1TT1A

Crystal structure of the glur6 ligand binding core in complex with kainate 1.93 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
b'NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 87
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A02
1MPCA 4GOTA 5CMMA 3U8QA 4N6PA 5H8QB 4ZE9A 3V89B 2QMXA 2QS1A 4NF5B 5JK4A 1MPDA 4RK9A 2AIXA 1B3HA 3PU5A 4KYDA 2F7BA 4EUOA 3CRBA 4F2QA 4F3PA 3PD8A 3E4RA 5H8SA 1DOTA 3FD3A 3K6UA 3VXBA 1XC1A 5I56A 3EHTA 1IXGA 3TFLA 1UTBA 5I2NA 4KYSA 5DEXB 5F1QA 1NNPA 3MP6A 1R9QA 3S9LC 2PMSA 1N84A 4G4PA 1EZOA 1SDXA 3C32A 4MH5A 4MFIA 5AA3A 4P0GA 3TDJA 3IOWA 5H8NB 3TTKA 3MVYA 1N3XA 4H65A 4PFUA 1SW2A 3TCGA 1B2HA 4ONYA 4R73A 3EPEA 4U1OA 3T9UA 1LLSA 3GZGA 3K01A 4G68A 3T9HB 1R9LA 2OLBA 4YKJA 3PPNA 4G8NA 3HHGA 3JZJA 3K02A 2A5TB 5H8QA 4OERA 5JEIA 3PMXA 5H8FB 4R2BA 3B6WA 3MVWA 1AOVA 4OHNA 2GH9A 3C9HA 3B6QA 3MZ9A 2E1SA 2XXYA 3S9MC 4GXSB 3H03A 1MM6A 1A40A 3OOAA 4OTEA 2Q8JA 4DZ1A 1II5A 1S50A 3RTWB 4ESWA 1B3FA 2Y7PA 4IO6A 5L9MA 5I84A 3IORA 3CG3A 4ZZAA 4NF6B 3G3HA 3HV1A 2THIA 3LSFB 4ECFA 1XS5A 5DEXA 2XXWA 2ZXTA 3HN0A 3JYRA 3VE1B 2Y7IA 2H9BA 2UVIA 1MM7A 3OO8A 1AMFA 4Z7EA 4U4XA 1MY2A 3EHSA 4R72A 5F7VA 1HSEA 3K00A 3TODA 4NF8B 4NF4B 1B6HA 5DVFA 1KWHA 3MPKA 4U2RA 3IR1A 3QUJA 3FJ7A 3FJGA 4GL0A 3DP6A 2V3UA 4FE8A 5J1DA 3KEIA 3FXRA 4F18A 4YB6A 3CR9A 4PP0A 2PYYA 3M3FA 4KI0E 3PMWA 1HSJA 4R6HA 2XX7A 3OXNA 2D21A 4EF1A 2Y7KA 4LONB 4R75A 2UVHA 3IK6B 1I6AA 2I48A 3EQ1A 1FCKA 5I2KA 2XXIA 1IUDA 3MZBA 1IZ1A 2ZYOA 1DMBA 2H25A 4XKPA 1A7LA 3SEVA 1A8FA 1VFEA 1DPEA 3C36A 4OEUA 5FTHA 3VLWA 1Z7NE 1SVXB 3FV2A 4RPNA 5JTYA 4EF2A 1B0HA 3G3FA 1EZ9A 3O9PA 4MLVA 2QSXA 1URGA 4OFOA 3HO7A 4G68C 2I49A 3LR1A 2O1LA 1ZMGA 3IJXB 2GHBA 2YLNA 3ILTB 2I0BA 2O84X 4QSEA 3H7MA 1WODA 2HAVA 3OMBA 4ZDMA 4NE4A 3G3KA 3CG1A 4ELOA 4IO5A 2RC7A 4I8CA 2UXAA 2Y84A 2REGA 2UYFA 3QYTA 4WXJA 5ICTA 2QPQA 3ODBA 4YKKA 2XXTA 1NH7A 5KCJB 1TXFA 1JEVA 4XKRA 1JVXA 4LATA 5EHMA 2VOZA 4GXAA 2V84A 3LSWA 1LCFA 2FYIA 1H45A 2XD2A 1PC3A 3UP9A 3H06B 3W9WA 4KPTA 4KCDA 4DDDA 3T96B 2I58A 4AB5A 2XXXA 4ZECA 2OZZA 4IO2A 4FORA 2F8DA 3PUZE 5M2VA 3TQWA 4O3CA 2I3WA 3W15C 3B7DA 1ATGA 4F2OA 3GXAA 1I6BA 3TMGA 5ITOA 2VHAA 5KDTB 1P99A 3OD7A 2O7UA 5CMBA 2B3FA 1LBBA 3BBRA 4OVJA 3N6UA 4QRZA 4GRKA 4BDLA 1NFTA 2F7AA 1IIWA 2QS3A 2X7QA 4GVOA 1JW1A 1N7WA 2F78A 1I69A 1N04A 1B40A 3MC2A 4JXIA 3UN6A 3EN3A 4YU0A 4KFQA 1B7ZA 1BP5A 1Y1MA 3C34A 4PFYA 3IOVA 3TTLA 2F35A 1H43A 4EXLA 1N0TA 4RY1A 5AA4A 3I3VA 4HTGA 5KCJA 2DE2A 2I4CA 2DVZA 2NXOA 1R1NA 1EH3A 3C31A 1TFDA 4QHQA 2O69A 1IXCA 3KSJA 1P1OA 1B5IA 2QS2A 2Z22A 3IX1A 4RXLA 2F36A 1MDP1 4G2ZA 1B9JA 3UIFA 3O29A 4F22A 1UTBB 4RK2A 5I2NB 4ZEKA 4H67A 4PE5B 1B32A 3BKIB 1A54A 4ZZEA 1LFIA 2H5YA 3KFMA 3IB2A 4ZEFA 3D4CA 3PUWE 5DVJA 3LSXA 4PFWA 2PBWA 3QUFA 1L5TA 2XX8A 2VD2A 3IB0A 3QSLA 4DXBA 2HEUA 1ZBMA 4R9FA 2VGQA 2DE4A 4H8IA 4POWA 4GQOA 1B4HA 3KN7A 1LGBC 5ICQA 1SYHA 4GFRA 1GTKA 2O6AA 2V93A 3SETA 2PVUA 4N07A 2QJEA 1B7HA 4Q8RA 2XXUA 4LVQA 4N13A 1SI1A 3W9VA 3IL1B 3TCFA 4H6DA 3U93A 3FVNA 3BFUA 1WDNA 3FV1A 3O66A 3O6GA 3OEKA 3IJOB 2KLFA 1AL3A 4JSOA 3TKDA 1YTVA 5IAIA 2ZYKA 5CRYA 1PB8A 3FATA 3RT6B 2ZYMA 1CB6A 4YZZA 4F19A 4OMBA 4QFLA 1DTGA 2DXRA 2XXVA 4FECA 3PPRA 1TFAA 4ISUA 1YAEA 3VFJA 3TCHA 1NH8A 3M3LA 2Y7WA 4FIMA 3Q29A 4O3AA 1SW1A 4JSDA 4ELRA 4QSDA 3UGWA 1MXUA 4OFJA 4H5GA 1Y9UA 1OLCA 2IEEA 1ZLQA 4IO4A 1XOCA 1S9TA 1GR2A 1MXZA 2HQ0A 1BTJA 4TLMB 3RT8A 3TZAA 1LAGE 4FATA 1USYH 3K1PA 4TQUQ 4IY5A 3G3IA 1B5HA 2DS9A 2QS4A 1B3GA 1B51A 4OFLA 3Q28A 2WKYA 3U92A 5AA1A 3DELB 3A09A 4BDQA 5TPAA 3T22A 3L6GA 4RNSA 4H0WA 3VVFA 1UIVA 4PFTA 2OJTA 5I2KB 3WAEA 4L17A 1US5A 2HXWA 3PUYE 1D3KA 3TTMA 3RGYA 3AXFA 3IOTA 3CFZA 3UK4A 5DYHA 3K6WA 4EXKA 3LC8A 2F97A 4P0IA 5JTYB 1S7YA 3OELA 1P1NA 4F1YA 1FTKA 2DQVA 2DWAA 1RYOA 3GLBA 1ZU0A 3R7XA 1DTZA 4ESXA 4XKQA 1B1HA 3PD9A 2PT1A 3FVOA 3MPLA 1B5JA 4LQ2A 4F31B 1MH4A 1M5FA 4AB6A 4DE8A 1Y4CA 3U72A 4IY6A 4JWXA 3DP4A 4GLIA 2P0SA 1UTHB 4NWCA 1PBPA 3G3JA 2E0SA 3CFLA 4IB2A 3RTFB 4BDMA 3SKPA 2NOOA 4YMAA 1NNTA 1AH5A 3KN3A 1Y4TA 4YB5A 3E9XA 3C33A 4R9GA 1FTJA 1MG1A 3M8UA 4F3BA 4KD5A 2P1SA 4DXCA 1POTA 2F6PA 1GV8A 2B65A 1Y20A 3L6HA 2Q2AA 1ZIUA 5CC2A 2ALUA 2Z8DA 4LA9A 3FVGA 1LAFE 4DLDA 1M5BA 1PBQA 3VV5A 1B52A 1FQAA 2REJA 3OO9A 1POY1 4KQPA 4ELPA 4U21A 5L9SA 3CFXA 4G8MA 4R2FA 2HFBA 3A3CA 3ECRA 4G77A 2F6GA 3FXQA 3KJTA 3KZGA 1VE4A 1N3WA 5FHMA 3SEUA 3O6HA 2XXHA 1J1NA 3ZSFA 1SD3A 3K6VA 1IXIA 3C35A 1URSA 4ZS9A 3TTNA 3HPIA 2DE3A 4AQ4A 3H4ZA 1UTHA 3CSBA 5AA4B 4TOZA 1MXVA 3TUSA 4C0RA 4OWDA 4QFKA 1QUIA 1PB7A 3VDFA 1QJMA 4RA1A 1MH3A 3SERA 1OQHA 1LFGA 3SEWA 4YB7A 2GHAA 2DYXA 1YPNA 1B3LA 5I57A 4F1UA 3KN8A 3MQ9A 2AL5A 3WAFA 3V5AA 1QKBA 1FQDA 2DWHA 1Q35A 3Q27A 1N7XA 4QSCA 4NMYA 3E3KA 2ZNUA 3FUZA 5EYFA 5CM6A 4RYAA 4Z0IA 4H8JA 2ONSA 3T9VA 3KSXA 2O7IA 1YCJA 3I6VA 1MS7A 5K2YA 3K4UA 4E0XA 1NMUA 4GF8A 3ILUB 3G3GA 1JVYA 4U1ZA 5DTBA 4HCYA 4Q0CA 5KZTA 5FHOA 1FTMA 1ZTYA 1QVSA 4IGRA 4PETA 2VD3A 4ZE8A 3VVDA 4HW8A 1Y1ZA 3MZ1A 2B3BA 2GRVA 1WVJA 5B70A 3TYHA 1LCTA 3RNNA 2O68A 4X9TA 3GBBA 2PT2A 1CE2A 3IO4A 4XIGQ 1FQFA 4OYVA 5I58A 3MBPA 4ZEBA 2DWIA 3HHFA 4M4GA 1TT1A 5EHSA 3RN8A 1B58A 4QFOA 3QXMA 2NWJA 2D5WA 4XXUA 4FJPA 1MQJA 4R74A 3IAZA 3TTRA 3K1NA 1PEBA 1JW5A 2D3IA 3U94A 2V25A 4BDRA 1D9VA 1H76A 4JB7A 2FNCA 3VVEA 2O51A 3OENA 1JQFA 3MVZA 3VLUA 2HZLA 1QULA 1FW0A 2OK2A 1TWYA 2DWJA 1BKAA 2PX1A 1MXXA 1ZJLA 3RUMA 3N94A 3I5OA 2ZNTA 3BFTA 3H6UA 3OO6A 2F34A 5CI5A 3Q25A 1A99A 5DVIA 2I0CA 3OO7A 3JV9A 3SEYA 4MBPA 2ABHA 3QAXA 2RCAA 1NNFA 4TLLB 2R9JA 3VXCA 1DSNA 4MF3A 3F11A 2QRYA 3MAMA 4I9DA 4ELQA 1QW0A 2I6EA 2X7PA 5CMKA 4G8HA 1Q1KA 1Y3PA 1SW5A 4C1TA 5TPAB 2AYSA 1EU8A 1JW4A 3FASA 5AA2B 1Y3QA 2M8CA 4LZ7A 1ZKBA 2G93A 2NVUB 1JETA 3V8XB 2DOJA 3TAJA 3S9NC 1A55A 5AE4A 3U1OA 4LUBA 3N26A 2CMOA 1LFHA 1A8EA 4U22A 2Z23A 4M1VA 4GWOA 4WEDA 3KOSA 2Z8FA 4PQJA 4KHZE 3FIRA 2YPNA 3PV0E 4RJZA 5IKBA 3IO6A 3QK6A 1FTOA 1VSOA 2XD3A 4FEDA 3M3KA 2BJJX 2Z8EA 4I1DA 1FQBA 4LP2B 1MXYA 2A5SA 5ISUA 3T93B 4DCXA 2Q2CA 5TU0A 5HM4B 3UORA 3H6TA 2AL4A 5CMCA 4NWDA 3R6UA 1MY1A 1O64A 3PUVE 5A5XA 4LZ5A 2QL3A 4NTLA 1EZPA 1LBCA 2O1MA 3FZVA 4GL8A 3T66A 1VR5A 3Q26A 3TEPA 2IA4A 2H4IA 1PB9A 5AA2A 1OIBA 3G7WA 4NEDA 3LSLA 3PUXE 4Q30B 4NF5A 4HCWA 4DIGA 3OSQA 1SYIA 3MUQA 5HPQA 3IB1A 1MQIA 1USYE 1OQGA 3MJNA 1B46A 3QIMA 4OETA 4R6YA 3TELA 3O28A 4EDPA 5BWJA 3K2DA 4WKMA 3MP1A 1T0KA 1GGGA 3S4UA 5H8HB 1P1UA 2UVJA 2ZNSA 4H5FA 3RQTA 4U4SA 1BIYA 1F9BA 4EQ9A 1MPBA 2I3VA 5FTIA 1B0LA 2DXYA 3THIA 1URDA 2XXRA 5HBCA 1XVYA 1B1XA 3K6XA 5BUUA 1MQDA 1NL5A 1P1QA 5L9OA 4O3BA 5H8NA 1B3EA 1RKMA 4OESA 4YKIA 3KGCA 1AIVA 2ZMBA 1B7UA 2DSFA 5L8DA 4ND9A 4QF9A 5I59B 3O2AA 2Y7RA 3KBRA 1NKXA 4X1BA 5I57B 1D9YA 2OBGA 3ONMA 2A5TA 1HSLA 4YMBA 1ELJA 1M5CA 5H8FA 2ESNA 3DLNA 2H99A 1XVXA 1QUJA 3FXUA 3MP8A 2W7YA 1GVCA 3UA8A 1OLAA 2RKMA 4K3FA 3K0VA 2GFEA 4MLQA 5AA2D 4IO3A 3O97A 3PMVA 4NF6A 4UACA 2V3TA 3H6VA 1R6ZA 4IO7A 4BDOA 1LAHE 3DM0A 5H8HA 3S2VA 2V3QA 5ELVA 4LZ8A 3GBAA 1Z7ME 2OCUA 3FGSA 4C1UA 3OSRA 4WEPA 4FEBA 1BLFA 4U23A 3CIJA 2FA7A 3B6TA 1D4NA 4KR5A 4NF8A 4NF4A 3SDFA 1MDQA 2XXPA 1MY0A 3EF7A 2DVCA 3A3UA 1IQ7A 2OWTA 3FJMA 1OMPA 1SBPA 1VFDA 3C4MA 1H3DA 2XHDA 4GIZA 4F3SA 5I58B 4OQOA 1OVBA 3TPAA 1FTLA 2ONKE 3RY3A 4DCYA 1MY3A 2Q89A 2R6GE 1LSTA 4OENA 2RF1A 3ZKLA 2CZLA 3CVGA 5I59A 4F29A 2F5XA 1MQHA 1IEJA 3RPWA 1M5DA 5DT6A 4EQ7A 1MY4A 1P1WA 2HZKA 3P7IA 2RC9A 4THIA 2RINA 1SI0A 3PPQA 1QKAA 4IGTA 4KCCA 3LUYA 1PDAA 1LB8A 4YKPA 3H3GA 3MW0A 1I6QA 3KOTA 2VP1A 1O7TA 5FHNA 3KG2A 4JBZA 4XTCQ 4XKNA 4E0WA 4GD5A 3KJ7A 5TP9B 3CI8A 2H98A 4H1XA 4OZ9A 4QFNA 4F1VA 3H6WA 3IOUA 4YICA 2G29A 1N76A 3PGFA 3LBSA 3R26A 3PPPA 1NNKA 3FVKA 1IXHA 2UVGA 2YJPA 2OWSA 4DXUA 1XHYA 4BDNA 3VLVA 3TQLA 5CBRA 4JWYA 2I4BA 4OXVA 1QUKA 3O6IA 1FQCA 2P2AA 4P11A 4UA8A 3SESA 1B05A 3EHUA 3OEMA 3RLFE 1Y3NA 3D4GA 3USDA 4R6KA 4BLAA 5ITPA 3DP8A 1LAXA 2Q9TA 2ONRA 4RPOA 3N5LA 3SEXA 2NUVA 1H44A 1O63A 2XX9A 2ANJA 1MRPA 4EQBA 1M5EA 3V83A 4JDFA 4X1DA 5CBSA 5B7DA 1MXWA 4F39A 3E13X 4X48A 3HSTA 4YAHX 4F3GA 4HS7A 5I56B 2RC8A 5K2XA 1LB9A 2Q88A 1UIUA 1US4A 2F7CA 2HCAA 1XT8A 2XXQA 5KDTA 3ZS6A 5TP9A 2QMWA 3K1MA 4LQ5A 4I62A 2UYEA 1SW4A 2DP8A 4KYEA 1MQGA 4ZEDA 1RYXA 3PPOA 1OVTA 3HCQA 2ZYNA 2R71A 2RCBA 1JNFA 3T9XB 1JEUA 1DPPA 4QFPA 2LAOA 2X26A 1UQWA 4FAJA 1IITA 1ANFA 5LOMA 4POXA 3MVXA 4OEVA 4Q5TA 5A5XB 1FQEA 3N6TA 1SQYA 4JWOA 3MWBA 3ZKKA 4ZEIA 3CSGA 4G68B 3S9EA 1B4ZA 2HAUA
