTL A;  3I5O A;  1GTK A;  5H8N A;  1ZMG A;  4POW A;  1SVX B;  3W15 C;  4RNS A;  5DEX B;  1N0T A;  4PFY A;  2YPN A;  3UOR A;  3PUY E;  1P1W A;  1LBB A;  4EDP A;  1IIT A;  1OQG A;  4XKN A;  4NED A;  5DYH A;  4G68 A;  3AXF A;  4L17 A;  4QFK A;  4BDL A;  3SEW A;  5I59 B;  2UXA A;  4U4X A;  1B5H A;  1UTB B;  2D21 A;  5JEI A;  5CMM A;  4NMY A;  4Q8R A;  3L6G A;  4KPT A;  1O63 A;  4R9F A;  4R6H A;  5M2V A;  3A3U A;  3G3G A;  3UK4 A;  1FTM A;  3V89 B;  4YKK A;  5B7D A;  1H43 A;  2AYS A;  4N07 A;  4X48 A;  2QPQ A;  4OEV A;  3EHT A;  5FHO A;  2OZZ A;  2P2A A;  1R9L A;  1ZIU A;  3O28 A;  4FE8 A;  2CMO A;  2XXP A;  4FOR A;  3BBR A;  2DE2 A;  1B6H A;  4LUB A;  3RQT A;  5HM4 B;  3K2D A;  4F1Y A;  1FQD A;  3U94 A;  1Y1Z A;  2X7P A;  3LC8 A;  3S9E A;  4I8C A;  4XKR A;  1Y20 A;  2XXT A;  2Y7P A;  3O66 A;  1NNF A;  3FJG A;  2I0C A;  1B7H A;  3DM0 A;  4NE4 A;  4F22 A;  4F3P A;  1POT A;  4IO4 A;  3HST A;  2AL4 A;  3CI8 A;  3IX1 A;  3H6V A;  1ATG A;  3FVN A;  5EHS A;  2Q2A A;  4G8M A;  1JVX A;  2I4B A;  3IB2 A;  3IAZ A;  4Q30 B;  5KZT A;  4H5G A;  3T96 B;  3MBP A;  3WAF A;  3Q26 A;  3RT8 A;  3U8Q A;  3RLF E;  2DWA A;  3G3H A;  3TEL A;  3U1O A;  5I2N A;  3FV2 A;  1SQY A;  1B7U A;  1VR5 A;  1ZBM A;  4IO2 A;  1JW1 A;  1S9T A;  3U93 A;  2HXW A;  1SI0 A;  2ABH A;  1B46 A;  4UA8 A;  1YPN A;  3V83 A;  1B0L A;  4G68 B;  3VDF A;  1T0K A;  3O29 A;  2I4C A;  3H6T A;  2QRY A;  2R9J A;  2VP1 A;  4GD5 A;  5TP9 B;  5A5X A;  2XD2 A;  1ZLQ A;  2OLB A;  1A8F A;  1R6Z A;  3TEP A;  3PD8 A;  1LB9 A;  1N76 A;  4PP0 A;  5I57 B;  4NTL A;  3OO8 A;  4HTG A;  3T9V A;  1DPE A;  1Z7M E;  3CRB A;  1MQI A;  4ZEK A;  1H44 A;  3KN8 A;  2Q2C A;  1MRP A;  1SW5 A;  2XXI A;  3GLB A;  1B1H A;  1HSJ A;  2VD3 A;  4OTE A;  1OVT A;  4PFT A;  4F29 A;  2DQV A;  2LAO A;  4R75 A;  3VLV A;  4RYA A;  1RYO A;  3N5L A;  3G3K A;  4GL8 A;  3K6U A;  1BLF A;  4R2B A;  1IXG A;  4ELR A;  3OEK A;  2DE4 A;  1P1O A;  3B7D A;  2DWJ A;  1QUL A;  3QUF A;  3CSG A;  4IGR A;  2GHA A;  4IY5 A;  