1TT1A

Crystal structure of the glur6 ligand binding core in complex with kainate 1.93 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 87
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A02
4RNSA 4AB5A 3IO4A 2ZYMA 3M3LA 1LBCA 4MF3A 2Q9TA 4ZE9A 4LP2B 1MPDA 5TP9B 3C9HA 3HHFA 4PFUA 5L9MA 3B6QA 3LSXA 1FQCA 4MLQA 1A40A 4Q0CA 2O68A 3FVOA 3HCQA 1D9YA 3IOUA 2HXWA 3FJ7A 3PMWA 5FTHA 1QVSA 4XKPA 3T22A 3VDFA 3G3GA 4ZDMA 2H25A 4I9DA 3C31A 3DM0A 4R75A 3MVYA 3R26A 3TTNA 3LSFB 4LUBA 1ZMGA 2DVCA 3IOTA 1FQAA 2ZXTA 3PGFA 2QS3A 1DPEA 3FVGA 4L17A 3W15C 1B5HA 2PT2A 3UP9A 3ILUB 1DSNA 5DT6A 4Q30B 4WKMA 2VOZA 1MRPA 2V3UA 2OZZA 3V89B 2PBWA 5H8QA 4R9GA 1B2HA 3FXRA 4BDQA 1SBPA 4G2ZA 5JTYB 4GD5A 3OEKA 1HSJA 1DTZA 2Q2CA 4QFKA 5H8HB 1H3DA 1ZIUA 2Q2AA 3CFZA 1FW0A 4FIMA 2D3IA 3IJXB 1JW5A 4ELRA 3U1OA 4ESXA 1SW4A 3TCGA 2DE2A 2REGA 3PPOA 2G93A 5H8NB 2XXHA 4DXBA 1ZJLA 4LVQA 3IORA 1FQBA 2IA4A 5B70A 1DPPA 3DELB 3QUJA 3LSWA 3OOAA 3G3JA 1QJMA 1Y4TA 3S9NC 3TODA 5I2NA 4GF8A 4Z0IA 1QKAA 4LZ8A 4EXKA 5DYHA 4ECFA 3C32A 5FHMA 4GVOA 1ATGA 1SQYA 2RKMA 1QW0A 2E0SA 1B5JA 2VD2A 1KWHA 2QS2A 3UGWA 3VLUA 1AIVA 4XKNA 4DCXA 2XXIA 3TZAA 1BP5A 4G68A 4IB2A 3I5OA 4H67A 2Y7PA 3CIJA 1AH5A 2O69A 2Y7IA 1FTKA 3MZ9A 3FV2A 3QYTA 4ESWA 4M4GA 2HZKA 4U2RA 1LAXA 3M8UA 4KYDA 3FXUA 4KHZE 1EZPA 3K02A 1IIWA 5M2VA 2GFEA 1XVXA 3EHUA 3HSTA 4Z7EA 2ZYKA 4HCYA 2NUVA 2DOJA 3LSLA 3K2DA 4GRKA 4R6YA 4R6HA 5I2KB 2O51A 4P11A 1SI1A 3JV9A 4OYVA 2Z8FA 1CE2A 3I3VA 2ZNTA 2VD3A 1MQHA 4P0GA 4QFLA 4R73A 1POY1 4POWA 3TPAA 3ZKKA 3MJNA 4EQ7A 5F1QA 3PD9A 1WVJA 1YPNA 1B1XA 3MVZA 1ZKBA 1ZU0A 3QSLA 3USDA 4RA1A 1MY4A 1SI0A 1OVTA 3K6WA 4KYSA 1AL3A 4OZ9A 3KN3A 4NF4B 5H8SA 4YB5A 2H99A 3T96B 4U4XA 2PX1A 1R9QA 4Q8RA 1BTJA 4NF8A 3BBRA 4OFLA 2O1LA 3TCFA 2H98A 5EYFA 2AL4A 3KEIA 3SDFA 4F1UA 3MP6A 2DWHA 4DXCA 1IZ1A 1FQFA 1UTBA 3EF7A 4KQPA 1H45A 3TTKA 3TDJA 4C0RA 4TQUQ 2XXQA 2DE4A 5JK4A 1Y3PA 2GHBA 4YMAA 1PBPA 4H0WA 1IEJA 3TAJA 3G7WA 1N7XA 2I0BA 4NMYA 1OMPA 5HPQA 3FZVA 2QJEA 5AA2D 3V5AA 3IX1A 3GBAA 5I56B 3Q29A 4LZ7A 4YICA 4YAHX 1AMFA 2CMOA 3LUYA 3OO8A 1JVXA 2D5WA 4GXAA 4R72A 3MPKA 1Y1MA 2XD2A 1QKBA 1RYXA 1MS7A 2QMXA 3H6TA 2XX8A 3ODBA 4NF6A 3N94A 3GLBA 2QMWA 5CC2A 1SYHA 1S9TA 1LFHA 1N84A 3MVWA 1POTA 3TQLA 3PD8A 2OWTA 3Q27A 1Y3QA 4MFIA 1FTLA 4I1DA 3O29A 1A54A 4KCCA 5KCJB 4OMBA 1JVYA 5CMMA 1Y9UA 2ALUA 4KR5A 4H8JA 3I6VA 2HCAA 2Z8EA 5I58A 2E1SA 4LQ2A 4QF9A 3GBBA 4NF5B 1NH8A 4IO3A 1J1NA 2H5YA 5ICTA 3PPQA 3TTRA 5K2YA 3OSRA 3KZGA 3JYRA 4O3AA 4Q5TA 4BDRA 3A3CA 4RPNA 3OSQA 1P99A 4OVJA 2UYEA 4ONYA 2HZLA 4I8CA 3U8QA 3G3FA 4FEBA 5I84A 3CI8A 2I0CA 1MQJA 1M5FA 5DVIA 5EHSA 2UVHA 2DWIA 4F31B 3L6HA 1MPCA 4THIA 3SEVA 2A5TA 4FAJA 4ELQA 3T9HB 2XXXA 2Z22A 1OLCA 2FA7A 4FECA 2P0SA 3ONMA 1O7TA 3V8XB 4XIGQ 1GTKA 5ISUA 3DLNA 3HHGA 1FTOA 4ZEDA 1UTHB 4WEPA 3MW0A 2V3QA 4IY6A 3K01A 1R6ZA 4U21A 5AA4A 3HPIA 4JDFA 5KDTA 2O6AA 3DP6A 3Q26A 2THIA 1NMUA 4F3SA 1Z7ME 4ZZAA 5I59B 3CVGA 4TOZA 1MQIA 4ELPA 3VFJA 4RJZA 1MG1A 4U4SA 4N6PA 1SDXA 1XS5A 3KN7A 4OENA 3EN3A 5CMKA 2M8CA 5ITPA 3K6XA 3QAXA 1PDAA 4R9FA 4GL0A 3H4ZA 1PEBA 3VXBA 1MXZA 2F5XA 5I57B 1Y4CA 3MVXA 4LONB 2QL3A 1Q35A 2NXOA 3U94A 3IB2A 