chains in the Genus database with same CATH superfamily
1MPCA 4GOTA 5CMMA 3U8QA 4N6PA 5H8QB 2WYKA 4ZE9A 3V89B 5IZ3A 4OA4A 2QMXA 2QS1A 4NF5B 5JK4A 1MPDA 4RK9A 2AIXA 1B3HA 3PU5A 4KYDA 2XXKA 2F7BA 4EUOA 3CRBA 4F2QA 4F3PA 3PD8A 3E4RA 5IZZA 5H8SA 1DOTA 3FD3A 3K6UA 3VXBA 1XC1A 5I56A 3EHTA 1IXGA 3TFLA 1UTBA 5I2NA 4KYSA 5DEXB 5F1QA 1YZ0A 5EQ7A 1NNPA 2R8TA 3B8BA 3MP6A 1R9QA 3S9LC 2B4MA 5EQ8A 2PMSA 1N84A 5IM2A 4GWYA 4G4PA 1EZOA 1SDXA 3C32A 1FBCA 4MH5A 4MFIA 5AA3A 4P0GA 5DW8A 3TDJA 1IMDA 3IOWA 5IGAA 1FPBA 5H8NB 1LBXA 3TTKA 3MVYA 1N3XA 4H65A 4PFUA 1SW2A 5ESYA 3TCGA 1B2HA 4ONYA 4R73A 3EPEA 2WX9A 4U1OA 3T9UA 1LLSA 3GZGA 3K01A 4G68A 3T9HB 1R9LA 2OLBA 4YKJA 3PPNA 4G8NA 3HHGA 3JZJA 3K02A 2A5TB 4NAPA 4NX1A 5H8QA 4OERA 4MX6A 5JEIA 3PMXA 5H8FB 4R2BA 3B6WA 3MVWA 1AOVA 4OHNA 2GH9A 3C9HA 3B6QA 3MZ9A 2E1SA 2XXYA 1G0HA 3S9MC 4GXSB 3H03A 1MM6A 1A40A 3OOAA 4OTEA 2Q8JA 4DZ1A 1II5A 1S50A 3RTWB 4ESWA 1B3FA 2Y7PA 4IO6A 5L9MA 5I84A 2OWZA 4O8MA 3IORA 3CG3A 4ZZAA 4NF6B 3G3HA 3HV1A 2THIA 1IMAA 3LSFB 4ECFA 1XS5A 5DEXA 2XXWA 2ZXTA 3HN0A 3JYRA 3VE1B 2Y7IA 2H9BA 2UVIA 1MM7A 3E78A 3OO8A 1AMFA 3FXBA 4OVPA 4Z7EA 1KA1A 4QBAA 4U4XA 1MY2A 2F3DA 3EHSA 2DDKA 4R72A 5F7VA 1HSEA 3K00A 4X04A 1K9ZA 3TODA 1NV5A 4NF8B 4NF4B 1B6HA 5DVFA 1KWHA 3MPKA 3BIHA 4U2RA 3IR1A 3QUJA 3FJ7A 3FJGA 4GL0A 3DP6A 2V3UA 4FE8A 5J1DA 3KEIA 3FXRA 1NI9A 4F18A 4YB6A 3CR9A 4PP0A 2PYYA 3M3FA 4KI0E 3PMWA 5LTCA 1HSJA 4R6HA 1FPEA 4GWUA 2XX7A 3OXNA 2D21A 4EF1A 4OANA 1RDZA 2Y7KA 4LONB 4R75A 5F24A 2UVHA 2FBPA 3IK6B 1I6AA 2I48A 3EQ1A 1D9QA 1FCKA 5I2KA 2XXIA 1IUDA 3MZBA 1IZ1A 2ZYOA 1DMBA 2H25A 4XKPA 1A7LA 3SEVA 1A8FA 1VFEA 1DPEA 2WEFA 3C36A 4OEUA 4N8YA 5FTHA 3VLWA 1Z7NE 1SVXB 3FV2A 4RPNA 5JTYA 4EF2A 1B0HA 3G3FA 1EZ9A 3O9PA 4MLVA 2FIEA 2QSXA 1URGA 4OFOA 3HO7A 4G68C 2I49A 4PFIA 3LR1A 4PDHA 2O1LA 1ZMGA 3IJXB 2GHBA 2YLNA 3ILTB 2I0BA 2O84X 4QSEA 3H7MA 4P3LA 1WODA 2HAVA 3OMBA 4N15A 5A5LA 4ZDMA 4NE4A 3G3KA 3CG1A 4ELOA 2JJKA 4IO5A 4HE1A 4P9KA 1IMFA 2RC7A 4MHFA 4I8CA 4PGPA 2UXAA 2Y84A 2REGA 3MYUA 2UYFA 3QYTA 4WXJA 5ICTA 2QPQA 3ODBA 4YKKA 4P1LA 2XXTA 1NH7A 5KCJB 1TXFA 1JEVA 4XKRA 1JVXA 4LATA 5EHMA 1EYKA 2VOZA 4GXAA 2V84A 4PFRA 3LSWA 1LCFA 2FYIA 1H45A 2XD2A 1PC3A 2L5VA 1NV4A 3UP9A 3H06B 3W9WA 1SPIA 4KPTA 4KCDA 4DDDA 3T96B 2I58A 4AB5A 2XXXA 4ZECA 2OZZA 4IO2A 4HXVA 4FORA 2F8DA 3PUZE 5M2VA 3TQWA 1FPGA 3QMFA 4O3CA 2I3WA 3W15C 3B7DA 1ATGA 4F2OA 3GXAA 3B50A 2PCRA 1I6BA 1FTAA 3TMGA 5ITOA 2VHAA 5KDTB 1P99A 3OD7A 2O7UA 5CMBA 2B3FA 1LBBA 3BBRA 4OVJA 3N6UA 4QRZA 4GRKA 4BDLA 1NFTA 2F7AA 1IIWA 2QS3A 2X7QA 4NHBA 4GVOA 1JW1A 1N7WA 2F78A 1I69A 1N04A 1B40A 3MC2A 4JXIA 4MAGA 3UN6A 3EN3A 4YU0A 4KFQA 1B7ZA 1BP5A 1Y1MA 3C34A 4PFYA 3IOVA 5EQ9A 3TTLA 2F35A 1H43A 4EXLA 1N0TA 3GYYA 4RY1A 5AA4A 3I3VA 5ET7A 4HTGA 5KCJA 2DE2A 2I4CA 4N91A 2DVZA 2NXOA 1R1NA 1EH3A 3C31A 1TFDA 4QHQA 2O69A 5IZ3B 1IXCA 3KSJA 1P1OA 1B5IA 2QS2A 2Z22A 3IX1A 4RXLA 4O7MA 2F36A 1MDP1 4G2ZA 1B9JA 2VT5A 3UIFA 3O29A 4F22A 1UTBB 4RK2A 5I2NB 4ZEKA 4H67A 4PE5B 1B32A 3BKIB 1A54A 4ZZEA 1LFIA 2H5YA 3KFMA 4P47A 3IB2A 4ZEFA 3D4CA 3PUWE 5DVJA 3LUZA 4JVDA 2F3BA 3LSXA 4PFWA 2PBWA 3QUFA 1L5TA 2XX8A 1NUWA 2VD2A 3IB0A 3QSLA 4DXBA 2HEUA 1ZBMA 4R9FA 2VGQA 2DE4A 4H8IA 4POWA 4GQOA 1B4HA 4O94A 3KN7A 1LGBC 5ICQA 3IFCA 1SYHA 4GFRA 3SZPA 1GTKA 2O6AA 2V93A 3SETA 1FPLA 2PVUA 2ZZWA 4N07A 2QJEA 4MJOA 4N4UA 1B7HA 4Q8RA 1NUZA 2XXUA 4LVQA 4N13A 1SI1A 3W9VA 3IL1B 3TCFA 4H6DA 3U93A 3FVNA 3BFUA 1WDNA 3FV1A 3O66A 3O6GA 3OEKA 3IJOB 2KLFA 1AL3A 4JSOA 3TKDA 1YTVA 5IAIA 2ZYKA 5CRYA 1PB8A 3FATA 3RT6B 2ZYMA 1CB6A 4YZZA 4F19A 4OMBA 4QFLA 1DTGA 2DXRA 4FECA 2XXVA 3PPRA 1FBFA 1FBDA 1TFAA 4ISUA 1YAEA 3VFJA 3TCHA 1NH8A 3M3LA 2Y7WA 1FRPA 4FIMA 3Q29A 4KXPA 4O3AA 4GWSA 1Q9DA 1SW1A 4JSDA 4ELRA 4QSDA 3UGWA 1MXUA 4OFJA 2CZIA 4H5GA 1Y9UA 1OLCA 4PFBA 2IEEA 4N81A 1ZLQA 4PAFA 4IO4A 1XOCA 1S9TA 1GR2A 1MXZA 2HQ0A 4MNIA 1BTJA 4TLMB 4PF8A 3RT8A 3TZAA 1LAGE 4FATA 1USYH 3K1PA 4TQUQ 4IY5A 3ROJA 3G3IA 1B5HA 4JVCA 4JVIA 2DS9A 2QS4A 1B3GA 1B51A 4OFLA 3Q28A 4MNPA 2WKYA 3U92A 5AA1A 3DELB 2FHYA 3A09A 4BDQA 5TPAA 3T22A 3L6GA 4RNSA 4H0WA 3VVFA 1UIVA 4PFTA 2OJTA 5I2KB 3WAEA 4L17A 1US5A 2QVVA 2HXWA 3PUYE 1D3KA 3TTMA 3RGYA 3AXFA 3IOTA 3CFZA 3UK4A 5DYHA 2KR0A 3K6WA 4EXKA 3LC8A 1DCUA 2F97A 4P0IA 5JTYB 1FBEA 4GX4A 1S7YA 3OELA 1P1NA 4F1YA 1FTKA 4UABA 2Q8MA 2DQVA 2DWAA 2CZHA 2VPNA 1RYOA 4N17A 3GLBA 1ZU0A 3R7XA 1DTZA 4ESXA 4XKQA 1B1HA 3PD9A 2PT1A 3FVOA 3IFAA 3MPLA 1B5JA 4LQ2A 4F31B 1MH4A 1FSAA 1M5FA 4AB6A 4DE8A 1Y4CA 3U72A 4IY6A 4JWXA 3DP4A 4HE0A 4GLIA 2P0SA 1UTHB 4NWCA 1PBPA 4I40A 2Y5LA 3G3JA 2E0SA 3CFLA 4IB2A 3RTFB 4BDMA 3SKPA 4GX6A 2FVZA 2NOOA 4YMAA 1NNTA 1AH5A 3KN3A 1Y4TA 4YB5A 3E9XA 3C33A 4R9GA 1FTJA 1MG1A 1LBYA 4PCDA 3M8UA 4F3BA 4KD5A 2P1SA 4DXCA 1POTA 1FPFA 2F6PA 1GV8A 2B65A 1Y20A 4N8GA 2XA5A 3L6HA 2Q2AA 1NUYA 1ZIUA 5CC2A 2ALUA 4PC9A 2Z8DA 4LA9A 3FVGA 1LAFE 4DLDA 1M5BA 1PBQA 3VV5A 1B52A 1FQAA 2REJA 4XF5A 3OO9A 1POY1 4KQPA 1FBHA 4ELPA 4U21A 3T0JA 5L9SA 3CFXA 4G8MA 4R2FA 1RDYA 2HFBA 1DBZA 1NUXA 3A3CA 3ECRA 4G77A 2F6GA 3FXQA 2Q74A 3KJTA 3KZGA 1VE4A 1N3WA 5FHMA 3SEUA 3O6HA 2XXHA 1J1NA 3ZSFA 1SD3A 3K6VA 1IXIA 3C35A 1URSA 4ZS9A 3TTNA 3HPIA 2DE3A 4AQ4A 5I5PA 3H4ZA 1UTHA 1NV7A 2QVUA 3CSBA 5AA4B 4TOZA 1MXVA 3TUSA 4C0RA 1VDWA 4OWDA 4PAKA 4QFKA 1YXIA 4OVRA 1QUIA 1PB7A 3VDFA 1QJMA 2PFYA 4OVSA 2Y5KA 4RA1A 1MH3A 3SERA 1OQHA 1LFGA 3SEWA 4YB7A 2GHAA 2DYXA 4IR8A 5ET8A 1YPNA 1B3LA 5EYHA 5I57A 4F1UA 3KN8A 3MQ9A 2AL5A 3WAFA 3V5AA 1QKBA 1FQDA 2DWHA 1Q35A 3Q27A 1N7XA 4QSCA 4NMYA 3E3KA 2GQ1A 2ZNUA 3FUZA 5EYFA 5CM6A 4RYAA 4G61A 3A29A 4Z0IA 4H8JA 2ONSA 3T9VA 3KSXA 2O7IA 2XWVA 4LN5A 1YCJA 3I6VA 1MS7A 5K2YA 3K4UA 4E0XA 4PF6A 1NMUA 1AWBA 4GF8A 3ILUB 3G3GA 1JVYA 4U1ZA 5DTBA 4HCYA 4Q0CA 5KZTA 5FHOA 1FTMA 1ZTYA 1QVSA 4IGRA 4PETA 2VD3A 2HPGA 3D1RA 4ZE8A 4NGUA 3VVDA 4HW8A 1Y1ZA 3MZ1A 2B3BA 2WYPA 2GRVA 1WVJA 4GBWA 5B70A 3TYHA 4NN3A 1LCTA 1IMBA 3RNNA 3KC1A 2O68A 4X9TA 3GBBA 2PT2A 1LEVA 4PBQA 1CE2A 1FPDA 3IO4A 4XIGQ 1FQFA 4OYVA 5I58A 3MBPA 4ZEBA 2DWIA 3HHFA 2CEYA 4N6DA 5LDZA 4M4GA 1TT1A 5EHSA 3RN8A 1B58A 4QFOA 3QXMA 2NWJA 2D5WA 4XXUA 1XI6A 4FJPA 2P3NA 1NV2A 1MQJA 4R74A 3IAZA 3EKIA 3RPLA 3TTRA 3K1NA 1PEBA 1JW5A 2D3IA 3U94A 2V25A 4BDRA 1D9VA 1H76A 1KZ8A 4JB7A 3RYDA 2XWIA 2FNCA 3VVEA 1DK4A 2O51A 3OENA 1JQFA 3MVZA 3VLUA 2HZLA 1QULA 1FW0A 2OK2A 1TWYA 2XWKA 2DWJA 1BKAA 2PX1A 1MXXA 1ZJLA 3RUMA 2WBDA 3N94A 3I5OA 2ZNTA 3BFTA 3H6UA 3OO6A 2F34A 5CI5A 3Q25A 1A99A 5DVIA 2I0CA 3OO7A 3JV9A 3SEYA 4MBPA 2ABHA 3QAXA 2RCAA 1NNFA 4TLLB 2R9JA 1FPKA 3VXCA 1DSNA 1FBGA 4MF3A 3F11A 2QRYA 3MAMA 4I9DA 1IMCA 4ELQA 1QW0A 2I6EA 2X7PA 5CMKA 4G8HA 3U65A 1Q1KA 1Y3PA 4PDDA 1SW5A 4C1TA 2XWOA 4P56A 5TPAB 2AYSA 1EU8A 1JW4A 3E79A 3FASA 2CZKA 5AA2B 1Y3QA 2M8CA 4LZ7A 1ZKBA 2G93A 4GBVA 2NVUB 1JETA 3V8XB 2DOJA 3TAJA 3S9NC 4QXDA 1A55A 5AE4A 3U1OA 4LUBA 3N26A 2CMOA 1LFHA 1A8EA 2MKZA 4U22A 2Z23A 4M1VA 4NQ8A 4GWOA 4WEDA 4OVTA 3KOSA 2Z8FA 1JP4A 4PQJA 4KHZE 2KQZA 3MSTA 3FIRA 2YPNA 3PV0E 4RJZA 4GX3A 5EYGA 5ET6A 5IKBA 3IO6A 2WBBA 4AS4A 4MIJA 4PE3A 3QK6A 2CEXA 1FTOA 1VSOA 5I3SA 2PFZA 2XD3A 4FEDA 3M3KA 2BJJX 2Z8EA 3ISPA 4I1DA 1FQBA 4LP2B 3PTYA 1MXYA 2A5SA 5ISUA 4O7IA 3T93B 5T3JA 1NV0A 4DCXA 4X8RA 2Q2CA 5TU0A 5HM4B 3UORA 1RDXA 3H6TA 2AL4A 5CMCA 4NWDA 3R6UA 1MY1A 1O64A 3PUVE 5A5XA 4LZ5A 2QL3A 4NTLA 1EZPA 1LBCA 2O1MA 3FZVA 4GL8A 3T66A 1INPA 1VR5A 2VPOA 2FIXA 4P1EA 3Q26A 3TEPA 2IA4A 2H4IA 1K9YA 1PB9A 5AA2A 4PBHA 1OIBA 3G7WA 4NEDA 3LSLA 2HHMA 1FBPA 3FBPA 3PUXE 4Q30B 4PGNA 4NF5A 4HCWA 4DIGA 4GWXA 3OSQA 1SYIA 3MUQA 5HPQA 3IB1A 1MQIA 1USYE 1OQGA 3MJNA 4GWZA 1B46A 3QIMA 4OETA 4R6YA 3TELA 3O28A 4EDPA 5BWJA 1G0IA 3K2DA 4WKMA 3MP1A 1T0KA 1GGGA 3S4UA 5ET5A 5H8HB 1P1UA 2UVJA 2ZNSA 4H5FA 3RQTA 4U4SA 1BIYA 1F9BA 4EQ9A 2HXRA 1MPBA 4NF0A 5FBPA 2I3VA 5FTIA 1LBWA 1B0LA 2DXYA 3THIA 1URDA 3LV0A 3KBZA 1LBZA 2XXRA 5HBCA 1XVYA 1B1XA 3K6XA 5BUUA 1MQDA 1NL5A 4HE2A 4MCOA 4DI4B 4PTKA 1KA0A 1P1QA 5L9OA 4O3BA 5H8NA 1B3EA 1RKMA 4OESA 4YKIA 3KGCA 1AIVA 2ZMBA 1B7UA 2DSFA 3BIGA 4PAIA 5L8DA 4ND9A 4QF9A 5I59B 3O2AA 2Y7RA 3KBRA 1NKXA 4X1BA 5I57B 1D9YA 2OBGA 3ONMA 1FJ6A 2A5TA 1HSLA 4MEVA 4YMBA 1ELJA 1M5CA 5H8FA 2OX3A 2ESNA 3DLNA 2B4LA 2H99A 1XVXA 3CHGA 5IZ1A 