1FQB A;  1B9J A;  1B2H A;  4EUO A;  2E0S A;  3A3C A;  2UVH A;  1CE2 A;  1JET A;  2GH9 A;  2XHD A;  1YCJ A;  3FAT A;  2PT2 A;  5FHN A;  3TKD A;  2OWT A;  2PVU A;  3LSF B;  3VLU A;  4HW8 A;  1A99 A;  3DLN A;  5CI5 A;  4OEU A;  3E4R A;  3IO6 A;  1MQJ A;  3IB0 A;  1MXY A;  1H45 A;  3KG2 A;  3OOA A;  4U21 A;  4XKP A;  3DP8 A;  4HS7 A;  3IK6 B;  1D4N A;  3OEN A;  3TCF A;  3E9X A;  1N3W A;  2DXY A;  1LAG E;  3MC2 A;  1XOC A;  4AB6 A;  4GQO A;  4RA1 A;  3OD7 A;  4GRK A;  3R7X A;  1Y3N A;  4ELP A;  1LFI A;  3RNN A;  2DVZ A;  2Z22 A;  3KGC A;  2I58 A;  5BUU A;  3HN0 A;  1Y3Q A;  2B65 A;  4GLI A;  3TTK A;  3TDJ A;  3CSB A;  2B3B A;  4XTC Q;  4ESW A;  1QW0 A;  5TPA B;  1Z7N E;  2F5X A;  4JSO A;  4YKP A;  4F3S A;  3HO7 A;  1OIB A;  3H7M A;  3THI A;  1AIV A;  1FQC A;  3FD3 A;  3PMX A;  4YMA A;  2HAV A;  3T66 A;  1EH3 A;  2Z8E A;  3KFM A;  4IO6 A;  4EQ9 A;  5CC2 A;  4POX A;  2F35 A;  3H4Z A;  4GL0 A;  3MWB A;  1A55 A;  2XX8 A;  3ZKK A;  3N94 A;  4LAT A;  4XXU A;  1MG1 A;  1B32 A;  2RKM A;  2E1S A;  3MZB A;  3VXB A;  4JDF A;  3PUW E;  2F8D A;  1O7T A;  4JBZ A;  3IOR A;  2GHB A;  2THI A;  3N6T A;  4QFO A;  2RIN A;  4KFQ A;  5AA1 A;  3VVD A;  3MVZ A;  5JTY B;  5CMB A;  1ZKB A;  4I1D A;  1B3E A;  3EHU A;  2ONK E;  3MAM A;  2WKY A;  4ECF A;  1YTV A;  5DEX A;  4OMB A;  1M5D A;  2ESN A;  2F7C A;  2OWS A;  1BTJ A;  2Y7R A;  5J1D A;  2Q8J A;  3S9L C;  4WKM A;  4OQO A;  1JEU A;  2HZL A;  3A09 A;  4GIZ A;  4IB2 A;  4KCD A;  1MXX A;  4OXV A;  3G3F A;  2M8C A;  3K00 A;  4MH5 A;  3M3K A;  4OET A;  1MPB A;  3E3K A;  1IIW A;  1SBP A;  2Q9T A;  3LSX A;  2DYX A;  1VSO A;  2Y7I A;  3C32 A;  4M4G A;  5AA2 B;  3FXQ A;  2Y7K A;  2XXU A;  3MJN A;  3MUQ A;  3PU5 A;  4YU0 A;  4U2R A;  3TFL A;  1B3L A;  4DXC A;  1SW4 A;  2VD2 A;  2B3F A;  2QS2 A;  4PFW A;  5JK4 A;  1DPP A;  3W9W A;  4H65 A;  1II5 A;  3WAE A;  4ZED A;  4RK9 A;  4ZZA A;  3UP9 A;  4C1T A;  4EF1 A;  4U4S A;  5H8H A;  1MQH A;  4NF5 A;  4LZ7 A;  1XS5 A;  1QKA A;  2ZMB A;  4RK2 A;  2NUV