4OEVA 3D4GA 4OTEA 4QFPA 1S7YA 4OHNA 4O3BA 3K1NA 4EXLA 4F3BA 1DOTA 3BFUA 1N3XA 4G4PA 3VVDA 2KLFA 3RT8A 3UA8A 3PUVE 3PUZE 1FTJA 3N26A 4UACA 3OENA 4YKJA 2DE3A 3E9XA 3E4RA 4YU0A 3KOTA 1MY3A 4H5GA 3SEXA 1NFTA 2F97A 2XXVA 2XHDA 3V83A 2H9BA 2OK2A 4GLIA 3TEPA 3FD3A 2D21A 1N04A 4F2QA 5KZTA 4R6KA 3H03A 4POXA 4F1YA 3O6IA 3C36A 1CB6A 1PB7A 4DXUA 2GRVA 2XX7A 1I69A 5DEXB 1B0HA 3EQ1A 4DE8A 2GH9A 2VP1A 3QIMA 1Z7NE 3AXFA 1LB8A 5FHOA 4RYAA 3CSGA 2QSXA 4JWXA 1NNFA 4KFQA 3S9LC 5AA2B 1FQEA 2DP8A 4JSDA 2FYIA 3O66A 3W9WA 4G8MA 3L6GA 2I58A 2F78A 1I6QA 3OXNA 5JEIA 1GVCA 1P1QA 3MQ9A 5CI5A 5CBSA 4OWDA 5B7DA 5TP9A 2I3WA 2ONRA 3SEWA 2OBGA 4IO7A 2UXAA 4JBZA 3ILTB 3MUQA 3FXQA 4MLVA 4KPTA 1I6AA 3TELA 4PQJA 1B1HA 1NNKA 4YZZA 1M5CA 1P1NA 4DCYA 5BUUA 4IO6A 1B0LA 4F3GA 4G77A 1H44A 5CM6A 1VFDA 2F7AA 4FEDA 3A09A 2O1MA 4TLLB 4HCWA 3F11A 3CG3A 3OEMA 4U1ZA 3RPWA 1M5EA 3O97A 4E0XA 3LC8A 4MBPA 1I6BA 1MXYA 4F1VA 4I62A 4G8NA 4EQBA 5DVFA 1GGGA 5FHNA 3OELA 1R1NA 1H76A 2Z8DA 3C33A 3SKPA 1SW2A 4DDDA 5IKBA 4QSCA 1ZTYA 1TFDA 3UIFA 4XXUA 4GL8A 5JTYA 4F3PA 4F22A 3E13X 3PPNA 1Y3NA 4YKPA 5H8HA 5L9OA 1BKAA 2HEUA 2IEEA 1A99A 1BIYA 1FQDA 3T9VA 2I3VA 2DXYA 2DS9A 4ZS9A 5AE4A 2NOOA 5HM4B 2ONSA 3TMGA 4N07A 4MH5A 3A3UA 5H8NA 3KBRA 4K3FA 1IXCA 3OO6A 1VR5A 4HTGA 3IB0A 3TQWA 3LR1A 4GXSB 1RYOA 1WDNA 4X1DA 4QHQA 3U72A 4PP0A 1D9VA 3ZS6A 4OERA 5A5XB 5TPAB 4AQ4A 1QUIA 3MBPA 1TT1A 1OIBA 3JZJA 2Q88A 3W9VA 2XXPA 5H8FB 3B6TA 3QK6A 4AB6A 3FASA 3K4UA 3UK4A 1MH4A 2Z23A 4TLMB 3TTLA 5F7VA 1A8EA 3R6UA 1EH3A 1LBBA 1OLAA 3FVNA 4GOTA 3PPRA 2ZNSA 2B3BA 1LGBC 2Q89A 4R2BA 3R7XA 3FGSA 3CRBA 4NWCA 1IUDA 3K0VA 3RUMA 4BDLA 3OO9A 3S4UA 3K1MA 1XT8A 1Q1KA 2RCAA 4JWYA 1DTGA 2PYYA 1A7LA 1URDA 2I49A 3TKDA 4JXIA 1GR2A 3RTWB 2HAUA 4R2FA 2Y7RA 1MY0A 1MQDA 3HN0A 1PB8A 1JNFA 4G8HA 1MXUA 2Q8JA 2ANJA 1LLSA 4EF1A 1LCFA 2F35A 3FV1A 1B3HA 1LAFE 3PUYE 2HAVA 3TCHA 4BDOA 3CR9A 5I2KA 3OO7A 5EHMA 4YB6A 4C1TA 4PFWA 5ICQA 4F2OA 4U23A 1LAGE 3K00A 4DLDA 4LATA 2VHAA 2Y7WA 4XTCQ 1YCJA 1USYH 4GFRA 2Y84A 1R9LA 4XKQA 1ZLQA 3M3FA 4FE8A 2O7UA 4QSDA 5H8QB 1O63A 1IITA 1B46A 1B51A 1QUKA 1B3GA 1RKMA 3C34A 2V3TA 1JW4A 4NF4A 4E0WA 3PU5A 1B4ZA 2I6EA 2HQ0A 2R9JA 2AIXA 1MM7A 5L8DA 1YAEA 3VV5A 1N0TA 3ZSFA 1GV8A 1ANFA 3IK6B 3QXMA 3K6UA 1WODA 2ABHA 3TFLA 2O84X 4F29A 2DSFA 1A55A 5TU0A 2ZNUA 4KCDA 3IR1A 4X48A 3O2AA 1EZ9A 2NWJA 5I2NB 3IO6A 4IGRA 1OQGA 4GWOA 2F6PA 1TXFA 3K1PA 1B52A 2PMSA 2DVZA 1MH3A 1XHYA 1B5IA 2OJTA 2I48A 1FTMA 2YJPA 4PE5B 3C4MA 1MXVA 4BDNA 1N3WA 5I56A 4NWDA 4H65A 3PUWE 4GQOA 4OEUA 1XOCA 1YTVA 3CG1A 4G68B 2F8DA 3VVFA 3D4CA 3SERA 3H6UA 4PETA 1M5BA 4JWOA 1JW1A 1URGA 4M1VA 3U92A 3KOSA 1B40A 4ZE8A 1SW1A 4ZEBA 4YB7A 3T93B 5L9SA 2YLNA 3Q25A 3G3KA 4C1UA 1B3FA 5KCJA 3TTMA 1NNPA 4IO4A 1B7HA 2DXRA 5ELVA 4BLAA 1PBQA 3BKIB 3H3GA 3TUSA 4NF5A 2I4BA 4F19A 1L5TA 2BJJX 3KSXA 4N13A 4X1BA 1HSLA 1HSEA 2AL5A 4DIGA 4EUOA 2AYSA 1MPBA 4P0IA 4EDPA 2F36A 1IXHA 2P2AA 3VXCA 4RPOA 2ESNA 4OESA 3DP4A 1II5A 2B3FA 3MPLA 3S9EA 4PFYA 4OXVA 4R74A 3RN8A 2H4IA 3FUZA 3FIRA 1F9BA 1SYIA 3O9PA 1OQHA 2CZLA 2XXRA 1Y20A 4ZEFA 1LCTA 4XKRA 3VLWA 3SEUA 3HO7A 5DTBA 5AA3A 4RXLA 1H43A 4NEDA 4IO5A 2PT1A 3PMVA 3Q28A 