1QUJA 4DI3D 3FXUA 1LBVA 3MP8A 1BK4A 2W7YA 4MNCA 1GVCA 3UA8A 1OLAA 2RKMA 4K3FA 3K0VA 4I3YA 2GFEA 4MLQA 5AA2D 4IO3A 3O97A 3PMVA 4NF6A 4UACA 2V3TA 3H6VA 1R6ZA 3KC0A 4IO7A 4BDOA 1LAHE 3DM0A 5H8HA 3S2VA 2V3QA 5ELVA 4LZ8A 3GBAA 1Z7ME 2OCUA 3FGSA 4C1UA 3OSRA 4WEPA 4FEBA 1BLFA 1NV6A 4U23A 3CIJA 2FA7A 3B6TA 1D4NA 4KR5A 4NF8A 4NF4A 3SDFA 1MDQA 2XXPA 1MY0A 3EF7A 2DVCA 3A3UA 1IQ7A 2OWTA 3FJMA 1FPJA 1OMPA 1SBPA 1VFDA 3C4MA 1H3DA 2XHDA 4GIZA 4F3SA 5I58B 4OQOA 1OVBA 3TPAA 1FTLA 2ONKE 3RY3A 4DCYA 1MY3A 2Q89A 2R6GE 1LSTA 4OENA 4XEQA 2RF1A 3ZKLA 2CZLA 3CVGA 5I59A 4F29A 4NG7A 2F5XA 4MMPA 1MQHA 1IMEA 4H45A 1IEJA 3RPWA 2ZZXA 1M5DA 5DT6A 4EQ7A 3RPLB 1MY4A 1P1WA 2HZKA 3P7IA 5J16A 2RC9A 4THIA 2RINA 1SI0A 3PPQA 1QKAA 4IGTA 4KCCA 3LUYA 1PDAA 1LB8A 4YKPA 3H3GA 3MW0A 1I6QA 3KOTA 2VP1A 1O7TA 5FHNA 3KG2A 4JBZA 4XTCQ 4XKNA 5I7IA 4E0WA 4GD5A 3KJ7A 5TP9B 3CI8A 2H98A 4H1XA 4OZ9A 4QFNA 4F1VA 1QGXA 3H6WA 3IOUA 1EYJA 4XFEA 4FBPA 4YICA 2G29A 4H46A 1N76A 2QFLA 3PGFA 3LBSA 3HFUA 3R26A 3PPPA 1NNKA 3FVKA 1NV3A 1IXHA 2UVGA 2YJPA 2OWSA 4DXUA 1XHYA 4BDNA 3VLVA 3TQLA 5EQAA 1YYZA 5CBRA 4JWYA 2I4BA 4OXVA 1QUKA 3O6IA 1NV1A 4UA8A 1FQCA 2P2AA 4P11A 4I3EA 3SESA 1EYIA 1B05A 3EHUA 3OEMA 3RLFE 1Y3NA 3D4GA 3USDA 4R6KA 4BLAA 5ITPA 3DP8A 1LAXA 2Q9TA 2ONRA 4RPOA 2P3VA 3N5LA 3NOHA 3SEXA 2NUVA 1H44A 1O63A 2XX9A 2ANJA 1MRPA 4EQBA 1M5EA 2ZZVA 3V83A 4JDFA 4X1DA 5CBSA 5B7DA 1FJ9A 1MXWA 4F39A 2QVRA 3E13X 4X48A 3HSTA 4YAHX 4F3GA 4HS7A 5I56B 2RC8A 5K2XA 1LB9A 2V4CA 2Q88A 1UIUA 1US4A 2F7CA 2HCAA 1XT8A 2XXQA 5KDTA 3ZS6A 5TP9A 2QMWA 3K1MA 4LQ5A 4I62A 2UYEA 1CNQA 1SW4A 2DP8A 4KYEA 1MQGA 4ZEDA 1RYXA 3PPOA 4OVQA 4AS5A 3T1BA 1OVTA 3HCQA 2BJIA 2ZYNA 2R71A 2RCBA 1JNFA 4GWWA 3T9XB 1JEUA 1DPPA 4QFPA 2LAOA 2X26A 1UQWA 4FAJA 1IITA 1ANFA 5LOMA 4POXA 4N6KA 3MVXA 4OEVA 4Q5TA 5A5XB 1FQEA 3N6TA 1SQYA 4JWOA 3MWBA 4P8BA 3ZKKA 4ZEIA 3CSGA 1FPIA 4G68B 3S9EA 1B4ZA 2HAUA
chains in the Genus database with same CATH topology
1MPCA 4GOTA 5CMMA 3U8QA 4N6PA 5H8QB 4ZE9A 3V89B 2QMXA 2QS1A 4NF5B 5JK4A 1MPDA 4RK9A 2AIXA 1B3HA 3PU5A 4KYDA 2F7BA 4EUOA 3CRBA 4F2QA 4F3PA 3PD8A 3E4RA 5H8SA 1DOTA 3FD3A 3K6UA 3VXBA 1XC1A 5I56A 3EHTA 1IXGA 3TFLA 1UTBA 5I2NA 4KYSA 5DEXB 5F1QA 1NNPA 3MP6A 1R9QA 3S9LC 2PMSA 1N84A 4G4PA 1EZOA 1SDXA 3C32A 4MH5A 4MFIA 5AA3A 4P0GA 3TDJA 3IOWA 5H8NB 3TTKA 3MVYA 1N3XA 4H65A 4PFUA 1SW2A 3TCGA 1B2HA 4ONYA 4R73A 3EPEA 4U1OA 3T9UA 1LLSA 3GZGA 3K01A 4G68A 3T9HB 1R9LA 2OLBA 4YKJA 3PPNA 4G8NA 3HHGA 3JZJA 3K02A 2A5TB 5H8QA 4OERA 5JEIA 3PMXA 5H8FB 4R2BA 3B6WA 3MVWA 1AOVA 4OHNA 2GH9A 3C9HA 3B6QA 3MZ9A 2E1SA 2XXYA 3S9MC 4GXSB 3H03A 1MM6A 1A40A 3OOAA 4OTEA 2Q8JA 4DZ1A 1II5A 1S50A 3RTWB 4ESWA 1B3FA 2Y7PA 4IO6A 5L9MA 5I84A 3IORA 3CG3A 4ZZAA 4NF6B 3G3HA 3HV1A 2THIA 3LSFB 4ECFA 1XS5A 5DEXA 2XXWA 2ZXTA 3HN0A 3JYRA 3VE1B 2Y7IA 2H9BA 2UVIA 1MM7A 3OO8A 1AMFA 4Z7EA 4U4XA 1MY2A 3EHSA 4R72A 5F7VA 1HSEA 3K00A 3TODA 4NF8B 4NF4B 1B6HA 5DVFA 1KWHA 3MPKA 4U2RA 3IR1A 3QUJA 3FJ7A 3FJGA 4GL0A 3DP6A 2V3UA 4FE8A 5J1DA 3KEIA 3FXRA 4F18A 4YB6A 3CR9A 4PP0A 2PYYA 3M3FA 4KI0E 3PMWA 1HSJA 4R6HA 2XX7A 3OXNA 2D21A 4EF1A 2Y7KA 4LONB 4R75A 2UVHA 3IK6B 1I6AA 2I48A 3EQ1A 1FCKA 5I2KA 2XXIA 1IUDA 3MZBA 1IZ1A 2ZYOA 1DMBA 2H25A 4XKPA 1A7LA 3SEVA 1A8FA 1VFEA 1DPEA 3C36A 4OEUA 5FTHA 3VLWA 1Z7NE 1SVXB 3FV2A 4RPNA 5JTYA 4EF2A 1B0HA 3G3FA 1EZ9A 3O9PA 4MLVA 2QSXA 1URGA 4OFOA 3HO7A 4G68C 2I49A 3LR1A 2O1LA 1ZMGA 3IJXB 2GHBA 2YLNA 3ILTB 2I0BA 2O84X 4QSEA 3H7MA 1WODA 2HAVA 3OMBA 4ZDMA 4NE4A 3G3KA 3CG1A 4ELOA 4IO5A 2RC7A 4I8CA 2UXAA 2Y84A 2REGA 2UYFA 3QYTA 4WXJA 5ICTA 2QPQA 3ODBA 4YKKA 2XXTA 1NH7A 5KCJB 1TXFA 1JEVA 4XKRA 1JVXA 4LATA 5EHMA 2VOZA 4GXAA 2V84A 3LSWA 1LCFA 2FYIA 1H45A 2XD2A 1PC3A 3UP9A 3H06B 3W9WA 4KPTA 4KCDA 4DDDA 3T96B 2I58A 4AB5A 2XXXA 4ZECA 2OZZA 4IO2A 4FORA 2F8DA 3PUZE 5M2VA 3TQWA 4O3CA 2I3WA 3W15C 3B7DA 1ATGA 4F2OA 3GXAA 1I6BA 3TMGA 5ITOA 2VHAA 5KDTB 1P99A 3OD7A 2O7UA 5CMBA 2B3FA 1LBBA 3BBRA 4OVJA 3N6UA 4QRZA 4GRKA 4BDLA 1NFTA 2F7AA 1IIWA 2QS3A 2X7QA 4GVOA 1JW1A 1N7WA 2F78A 1I69A 1N04A 1B40A 3MC2A 4JXIA 3UN6A 3EN3A 4YU0A 4KFQA 1B7ZA 1BP5A 1Y1MA 3C34A 4PFYA 3IOVA 3TTLA 2F35A 1H43A 4EXLA 1N0TA 4RY1A 5AA4A 3I3VA 4HTGA 5KCJA 2DE2A 2I4CA 2DVZA 2NXOA 1R1NA 1EH3A 3C31A 1TFDA 4QHQA 2O69A 1IXCA 3KSJA 1P1OA 1B5IA 2QS2A 2Z22A 3IX1A 4RXLA 2F36A 1MDP1 4G2ZA 1B9JA 3UIFA 3O29A 4F22A 1UTBB 4RK2A 5I2NB 4ZEKA 4H67A 4PE5B 1B32A 3BKIB 1A54A 4ZZEA 1LFIA 2H5YA 3KFMA 3IB2A 4ZEFA 3D4CA 3PUWE 5DVJA 3LSXA 4PFWA 2PBWA 3QUFA 1L5TA 2XX8A 2VD2A 3IB0A 3QSLA 4DXBA 2HEUA 1ZBMA 4R9FA 2VGQA 2DE4A 4H8IA 4POWA 4GQOA 1B4HA 3KN7A 1LGBC 5ICQA 1SYHA 4GFRA 1GTKA 2O6AA 2V93A 3SETA 2PVUA 4N07A 2QJEA 1B7HA 4Q8RA 2XXUA 4LVQA 4N13A 1SI1A 3W9VA 3IL1B 3TCFA 4H6DA 3U93A 3FVNA 3BFUA 1WDNA 3FV1A 3O66A 3O6GA 3OEKA 3IJOB 2KLFA 1AL3A 4JSOA 3TKDA 1YTVA 5IAIA 2ZYKA 5CRYA 1PB8A 3FATA 3RT6B 2ZYMA 1CB6A 4YZZA 4F19A 4OMBA 4QFLA 1DTGA 2DXRA 2XXVA 4FECA 3PPRA 1TFAA 4ISUA 1YAEA 3VFJA 3TCHA 1NH8A 3M3LA 2Y7WA 4FIMA 3Q29A 4O3AA 1SW1A 4JSDA 4ELRA 4QSDA 3UGWA 1MXUA 4OFJA 4H5GA 1Y9UA 1OLCA 2IEEA 1ZLQA 4IO4A 1XOCA 1S9TA 1GR2A 1MXZA 2HQ0A 1BTJA 4TLMB 3RT8A 3TZAA 1LAGE 4FATA 1USYH 3K1PA 4TQUQ 4IY5A 3G3IA 1B5HA 2DS9A 2QS4A 1B3GA 1B51A 4OFLA 3Q28A 2WKYA 3U92A 5AA1A 3DELB 3A09A 4BDQA 5TPAA 3T22A 3L6GA 4RNSA 4H0WA 3VVFA 1UIVA 4PFTA 2OJTA 5I2KB 3WAEA 4L17A 1US5A 2HXWA 3PUYE 1D3KA 3TTMA 3RGYA 3AXFA 3IOTA 3CFZA 3UK4A 5DYHA 3K6WA 4EXKA 3LC8A 2F97A 4P0IA 5JTYB 1S7YA 3OELA 1P1NA 4F1YA 1FTKA 2DQVA 2DWAA 1RYOA 3GLBA 1ZU0A 3R7XA 1DTZA 4ESXA 4XKQA 1B1HA 3PD9A 2PT1A 3FVOA 3MPLA 1B5JA 4LQ2A 4F31B 1MH4A 1M5FA 4AB6A 4DE8A 1Y4CA 3U72A 4IY6A 4JWXA 3DP4A 4GLIA 2P0SA 1UTHB 4NWCA 1PBPA 3G3JA 2E0SA 3CFLA 4IB2A 3RTFB 4BDMA 3SKPA 2NOOA 4YMAA 1NNTA 1AH5A 3KN3A 1Y4TA 4YB5A 3E9XA 3C33A 4R9GA 1FTJA 1MG1A 3M8UA 4F3BA 4KD5A 2P1SA 4DXCA 1POTA 2F6PA 1GV8A 2B65A 1Y20A 3L6HA 2Q2AA 1ZIUA 5CC2A 2ALUA 2Z8DA 4LA9A 3FVGA 1LAFE 4DLDA 1M5BA 1PBQA 3VV5A 1B52A 1FQAA 2REJA 3OO9A 1POY1 4KQPA 4ELPA 4U21A 5L9SA 3CFXA 4G8MA 4R2FA 2HFBA 3A3CA 3ECRA 4G77A 2F6GA 3FXQA 3KJTA 3KZGA 1VE4A 1N3WA 5FHMA 3SEUA 3O6HA 2XXHA 1J1NA 3ZSFA 1SD3A 3K6VA 1IXIA 3C35A 1URSA 4ZS9A 3TTNA 3HPIA 2DE3A 4AQ4A 3H4ZA 1UTHA 3CSBA 5AA4B 4TOZA 1MXVA 3TUSA 4C0RA 4OWDA 4QFKA 1QUIA 1PB7A 3VDFA 1QJMA 4RA1A 1MH3A 3SERA 1OQHA 1LFGA 3SEWA 4YB7A 2GHAA 2DYXA 1YPNA 1B3LA 5I57A 4F1UA 3KN8A 3MQ9A 2AL5A 3WAFA 3V5AA 1QKBA 1FQDA 2DWHA 1Q35A 3Q27A 1N7XA 4QSCA 4NMYA 3E3KA 2ZNUA 3FUZA 5EYFA 5CM6A 4RYAA 4Z0IA 4H8JA 2ONSA 3T9VA 3KSXA 2O7IA 1YCJA 3I6VA 1MS7A 5K2YA 3K4UA 4E0XA 1NMUA 4GF8A 3ILUB 3G3GA 1JVYA 4U1ZA 5DTBA 4HCYA 4Q0CA 5KZTA 5FHOA 1FTMA 1ZTYA 1QVSA 4IGRA 4PETA 2VD3A 4ZE8A 3VVDA 4HW8A 1Y1ZA 3MZ1A 2B3BA 2GRVA 1WVJA 5B70A 3TYHA 1LCTA 3RNNA 2O68A 4X9TA 3GBBA 2PT2A 1CE2A 3IO4A 4XIGQ 1FQFA 4OYVA 5I58A 3MBPA 4ZEBA 2DWIA 3HHFA 4M4GA 1TT1A 5EHSA 3RN8A 1B58A 4QFOA 3QXMA 2NWJA 2D5WA 4XXUA 4FJPA 1MQJA 4R74A 3IAZA 3TTRA 3K1NA 1PEBA 1JW5A 2D3IA 3U94A 2V25A 4BDRA 1D9VA 1H76A 4JB7A 2FNCA 3VVEA 2O51A 3OENA 1JQFA 3MVZA 3VLUA 2HZLA 1QULA 1FW0A 2OK2A 1TWYA 2DWJA 1BKAA 2PX1A 1MXXA 1ZJLA 3RUMA 3N94A 3I5OA 2ZNTA 3BFTA 3H6UA 3OO6A 2F34A 5CI5A 3Q25A 1A99A 5DVIA 2I0CA 3OO7A 3JV9A 3SEYA 4MBPA 2ABHA 3QAXA 2RCAA 1NNFA 4TLLB 2R9JA 3VXCA 1DSNA 4MF3A 3F11A 2QRYA 3MAMA 4I9DA 4ELQA 1QW0A 2I6EA 2X7PA 5CMKA 4G8HA 1Q1KA 1Y3PA 1SW5A 4C1TA 5TPAB 2AYSA 1EU8A 1JW4A 3FASA 5AA2B 1Y3QA 2M8CA 4LZ7A 1ZKBA 2G93A 2NVUB 1JETA 3V8XB 2DOJA 3TAJA 3S9NC 1A55A 5AE4A 3U1OA 4LUBA 3N26A 2CMOA 1LFHA 1A8EA 4U22A 2Z23A 4M1VA 4GWOA 4WEDA 3KOSA 2Z8FA 4PQJA 4KHZE 3FIRA 2YPNA 3PV0E 4RJZA 5IKBA 3IO6A 3QK6A 1FTOA 1VSOA 2XD3A 4FEDA 3M3KA 2BJJX 2Z8EA 4I1DA 1FQBA 4LP2B 1MXYA 2A5SA 5ISUA 3T93B 4DCXA 2Q2CA 5TU0A 5HM4B 3UORA 3H6TA 2AL4A 5CMCA 4NWDA 3R6UA 1MY1A 1O64A 3PUVE 5A5XA 4LZ5A 2QL3A 4NTLA 1EZPA 1LBCA 2O1MA 3FZVA 4GL8A 3T66A 1VR5A 3Q26A 3TEPA 2IA4A 2H4IA 1PB9A 5AA2A 1OIBA 3G7WA 4NEDA 3LSLA 3PUXE 4Q30B 4NF5A 4HCWA 4DIGA 3OSQA 1SYIA 3MUQA 5HPQA 3IB1A 1MQIA 1USYE 1OQGA 3MJNA 1B46A 3QIMA 4OETA 4R6YA 3TELA 3O28A 4EDPA 5BWJA 3K2DA 4WKMA 3MP1A 1T0KA 1GGGA 3S4UA 5H8HB 1P1UA 2UVJA 2ZNSA 4H5FA 3RQTA 4U4SA 1BIYA 1F9BA 4EQ9A 1MPBA 2I3VA 5FTIA 1B0LA 2DXYA 3THIA 1URDA 2XXRA 5HBCA 1XVYA 1B1XA 3K6XA 5BUUA 1MQDA 1NL5A 1P1QA 5L9OA 4O3BA 5H8NA 1B3EA 1RKMA 4OESA 4YKIA 