A;  3K6W A;  5L9O A;  3PUZ E;  5DVF A;  3ILU B;  4KHZ E;  3H6U A;  2A5T A;  3RT6 B;  1MQG A;  1QVS A;  4KD5 A;  1QKB A;  2PT1 A;  4NF6 A;  1S50 A;  2V3Q A;  1MY2 A;  2GFE A;  5DVJ A;  3CFX A;  3VLW A;  5CM6 A;  1KWH A;  2ZYN A;  5TPA A;  1B58 A;  4THI A;  4NF4 A;  3DEL B;  4WED A;  3T93 B;  4MLV A;  4Z7E A;  3MPL A;  4JWX A;  3BFT A;  4YIC A;  2I6E A;  4U23 A;  1OLA A;  2OCU A;  1NFT A;  3DP6 A;  1SW2 A;  2F78 A;  3OEL A;  2Y7W A;  1QUK A;  3OSQ A;  4YKJ A;  4MLQ A;  5EYF A;  1MY4 A;  1OQH A;  3IR1 A;  3K1N A;  1MM7 A;  2RC8 A;  3QK6 A;  4KQP A;  3TCG A;  3L6H A;  4RJZ A;  3TMG A;  4BDR A;  5AA2 A;  1N84 A;  2F36 A;  3JYR A;  3MVY A;  3VVE A;  2O7U A;  3OXN A;  1B52 A;  4WXJ A;  3I6V A;  2H25 A;  1B51 A;  5I56 A;  3K02 A;  4KCC A;  1IXH A;  3HCQ A;  3KSJ A;  1UQW A;  4FEB A;  4H67 A;  1UTB A;  4H8J A;  2O51 A;  2QSX A;  3C31 A;  3GZG A;  4GF8 A;  5F1Q A;  5H8F B;  2DOJ A;  3S2V A;  2YJP A;  5AA4 A;  2X7Q A;  4NF8 B;  5B70 A;  5CBS A;  3TCH A;  3IOU A;  5CMC A;  3O6H A;  3FZV A;  4IO3 A;  5ISU A;  4LVQ A;  4WEP A;  4EQ7 A;  2RC7 A;  1NH8 A;  2IEE A;  1FTO A;  1RKM A;  3B6T A;  3FAS A;  3OMB A;  4H6D A;  3TYH A;  4ZEC A;  3IOW A;  1XVX A;  5K2Y A;  2Z8D A;  1PBQ A;  2A5S A;  3PPP A;  1ANF A;  3OSR A;  3O2A A;  3CIJ A;  1XVY A;  2RCA A;  2XXV A;  1MPD A;  1MQD A;  1Y1M A;  4LP2 B;  2Z8F A;  1Q35 A;  2HCA A;  4QRZ A;  2XXX A;  1JEV A;  5KCJ B;  3UA8 A;  1NMU A;  4YB7 A;  3KEI A;  1B05 A;  4PET A;  4EXK A;  1NNP A;  5TP9 A;  2VOZ A;  3LR1 A;  2H4I A;  5A5X B;  1Y4C A;  2FA7 A;  3TQL A;  1LBC A;  1MXU A;  3K6V A;  4H5F A;  4BDN A;  4N6P A;  1N3X A;  1PB8 A;  5ELV A;  2DXR A;  4K3F A;  4XIG Q;  1MXV A;  1QJM A;  5KDT B;  1I6A A;  4Z0I A;  4BDM A;  2ZNT A;  4X1B A;  1N7X A;  2DS9 A;  5I56 B;  3D4C A;  1CB6 A;  1B4Z A;  1MXZ A;  2F97 A;  3FXR A;  4OHN A;  5TU0 A;  5CMK A;  1MY1 A;  2XXH A;  5H8Q B;  4G8N A;  4F2Q A;  2A5T B;  4YB5 A;  4GVO A;  1US4 A;  1B0H A;  1D9V A;  1B5I A;  2O1M A;  3H03 A;  4YKI A;  1FQE A;  