4OFOA 3WAEA 4NF8B 1D4NA 1B7UA 2XXTA 1EZOA 1SVXB 1UTHA 3EHSA 3G3IA 1EU8A 1OVBA 3MC2A 4YMBA 3RY3A 4H1XA 2GHAA 3N6TA 1UTBB 4IY5A 1US5A 4ELOA 4IO2A 3ZKLA 4H6DA 2QS4A 1B6HA 1US4A 1ZBMA 2DWJA 4RK2A 2DQVA 1MXWA 3S9MC 1Y1ZA 4GIZA 3WAFA 2G29A 5I59A 1NNTA 2ZMBA 3IAZA 1ELJA 3N6UA 1VE4A 3EPEA 4EQ9A 3KGCA 4F39A 2R71A 1T0KA 1JEVA 3T9XB 1B4HA 3H6WA 1P1UA 2V25A 3RLFE 3N5LA 2I4CA 3C35A 1P1WA 3PUXE 4UA8A 4LQ5A 5I57A 4FJPA 1QULA 3DP8A 2OWSA 4NF6B 2B65A 3U93A 4JB7A 4YKIA 3BFTA 3PPPA 3VVEA 2RCBA 4NTLA 3UN6A 2X26A 3IJOB 1NL5A 2LAOA 1M5DA 4F18A 5I58B 1N7WA 4U22A 3THIA 1S50A 2R6GE 1B9JA 1PC3A 1VSOA 3MWBA 3KJ7A 4ND9A 5CMCA 4H8IA 4G68C 2Y7KA 1MDP1 5BWJA 1JQFA 4KYEA 2RC7A 4WXJA 4YKKA 2REJA 2UYFA 4OFJA 1B58A 2OCUA 2P1SA 2RF1A 2X7PA 3KJTA 3UORA 5DEXA 5LOMA 1IXGA 2FNCA 3B6WA 1XC1A 1P1OA 3FJMA 2XXWA 3KN8A 3K6VA 1QUJA 1SW5A 4PFTA 3G3HA 4IGTA 2NVUB 1DMBA 2YPNA 1MY1A 2HFBA 3SESA 1JETA 5CRYA 2A5TB 4OQOA 5AA2A 3MP8A 5IAIA 5AA1A 4H5FA 2V93A 2X7QA 3MZ1A 1AOVA 1FCKA 2PVUA 4FORA 1B7ZA 2UVGA 3PMXA 1B32A 3IOVA 4WEDA 3MAMA 1MQGA 3S2VA 4KI0E 1UIVA 3RGYA 4RY1A 3ECRA 2XXYA 1B3LA 2VGQA 3VE1B 5AA4B 2XXUA 5KDTB 5FTIA 1LB9A 3SEYA 2XX9A 3QUFA 3CSBA 1D3KA 3O28A 3VLVA 2OLBA 2O7IA 1B05A 1A8FA 2ZYNA 1TFAA 3MP1A 2DWAA 3H7MA 3PV0E 2QRYA 1USYE 1JEUA 2XD3A 1TWYA 1PB9A 3IOWA 5HBCA 4ZEIA 1O64A 3MZBA 1NKXA 3KSJA 4HS7A 5CBRA 2F7CA 5CMBA 3RNNA 2F34A 4DZ1A 2ONKE 1VFEA 1IXIA 2RC8A 4RK9A 4BDMA 4O3CA 1SD3A 3O6GA 1LFIA 1LFGA 1MDQA 3E3KA 3RT6B 1NH7A 2V84A 4EF2A 1MY2A 2UVIA 4QRZA 2W7YA 1URSA 1XVYA 3RTFB 3GXAA 2QS1A 4X9TA 3RQTA 3FJGA 4U1OA 3T66A 1IQ7A 4LZ5A 1UQWA 4ZECA 3KG2A 3IL1B 2F7BA 1MXXA 4JSOA 4ISUA 2WKYA 3IB1A 3T9UA 3OD7A 4QSEA 2A5SA 1MM6A 3GZGA 1LAHE 5J1DA 4FATA 3CFLA 3LBSA 2F6GA 4ZZEA 5A5XA 3OMBA 3P7IA 4ZEKA 1BLFA 3O6HA 3M3KA 3TYHA 1LSTA 3FVKA 4NE4A 5TPAA 3B7DA 3FATA 3KFMA 4OETA 5K2XA 2DYXA 5DVJA 2UVJA 4QFOA 3CFXA 3EHTA 1N76A 5ITOA 4LA9A 5H8FA 4QFNA 2QPQA 2ZYOA 2RINA 1B3EA 4HW8A 3H6VA 3HV1A 3H06B 1UIUA 3SETA 4KD5A 2RC9A
chains in the Genus database with same CATH superfamily
4RNSA 4AB5A 3IO4A 2ZYMA 3M3LA 1LBCA 4AS4A 4MF3A 2Q9TA 4ZE9A 4LP2B 1MPDA 5TP9B 3C9HA 2GQ1A 3HHFA 4MNPA 4GX3A 4PFUA 5L9MA 2XWVA 3B6QA 3LSXA 1FQCA 4MLQA 1A40A 4Q0CA 1YYZA 1FPGA 2O68A 3FVOA 3HCQA 1D9YA 3IOUA 2HXWA 3FJ7A 3PMWA 5FTHA 2CEYA 1QVSA 4N8GA 4PDHA 4XKPA 3T22A 3VDFA 2CZKA 3G3GA 3RYDA 4ZDMA 1YXIA 2H25A 4I9DA 3C31A 3DM0A 4R75A 3MVYA 3R26A 4QBAA 3TTNA 3LSFB 4LUBA 1ZMGA 2DVCA 3IOTA 2HHMA 1FQAA 2ZXTA 3PGFA 2QS3A 1DPEA 3FVGA 4L17A 3W15C 1B5HA 2PT2A 3UP9A 3ILUB 1DSNA 5DT6A 4Q30B 4WKMA 2VOZA 1MRPA 2V3UA 2OZZA 5DW8A 3V89B 2PBWA 5H8QA 4R9GA 1B2HA 3FXRA 4BDQA 4N6KA 1SBPA 4G2ZA 5JTYB 4GD5A 3T0JA 3OEKA 1HSJA 1DTZA 1RDZA 2Q2CA 4QFKA 2QVRA 5H8HB 1H3DA 1ZIUA 2HPGA 2Q2AA 3CFZA 1FW0A 4FIMA 2D3IA 3IJXB 3RPLA 4X8RA 4GBWA 1JW5A 4ELRA 3U1OA 4ESXA 1SW4A 3TCGA 2DE2A 2REGA 4XEQA 3PPOA 2G93A 1FPBA 5H8NB 2XXHA 4DXBA 3CHGA 1ZJLA 1FPFA 4LVQA 3IORA 1FQBA 2IA4A 5B70A 1DPPA 3DELB 3EKIA 3QUJA 3LSWA 3OOAA 3G3JA 1QJMA 1Y4TA 3S9NC 3TODA 5I2NA 4GF8A 4Z0IA 1QKAA 4LZ8A 4EXKA 5DYHA 1FTAA 4ECFA 3C32A 1FRPA 5FHMA 4GVOA 1ATGA 1SQYA 2RKMA 1QW0A 2E0SA 1B5JA 2VD2A 1KWHA 2QS2A 3UGWA 