3KGCA 1AIVA 2ZMBA 1B7UA 2DSFA 5L8DA 4ND9A 4QF9A 5I59B 3O2AA 2Y7RA 3KBRA 1NKXA 4X1BA 5I57B 1D9YA 2OBGA 3ONMA 2A5TA 1HSLA 4YMBA 1ELJA 1M5CA 5H8FA 2ESNA 3DLNA 2H99A 1XVXA 1QUJA 3FXUA 3MP8A 2W7YA 1GVCA 3UA8A 1OLAA 2RKMA 4K3FA 3K0VA 2GFEA 4MLQA 5AA2D 4IO3A 3O97A 3PMVA 4NF6A 4UACA 2V3TA 3H6VA 1R6ZA 4IO7A 4BDOA 1LAHE 3DM0A 5H8HA 3S2VA 2V3QA 5ELVA 4LZ8A 3GBAA 1Z7ME 2OCUA 3FGSA 4C1UA 3OSRA 4WEPA 4FEBA 1BLFA 4U23A 3CIJA 2FA7A 3B6TA 1D4NA 4KR5A 4NF8A 4NF4A 3SDFA 1MDQA 2XXPA 1MY0A 3EF7A 2DVCA 3A3UA 1IQ7A 2OWTA 3FJMA 1OMPA 1SBPA 1VFDA 3C4MA 1H3DA 2XHDA 4GIZA 4F3SA 5I58B 4OQOA 1OVBA 3TPAA 1FTLA 2ONKE 3RY3A 4DCYA 1MY3A 2Q89A 2R6GE 1LSTA 4OENA 2RF1A 3ZKLA 2CZLA 3CVGA 5I59A 4F29A 2F5XA 1MQHA 1IEJA 3RPWA 1M5DA 5DT6A 4EQ7A 1MY4A 1P1WA 2HZKA 3P7IA 2RC9A 4THIA 2RINA 1SI0A 3PPQA 1QKAA 4IGTA 4KCCA 3LUYA 1PDAA 1LB8A 4YKPA 3H3GA 3MW0A 1I6QA 3KOTA 2VP1A 1O7TA 5FHNA 3KG2A 4JBZA 4XTCQ 4XKNA 4E0WA 4GD5A 3KJ7A 5TP9B 3CI8A 2H98A 4H1XA 4OZ9A 4QFNA 4F1VA 3H6WA 3IOUA 4YICA 2G29A 1N76A 3PGFA 3LBSA 3R26A 3PPPA 1NNKA 3FVKA 1IXHA 2UVGA 2YJPA 2OWSA 4DXUA 1XHYA 4BDNA 3VLVA 3TQLA 5CBRA 4JWYA 2I4BA 4OXVA 1QUKA 3O6IA 1FQCA 2P2AA 4P11A 4UA8A 3SESA 1B05A 3EHUA 3OEMA 3RLFE 1Y3NA 3D4GA 3USDA 4R6KA 4BLAA 5ITPA 3DP8A 1LAXA 2Q9TA 2ONRA 4RPOA 3N5LA 3SEXA 2NUVA 1H44A 1O63A 2XX9A 2ANJA 1MRPA 4EQBA 1M5EA 3V83A 4JDFA 4X1DA 5CBSA 5B7DA 1MXWA 4F39A 3E13X 4X48A 3HSTA 4YAHX 4F3GA 4HS7A 5I56B 2RC8A 5K2XA 1LB9A 2Q88A 1UIUA 1US4A 2F7CA 2HCAA 1XT8A 2XXQA 5KDTA 3ZS6A 5TP9A 2QMWA 3K1MA 4LQ5A 4I62A 2UYEA 1SW4A 2DP8A 4KYEA 1MQGA 4ZEDA 1RYXA 3PPOA 1OVTA 3HCQA 2ZYNA 2R71A 2RCBA 1JNFA 3T9XB 1JEUA 1DPPA 4QFPA 2LAOA 2X26A 1UQWA 4FAJA 1IITA 1ANFA 5LOMA 4POXA 3MVXA 4OEVA 4Q5TA 5A5XB 1FQEA 3N6TA 1SQYA 4JWOA 3MWBA 3ZKKA 4ZEIA 3CSGA 4G68B 3S9EA 1B4ZA 2HAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPC A;  4GOT A;  5CMM A;  3U8Q A;  4N6P A;  5H8Q B;  4ZE9 A;  3V89 B;  2QMX A;  2QS1 A;  4NF5 B;  5JK4 A;  1MPD A;  4RK9 A;  2AIX A;  1B3H A;  3PU5 A;  4KYD A;  2F7B A;  4EUO A;  3CRB A;  4F2Q A;  4F3P A;  3PD8 A;  3E4R A;  5H8S A;  1DOT A;  3FD3 A;  3K6U A;  3VXB A;  1XC1 A;  5I56 A;  3EHT A;  1IXG A;  3TFL A;  1UTB A;  5I2N A;  4KYS A;  5DEX B;  5F1Q A;  1NNP A;  3MP6 A;  1R9Q A;  3S9L C;  2PMS A;  1N84 A;  4G4P A;  1EZO A;  1SDX A;  3C32 A;  4MH5 A;  4MFI A;  5AA3 A;  4P0G A;  3TDJ A;  3IOW A;  5H8N B;  3TTK A;  3MVY A;  1N3X A;  4H65 A;  4PFU A;  1SW2 A;  3TCG A;  1B2H A;  4ONY A;  4R73 A;  3EPE A;  4U1O A;  3T9U A;  1LLS A;  3GZG A;  3K01 A;  4G68 A;  3T9H B;  1R9L A;  2OLB A;  4YKJ A;  3PPN A;  4G8N A;  3HHG A;  3JZJ A;  3K02 A;  2A5T B;  5H8Q A;  4OER A;  5JEI A;  3PMX A;  5H8F B;  4R2B A;  3B6W A;  3MVW A;  1AOV A;  4OHN A;  2GH9 A;  3C9H A;  3B6Q A;  3MZ9 A;  2E1S A;  2XXY A;  3S9M C;  4GXS B;  3H03 A;  1MM6 A;  1A40 A;  3OOA A;  4OTE A;  2Q8J A;  4DZ1 A;  1II5 A;  1S50 A;  3RTW B;  4ESW A;  1B3F A;  2Y7P A;  4IO6 A;  5L9M A;  5I84 A;  3IOR A;  3CG3 A;  4ZZA A;  4NF6 B;  3G3H A;  3HV1 A;  2THI A;  3LSF B;  4ECF A;  1XS5 A;  5DEX A;  2XXW A;  2ZXT A;  3HN0 A;  3JYR A;  3VE1 B;  2Y7I A;  2H9B A;  2UVI A;  1MM7 A;  3OO8 A;  1AMF A;  4Z7E A;  4U4X A;  1MY2 A;  3EHS A;  4R72 A;  5F7V A;  1HSE A;  3K00 A;  3TOD A;  4NF8 B;  4NF4 B;  1B6H A;  5DVF A;  1KWH A;  3MPK A;  4U2R A;  3IR1 A;  3QUJ A;  3FJ7 A;  3FJG A;  4GL0 A;  3DP6 A;  2V3U A;  4FE8 A;  5J1D A;  3KEI A;  3FXR A;  4F18 A;  4YB6 A;  3CR9 A;  4PP0 A;  2PYY A;  3M3F A;  4KI0 E;  3PMW A;  1HSJ A;  4R6H A;  2XX7 A;  3OXN A;  2D21 A;  4EF1 A;  2Y7K A;  4LON B;  4R75 A;  2UVH A;  3IK6 B;  1I6A A;  2I48 A;  3EQ1 A;  1FCK A;  5I2K A;  2XXI A;  1IUD A;  3MZB A;  1IZ1 A;  2ZYO A;  1DMB A;  2H25 A;  4XKP A;  1A7L A;  3SEV A;  1A8F A;  1VFE A;  1DPE A;  3C36 A;  4OEU A;  5FTH A;  3VLW A;  1Z7N E;  1SVX B;  3FV2 A;  4RPN A;  5JTY A;  4EF2 A;  1B0H A;  3G3F A;  1EZ9 A;  3O9P A;  4MLV A;  2QSX A;  1URG A;  4OFO A;  3HO7 A;  4G68 C;  2I49 A;  3LR1 A;  2O1L A;  1ZMG A;  3IJX B;  2GHB A;  2YLN A;  3ILT B;  2I0B A;  2O84 X;  4QSE A;  3H7M A;  1WOD A;  2HAV A;  3OMB A;  4ZDM A;  4NE4 A;  3G3K A;  3CG1 A;  4ELO A;  4IO5 A;  2RC7 A;  4I8C A;  2UXA A;  2Y84 A;  2REG A;  2UYF A;  3QYT A;  4WXJ A;  5ICT A;  2QPQ A;  3ODB A;  4YKK A;  2XXT A;  1NH7 A;  5KCJ B;  1TXF A;  1JEV A;  4XKR A;  1JVX A;  4LAT A;  5EHM A;  2VOZ A;  4GXA A;  2V84 A;  3LSW A;  1LCF A;  2FYI A;  1H45 A;  2XD2 A;  1PC3 A;  3UP9 A;  3H06 B;  3W9W A;  4KPT A;  4KCD A;  4DDD A;  3T96 B;  2I58 A;  4AB5 A;  2XXX A;  4ZEC A;  2OZZ A;  4IO2 A;  4FOR A;  2F8D A;  3PUZ E;  5M2V A;  3TQW A;  4O3C A;  2I3W A;  3W15 C;  3B7D A;  1ATG A;  4F2O A;  3GXA A;  1I6B A;  3TMG A;  5ITO A;  2VHA A;  5KDT B;  1P99 A;  3OD7 A;  2O7U A;  5CMB A;  2B3F A;  1LBB A;  3BBR A;  4OVJ A;  3N6U A;  4QRZ A;  4GRK A;  4BDL A;  1NFT A;  2F7A A;  1IIW A;  2QS3 A;  2X7Q A;  4GVO A;  1JW1 A;  1N7W A;  2F78 A;  1I69 A;  1N04 A;  1B40 A;  3MC2 A;  4JXI A;  3UN6 A;  3EN3 A;  4YU0 A;  4KFQ A;  1B7Z A;  1BP5 A;  1Y1M A;  3C34 A;  4PFY A;  3IOV A;  3TTL A;  2F35 A;  1H43 A;  4EXL A;  1N0T A;  4RY1 A;  5AA4 A;  3I3V A;  4HTG A;  5KCJ A;  2DE2 A;  2I4C A;  2DVZ A;  2NXO A;  1R1N A;  1EH3 A;  3C31 A;  1TFD A;  4QHQ A;  2O69 A;  1IXC A;  3KSJ A;  1P1O A;  1B5I A;  2QS2 A;  2Z22 A;  3IX1 A;  4RXL A;  2F36 A;  1MDP 1;  4G2Z A;  1B9J A;  3UIF A;  3O29 A;  4F22 A;  1UTB B;  4RK2 A;  5I2N B;  4ZEK A;  4H67 A;  4PE5 B;  1B32 A;  3BKI B;  1A54 A;  4ZZE A;  1LFI A;  2H5Y A;  3KFM A;  3IB2 A;  4ZEF A;  3D4C A;  3PUW E;  5DVJ A;  3LSX A;  4PFW A;  2PBW A;  3QUF A;  1L5T A;  2XX8 A;  2VD2 A;  3IB0 A;  3QSL A;  4DXB A;  2HEU A;  1ZBM A;  4R9F A;  2VGQ A;  2DE4 A;  4H8I A;  4POW A;  4GQO A;  1B4H A;  3KN7 A;  1LGB C;  5ICQ A;  1SYH A;  4GFR A;  1GTK A;  2O6A A;  2V93 A;  3SET A;  2PVU A;  4N07 A;  2QJE A;  1B7H A;  4Q8R A;  2XXU A;  4LVQ A;  4N13 A;  1SI1 A;  3W9V A;  3IL1 B;  3TCF A;  4H6D A;  3U93 A;  3FVN A;  3BFU A;  1WDN A;  3FV1 A;  3O66 A;  3O6G A;  3OEK A;  3IJO B;  2KLF A;  1AL3 A;  4JSO A;  3TKD A;  1YTV A;  5IAI A;  2ZYK A;  5CRY A;  1PB8 A;  3FAT A;  3RT6 B;  2ZYM A;  1CB6 A;  4YZZ A;  4F19 A;  4OMB A;  4QFL A;  1DTG A;  2DXR A;  2XXV A;  4FEC A;  3PPR A;  1TFA A;  4ISU A;  1YAE A;  3VFJ A;  3TCH A;  1NH8 A;  3M3L A;  2Y7W A;  4FIM A;  3Q29 A;  4O3A A;  1SW1 A;  4JSD A;  4ELR A;  4QSD A;  3UGW A;  1MXU A;  4OFJ A;  4H5G A;  1Y9U A;  1OLC A;  2IEE A;  1ZLQ A;  4IO4 A;  1XOC A;  1S9T A;  1GR2 A;  1MXZ A;  2HQ0 A;  1BTJ A;  4TLM B;  3RT8 A;  3TZA A;  1LAG E;  4FAT A;  1USY H;  3K1P A;  4TQU Q;  4IY5 A;  3G3I A;  1B5H A;  2DS9 A;  2QS4 A;  1B3G A;  1B51 A;  4OFL A;  3Q28 A;  2WKY A;  3U92 A;  5AA1 A;  3DEL B;  3A09 A;  4BDQ A;  5TPA A;  3T22 A;  3L6G A;  4RNS A;  4H0W A;  3VVF A;  1UIV A;  4PFT A;  2OJT A;  5I2K B;  3WAE A;  4L17 A;  1US5 A;  2HXW A;  3PUY E;  1D3K A;  3TTM A;  3RGY A;  3AXF A;  3IOT A;  3CFZ A;  3UK4 A;  5DYH A;  3K6W A;  4EXK A;  3LC8 A;  2F97 A;  4P0I A;  5JTY B;  1S7Y A;  3OEL A;  1P1N A;  4F1Y A;  1FTK A;  2DQV A;  2DWA A;  1RYO A;  3GLB A;  1ZU0 A;  3R7X A;  1DTZ A;  4ESX A;  4XKQ A;  1B1H A;  3PD9 A;  2PT1 A;  3FVO A;  3MPL A;  1B5J A;  4LQ2 A;  4F31 B;  1MH4 A;  1M5F A;  4AB6 A;  4DE8 A;  1Y4C A;  3U72 A;  4IY6 A;  4JWX A;  3DP4 A;  4GLI A;  2P0S A;  1UTH B;  4NWC A;  1PBP A;  3G3J A;  2E0S A;  3CFL A;  4IB2 A;  3RTF B;  4BDM A;  3SKP A;  2NOO A;  4YMA A;  1NNT A;  1AH5 A;  3KN3 A;  1Y4T A;  4YB5 A;  3E9X A;  3C33 A;  4R9G A;  1FTJ A;  1MG1 A;  3M8U A;  4F3B A;  4KD5 A;  2P1S A;  4DXC A;  1POT A;  2F6P A;  1GV8 A;  2B65 A;  1Y20 A;  3L6H A;  2Q2A A;  1ZIU A;  5CC2 A;  2ALU A;  2Z8D A;  4LA9 A;  3FVG A;  1LAF E;  4DLD A;  1M5B A;  1PBQ A;  3VV5 A;  1B52 A;  1FQA A;  2REJ A;  3OO9 A;  1POY 1;  4KQP A;  4ELP A;  4U21 A;  5L9S A;  3CFX A;  4G8M A;  4R2F A;  2HFB A;  3A3C A;  3ECR A;  4G77 A;  2F6G A;  3FXQ A;  3KJT A;  3KZG A;  1VE4 A;  1N3W A;  5FHM A;  3SEU A;  3O6H A;  2XXH A;  1J1N A;  3ZSF A;  1SD3 A;  3K6V A;  1IXI A;  3C35 A;  1URS A;  4ZS9 A;  3TTN A;  3HPI A;  2DE3 A;  4AQ4 A;  3H4Z A;  1UTH A;  3CSB A;  5AA4 B;  4TOZ A;  1MXV A;  3TUS A;  4C0R A;  4OWD A;  4QFK A;  1QUI A;  1PB7 A;  3VDF A;  1QJM