4PQJ A;  4DCY A;  4NF5 B;  4E0W A;  4LZ8 A;  3B6W A;  2DVC A;  1B7Z A;  3LSW A;  3FVG A;  3C9H A;  3EQ1 A;  1GVC A;  4FEC A;  4C1U A;  1JW4 A;  4ELO A;  1B4H A;  4X9T A;  4ZEF A;  1MDP 1;  5K2X A;  4H8I A;  4FAJ A;  4MFI A;  4QSE A;  4F3G A;  4R73 A;  3K0V A;  1B3F A;  3T9U A;  5L9M A;  3RGY A;  1IZ1 A;  3FJM A;  3VE1 B;  1ELJ A;  3Q29 A;  1SI1 A;  3CG1 A;  3FUZ A;  2UVG A;  3K01 A;  1QUI A;  3R6U A;  2YLN A;  1LAX A;  3ONM A;  4O3B A;  3M8U A;  5H8Q A;  2FNC A;  4TQU Q;  3V5A A;  4P0I A;  3TUS A;  3FV1 A;  1VE4 A;  4OEN A;  1A40 A;  3H3G A;  4F19 A;  1B3G A;  1Y3P A;  2HEU A;  2I49 A;  3F11 A;  3QIM A;  3ZKL A;  4F18 A;  3B6Q A;  1TFA A;  2DWH A;  2PX1 A;  5H8H B;  1TXF A;  3MVX A;  4F3B A;  2OK2 A;  3N26 A;  1B3H A;  4R72 A;  3VVF A;  3GBA A;  3P7I A;  1PEB A;  3PUX E;  2NXO A;  4FAT A;  3KN3 A;  3O6G A;  1LB8 A;  3HV1 A;  1QUJ A;  4G68 C;  4NWC A;  1S7Y A;  4MF3 A;  5DTB A;  4ZEI A;  1I69 A;  3ECR A;  3RN8 A;  4EF2 A;  1NNK A;  1SDX A;  2AIX A;  3SET A;  1PDA A;  5LOM A;  2HFB A;  5AA3 A;  2NOO A;  1FQF A;  5I2K B;  2RC9 A;  4FJP A;  1RYX A;  1P99 A;  4LQ5 A;  1O64 A;  1M5C A;  4TLL B;  3SEX A;  2ANJ A;  4OZ9 A;  5L9S A;  1P1Q A;  3E13 X;  2UYF A;  1TT1 A;  1JNF A;  4QSD A;  2Q88 A;  3K1P A;  3Q25 A;  3BFU A;  1LFH A;  3K1M A;  4TOZ A;  1M5E A;  3TZA A;  4ZE9 A;  1N7W A;  4YAH X;  2PMS A;  4BLA A;  2REJ A;  1FTK A;  2ALU A;  3SDF A;  3V8X B;  4MBP A;  4G77 A;  3PGF A;  1NH7 A;  3CVG A;  3C35 A;  4AB5 A;  4F2O A;  1MDQ A;  2ONS A;  1M5B A;  2UVI A;  4X1D A;  4QHQ A;  4ZE8 A;  5DVI A;  3T9X B;  1LLS A;  3C4M A;  4R6Y A;  2F34 A;  3SER A;  2I3W A;  1BP5 A;  4FIM A;  1SYI A;  3G3J A;  4JWO A;  3HHG A;  4F39 A;  2R71 A;  2RCB A;  3EHS A;  2QMW A;  3HPI A;  1DSN A;  4F1U A;  2DWI A;  3FVK A;  2HZK A;  3PD9 A;  3K6X A;  4U1Z A;  1LAF E;  3TTN A;  5I59 A;  3FIR A;  3S9M C;  4JWY A;  1F9B A;  1M5F A;  1FQA A;  3I3V A;  3TQW A;  4ESX A;  2O68 A;  1P1U A;  3C34 A;  3MZ1 A;  1IXC A;  1LST A;  2PYY A;  3GBB A;  2HQ0 A;  