3VLUA 1AIVA 4OVRA 4XKNA 4DCXA 2XXIA 4QXDA 3TZAA 1BP5A 4G68A 4IB2A 3I5OA 4H67A 2ZZXA 2Y7PA 3CIJA 1AH5A 2O69A 2Y7IA 1FTKA 3MZ9A 3FV2A 3QYTA 3BIGA 4ESWA 4M4GA 2P3VA 4JVIA 1DBZA 2HZKA 4U2RA 4I40A 1LAXA 3M8UA 4KYDA 3FXUA 2XWIA 4KHZE 1EZPA 1INPA 3K02A 1IIWA 5M2VA 2GFEA 1XVXA 3EHUA 3HSTA 4Z7EA 4NAPA 2ZYKA 4HCYA 2NUVA 2XWOA 2DOJA 3LSLA 5A5LA 3K2DA 4GRKA 4R6YA 4R6HA 5I2KB 2B4MA 2O51A 4O7IA 4P11A 1SI1A 3JV9A 4OYVA 2Z8FA 5IZ3A 3NOHA 1CE2A 3I3VA 2ZNTA 2VD3A 1MQHA 4P0GA 4QFLA 5ESYA 1FBFA 4R73A 1POY1 4POWA 3TPAA 3ZKKA 3MJNA 4PFRA 4EQ7A 5F1QA 3PD9A 2VT5A 1WVJA 1YPNA 1B1XA 1NV5A 3MVZA 1ZKBA 1ZU0A 3QSLA 3USDA 4RA1A 1MY4A 3QMFA 1SI0A 1OVTA 3K6WA 4KYSA 1AL3A 4OZ9A 3KN3A 4NF4B 5H8SA 4YB5A 2H99A 3T96B 4U4XA 2PX1A 1R9QA 4Q8RA 1BTJA 4NF8A 3BBRA 4OFLA 2O1LA 3TCFA 2H98A 5EYFA 2AL4A 3KEIA 1FBDA 3SDFA 3PTYA 4HXVA 4F1UA 2WYKA 3MP6A 2DWHA 4DXCA 1IZ1A 1FQFA 1UTBA 3EF7A 4KQPA 1H45A 3TTKA 3TDJA 4C0RA 2WYPA 4TQUQ 2XXQA 2DE4A 5JK4A 1Y3PA 2GHBA 4YMAA 1PBPA 4H0WA 1IEJA 4JVCA 3TAJA 4GWSA 3G7WA 4P3LA 1N7XA 2I0BA 4NMYA 1OMPA 5HPQA 3FZVA 2QJEA 4GX4A 5AA2D 3IX1A 3V5AA 3GBAA 5I56B 3Q29A 4LZ7A 4YICA 4YAHX 1AMFA 2CMOA 3LUYA 3OO8A 5ET7A 1JVXA 2D5WA 4GXAA 4R72A 3MPKA 1Y1MA 2XD2A 1QKBA 1RYXA 1MS7A 2QMXA 3H6TA 2XX8A 3ODBA 4NF6A 3N94A 3GLBA 2QMWA 5CC2A 1SYHA 1S9TA 1LFHA 1N84A 3MVWA 1POTA 3TQLA 2CZHA 3PD8A 2OWTA 3Q27A 1Y3QA 4MEVA 4MFIA 1FTLA 4I1DA 3O29A 1A54A 4KCCA 5KCJB 2QVUA 4OMBA 1JVYA 4N6DA 5CMMA 1Y9UA 2ALUA 4KR5A 4H8JA 4P9KA 3I6VA 1LBYA 2HCAA 2Z8EA 5I58A 2E1SA 4LQ2A 4QF9A 4JVDA 4PE3A 3GBBA 4NF5B 1NH8A 4IO3A 1J1NA 3HFUA 2H5YA 5ICTA 3PPQA 3TTRA 4PFIA 5K2YA 3OSRA 4O7MA 2OX3A 5EQ7A 3KZGA 4MNCA 3A29A 3JYRA 4O3AA 4Q5TA 4BDRA 3A3CA 4RPNA 3MYUA 3OSQA 1P99A 1NV4A 4OVJA 2UYEA 4ONYA 2HZLA 4I8CA 2VPOA 3U8QA 3G3FA 4FEBA 5I84A 3CI8A 2I0CA 1MQJA 1M5FA 5DVIA 5EHSA 2UVHA 2DWIA 4F31B 1FPEA 3L6HA 1IMAA 1MPCA 4NHBA 4THIA 3SEVA 3B50A 2A5TA 4FAJA 4HE1A 4ELQA 3T9HB 1FPJA 2XXXA 2Z22A 1OLCA 2FA7A 4FECA 2P0SA 3ONMA 1O7TA 3V8XB 4XIGQ 4N15A 5T3JA 1GTKA 5ISUA 3LUZA 3DLNA 3HHGA 1FTOA 1DCUA 1FBHA 4ZEDA 1UTHB 4WEPA 2WBDA 3MW0A 2Q74A 2V3QA 4IY6A 3K01A 1R6ZA 4U21A 5AA4A 3HPIA 4JDFA 5KDTA 1FJ6A 2O6AA 4PGNA 3DP6A 3Q26A 2THIA 4PAKA 1NMUA 4F3SA 1Z7ME 4I3YA 4ZZAA 5I59B 1FBGA 3CVGA 4TOZA 1MQIA 4ELPA 5F24A 3VFJA 4RJZA 1MG1A 3FXBA 1KA0A 4U4SA 4N6PA 1SDXA 1XS5A 3KN7A 4OENA 3EN3A 5CMKA 2PFYA 2M8CA 5ITPA 3K6XA 3QAXA 1PDAA 4R9FA 4GL0A 3H4ZA 1PEBA 3VXBA 1MXZA 2BJIA 2F5XA 5I57B 1FBCA 1Y4CA 3MVXA 4LONB 2QL3A 1Q35A 2NXOA 3U94A 4GBVA 3IB2A 4OEVA 4X04A 3D4GA 4OTEA 4QFPA 4PGPA 1S7YA 4OHNA 4O3BA 3K1NA 4EXLA 4F3BA 1DOTA 4UABA 3BFUA 1N3XA 4G4PA 3VVDA 2KLFA 3RT8A 3UA8A 3PUVE 3PUZE 1FTJA 3N26A 4UACA 2FIXA 3OENA 4YKJA 2DE3A 3E9XA 3E4RA 4YU0A 3KOTA 1MY3A 4GWYA 1NV6A 4H5GA 4PCDA 3SEXA 4NGUA 1NFTA 2F97A 2XXVA 2XHDA 3V83A 2H9BA 2OK2A 4GLIA 4OA4A 3TEPA 3FD3A 2D21A 1K9ZA 1N04A 4F2QA 5KZTA 4R6KA 1IMCA 3H03A 4POXA 4F1YA 3O6IA 3C36A 1CB6A 1PB7A 4DXUA 2GRVA 2XX7A 1I69A 4MCOA 5DEXB 1B0HA 3EQ1A 4N17A 4DE8A 2GH9A 2VP1A 3QIMA 1Z7NE 3AXFA 1LB8A 2WBBA 5FHOA 4RYAA 3CSGA 2QSXA 4JWXA 1AWBA 1NNFA 4KFQA 3S9LC 5AA2B 1FQEA 2DP8A 4JSDA 4N81A 5LTCA 2FYIA 3O66A 3W9WA 4G8MA 