A;  4RA1 A;  1MH3 A;  3SER A;  1OQH A;  1LFG A;  3SEW A;  4YB7 A;  2GHA A;  2DYX A;  1YPN A;  1B3L A;  5I57 A;  4F1U A;  3KN8 A;  3MQ9 A;  2AL5 A;  3WAF A;  3V5A A;  1QKB A;  1FQD A;  2DWH A;  1Q35 A;  3Q27 A;  1N7X A;  4QSC A;  4NMY A;  3E3K A;  2ZNU A;  3FUZ A;  5EYF A;  5CM6 A;  4RYA A;  4Z0I A;  4H8J A;  2ONS A;  3T9V A;  3KSX A;  2O7I A;  1YCJ A;  3I6V A;  1MS7 A;  5K2Y A;  3K4U A;  4E0X A;  1NMU A;  4GF8 A;  3ILU B;  3G3G A;  1JVY A;  4U1Z A;  5DTB A;  4HCY A;  4Q0C A;  5KZT A;  5FHO A;  1FTM A;  1ZTY A;  1QVS A;  4IGR A;  4PET A;  2VD3 A;  4ZE8 A;  3VVD A;  4HW8 A;  1Y1Z A;  3MZ1 A;  2B3B A;  2GRV A;  1WVJ A;  5B70 A;  3TYH A;  1LCT A;  3RNN A;  2O68 A;  4X9T A;  3GBB A;  2PT2 A;  1CE2 A;  3IO4 A;  4XIG Q;  1FQF A;  4OYV A;  5I58 A;  3MBP A;  4ZEB A;  2DWI A;  3HHF A;  4M4G A;  1TT1 A;  5EHS A;  3RN8 A;  1B58 A;  4QFO A;  3QXM A;  2NWJ A;  2D5W A;  4XXU A;  4FJP A;  1MQJ A;  4R74 A;  3IAZ A;  3TTR A;  3K1N A;  1PEB A;  1JW5 A;  2D3I A;  3U94 A;  2V25 A;  4BDR A;  1D9V A;  1H76 A;  4JB7 A;  2FNC A;  3VVE A;  2O51 A;  3OEN A;  1JQF A;  3MVZ A;  3VLU A;  2HZL A;  1QUL A;  1FW0 A;  2OK2 A;  1TWY A;  2DWJ A;  1BKA A;  2PX1 A;  1MXX A;  1ZJL A;  3RUM A;  3N94 A;  3I5O A;  2ZNT A;  3BFT A;  3H6U A;  3OO6 A;  2F34 A;  5CI5 A;  3Q25 A;  1A99 A;  5DVI A;  2I0C A;  3OO7 A;  3JV9 A;  3SEY A;  4MBP A;  2ABH A;  3QAX A;  2RCA A;  1NNF A;  4TLL B;  2R9J A;  3VXC A;  1DSN A;  4MF3 A;  3F11 A;  2QRY A;  3MAM A;  4I9D A;  4ELQ A;  1QW0 A;  2I6E A;  2X7P A;  5CMK A;  4G8H A;  1Q1K A;  1Y3P A;  1SW5 A;  4C1T A;  5TPA B;  2AYS A;  1EU8 A;  1JW4 A;  3FAS A;  5AA2 B;  1Y3Q A;  2M8C A;  4LZ7 A;  1ZKB A;  2G93 A;  2NVU B;  1JET A;  3V8X B;  2DOJ A;  3TAJ A;  3S9N C;  1A55 A;  5AE4 A;  3U1O A;  4LUB A;  3N26 A;  2CMO A;  1LFH A;  1A8E A;  4U22 A;  2Z23 A;  4M1V A;  4GWO A;  4WED A;  3KOS A;  2Z8F A;  4PQJ A;  4KHZ E;  3FIR A;  2YPN A;  3PV0 E;  4RJZ A;  5IKB A;  3IO6 A;  3QK6 A;  1FTO A;  1VSO A;  2XD3 A;  4FED A;  3M3K A;  2BJJ X;  2Z8E A;  4I1D A;  1FQB A;  4LP2 B;  1MXY A;  2A5S A;  5ISU A;  3T93 B;  4DCX A;  2Q2C A;  5TU0 A;  5HM4 B;  3UOR A;  3H6T A;  2AL4 A;  5CMC A;  4NWD A;  3R6U A;  1MY1 A;  1O64 A;  3PUV E;  5A5X A;  4LZ5 A;  2QL3 A;  4NTL A;  1EZP A;  1LBC A;  2O1M A;  3FZV A;  4GL8 A;  3T66 A;  1VR5 A;  3Q26 A;  3TEP A;  2IA4 A;  2H4I A;  1PB9 A;  5AA2 A;  1OIB A;  3G7W A;  4NED A;  3LSL A;  3PUX E;  4Q30 B;  4NF5 A;  4HCW A;  4DIG A;  3OSQ A;  1SYI A;  3MUQ A;  5HPQ A;  3IB1 A;  1MQI A;  1USY E;  1OQG A;  3MJN A;  1B46 A;  3QIM A;  4OET A;  4R6Y A;  3TEL A;  3O28 A;  4EDP A;  5BWJ A;  3K2D A;  4WKM A;  3MP1 A;  1T0K A;  1GGG A;  3S4U A;  5H8H B;  1P1U A;  2UVJ A;  2ZNS A;  4H5F A;  3RQT A;  4U4S A;  1BIY A;  1F9B A;  4EQ9 A;  1MPB A;  2I3V A;  5FTI A;  1B0L A;  2DXY A;  3THI A;  1URD A;  2XXR A;  5HBC A;  1XVY A;  1B1X A;  3K6X A;  5BUU A;  1MQD A;  1NL5 A;  1P1Q A;  5L9O A;  4O3B A;  5H8N A;  1B3E A;  1RKM A;  4OES A;  4YKI A;  3KGC A;  1AIV A;  2ZMB A;  1B7U A;  2DSF A;  5L8D A;  4ND9 A;  4QF9 A;  5I59 B;  3O2A A;  2Y7R A;  3KBR A;  1NKX A;  4X1B A;  5I57 B;  1D9Y A;  2OBG A;  3ONM A;  2A5T A;  1HSL A;  4YMB A;  1ELJ A;  1M5C A;  5H8F A;  2ESN A;  3DLN A;  2H99 A;  1XVX A;  1QUJ A;  3FXU A;  3MP8 A;  2W7Y A;  1GVC A;  3UA8 A;  1OLA A;  2RKM A;  4K3F A;  3K0V A;  2GFE A;  4MLQ A;  5AA2 D;  4IO3 A;  3O97 A;  3PMV A;  4NF6 A;  4UAC A;  2V3T A;  3H6V A;  1R6Z A;  4IO7 A;  4BDO A;  1LAH E;  3DM0 A;  5H8H A;  3S2V A;  2V3Q A;  5ELV A;  4LZ8 A;  3GBA A;  1Z7M E;  2OCU A;  3FGS A;  4C1U A;  3OSR A;  4WEP A;  4FEB A;  1BLF A;  4U23 A;  3CIJ A;  2FA7 A;  3B6T A;  1D4N A;  4KR5 A;  4NF8 A;  4NF4 A;  3SDF A;  1MDQ A;  2XXP A;  1MY0 A;  3EF7 A;  2DVC A;  3A3U A;  1IQ7 A;  2OWT A;  3FJM A;  1OMP A;  1SBP A;  1VFD A;  3C4M A;  1H3D A;  2XHD A;  4GIZ A;  4F3S A;  5I58 B;  4OQO A;  1OVB A;  3TPA A;  1FTL A;  2ONK E;  3RY3 A;  4DCY A;  1MY3 A;  2Q89 A;  2R6G E;  1LST A;  4OEN A;  2RF1 A;  3ZKL A;  2CZL A;  3CVG A;  5I59 A;  4F29 A;  2F5X A;  1MQH A;  1IEJ A;  3RPW A;  1M5D A;  5DT6 A;  4EQ7 A;  1MY4 A;  1P1W A;  2HZK A;  3P7I A;  2RC9 A;  4THI A;  2RIN A;  1SI0 A;  3PPQ A;  1QKA A;  4IGT A;  4KCC A;  3LUY A;  1PDA A;  1LB8 A;  4YKP A;  3H3G A;  3MW0 A;  1I6Q A;  3KOT A;  2VP1 A;  1O7T A;  5FHN A;  3KG2 A;  4JBZ A;  4XTC Q;  4XKN A;  4E0W A;  4GD5 A;  3KJ7 A;  5TP9 B;  3CI8 A;  2H98 A;  4H1X A;  4OZ9 A;  4QFN A;  4F1V A;  3H6W A;  3IOU A;  4YIC A;  2G29 A;  1N76 A;  3PGF A;  3LBS A;  3R26 A;  3PPP A;  1NNK A;  3FVK A;  1IXH A;  2UVG A;  2YJP A;  2OWS A;  4DXU A;  1XHY A;  4BDN A;  3VLV A;  3TQL A;  5CBR A;  4JWY A;  2I4B A;  4OXV A;  1QUK A;  3O6I A;  1FQC A;  2P2A A;  4P11 A;  4UA8 A;  3SES A;  1B05 A;  3EHU A;  3OEM A;  3RLF E;  1Y3N A;  3D4G A;  3USD A;  4R6K A;  4BLA A;  5ITP A;  3DP8 A;  1LAX A;  2Q9T A;  2ONR A;  4RPO A;  3N5L A;  3SEX A;  2NUV A;  1H44 A;  1O63 A;  2XX9 A;  2ANJ A;  1MRP A;  4EQB A;  1M5E A;  3V83 A;  4JDF A;  4X1D A;  5CBS A;  5B7D A;  1MXW A;  4F39 A;  3E13 X;  4X48 A;  3HST A;  4YAH X;  4F3G A;  4HS7 A;  5I56 B;  2RC8 A;  5K2X A;  1LB9 A;  2Q88 A;  1UIU A;  1US4 A;  2F7C A;  2HCA A;  1XT8 A;  2XXQ A;  5KDT A;  3ZS6 A;  5TP9 A;  2QMW A;  3K1M A;  4LQ5 A;  4I62 A;  2UYE A;  1SW4 A;  2DP8 A;  4KYE A;  1MQG A;  4ZED A;  1RYX A;  3PPO A;  1OVT A;  3HCQ A;  2ZYN A;  2R71 A;  2RCB A;  1JNF A;  3T9X B;  1JEU A;  1DPP A;  4QFP A;  2LAO A;  2X26 A;  1UQW A;  4FAJ A;  1IIT A;  1ANF A;  5LOM A;  4POX A;  3MVX A;  4OEV A;  4Q5T A;  5A5X B;  1FQE A;  3N6T A;  1SQY A;  4JWO A;  3MWB A;  3ZKK A;  4ZEI A;  3CSG A;  4G68 B;  3S9E A;  1B4Z A;  2HAU A; 
#chains in the Genus database with same CATH topology
 1MPC A;  4GOT A;  5CMM A;  3U8Q A;  4N6P A;  5H8Q B;  2WYK A;  4ZE9 A;  3V89 B;  5IZ3 A;  4OA4 A;  2QMX A;  2QS1 A;  4NF5 B;  5JK4 A;  1MPD A;  4RK9 A;  2AIX A;  1B3H A;  3PU5 A;  4KYD A;  2XXK A;  2F7B A;  4EUO A;  3CRB A;  4F2Q A;  4F3P A;  3PD8 A;  3E4R A;  5IZZ A;  5H8S A;  1DOT A;  3FD3 A;  3K6U A;  3VXB A;  1XC1 A;  5I56 A;  3EHT A;  1IXG A;  3TFL A;  1UTB A;  5I2N A;  4KYS A;  5DEX B;  5F1Q A;  1YZ0 A;  5EQ7 A;  1NNP A;  2R8T A;  3B8B A;  3MP6 A;  1R9Q A;  3S9L C;  2B4M A;  5EQ8 A;  2PMS A;  1N84 A;  5IM2 A;  4GWY A;  4G4P A;  1EZO A;  1SDX A;  3C32 A;  1FBC A;  4MH5 A;  4MFI A;  5AA3 A;  4P0G A;  5DW8 A;  3TDJ A;  1IMD A;  3IOW A;  5IGA A;  1FPB A;  5H8N B;  1LBX A;  3TTK A;  3MVY A;  1N3X A;  4H65 A;  4PFU A;  1SW2 A;  5ESY A;  3TCG A;  1B2H A;  4ONY A;  4R73 A;  3EPE A;  2WX9 A;  4U1O A;  3T9U A;  1LLS A;  3GZG A;  3K01 A;  4G68 A;  3T9H B;  1R9L A;  2OLB A;  4YKJ A;  3PPN A;  4G8N A;  3HHG A;  3JZJ A;  3K02 A;  2A5T B;  4NAP A;  4NX1 A;  5H8Q A;  4OER A;  4MX6 A;  5JEI A;  3PMX A;  5H8F B;  4R2B A;  3B6W A;  3MVW A;  1AOV A;  4OHN A;  2GH9 A;  3C9H A;  3B6Q A;  3MZ9 A;  2E1S A;  2XXY A;  1G0H A;  3S9M C;  4GXS B;  3H03 A;  1MM6 A;  1A40 A;  3OOA A;  4OTE A;  2Q8J A;  4DZ1 A;  1II5 A;  1S50 A;  3RTW B;  4ESW A;  1B3F A;  2Y7P A;  4IO6 A;  5L9M A;  5I84 A;  2OWZ A;  4O8M A;  3IOR A;  3CG3 A;  4ZZA A;  4NF6 B;  3G3H A;  3HV1 A;  2THI A;  1IMA A;  3LSF B;  4ECF A;  1XS5 A;  5DEX A;  2XXW A;  2ZXT A;  3HN0 A;  3JYR A;  3VE1 B;  2Y7I A;  2H9B A;  2UVI A;  1MM7 A;  3E78 A;  3OO8 A;  1AMF A;  3FXB A;  4OVP A;  4Z7E A;  1KA1 A;  4QBA A;  4U4X A;  1MY2 A;  2F3D A;  3EHS A;  2DDK A;  4R72 A;  5F7V A;  1HSE A;  3K00 A;  4X04 A;  1K9Z A;  3TOD A;  1NV5 A;  4NF8 B;  4NF4 B;  1B6H A;  5DVF A;  1KWH A;  3MPK A;  3BIH A;  4U2R A;  3IR1 A;  3QUJ A;  3FJ7 A;  3FJG A;  4GL0 A;  3DP6 A;  2V3U A;  4FE8 A;  5J1D A;  3KEI A;  3FXR A;  1NI9 A;  4F18 A;  4YB6 A;  3CR9 A;  4PP0 A;  2PYY A;  3M3F A;  4KI0 E;  3PMW A;  5LTC A;  1HSJ A;  4R6H A;  1FPE A;  4GWU A;  2XX7 A;  3OXN A;  2D21 A;  4EF1 A;  4OAN A;  1RDZ A;  2Y7K A;  4LON B;  4R75 A;  5F24 A;  2UVH A;  2FBP A;  3IK6 B;  1I6A A;  2I48 A;  3EQ1 A;  1D9Q A;  1FCK A;  5I2K A;  2XXI A;  1IUD A;  3MZB A;  1IZ1 A;  2ZYO A;  1DMB A;  2H25 A;  4XKP A;  1A7L A;  3SEV A;  1A8F A;  1VFE A;  1DPE A;  2WEF A;  3C36 A;  4OEU A;  4N8Y A;  5FTH A;  3VLW A;  1Z7N E;  1SVX B;  3FV2 A;  4RPN