5L8D A;  4RPO A;  3G3I A;  4HCY A;  2REG A;  2V84 A;  1AL3 A;  1I6B A;  1WVJ A;  2O1L A;  1A7L A;  3H6W A;  3IJO B;  4EXL A;  4OVJ A;  3TTM A;  1WDN A;  3QSL A;  4LQ2 A;  3KJT A;  4DIG A;  4H0W A;  1MH3 A;  4R2F A;  2O7I A;  1MY3 A;  2XX7 A;  2F6P A;  2F7B A;  3IL1 B;  4NF6 B;  2NWJ A;  2QS4 A;  4R9G A;  3W9V A;  4IGT A;  1DOT A;  1PB7 A;  2DE3 A;  1N04 A;  1VFE A;  1B5J A;  4I62 A;  4PE5 B;  2UYE A;  4M1V A;  5FTI A;  2PBW A;  4Q0C A;  1LFG A;  1P1N A;  4OFO A;  3FVO A;  1GGG A;  3LBS A;  2QS1 A;  4FED A;  4I9D A;  1UTH B;  2XXQ A;  4NWD A;  3VV5 A;  1FTJ A;  2H5Y A;  2RF1 A;  4ISU A;  4G4P A;  1MY0 A;  4XKQ A;  2ZNS A;  5I84 A;  1OLC A;  3M3L A;  3Q28 A;  1VFD A;  4LON B;  3MPK A;  1D3K A;  3C33 A;  4QFP A;  3G7W A;  2V3T A;  2OJT A;  3H06 B;  2ZYK A;  3VFJ A;  3RTW B;  1MPC A;  4JXI A;  3TTR A;  1ZJL A;  2I48 A;  1FW0 A;  3CG3 A;  2BJJ X;  4OER A;  3SKP A;  5HBC A;  3IOV A;  4PFU A;  3D4G A;  4GFR A;  4JB7 A;  3TAJ A;  2ZNU A;  4E0X A;  1I6Q A;  3UGW A;  4Q5T A;  5FHM A;  5CRY A;  4QF9 A;  3BKI B;  1DTG A;  1USY E;  2F7A A;  1GR2 A;  2F6G A;  4HCW A;  4DXB A;  2OBG A;  4YB6 A;  3RTF B;  4KYD A;  3KN7 A;  1SW1 A;  3VXC A;  4IO5 A;  2QL3 A;  3KOS A;  4ZDM A;  4G2Z A;  3UN6 A;  3T22 A;  2DP8 A;  2I3V A;  2ZYO A;  4GOT A;  4P11 A;  3MP6 A;  1J1N A;  5I2N B;  2FYI A;  1JW5 A;  3FXU A;  3U72 A;  1PB9 A;  1IEJ A;  3SEY A;  2QMX A;  5ICT A;  2CZL A;  2UVJ A;  1LCF A;  3SEV A;  3OO9 A;  4U1O A;  3S4U A;  1US5 A;  3O9P A;  1OVB A;  4LA9 A;  3TPA A;  4UAC A;  1BIY A;  1NKX A;  2Z23 A;  3MZ9 A;  5KDT A;  3Q27 A;  1B40 A;  3OO6 A;  2V3U A;  4DXU A;  3KBR A;  2KLF A;  3PMV A;  1OMP A;  4O3C A;  1GV8 A;  1UIU A;  1URS A;  5IAI A;  1Y4T A;  3LUY A;  1UIV A;  3IJX B;  3PPQ A;  3PPR A;  1PC3 A;  2XXR A;  1AH5 A;  5KCJ A;  2O69 A;  1H3D A;  1A8E A;  3RPW A;  5H8N B;  4ONY A;  2VGQ A;  2XXW A;  2QS3 A;  3CFL A;  3FGS A;  2R6G E;  5I2K A;  1DTZ A;  5I58 A;  2NVU B;  2XX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...