4HE0A 3L6GA 2I58A 2F78A 1I6QA 4NF0A 3OXNA 5JEIA 1GVCA 1P1QA 3MQ9A 5CI5A 5CBSA 2PCRA 4OWDA 5B7DA 5TP9A 2I3WA 2ONRA 3SEWA 2OBGA 4IO7A 2UXAA 4JBZA 3ILTB 3MUQA 4H46A 3FXQA 4MLVA 4N4UA 4KPTA 1I6AA 3TELA 4PQJA 1B1HA 1NNKA 4YZZA 1M5CA 1P1NA 4DCYA 1FPIA 5BUUA 4IO6A 1B0LA 4F3GA 4G77A 1H44A 5CM6A 1VFDA 2F7AA 4FEDA 3A09A 2O1MA 5I3SA 4TLLB 4HCWA 3F11A 3CG3A 1G0IA 3OEMA 4U1ZA 3RPWA 1M5EA 3O97A 4E0XA 3LC8A 4MBPA 1I6BA 1MXYA 4F1VA 1BK4A 4I62A 4G8NA 4EQBA 5DVFA 1GGGA 5FHNA 3OELA 1R1NA 5LDZA 1K9YA 1H76A 2Z8DA 3C33A 3SKPA 2P3NA 4N8YA 1SW2A 4DDDA 5IKBA 2Y5KA 4QSCA 1ZTYA 1FPLA 1TFDA 3UIFA 4XXUA 4GL8A 5JTYA 4F3PA 4F22A 3E13X 3PPNA 1Y3NA 4YKPA 5H8HA 3U65A 5L9OA 4P1EA 1BKAA 1NUZA 2HEUA 1CNQA 1IMBA 2IEEA 1A99A 4IR8A 3KC1A 1BIYA 1FQDA 3T9VA 2I3VA 2DXYA 2DS9A 4ZS9A 5AE4A 2NOOA 5HM4B 2ONSA 3TMGA 4N07A 4MH5A 3A3UA 5H8NA 3KBRA 4K3FA 1IXCA 3OO6A 1VR5A 4HTGA 1NUYA 3IB0A 3TQWA 3LR1A 3E78A 4GXSB 1RYOA 1WDNA 4X1DA 5EQ8A 4QHQA 4PBHA 3U72A 4PP0A 1D9VA 3ZS6A 4PTKA 4OERA 5A5XB 4MMPA 2KR0A 5TPAB 4AQ4A 1QUIA 3IFCA 3MBPA 1TT1A 1OIBA 3JZJA 1KZ8A 2Q88A 3W9VA 2XXPA 5H8FB 3B6TA 3QK6A 4AB6A 1NV3A 2CZIA 3FASA 3K4UA 3UK4A 1MH4A 2Z23A 4MJOA 4TLMB 4OANA 3TTLA 5F7VA 1A8EA 3R6UA 4GWWA 1EH3A 1LBBA 1OLAA 2JJKA 3FVNA 4GOTA 3PPRA 2ZNSA 2B3BA 1LGBC 2Q89A 3MSTA 2ZZWA 4R2BA 3R7XA 3FGSA 3CRBA 4NWCA 1IUDA 3K0VA 3RUMA 4BDLA 3OO9A 3S4UA 3K1MA 1XT8A 1Q1KA 2RCAA 4JWYA 1DTGA 2PYYA 1A7LA 1URDA 2I49A 3TKDA 4GWXA 4JXIA 1GR2A 3RTWB 2HAUA 4R2FA 2Y7RA 1MY0A 1MQDA 3HN0A 1PB8A 1JNFA 4G8HA 1MXUA 2Q8JA 4OVQA 2ANJA 1LLSA 4EF1A 1LCFA 2F35A 3FV1A 1B3HA 1LAFE 3PUYE 2HAVA 3TCHA 4BDOA 3CR9A 5I2KA 3OO7A 3E79A 5EHMA 4YB6A 4C1TA 4PFWA 5ICQA 4F2OA 4U23A 1LAGE 2WX9A 1EYIA 3K00A 4DLDA 4LATA 2VHAA 2Y7WA 1G0HA 4XTCQ 1FJ9A 1YCJA 1USYH 1NV1A 4GFRA 2Y84A 1R9LA 4NG7A 1FSAA 4XKQA 1ZLQA 3M3FA 4FE8A 2O7UA 4QSDA 5H8QB 1O63A 1EYJA 1IITA 1B46A 1B51A 1QUKA 1B3GA 1RKMA 3C34A 4DI4B 2V3TA 1JW4A 4FBPA 4NF4A 4PF8A 4E0WA 3PU5A 1B4ZA 2I6EA 2HQ0A 2R9JA 2AIXA 1MM7A 5L8DA 3RPLB 2HXRA 1YAEA 4P56A 3VV5A 1N0TA 1FBPA 3ZSFA 1GV8A 1ANFA 3IK6B 3BIHA 3QXMA 3K6UA 1WODA 2ABHA 3TFLA 2O84X 4F29A 2DSFA 1A55A 5TU0A 2ZNUA 4KCDA 4MIJA 3IR1A 4X48A 3O2AA 1EZ9A 2NWJA 5I2NB 3IO6A 4IGRA 3SZPA 1OQGA 4GWOA 2F6PA 1TXFA 4PAFA 3K1PA 1B52A 2PMSA 2DVZA 3KBZA 1MH3A 1XHYA 1B5IA 1SPIA 2OJTA 2I48A 1FTMA 2YJPA 4PE5B 4O8MA 3C4MA 1MXVA 4BDNA 1N3WA 5I56A 4NWDA 4H65A 3PUWE 4GQOA 4OEUA 4KXPA 1XOCA 1YTVA 3CG1A 4G68B 2F8DA 3VVFA 3D4CA 1NUWA 3SERA 3H6UA 4PETA 1M5BA 4JWOA 2Q8MA 1JW1A 1URGA 4M1VA 3U92A 4XFEA 3KOSA 1B40A 4ZE8A 1SW1A 4ZEBA 4HE2A 4OVSA 4MAGA 4YB7A 3T93B 5L9SA 3B8BA 2YLNA 2B4LA 3Q25A 3G3KA 4GX6A 4C1UA 2R8TA 1B3FA 5KCJA 4AS5A 2XXKA 3TTMA 1NNPA 4MX6A 4IO4A 1B7HA 2DXRA 5ELVA 2VPNA 4BLAA 1PBQA 1QGXA 1NV0A 3BKIB 2WEFA 3H3GA 3TUSA 4NF5A 2I4BA 4F19A 2FHYA 1L5TA 2BJJX 1NV2A 3KSXA 4N13A 2ZZVA 4X1BA 1HSLA 1HSEA 2AL5A 4DIGA 4EUOA 2AYSA 1MPBA 4P0IA 4EDPA 2F36A 1IXHA 2P2AA 3VXCA 4RPOA 2ESNA 4OESA 3DP4A 5IZ3B 1II5A 5IZZA 2B3FA 3MPLA 3S9EA 4PFYA 4OXVA 4R74A 1LBXA 5ET5A 3RN8A 2H4IA 4PFBA 4GWUA 2XA5A 3FUZA 3FIRA 1F9BA 1SYIA 3O9PA 1OQHA 1IMEA 2CZLA 2XXRA 1Y20A 4ZEFA 1LCTA 4XKRA 5EYHA 3VLWA 3SEUA 3HO7A 