A;  5JTY A;  4EF2 A;  1B0H A;  3G3F A;  1EZ9 A;  3O9P A;  4MLV A;  2FIE A;  2QSX A;  1URG A;  4OFO A;  3HO7 A;  4G68 C;  2I49 A;  4PFI A;  3LR1 A;  4PDH A;  2O1L A;  1ZMG A;  3IJX B;  2GHB A;  2YLN A;  3ILT B;  2I0B A;  2O84 X;  4QSE A;  3H7M A;  4P3L A;  1WOD A;  2HAV A;  3OMB A;  4N15 A;  5A5L A;  4ZDM A;  4NE4 A;  3G3K A;  3CG1 A;  4ELO A;  2JJK A;  4IO5 A;  4HE1 A;  4P9K A;  1IMF A;  2RC7 A;  4MHF A;  4I8C A;  4PGP A;  2UXA A;  2Y84 A;  2REG A;  3MYU A;  2UYF A;  3QYT A;  4WXJ A;  5ICT A;  2QPQ A;  3ODB A;  4YKK A;  4P1L A;  2XXT A;  1NH7 A;  5KCJ B;  1TXF A;  1JEV A;  4XKR A;  1JVX A;  4LAT A;  5EHM A;  1EYK A;  2VOZ A;  4GXA A;  2V84 A;  4PFR A;  3LSW A;  1LCF A;  2FYI A;  1H45 A;  2XD2 A;  1PC3 A;  2L5V A;  1NV4 A;  3UP9 A;  3H06 B;  3W9W A;  1SPI A;  4KPT A;  4KCD A;  4DDD A;  3T96 B;  2I58 A;  4AB5 A;  2XXX A;  4ZEC A;  2OZZ A;  4IO2 A;  4HXV A;  4FOR A;  2F8D A;  3PUZ E;  5M2V A;  3TQW A;  1FPG A;  3QMF A;  4O3C A;  2I3W A;  3W15 C;  3B7D A;  1ATG A;  4F2O A;  3GXA A;  3B50 A;  2PCR A;  1I6B A;  1FTA A;  3TMG A;  5ITO A;  2VHA A;  5KDT B;  1P99 A;  3OD7 A;  2O7U A;  5CMB A;  2B3F A;  1LBB A;  3BBR A;  4OVJ A;  3N6U A;  4QRZ A;  4GRK A;  4BDL A;  1NFT A;  2F7A A;  1IIW A;  2QS3 A;  2X7Q A;  4NHB A;  4GVO A;  1JW1 A;  1N7W A;  2F78 A;  1I69 A;  1N04 A;  1B40 A;  3MC2 A;  4JXI A;  4MAG A;  3UN6 A;  3EN3 A;  4YU0 A;  4KFQ A;  1B7Z A;  1BP5 A;  1Y1M A;  3C34 A;  4PFY A;  3IOV A;  5EQ9 A;  3TTL A;  2F35 A;  1H43 A;  4EXL A;  1N0T A;  3GYY A;  4RY1 A;  5AA4 A;  3I3V A;  5ET7 A;  4HTG A;  5KCJ A;  2DE2 A;  2I4C A;  4N91 A;  2DVZ A;  2NXO A;  1R1N A;  1EH3 A;  3C31 A;  1TFD A;  4QHQ A;  2O69 A;  5IZ3 B;  1IXC A;  3KSJ A;  1P1O A;  1B5I A;  2QS2 A;  2Z22 A;  3IX1 A;  4RXL A;  4O7M A;  2F36 A;  1MDP 1;  4G2Z A;  1B9J A;  2VT5 A;  3UIF A;  3O29 A;  4F22 A;  1UTB B;  4RK2 A;  5I2N B;  4ZEK A;  4H67 A;  4PE5 B;  1B32 A;  3BKI B;  1A54 A;  4ZZE A;  1LFI A;  2H5Y A;  3KFM A;  4P47 A;  3IB2 A;  4ZEF A;  3D4C A;  3PUW E;  5DVJ A;  3LUZ A;  4JVD A;  2F3B A;  3LSX A;  4PFW A;  2PBW A;  3QUF A;  1L5T A;  2XX8 A;  1NUW A;  2VD2 A;  3IB0 A;  3QSL A;  4DXB A;  2HEU A;  1ZBM A;  4R9F A;  2VGQ A;  2DE4 A;  4H8I A;  4POW A;  4GQO A;  1B4H A;  4O94 A;  3KN7 A;  1LGB C;  5ICQ A;  3IFC A;  1SYH A;  4GFR A;  3SZP A;  1GTK A;  2O6A A;  2V93 A;  3SET A;  1FPL A;  2PVU A;  2ZZW A;  4N07 A;  2QJE A;  4MJO A;  4N4U A;  1B7H A;  4Q8R A;  1NUZ A;  2XXU A;  4LVQ A;  4N13 A;  1SI1 A;  3W9V A;  3IL1 B;  3TCF A;  4H6D A;  3U93 A;  3FVN A;  3BFU A;  1WDN A;  3FV1 A;  3O66 A;  3O6G A;  3OEK A;  3IJO B;  2KLF A;  1AL3 A;  4JSO A;  3TKD A;  1YTV A;  5IAI A;  2ZYK A;  5CRY A;  1PB8 A;  3FAT A;  3RT6 B;  2ZYM A;  1CB6 A;  4YZZ A;  4F19 A;  4OMB A;  4QFL A;  1DTG A;  2DXR A;  4FEC A;  2XXV A;  3PPR A;  1FBF A;  1FBD A;  1TFA A;  4ISU A;  1YAE A;  3VFJ A;  3TCH A;  1NH8 A;  3M3L A;  2Y7W A;  1FRP A;  4FIM A;  3Q29 A;  4KXP A;  4O3A A;  4GWS A;  1Q9D A;  1SW1 A;  4JSD A;  4ELR A;  4QSD A;  3UGW A;  1MXU A;  4OFJ A;  2CZI A;  4H5G A;  1Y9U A;  1OLC A;  4PFB A;  2IEE A;  4N81 A;  1ZLQ A;  4PAF A;  4IO4 A;  1XOC A;  1S9T A;  1GR2 A;  1MXZ A;  2HQ0 A;  4MNI A;  1BTJ A;  4TLM B;  4PF8 A;  3RT8 A;  3TZA A;  1LAG E;  4FAT A;  1USY H;  3K1P A;  4TQU Q;  4IY5 A;  3ROJ A;  3G3I A;  1B5H A;  4JVC A;  4JVI A;  2DS9 A;  2QS4 A;  1B3G A;  1B51 A;  4OFL A;  3Q28 A;  4MNP A;  2WKY A;  3U92 A;  5AA1 A;  3DEL B;  2FHY A;  3A09 A;  4BDQ A;  5TPA A;  3T22 A;  3L6G A;  4RNS A;  4H0W A;  3VVF A;  1UIV A;  4PFT A;  2OJT A;  5I2K B;  3WAE A;  4L17 A;  1US5 A;  2QVV A;  2HXW A;  3PUY E;  1D3K A;  3TTM A;  3RGY A;  3AXF A;  3IOT A;  3CFZ A;  3UK4 A;  5DYH A;  2KR0 A;  3K6W A;  4EXK A;  3LC8 A;  1DCU A;  2F97 A;  4P0I A;  5JTY B;  1FBE A;  4GX4 A;  1S7Y A;  3OEL A;  1P1N A;  4F1Y A;  1FTK A;  4UAB A;  2Q8M A;  2DQV A;  2DWA A;  2CZH A;  2VPN A;  1RYO A;  4N17 A;  3GLB A;  1ZU0 A;  3R7X A;  1DTZ A;  4ESX A;  4XKQ A;  1B1H A;  3PD9 A;  2PT1 A;  3FVO A;  3IFA A;  3MPL A;  1B5J A;  4LQ2 A;  4F31 B;  1MH4 A;  1FSA A;  1M5F A;  4AB6 A;  4DE8 A;  1Y4C A;  3U72 A;  4IY6 A;  4JWX A;  3DP4 A;  4HE0 A;  4GLI A;  2P0S A;  1UTH B;  4NWC A;  1PBP A;  4I40 A;  2Y5L A;  3G3J A;  2E0S A;  3CFL A;  4IB2 A;  3RTF B;  4BDM A;  3SKP A;  4GX6 A;  2FVZ A;  2NOO A;  4YMA A;  1NNT A;  1AH5 A;  3KN3 A;  1Y4T A;  4YB5 A;  3E9X A;  3C33 A;  4R9G A;  1FTJ A;  1MG1 A;  1LBY A;  4PCD A;  3M8U A;  4F3B A;  4KD5 A;  2P1S A;  4DXC A;  1POT A;  1FPF A;  2F6P A;  1GV8 A;  2B65 A;  1Y20 A;  4N8G A;  2XA5 A;  3L6H A;  2Q2A A;  1NUY A;  1ZIU A;  5CC2 A;  2ALU A;  4PC9 A;  2Z8D A;  4LA9 A;  3FVG A;  1LAF E;  4DLD A;  1M5B A;  1PBQ A;  3VV5 A;  1B52 A;  1FQA A;  2REJ A;  4XF5 A;  3OO9 A;  1POY 1;  4KQP A;  1FBH A;  4ELP A;  4U21 A;  3T0J A;  5L9S A;  3CFX A;  4G8M A;  4R2F A;  1RDY A;  2HFB A;  1DBZ A;  1NUX A;  3A3C A;  3ECR A;  4G77 A;  2F6G A;  3FXQ A;  2Q74 A;  3KJT A;  3KZG A;  1VE4 A;  1N3W A;  5FHM A;  3SEU A;  3O6H A;  2XXH A;  1J1N A;  3ZSF A;  1SD3 A;  3K6V A;  1IXI A;  3C35 A;  1URS A;  4ZS9 A;  3TTN A;  3HPI A;  2DE3 A;  4AQ4 A;  5I5P A;  3H4Z A;  1UTH A;  1NV7 A;  2QVU A;  3CSB A;  5AA4 B;  4TOZ A;  1MXV A;  3TUS A;  4C0R A;  1VDW A;  4OWD A;  4PAK A;  4QFK A;  1YXI A;  4OVR A;  1QUI A;  1PB7 A;  3VDF A;  1QJM A;  2PFY A;  4OVS A;  2Y5K A;  4RA1 A;  1MH3 A;  3SER A;  1OQH A;  1LFG A;  3SEW A;  4YB7 A;  2GHA A;  2DYX A;  4IR8 A;  5ET8 A;  1YPN A;  1B3L A;  5EYH A;  5I57 A;  4F1U A;  3KN8 A;  3MQ9 A;  2AL5 A;  3WAF A;  3V5A A;  1QKB A;  1FQD A;  2DWH A;  1Q35 A;  3Q27 A;  1N7X A;  4QSC A;  4NMY A;  3E3K A;  2GQ1 A;  2ZNU A;  3FUZ A;  5EYF A;  5CM6 A;  4RYA A;  4G61 A;  3A29 A;  4Z0I A;  4H8J A;  2ONS A;  3T9V A;  3KSX A;  2O7I A;  2XWV A;  4LN5 A;  1YCJ A;  3I6V A;  1MS7 A;  5K2Y A;  3K4U A;  4E0X A;  4PF6 A;  1NMU A;  1AWB A;  4GF8 A;  3ILU B;  3G3G A;  1JVY A;  4U1Z A;  5DTB A;  4HCY A;  4Q0C A;  5KZT A;  5FHO A;  1FTM A;  1ZTY A;  1QVS A;  4IGR A;  4PET A;  2VD3 A;  2HPG A;  3D1R A;  4ZE8 A;  4NGU A;  3VVD A;  4HW8 A;  1Y1Z A;  3MZ1 A;  2B3B A;  2WYP A;  2GRV A;  1WVJ A;  4GBW A;  5B70 A;  3TYH A;  4NN3 A;  1LCT A;  1IMB A;  3RNN A;  3KC1 A;  2O68 A;  4X9T A;  3GBB A;  2PT2 A;  1LEV A;  4PBQ A;  1CE2 A;  1FPD A;  3IO4 A;  4XIG Q;  1FQF A;  4OYV A;  5I58 A;  3MBP A;  4ZEB A;  2DWI A;  3HHF A;  2CEY A;  4N6D A;  5LDZ A;  4M4G A;  1TT1 A;  5EHS A;  3RN8 A;  1B58 A;  4QFO A;  3QXM A;  2NWJ A;  2D5W A;  4XXU A;  1XI6 A;  4FJP A;  2P3N A;  1NV2 A;  1MQJ A;  4R74 A;  3IAZ A;  3EKI A;  3RPL A;  3TTR A;  3K1N A;  1PEB A;  1JW5 A;  2D3I A;  3U94 A;  2V25 A;  4BDR A;  1D9V A;  1H76 A;  1KZ8 A;  4JB7 A;  3RYD A;  2XWI A;  2FNC A;  3VVE A;  1DK4 A;  2O51 A;  3OEN A;  1JQF A;  3MVZ A;  3VLU A;  2HZL A;  1QUL A;  1FW0 A;  2OK2 A;  1TWY A;  2XWK A;  2DWJ A;  1BKA A;  2PX1 A;  1MXX A;  1ZJL A;  3RUM A;  2WBD A;  3N94 A;  3I5O A;  2ZNT A;  3BFT A;  3H6U A;  3OO6 A;  2F34 A;  5CI5 A;  3Q25 A;  1A99 A;  5DVI A;  2I0C A;  3OO7 A;  3JV9 A;  3SEY A;  4MBP A;  2ABH A;  3QAX A;  2RCA A;  1NNF A;  4TLL B;  2R9J A;  1FPK A;  3VXC A;  1DSN A;  1FBG A;  4MF3 A;  3F11 A;  2QRY A;  3MAM A;  4I9D A;  1IMC A;  4ELQ A;  1QW0 A;  2I6E A;  2X7P A;  5CMK A;  4G8H A;  3U65 A;  1Q1K A;  1Y3P A;  4PDD A;  1SW5 A;  4C1T A;  2XWO A;  4P56 A;  5TPA B;  2AYS A;  1EU8 A;  1JW4 A;  3E79 A;  3FAS A;  2CZK A;  5AA2 B;  1Y3Q A;  2M8C A;  4LZ7 A;  1ZKB A;  2G93 A;  4GBV A;  2NVU B;  1JET A;  3V8X B;  2DOJ A;  3TAJ A;  3S9N C;  4QXD A;  1A55 A;  5AE4 A;  3U1O A;  4LUB A;  3N26 A;  2CMO A;  1LFH A;  1A8E A;  2MKZ A;  4U22 A;  2Z23 A;  4M1V A;  4NQ8 A;  4GWO A;  4WED A;  4OVT A;  3KOS A;  2Z8F A;  1JP4 A;  4PQJ A;  4KHZ E;  2KQZ A;  3MST A;  3FIR A;  2YPN A;  3PV0 E;  4RJZ A;  4GX3 A;  5EYG A;  5ET6 A;  5IKB A;  3IO6 A;  2WBB A;  4AS4 A;  4MIJ A;  4PE3 A;  3QK6 A;  2CEX A;  1FTO A;  1VSO A;  5I3S A;  2PFZ A;  2XD3 A;  4FED A;  3M3K A;  2BJJ X;  2Z8E A;  3ISP A;  4I1D A;  1FQB A;  4LP2 B;  3PTY A;  1MXY A;  2A5S A;  5ISU A;  4O7I A;  3T93 B;  5T3J A;  1NV0 A;  4DCX A;  4X8R A;  2Q2C A;  5TU0 A;  5HM4 B;  3UOR A;  1RDX A;  3H6T A;  2AL4 A;  5CMC A;  