1NI9A 5DTBA 5AA3A 4RXLA 1H43A 4NEDA 4IO5A 2PT1A 3PMVA 3Q28A 1RDYA 4OFOA 4OVTA 3WAEA 4NF8B 4DI3D 1D4NA 1B7UA 2XXTA 1EZOA 1SVXB 1UTHA 3EHSA 3G3IA 1EU8A 1EYKA 1OVBA 3MC2A 4YMBA 3RY3A 4H1XA 5ET6A 2GHAA 3T1BA 3N6TA 1UTBB 4IY5A 1US5A 4ELOA 4IO2A 3ZKLA 4H6DA 2QS4A 2XWKA 1B6HA 1US4A 1RDXA 1ZBMA 2DWJA 4RK2A 2DQVA 4MHFA 1MXWA 3S9MC 1Y1ZA 5I7IA 2OWZA 4GIZA 3WAFA 4P1LA 2G29A 5I59A 1IMDA 1NNTA 2ZMBA 3IAZA 1ELJA 3N6UA 1VE4A 3EPEA 1D9QA 3KGCA 3GYYA 4EQ9A 4F39A 2R71A 1T0KA 1JEVA 1Q9DA 3T9XB 1B4HA 3H6WA 1P1UA 1NV7A 2V25A 3RLFE 3N5LA 2I4CA 3C35A 1P1WA 3PUXE 4UA8A 4LQ5A 4OVPA 5I57A 4FJPA 1QULA 3DP8A 2OWSA 4NF6B 2V4CA 2B65A 3U93A 4JB7A 4YKIA 3BFTA 5EQAA 3PPPA 3VVEA 5IGAA 2RCBA 4NTLA 1JP4A 4NN3A 3UN6A 2F3BA 2X26A 3IJOB 1NL5A 2LAOA 1M5DA 2FIEA 2DDKA 4F18A 5I58B 1XI6A 2QFLA 5FBPA 1FBEA 1N7WA 4U22A 3THIA 1S50A 2R6GE 3FBPA 1B9JA 2F3DA 1PC3A 1VSOA 3MWBA 3KJ7A 4GWZA 4ND9A 5CMCA 3IFAA 4H8IA 4LN5A 4G68C 2Y7KA 1MDP1 5BWJA 1JQFA 4KYEA 2RC7A 4WXJA 4YKKA 2REJA 1VDWA 2UYFA 4OFJA 1B58A 2OCUA 2P1SA 1DK4A 2RF1A 2X7PA 3KJTA 3UORA 5DEXA 4PC9A 5LOMA 1IXGA 2FNCA 3B6WA 4MNIA 1XC1A 1P1OA 3FJMA 2XXWA 3KN8A 3K6VA 1QUJA 4O94A 1SW5A 4PFTA 3G3HA 4IGTA 4P8BA 2NVUB 1DMBA 2YPNA 1MY1A 4PF6A 2HFBA 3SESA 1JETA 2QVVA 5CRYA 2A5TB 4H45A 4OQOA 5AA2A 5IM2A 3MP8A 5IAIA 5AA1A 4H5FA 2V93A 2FBPA 2X7QA 3MZ1A 1AOVA 1FCKA 2PVUA 4FORA 4N91A 1B7ZA 2UVGA 3PMXA 1B32A 3IOVA 4WEDA 3MAMA 1MQGA 3S2VA 4KI0E 1UIVA 3RGYA 4RY1A 3ECRA 1YZ0A 2XXYA 1B3LA 2VGQA 3VE1B 5AA4B 2XXUA 5KDTB 5FTIA 1LB9A 3SEYA 2XX9A 3QUFA 3CSBA 1D3KA 3O28A 2CEXA 3VLVA 1LEVA 4PDDA 2OLBA 2O7IA 1B05A 1A8FA 2ZYNA 1TFAA 3MP1A 2DWAA 1LBZA 3H7MA 3PV0E 2QRYA 1USYE 1JEUA 2XD3A 1TWYA 1PB9A 3LV0A 3IOWA 5HBCA 4ZEIA 1O64A 5ET8A 3MZBA 1NKXA 3KSJA 4HS7A 5CBRA 2F7CA 5CMBA 3RNNA 2F34A 2KQZA 4NX1A 2FVZA 2MKZA 4DZ1A 2ONKE 1VFEA 1KA1A 1IXIA 2RC8A 4RK9A 1FPKA 5EQ9A 4BDMA 4O3CA 1SD3A 3O6GA 3ISPA 1LFIA 1LFGA 1MDQA 3E3KA 3RT6B 1NH7A 2V84A 4EF2A 4XF5A 1MY2A 2UVIA 4QRZA 2W7YA 1URSA 1XVYA 4P47A 3RTFB 3GXAA 1LBWA 2PFZA 3KC0A 2QS1A 4X9TA 3RQTA 1IMFA 3FJGA 4U1OA 3T66A 1IQ7A 4LZ5A 4NQ8A 1UQWA 5IZ1A 4ZECA 5EYGA 3KG2A 3IL1B 2F7BA 1MXXA 4I3EA 4JSOA 4ISUA 2WKYA 3IB1A 3T9UA 4G61A 3OD7A 4QSEA 5I5PA 2A5SA 1MM6A 3GZGA 1LAHE 5J1DA 4FATA 3CFLA 3LBSA 2F6GA 4ZZEA 5A5XA 3OMBA 3P7IA 1NUXA 2L5VA 1BLFA 3O6HA 4ZEKA 3M3KA 3TYHA 1LSTA 3FVKA 3ROJA 4NE4A 5TPAA 3B7DA 1LBVA 3FATA 3KFMA 5J16A 3D1RA 4OETA 5K2XA 4PAIA 2DYXA 5DVJA 2UVJA 1FPDA 4PBQA 4QFOA 3CFXA 3EHTA 1N76A 5ITOA 4LA9A 5H8FA 4QFNA 2QPQA 2ZYOA 2RINA 1B3EA 4HW8A 2Y5LA 3H6VA 3HV1A 3H06B 1UIUA 3SETA 4KD5A 2RC9A
chains in the Genus database with same CATH topology
4RNSA 4AB5A 3IO4A 2ZYMA 3M3LA 1LBCA 4MF3A 2Q9TA 4ZE9A 4LP2B 1MPDA 5TP9B 3C9HA 3HHFA 4PFUA 5L9MA 3B6QA 3LSXA 1FQCA 4MLQA 1A40A 4Q0CA 2O68A 3FVOA 3HCQA 1D9YA 3IOUA 2HXWA 3FJ7A 3PMWA 5FTHA 1QVSA 4XKPA 3T22A 3VDFA 3G3GA 4ZDMA 2H25A 4I9DA 3C31A 3DM0A 4R75A 3MVYA 3R26A 3TTNA 3LSFB 4LUBA 1ZMGA 2DVCA 3IOTA 1FQAA 2ZXTA 3PGFA 2QS3A 1DPEA 3FVGA 4L17A 3W15C 1B5HA 2PT2A 3UP9A 3ILUB 1DSNA 5DT6A 4Q30B 4WKMA 2VOZA 1MRPA 2V3UA 2OZZA 3V89B 2PBWA 5H8QA 4R9GA 1B2HA 3FXRA 4BDQA 1SBPA 4G2ZA 5JTYB 4GD5A 3OEKA 