4NWD A;  3R6U A;  1MY1 A;  1O64 A;  3PUV E;  5A5X A;  4LZ5 A;  2QL3 A;  4NTL A;  1EZP A;  1LBC A;  2O1M A;  3FZV A;  4GL8 A;  3T66 A;  1INP A;  1VR5 A;  2VPO A;  2FIX A;  4P1E A;  3Q26 A;  3TEP A;  2IA4 A;  2H4I A;  1K9Y A;  1PB9 A;  5AA2 A;  4PBH A;  1OIB A;  3G7W A;  4NED A;  3LSL A;  2HHM A;  1FBP A;  3FBP A;  3PUX E;  4Q30 B;  4PGN A;  4NF5 A;  4HCW A;  4DIG A;  4GWX A;  3OSQ A;  1SYI A;  3MUQ A;  5HPQ A;  3IB1 A;  1MQI A;  1USY E;  1OQG A;  3MJN A;  4GWZ A;  1B46 A;  3QIM A;  4OET A;  4R6Y A;  3TEL A;  3O28 A;  4EDP A;  5BWJ A;  1G0I A;  3K2D A;  4WKM A;  3MP1 A;  1T0K A;  1GGG A;  3S4U A;  5ET5 A;  5H8H B;  1P1U A;  2UVJ A;  2ZNS A;  4H5F A;  3RQT A;  4U4S A;  1BIY A;  1F9B A;  4EQ9 A;  2HXR A;  1MPB A;  4NF0 A;  5FBP A;  2I3V A;  5FTI A;  1LBW A;  1B0L A;  2DXY A;  3THI A;  1URD A;  3LV0 A;  3KBZ A;  1LBZ A;  2XXR A;  5HBC A;  1XVY A;  1B1X A;  3K6X A;  5BUU A;  1MQD A;  1NL5 A;  4HE2 A;  4MCO A;  4DI4 B;  4PTK A;  1KA0 A;  1P1Q A;  5L9O A;  4O3B A;  5H8N A;  1B3E A;  1RKM A;  4OES A;  4YKI A;  3KGC A;  1AIV A;  2ZMB A;  1B7U A;  2DSF A;  3BIG A;  4PAI A;  5L8D A;  4ND9 A;  4QF9 A;  5I59 B;  3O2A A;  2Y7R A;  3KBR A;  1NKX A;  4X1B A;  5I57 B;  1D9Y A;  2OBG A;  3ONM A;  1FJ6 A;  2A5T A;  1HSL A;  4MEV A;  4YMB A;  1ELJ A;  1M5C A;  5H8F A;  2OX3 A;  2ESN A;  3DLN A;  2B4L A;  2H99 A;  1XVX A;  3CHG A;  5IZ1 A;  1QUJ A;  4DI3 D;  3FXU A;  1LBV A;  3MP8 A;  1BK4 A;  2W7Y A;  4MNC A;  1GVC A;  3UA8 A;  1OLA A;  2RKM A;  4K3F A;  3K0V A;  4I3Y A;  2GFE A;  4MLQ A;  5AA2 D;  4IO3 A;  3O97 A;  3PMV A;  4NF6 A;  4UAC A;  2V3T A;  3H6V A;  1R6Z A;  3KC0 A;  4IO7 A;  4BDO A;  1LAH E;  3DM0 A;  5H8H A;  3S2V A;  2V3Q A;  5ELV A;  4LZ8 A;  3GBA A;  1Z7M E;  2OCU A;  3FGS A;  4C1U A;  3OSR A;  4WEP A;  4FEB A;  1BLF A;  1NV6 A;  4U23 A;  3CIJ A;  2FA7 A;  3B6T A;  1D4N A;  4KR5 A;  4NF8 A;  4NF4 A;  3SDF A;  1MDQ A;  2XXP A;  1MY0 A;  3EF7 A;  2DVC A;  3A3U A;  1IQ7 A;  2OWT A;  3FJM A;  1FPJ A;  1OMP A;  1SBP A;  1VFD A;  3C4M A;  1H3D A;  2XHD A;  4GIZ A;  4F3S A;  5I58 B;  4OQO A;  1OVB A;  3TPA A;  1FTL A;  2ONK E;  3RY3 A;  4DCY A;  1MY3 A;  2Q89 A;  2R6G E;  1LST A;  4OEN A;  4XEQ A;  2RF1 A;  3ZKL A;  2CZL A;  3CVG A;  5I59 A;  4F29 A;  4NG7 A;  2F5X A;  4MMP A;  1MQH A;  1IME A;  4H45 A;  1IEJ A;  3RPW A;  2ZZX A;  1M5D A;  5DT6 A;  4EQ7 A;  3RPL B;  1MY4 A;  1P1W A;  2HZK A;  3P7I A;  5J16 A;  2RC9 A;  4THI A;  2RIN A;  1SI0 A;  3PPQ A;  1QKA A;  4IGT A;  4KCC A;  3LUY A;  1PDA A;  1LB8 A;  4YKP A;  3H3G A;  3MW0 A;  1I6Q A;  3KOT A;  2VP1 A;  1O7T A;  5FHN A;  3KG2 A;  4JBZ A;  4XTC Q;  4XKN A;  5I7I A;  4E0W A;  4GD5 A;  3KJ7 A;  5TP9 B;  3CI8 A;  2H98 A;  4H1X A;  4OZ9 A;  4QFN A;  4F1V A;  1QGX A;  3H6W A;  3IOU A;  1EYJ A;  4XFE A;  4FBP A;  4YIC A;  2G29 A;  4H46 A;  1N76 A;  2QFL A;  3PGF A;  3LBS A;  3HFU A;  3R26 A;  3PPP A;  1NNK A;  3FVK A;  1NV3 A;  1IXH A;  2UVG A;  2YJP A;  2OWS A;  4DXU A;  1XHY A;  4BDN A;  3VLV A;  3TQL A;  5EQA A;  1YYZ A;  5CBR A;  4JWY A;  2I4B A;  4OXV A;  1QUK A;  3O6I A;  1NV1 A;  4UA8 A;  1FQC A;  2P2A A;  4P11 A;  4I3E A;  3SES A;  1EYI A;  1B05 A;  3EHU A;  3OEM A;  3RLF E;  1Y3N A;  3D4G A;  3USD A;  4R6K A;  4BLA A;  5ITP A;  3DP8 A;  1LAX A;  2Q9T A;  2ONR A;  4RPO A;  2P3V A;  3N5L A;  3NOH A;  3SEX A;  2NUV A;  1H44 A;  1O63 A;  2XX9 A;  2ANJ A;  1MRP A;  4EQB A;  1M5E A;  2ZZV A;  3V83 A;  4JDF A;  4X1D A;  5CBS A;  5B7D A;  1FJ9 A;  1MXW A;  4F39 A;  2QVR A;  3E13 X;  4X48 A;  3HST A;  4YAH X;  4F3G A;  4HS7 A;  5I56 B;  2RC8 A;  5K2X A;  1LB9 A;  2V4C A;  2Q88 A;  1UIU A;  1US4 A;  2F7C A;  2HCA A;  1XT8 A;  2XXQ A;  5KDT A;  3ZS6 A;  5TP9 A;  2QMW A;  3K1M A;  4LQ5 A;  4I62 A;  2UYE A;  1CNQ A;  1SW4 A;  2DP8 A;  4KYE A;  1MQG A;  4ZED A;  1RYX A;  3PPO A;  4OVQ A;  4AS5 A;  3T1B A;  1OVT A;  3HCQ A;  2BJI A;  2ZYN A;  2R71 A;  2RCB A;  1JNF A;  4GWW A;  3T9X B;  1JEU A;  1DPP A;  4QFP A;  2LAO A;  2X26 A;  1UQW A;  4FAJ A;  1IIT A;  1ANF A;  5LOM A;  4POX A;  4N6K A;  3MVX A;  4OEV A;  4Q5T A;  5A5X B;  1FQE A;  3N6T A;  1SQY A;  4JWO A;  3MWB A;  4P8B A;  3ZKK A;  4ZEI A;  3CSG A;  1FPI A;  4G68 B;  3S9E A;  1B4Z A;  2HAU A; 
#chains in the Genus database with same CATH homology
 1MPC A;  4GOT A;  5CMM A;  3U8Q A;  4N6P A;  5H8Q B;  4ZE9 A;  3V89 B;  2QMX A;  2QS1 A;  4NF5 B;  5JK4 A;  1MPD A;  4RK9 A;  2AIX A;  1B3H A;  3PU5 A;  4KYD A;  2F7B A;  4EUO A;  3CRB A;  4F2Q A;  4F3P A;  3PD8 A;  3E4R A;  5H8S A;  1DOT A;  3FD3 A;  3K6U A;  3VXB A;  1XC1 A;  5I56 A;  3EHT A;  1IXG A;  3TFL A;  1UTB A;  5I2N A;  4KYS A;  5DEX B;  5F1Q A;  1NNP A;  3MP6 A;  1R9Q A;  3S9L C;  2PMS A;  1N84 A;  4G4P A;  1EZO A;  1SDX A;  3C32 A;  4MH5 A;  4MFI A;  5AA3 A;  4P0G A;  3TDJ A;  3IOW A;  5H8N B;  3TTK A;  3MVY A;  1N3X A;  4H65 A;  4PFU A;  1SW2 A;  3TCG A;  1B2H A;  4ONY A;  4R73 A;  3EPE A;  4U1O A;  3T9U A;  1LLS A;  3GZG A;  3K01 A;  4G68 A;  3T9H B;  1R9L A;  2OLB A;  4YKJ A;  3PPN A;  4G8N A;  3HHG A;  3JZJ A;  3K02 A;  2A5T B;  5H8Q A;  4OER A;  5JEI A;  3PMX A;  5H8F B;  4R2B A;  3B6W A;  3MVW A;  1AOV A;  4OHN A;  2GH9 A;  3C9H A;  3B6Q A;  3MZ9 A;  2E1S A;  2XXY A;  3S9M C;  4GXS B;  3H03 A;  1MM6 A;  1A40 A;  3OOA A;  4OTE A;  2Q8J A;  4DZ1 A;  1II5 A;  1S50 A;  3RTW B;  4ESW A;  1B3F A;  2Y7P A;  4IO6 A;  5L9M A;  5I84 A;  3IOR A;  3CG3 A;  4ZZA A;  4NF6 B;  3G3H A;  3HV1 A;  2THI A;  3LSF B;  4ECF A;  1XS5 A;  5DEX A;  2XXW A;  2ZXT A;  3HN0 A;  3JYR A;  3VE1 B;  2Y7I A;  2H9B A;  2UVI A;  1MM7 A;  3OO8 A;  1AMF A;  4Z7E A;  4U4X A;  1MY2 A;  3EHS A;  4R72 A;  5F7V A;  1HSE A;  3K00 A;  3TOD A;  4NF8 B;  4NF4 B;  1B6H A;  5DVF A;  1KWH A;  3MPK A;  4U2R A;  3IR1 A;  3QUJ A;  3FJ7 A;  3FJG A;  4GL0 A;  3DP6 A;  2V3U A;  4FE8 A;  5J1D A;  3KEI A;  3FXR A;  4F18 A;  4YB6 A;  3CR9 A;  4PP0 A;  2PYY A;  3M3F A;  4KI0 E;  3PMW A;  1HSJ A;  4R6H A;  2XX7 A;  3OXN A;  2D21 A;  4EF1 A;  2Y7K A;  4LON B;  4R75 A;  2UVH A;  3IK6 B;  1I6A A;  2I48 A;  3EQ1 A;  1FCK A;  5I2K A;  2XXI A;  1IUD A;  3MZB A;  1IZ1 A;  2ZYO A;  1DMB A;  2H25 A;  4XKP A;  1A7L A;  3SEV A;  1A8F A;  1VFE A;  1DPE A;  3C36 A;  4OEU A;  5FTH A;  3VLW A;  1Z7N E;  1SVX B;  3FV2 A;  4RPN A;  5JTY A;  4EF2 A;  1B0H A;  3G3F A;  1EZ9 A;  3O9P A;  4MLV A;  2QSX A;  1URG A;  4OFO A;  3HO7 A;  4G68 C;  2I49 A;  3LR1 A;  2O1L A;  1ZMG A;  3IJX B;  2GHB A;  2YLN A;  3ILT B;  2I0B A;  2O84 X;  4QSE A;  3H7M A;  1WOD A;  2HAV A;  3OMB A;  4ZDM A;  4NE4 A;  3G3K A;  3CG1 A;  4ELO A;  4IO5 A;  2RC7 A;  4I8C A;  2UXA A;  2Y84 A;  2REG A;  2UYF A;  3QYT A;  4WXJ A;  5ICT A;  2QPQ A;  3ODB A;  4YKK A;  2XXT A;  1NH7 A;  5KCJ B;  1TXF A;  1JEV A;  4XKR A;  1JVX A;  4LAT A;  5EHM A;  2VOZ A;  4GXA A;  2V84 A;  3LSW A;  1LCF A;  2FYI A;  1H45 A;  2XD2 A;  1PC3 A;  3UP9 A;  3H06 B;  3W9W A;  4KPT A;  4KCD A;  4DDD A;  3T96 B;  2I58 A;  4AB5 A;  2XXX A;  4ZEC A;  2OZZ A;  4IO2 A;  4FOR A;  2F8D A;  3PUZ E;  5M2V A;  3TQW A;  4O3C A;  2I3W A;  3W15 C;  3B7D A;  1ATG A;  4F2O A;  3GXA A;  1I6B A;  3TMG A;  5ITO A;  2VHA A;  5KDT B;  1P99 A;  3OD7 A;  2O7U A;  5CMB A;  2B3F A;  1LBB A;  3BBR A;  4OVJ A;  3N6U A;  4QRZ A;  4GRK A;  4BDL A;  1NFT A;  2F7A A;  1IIW A;  2QS3 A;  2X7Q A;  4GVO A;  1JW1 A;  1N7W A;  2F78 A;  1I69 A;  1N04 A;  1B40 A;  3MC2 A;  4JXI A;  3UN6 A;  3EN3 A;  4YU0 A;  4KFQ A;  1B7Z A;  1BP5 A;  1Y1M A;  3C34 A;  4PFY A;  3IOV A;  3TTL A;  2F35 A;  1H43 A;  4EXL A;  1N0T A;  4RY1 A;  5AA4 A;  3I3V A;  4HTG A;  5KCJ A;  2DE2 A;  2I4C A;  2DVZ A;  2NXO A;  1R1N A;  1EH3 A;  3C31 A;  1TFD A;  4QHQ A;  2O69 A;  1IXC A;  3KSJ A;  1P1O A;  1B5I A;  2QS2 A;  2Z22 A;  3IX1 A;  4RXL A;  2F36 A;  1MDP 1;  4G2Z A;  1B9J A;  3UIF A;  3O29 A;  4F22 A;  1UTB B;  4RK2 A;  5I2N B;  4ZEK A;  4H67 A;  4PE5 B;  1B32 A;  3BKI B;  1A54 A;  4ZZE A;  1LFI A;  2H5Y A;  3KFM A;  3IB2 A;  4ZEF A;  3D4C A;  3PUW E;  5DVJ A;  3LSX A;  4PFW A;  2PBW A;  3QUF A;  1L5T A;  2XX8 A;  2VD2 A;  3IB0 A;  3QSL A;  4DXB A;  2HEU A;  1ZBM A;  4R9F A;  2VGQ A;  2DE4 A;  4H8I A;  4POW A;  4GQO A;  1B4H A;  3KN7 A;  1LGB C;  