1HSJA 1DTZA 2Q2CA 4QFKA 5H8HB 1H3DA 1ZIUA 2Q2AA 3CFZA 1FW0A 4FIMA 2D3IA 3IJXB 1JW5A 4ELRA 3U1OA 4ESXA 1SW4A 3TCGA 2DE2A 2REGA 3PPOA 2G93A 5H8NB 2XXHA 4DXBA 1ZJLA 4LVQA 3IORA 1FQBA 2IA4A 5B70A 1DPPA 3DELB 3QUJA 3LSWA 3OOAA 3G3JA 1QJMA 1Y4TA 3S9NC 3TODA 5I2NA 4GF8A 4Z0IA 1QKAA 4LZ8A 4EXKA 5DYHA 4ECFA 3C32A 5FHMA 4GVOA 1ATGA 1SQYA 2RKMA 1QW0A 2E0SA 1B5JA 2VD2A 1KWHA 2QS2A 3UGWA 3VLUA 1AIVA 4XKNA 4DCXA 2XXIA 3TZAA 1BP5A 4G68A 4IB2A 3I5OA 4H67A 2Y7PA 3CIJA 1AH5A 2O69A 2Y7IA 1FTKA 3MZ9A 3FV2A 3QYTA 4ESWA 4M4GA 2HZKA 4U2RA 1LAXA 3M8UA 4KYDA 3FXUA 4KHZE 1EZPA 3K02A 1IIWA 5M2VA 2GFEA 1XVXA 3EHUA 3HSTA 4Z7EA 2ZYKA 4HCYA 2NUVA 2DOJA 3LSLA 3K2DA 4GRKA 4R6YA 4R6HA 5I2KB 2O51A 4P11A 1SI1A 3JV9A 4OYVA 2Z8FA 1CE2A 3I3VA 2ZNTA 2VD3A 1MQHA 4P0GA 4QFLA 4R73A 1POY1 4POWA 3TPAA 3ZKKA 3MJNA 4EQ7A 5F1QA 3PD9A 1WVJA 1YPNA 1B1XA 3MVZA 1ZKBA 1ZU0A 3QSLA 3USDA 4RA1A 1MY4A 1SI0A 1OVTA 3K6WA 4KYSA 1AL3A 4OZ9A 3KN3A 4NF4B 5H8SA 4YB5A 2H99A 3T96B 4U4XA 2PX1A 1R9QA 4Q8RA 1BTJA 4NF8A 3BBRA 4OFLA 2O1LA 3TCFA 2H98A 5EYFA 2AL4A 3KEIA 3SDFA 4F1UA 3MP6A 2DWHA 4DXCA 1IZ1A 1FQFA 1UTBA 3EF7A 4KQPA 1H45A 3TTKA 3TDJA 4C0RA 4TQUQ 2XXQA 2DE4A 5JK4A 1Y3PA 2GHBA 4YMAA 1PBPA 4H0WA 1IEJA 3TAJA 3G7WA 1N7XA 2I0BA 4NMYA 1OMPA 5HPQA 3FZVA 2QJEA 5AA2D 3V5AA 3IX1A 3GBAA 5I56B 3Q29A 4LZ7A 4YICA 4YAHX 1AMFA 2CMOA 3LUYA 3OO8A 1JVXA 2D5WA 4GXAA 4R72A 3MPKA 1Y1MA 2XD2A 1QKBA 1RYXA 1MS7A 2QMXA 3H6TA 2XX8A 3ODBA 4NF6A 3N94A 3GLBA 2QMWA 5CC2A 1SYHA 1S9TA 1LFHA 1N84A 3MVWA 1POTA 3TQLA 3PD8A 2OWTA 3Q27A 1Y3QA 4MFIA 1FTLA 4I1DA 3O29A 1A54A 4KCCA 5KCJB 4OMBA 1JVYA 5CMMA 1Y9UA 2ALUA 4KR5A 4H8JA 3I6VA 2HCAA 2Z8EA 5I58A 2E1SA 4LQ2A 4QF9A 3GBBA 4NF5B 1NH8A 4IO3A 1J1NA 2H5YA 5ICTA 3PPQA 3TTRA 5K2YA 3OSRA 3KZGA 3JYRA 4O3AA 4Q5TA 4BDRA 3A3CA 4RPNA 3OSQA 1P99A 4OVJA 2UYEA 4ONYA 2HZLA 4I8CA 3U8QA 3G3FA 4FEBA 5I84A 3CI8A 2I0CA 1MQJA 1M5FA 5DVIA 5EHSA 2UVHA 2DWIA 4F31B 3L6HA 1MPCA 4THIA 3SEVA 2A5TA 4FAJA 4ELQA 3T9HB 2XXXA 2Z22A 1OLCA 2FA7A 4FECA 2P0SA 3ONMA 1O7TA 3V8XB 4XIGQ 1GTKA 5ISUA 3DLNA 3HHGA 1FTOA 4ZEDA 1UTHB 4WEPA 3MW0A 2V3QA 4IY6A 3K01A 1R6ZA 4U21A 5AA4A 3HPIA 4JDFA 5KDTA 2O6AA 3DP6A 3Q26A 2THIA 1NMUA 4F3SA 1Z7ME 4ZZAA 5I59B 3CVGA 4TOZA 1MQIA 4ELPA 3VFJA 4RJZA 1MG1A 4U4SA 4N6PA 1SDXA 1XS5A 3KN7A 4OENA 3EN3A 5CMKA 2M8CA 5ITPA 3K6XA 3QAXA 1PDAA 4R9FA 4GL0A 3H4ZA 1PEBA 3VXBA 1MXZA 2F5XA 5I57B 1Y4CA 3MVXA 4LONB 2QL3A 1Q35A 2NXOA 3U94A 3IB2A 4OEVA 3D4GA 4OTEA 4QFPA 1S7YA 4OHNA 4O3BA 3K1NA 4EXLA 4F3BA 1DOTA 3BFUA 1N3XA 4G4PA 3VVDA 2KLFA 3RT8A 3UA8A 3PUVE 3PUZE 1FTJA 3N26A 4UACA 3OENA 4YKJA 2DE3A 3E9XA 3E4RA 4YU0A 3KOTA 1MY3A 4H5GA 3SEXA 1NFTA 2F97A 2XXVA 2XHDA 3V83A 2H9BA 2OK2A 4GLIA 3TEPA 3FD3A 2D21A 1N04A 4F2QA 5KZTA 4R6KA 3H03A 4POXA 4F1YA 3O6IA 3C36A 1CB6A 1PB7A 4DXUA 2GRVA 2XX7A 1I69A 5DEXB 1B0HA 3EQ1A 4DE8A 2GH9A 2VP1A 3QIMA 1Z7NE 3AXFA 1LB8A 5FHOA 4RYAA 3CSGA 2QSXA 4JWXA 1NNFA 4KFQA 3S9LC 5AA2B 1FQEA 2DP8A 4JSDA 2FYIA 3O66A 3W9WA 4G8MA 3L6GA 2I58A 2F78A 1I6QA 3OXNA 5JEIA 1GVCA 1P1QA 3MQ9A 5CI5A 5CBSA 4OWDA 5B7DA 5TP9A 2I3WA 2ONRA 3SEWA 2OBGA 4IO7A 2UXAA 4JBZA 3ILTB 3MUQA 3FXQA 4MLVA 4KPTA 1I6AA 3TELA 4PQJA 1B1HA 