5ICQ A;  1SYH A;  4GFR A;  1GTK A;  2O6A A;  2V93 A;  3SET A;  2PVU A;  4N07 A;  2QJE A;  1B7H A;  4Q8R A;  2XXU A;  4LVQ A;  4N13 A;  1SI1 A;  3W9V A;  3IL1 B;  3TCF A;  4H6D A;  3U93 A;  3FVN A;  3BFU A;  1WDN A;  3FV1 A;  3O66 A;  3O6G A;  3OEK A;  3IJO B;  2KLF A;  1AL3 A;  4JSO A;  3TKD A;  1YTV A;  5IAI A;  2ZYK A;  5CRY A;  1PB8 A;  3FAT A;  3RT6 B;  2ZYM A;  1CB6 A;  4YZZ A;  4F19 A;  4OMB A;  4QFL A;  1DTG A;  2DXR A;  2XXV A;  4FEC A;  3PPR A;  1TFA A;  4ISU A;  1YAE A;  3VFJ A;  3TCH A;  1NH8 A;  3M3L A;  2Y7W A;  4FIM A;  3Q29 A;  4O3A A;  1SW1 A;  4JSD A;  4ELR A;  4QSD A;  3UGW A;  1MXU A;  4OFJ A;  4H5G A;  1Y9U A;  1OLC A;  2IEE A;  1ZLQ A;  4IO4 A;  1XOC A;  1S9T A;  1GR2 A;  1MXZ A;  2HQ0 A;  1BTJ A;  4TLM B;  3RT8 A;  3TZA A;  1LAG E;  4FAT A;  1USY H;  3K1P A;  4TQU Q;  4IY5 A;  3G3I A;  1B5H A;  2DS9 A;  2QS4 A;  1B3G A;  1B51 A;  4OFL A;  3Q28 A;  2WKY A;  3U92 A;  5AA1 A;  3DEL B;  3A09 A;  4BDQ A;  5TPA A;  3T22 A;  3L6G A;  4RNS A;  4H0W A;  3VVF A;  1UIV A;  4PFT A;  2OJT A;  5I2K B;  3WAE A;  4L17 A;  1US5 A;  2HXW A;  3PUY E;  1D3K A;  3TTM A;  3RGY A;  3AXF A;  3IOT A;  3CFZ A;  3UK4 A;  5DYH A;  3K6W A;  4EXK A;  3LC8 A;  2F97 A;  4P0I A;  5JTY B;  1S7Y A;  3OEL A;  1P1N A;  4F1Y A;  1FTK A;  2DQV A;  2DWA A;  1RYO A;  3GLB A;  1ZU0 A;  3R7X A;  1DTZ A;  4ESX A;  4XKQ A;  1B1H A;  3PD9 A;  2PT1 A;  3FVO A;  3MPL A;  1B5J A;  4LQ2 A;  4F31 B;  1MH4 A;  1M5F A;  4AB6 A;  4DE8 A;  1Y4C A;  3U72 A;  4IY6 A;  4JWX A;  3DP4 A;  4GLI A;  2P0S A;  1UTH B;  4NWC A;  1PBP A;  3G3J A;  2E0S A;  3CFL A;  4IB2 A;  3RTF B;  4BDM A;  3SKP A;  2NOO A;  4YMA A;  1NNT A;  1AH5 A;  3KN3 A;  1Y4T A;  4YB5 A;  3E9X A;  3C33 A;  4R9G A;  1FTJ A;  1MG1 A;  3M8U A;  4F3B A;  4KD5 A;  2P1S A;  4DXC A;  1POT A;  2F6P A;  1GV8 A;  2B65 A;  1Y20 A;  3L6H A;  2Q2A A;  1ZIU A;  5CC2 A;  2ALU A;  2Z8D A;  4LA9 A;  3FVG A;  1LAF E;  4DLD A;  1M5B A;  1PBQ A;  3VV5 A;  1B52 A;  1FQA A;  2REJ A;  3OO9 A;  1POY 1;  4KQP A;  4ELP A;  4U21 A;  5L9S A;  3CFX A;  4G8M A;  4R2F A;  2HFB A;  3A3C A;  3ECR A;  4G77 A;  2F6G A;  3FXQ A;  3KJT A;  3KZG A;  1VE4 A;  1N3W A;  5FHM A;  3SEU A;  3O6H A;  2XXH A;  1J1N A;  3ZSF A;  1SD3 A;  3K6V A;  1IXI A;  3C35 A;  1URS A;  4ZS9 A;  3TTN A;  3HPI A;  2DE3 A;  4AQ4 A;  3H4Z A;  1UTH A;  3CSB A;  5AA4 B;  4TOZ A;  1MXV A;  3TUS A;  4C0R A;  4OWD A;  4QFK A;  1QUI A;  1PB7 A;  3VDF A;  1QJM A;  4RA1 A;  1MH3 A;  3SER A;  1OQH A;  1LFG A;  3SEW A;  4YB7 A;  2GHA A;  2DYX A;  1YPN A;  1B3L A;  5I57 A;  4F1U A;  3KN8 A;  3MQ9 A;  2AL5 A;  3WAF A;  3V5A A;  1QKB A;  1FQD A;  2DWH A;  1Q35 A;  3Q27 A;  1N7X A;  4QSC A;  4NMY A;  3E3K A;  2ZNU A;  3FUZ A;  5EYF A;  5CM6 A;  4RYA A;  4Z0I A;  4H8J A;  2ONS A;  3T9V A;  3KSX A;  2O7I A;  1YCJ A;  3I6V A;  1MS7 A;  5K2Y A;  3K4U A;  4E0X A;  1NMU A;  4GF8 A;  3ILU B;  3G3G A;  1JVY A;  4U1Z A;  5DTB A;  4HCY A;  4Q0C A;  5KZT A;  5FHO A;  1FTM A;  1ZTY A;  1QVS A;  4IGR A;  4PET A;  2VD3 A;  4ZE8 A;  3VVD A;  4HW8 A;  1Y1Z A;  3MZ1 A;  2B3B A;  2GRV A;  1WVJ A;  5B70 A;  3TYH A;  1LCT A;  3RNN A;  2O68 A;  4X9T A;  3GBB A;  2PT2 A;  1CE2 A;  3IO4 A;  4XIG Q;  1FQF A;  4OYV A;  5I58 A;  3MBP A;  4ZEB A;  2DWI A;  3HHF A;  4M4G A;  1TT1 A;  5EHS A;  3RN8 A;  1B58 A;  4QFO A;  3QXM A;  2NWJ A;  2D5W A;  4XXU A;  4FJP A;  1MQJ A;  4R74 A;  3IAZ A;  3TTR A;  3K1N A;  1PEB A;  1JW5 A;  2D3I A;  3U94 A;  2V25 A;  4BDR A;  1D9V A;  1H76 A;  4JB7 A;  2FNC A;  3VVE A;  2O51 A;  3OEN A;  1JQF A;  3MVZ A;  3VLU A;  2HZL A;  1QUL A;  1FW0 A;  2OK2 A;  1TWY A;  2DWJ A;  1BKA A;  2PX1 A;  1MXX A;  1ZJL A;  3RUM A;  3N94 A;  3I5O A;  2ZNT A;  3BFT A;  3H6U A;  3OO6 A;  2F34 A;  5CI5 A;  3Q25 A;  1A99 A;  5DVI A;  2I0C A;  3OO7 A;  3JV9 A;  3SEY A;  4MBP A;  2ABH A;  3QAX A;  2RCA A;  1NNF A;  4TLL B;  2R9J A;  3VXC A;  1DSN A;  4MF3 A;  3F11 A;  2QRY A;  3MAM A;  4I9D A;  4ELQ A;  1QW0 A;  2I6E A;  2X7P A;  5CMK A;  4G8H A;  1Q1K A;  1Y3P A;  1SW5 A;  4C1T A;  5TPA B;  2AYS A;  1EU8 A;  1JW4 A;  3FAS A;  5AA2 B;  1Y3Q A;  2M8C A;  4LZ7 A;  1ZKB A;  2G93 A;  2NVU B;  1JET A;  3V8X B;  2DOJ A;  3TAJ A;  3S9N C;  1A55 A;  5AE4 A;  3U1O A;  4LUB A;  3N26 A;  2CMO A;  1LFH A;  1A8E A;  4U22 A;  2Z23 A;  4M1V A;  4GWO A;  4WED A;  3KOS A;  2Z8F A;  4PQJ A;  4KHZ E;  3FIR A;  2YPN A;  3PV0 E;  4RJZ A;  5IKB A;  3IO6 A;  3QK6 A;  1FTO A;  1VSO A;  2XD3 A;  4FED A;  3M3K A;  2BJJ X;  2Z8E A;  4I1D A;  1FQB A;  4LP2 B;  1MXY A;  2A5S A;  5ISU A;  3T93 B;  4DCX A;  2Q2C A;  5TU0 A;  5HM4 B;  3UOR A;  3H6T A;  2AL4 A;  5CMC A;  4NWD A;  3R6U A;  1MY1 A;  1O64 A;  3PUV E;  5A5X A;  4LZ5 A;  2QL3 A;  4NTL A;  1EZP A;  1LBC A;  2O1M A;  3FZV A;  4GL8 A;  3T66 A;  1VR5 A;  3Q26 A;  3TEP A;  2IA4 A;  2H4I A;  1PB9 A;  5AA2 A;  1OIB A;  3G7W A;  4NED A;  3LSL A;  3PUX E;  4Q30 B;  4NF5 A;  4HCW A;  4DIG A;  3OSQ A;  1SYI A;  3MUQ A;  5HPQ A;  3IB1 A;  1MQI A;  1USY E;  1OQG A;  3MJN A;  1B46 A;  3QIM A;  4OET A;  4R6Y A;  3TEL A;  3O28 A;  4EDP A;  5BWJ A;  3K2D A;  4WKM A;  3MP1 A;  1T0K A;  1GGG A;  3S4U A;  5H8H B;  1P1U A;  2UVJ A;  2ZNS A;  4H5F A;  3RQT A;  4U4S A;  1BIY A;  1F9B A;  4EQ9 A;  1MPB A;  2I3V A;  5FTI A;  1B0L A;  2DXY A;  3THI A;  1URD A;  2XXR A;  5HBC A;  1XVY A;  1B1X A;  3K6X A;  5BUU A;  1MQD A;  1NL5 A;  1P1Q A;  5L9O A;  4O3B A;  5H8N A;  1B3E A;  1RKM A;  4OES A;  4YKI A;  3KGC A;  1AIV A;  2ZMB A;  1B7U A;  2DSF A;  5L8D A;  4ND9 A;  4QF9 A;  5I59 B;  3O2A A;  2Y7R A;  3KBR A;  1NKX A;  4X1B A;  5I57 B;  1D9Y A;  2OBG A;  3ONM A;  2A5T A;  1HSL A;  4YMB A;  1ELJ A;  1M5C A;  5H8F A;  2ESN A;  3DLN A;  2H99 A;  1XVX A;  1QUJ A;  3FXU A;  3MP8 A;  2W7Y A;  1GVC A;  3UA8 A;  1OLA A;  2RKM A;  4K3F A;  3K0V A;  2GFE A;  4MLQ A;  5AA2 D;  4IO3 A;  3O97 A;  3PMV A;  4NF6 A;  4UAC A;  2V3T A;  3H6V A;  1R6Z A;  4IO7 A;  4BDO A;  1LAH E;  3DM0 A;  5H8H A;  3S2V A;  2V3Q A;  5ELV A;  4LZ8 A;  3GBA A;  1Z7M E;  2OCU A;  3FGS A;  4C1U A;  3OSR A;  4WEP A;  4FEB A;  1BLF A;  4U23 A;  3CIJ A;  2FA7 A;  3B6T A;  1D4N A;  4KR5 A;  4NF8 A;  4NF4 A;  3SDF A;  1MDQ A;  2XXP A;  1MY0 A;  3EF7 A;  2DVC A;  3A3U A;  1IQ7 A;  2OWT A;  3FJM A;  1OMP A;  1SBP A;  1VFD A;  3C4M A;  1H3D A;  2XHD A;  4GIZ A;  4F3S A;  5I58 B;  4OQO A;  1OVB A;  3TPA A;  1FTL A;  2ONK E;  3RY3 A;  4DCY A;  1MY3 A;  2Q89 A;  2R6G E;  1LST A;  4OEN A;  2RF1 A;  3ZKL A;  2CZL A;  3CVG A;  5I59 A;  4F29 A;  2F5X A;  1MQH A;  1IEJ A;  3RPW A;  1M5D A;  5DT6 A;  4EQ7 A;  1MY4 A;  1P1W A;  2HZK A;  3P7I A;  2RC9 A;  4THI A;  2RIN A;  1SI0 A;  3PPQ A;  1QKA A;  4IGT A;  4KCC A;  3LUY A;  1PDA A;  1LB8 A;  4YKP A;  3H3G A;  3MW0 A;  1I6Q A;  3KOT A;  2VP1 A;  1O7T A;  5FHN A;  3KG2 A;  4JBZ A;  4XTC Q;  4XKN A;  4E0W A;  4GD5 A;  3KJ7 A;  5TP9 B;  3CI8 A;  2H98 A;  4H1X A;  4OZ9 A;  4QFN A;  4F1V A;  3H6W A;  3IOU A;  4YIC A;  2G29 A;  1N76 A;  3PGF A;  3LBS A;  3R26 A;  3PPP A;  1NNK A;  3FVK A;  1IXH A;  2UVG A;  2YJP A;  2OWS A;  4DXU A;  1XHY A;  4BDN A;  3VLV A;  3TQL A;  5CBR A;  4JWY A;  2I4B A;  4OXV A;  1QUK A;  3O6I A;  1FQC A;  2P2A A;  4P11 A;  4UA8 A;  3SES A;  1B05 A;  3EHU A;  3OEM A;  3RLF E;  1Y3N A;  3D4G A;  3USD A;  4R6K A;  4BLA A;  5ITP A;  3DP8 A;  1LAX A;  2Q9T A;  2ONR A;  4RPO A;  3N5L A;  3SEX A;  2NUV A;  1H44 A;  1O63 A;  2XX9 A;  2ANJ A;  1MRP A;  4EQB A;  1M5E A;  3V83 A;  4JDF A;  4X1D A;  5CBS A;  5B7D A;  1MXW A;  4F39 A;  3E13 X;  4X48 A;  3HST A;  4YAH X;  4F3G A;  4HS7 A;  5I56 B;  2RC8 A;  5K2X A;  1LB9 A;  2Q88 A;  1UIU A;  1US4 A;  2F7C A;  2HCA A;  1XT8 A;  2XXQ A;  5KDT A;  3ZS6 A;  5TP9 A;  2QMW A;  3K1M A;  4LQ5 A;  4I62 A;  2UYE A;  1SW4 A;  2DP8 A;  4KYE A;  1MQG A;  4ZED A;  1RYX A;  3PPO A;  1OVT A;  3HCQ A;  2ZYN A;  2R71 A;  2RCB A;  1JNF A;  3T9X B;  1JEU A;  1DPP A;  4QFP A;  2LAO A;  2X26 A;  1UQW A;  4FAJ A;  1IIT A;  1ANF A;  5LOM A;  4POX A;  3MVX A;  4OEV A;  4Q5T A;  5A5X B;  1FQE A;  3N6T A;  1SQY A;  4JWO A;  3MWB A;  3ZKK A;  4ZEI A;  3CSG A;  4G68 B;  3S9E A;  1B4Z A;  2HAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...