1NNKA 4YZZA 1M5CA 1P1NA 4DCYA 5BUUA 4IO6A 1B0LA 4F3GA 4G77A 1H44A 5CM6A 1VFDA 2F7AA 4FEDA 3A09A 2O1MA 4TLLB 4HCWA 3F11A 3CG3A 3OEMA 4U1ZA 3RPWA 1M5EA 3O97A 4E0XA 3LC8A 4MBPA 1I6BA 1MXYA 4F1VA 4I62A 4G8NA 4EQBA 5DVFA 1GGGA 5FHNA 3OELA 1R1NA 1H76A 2Z8DA 3C33A 3SKPA 1SW2A 4DDDA 5IKBA 4QSCA 1ZTYA 1TFDA 3UIFA 4XXUA 4GL8A 5JTYA 4F3PA 4F22A 3E13X 3PPNA 1Y3NA 4YKPA 5H8HA 5L9OA 1BKAA 2HEUA 2IEEA 1A99A 1BIYA 1FQDA 3T9VA 2I3VA 2DXYA 2DS9A 4ZS9A 5AE4A 2NOOA 5HM4B 2ONSA 3TMGA 4N07A 4MH5A 3A3UA 5H8NA 3KBRA 4K3FA 1IXCA 3OO6A 1VR5A 4HTGA 3IB0A 3TQWA 3LR1A 4GXSB 1RYOA 1WDNA 4X1DA 4QHQA 3U72A 4PP0A 1D9VA 3ZS6A 4OERA 5A5XB 5TPAB 4AQ4A 1QUIA 3MBPA 1TT1A 1OIBA 3JZJA 2Q88A 3W9VA 2XXPA 5H8FB 3B6TA 3QK6A 4AB6A 3FASA 3K4UA 3UK4A 1MH4A 2Z23A 4TLMB 3TTLA 5F7VA 1A8EA 3R6UA 1EH3A 1LBBA 1OLAA 3FVNA 4GOTA 3PPRA 2ZNSA 2B3BA 1LGBC 2Q89A 4R2BA 3R7XA 3FGSA 3CRBA 4NWCA 1IUDA 3K0VA 3RUMA 4BDLA 3OO9A 3S4UA 3K1MA 1XT8A 1Q1KA 2RCAA 4JWYA 1DTGA 2PYYA 1A7LA 1URDA 2I49A 3TKDA 4JXIA 1GR2A 3RTWB 2HAUA 4R2FA 2Y7RA 1MY0A 1MQDA 3HN0A 1PB8A 1JNFA 4G8HA 1MXUA 2Q8JA 2ANJA 1LLSA 4EF1A 1LCFA 2F35A 3FV1A 1B3HA 1LAFE 3PUYE 2HAVA 3TCHA 4BDOA 3CR9A 5I2KA 3OO7A 5EHMA 4YB6A 4C1TA 4PFWA 5ICQA 4F2OA 4U23A 1LAGE 3K00A 4DLDA 4LATA 2VHAA 2Y7WA 4XTCQ 1YCJA 1USYH 4GFRA 2Y84A 1R9LA 4XKQA 1ZLQA 3M3FA 4FE8A 2O7UA 4QSDA 5H8QB 1O63A 1IITA 1B46A 1B51A 1QUKA 1B3GA 1RKMA 3C34A 2V3TA 1JW4A 4NF4A 4E0WA 3PU5A 1B4ZA 2I6EA 2HQ0A 2R9JA 2AIXA 1MM7A 5L8DA 1YAEA 3VV5A 1N0TA 3ZSFA 1GV8A 1ANFA 3IK6B 3QXMA 3K6UA 1WODA 2ABHA 3TFLA 2O84X 4F29A 2DSFA 1A55A 5TU0A 2ZNUA 4KCDA 3IR1A 4X48A 3O2AA 1EZ9A 2NWJA 5I2NB 3IO6A 4IGRA 1OQGA 4GWOA 2F6PA 1TXFA 3K1PA 1B52A 2PMSA 2DVZA 1MH3A 1XHYA 1B5IA 2OJTA 2I48A 1FTMA 2YJPA 4PE5B 3C4MA 1MXVA 4BDNA 1N3WA 5I56A 4NWDA 4H65A 3PUWE 4GQOA 4OEUA 1XOCA 1YTVA 3CG1A 4G68B 2F8DA 3VVFA 3D4CA 3SERA 3H6UA 4PETA 1M5BA 4JWOA 1JW1A 1URGA 4M1VA 3U92A 3KOSA 1B40A 4ZE8A 1SW1A 4ZEBA 4YB7A 3T93B 5L9SA 2YLNA 3Q25A 3G3KA 4C1UA 1B3FA 5KCJA 3TTMA 1NNPA 4IO4A 1B7HA 2DXRA 5ELVA 4BLAA 1PBQA 3BKIB 3H3GA 3TUSA 4NF5A 2I4BA 4F19A 1L5TA 2BJJX 3KSXA 4N13A 4X1BA 1HSLA 1HSEA 2AL5A 4DIGA 4EUOA 2AYSA 1MPBA 4P0IA 4EDPA 2F36A 1IXHA 2P2AA 3VXCA 4RPOA 2ESNA 4OESA 3DP4A 1II5A 2B3FA 3MPLA 3S9EA 4PFYA 4OXVA 4R74A 3RN8A 2H4IA 3FUZA 3FIRA 1F9BA 1SYIA 3O9PA 1OQHA 2CZLA 2XXRA 1Y20A 4ZEFA 1LCTA 4XKRA 3VLWA 3SEUA 3HO7A 5DTBA 5AA3A 4RXLA 1H43A 4NEDA 4IO5A 2PT1A 3PMVA 3Q28A 4OFOA 3WAEA 4NF8B 1D4NA 1B7UA 2XXTA 1EZOA 1SVXB 1UTHA 3EHSA 3G3IA 1EU8A 1OVBA 3MC2A 4YMBA 3RY3A 4H1XA 2GHAA 3N6TA 1UTBB 4IY5A 1US5A 4ELOA 4IO2A 3ZKLA 4H6DA 2QS4A 1B6HA 1US4A 1ZBMA 2DWJA 4RK2A 2DQVA 1MXWA 3S9MC 1Y1ZA 4GIZA 3WAFA 2G29A 5I59A 1NNTA 2ZMBA 3IAZA 1ELJA 3N6UA 1VE4A 3EPEA 4EQ9A 3KGCA 4F39A 2R71A 1T0KA 1JEVA 3T9XB 1B4HA 3H6WA 1P1UA 2V25A 3RLFE 3N5LA 2I4CA 3C35A 1P1WA 3PUXE 4UA8A 4LQ5A 5I57A 4FJPA 1QULA 3DP8A 2OWSA 4NF6B 2B65A 3U93A 4JB7A 4YKIA 3BFTA 3PPPA 3VVEA 2RCBA 4NTLA 3UN6A 2X26A 3IJOB 1NL5A 2LAOA 1M5DA 4F18A 5I58B 1N7WA 4U22A 3THIA 1S50A 2R6GE 1B9JA 1PC3A 1VSOA 3MWBA 3KJ7A 4ND9A 5CMCA 4H8IA 4G68C 2Y7KA 1MDP1 5BWJA 1JQFA 4KYEA 2RC7A 4WXJA 4YKKA 2REJA 2UYFA 4OFJA 1B58A 2OCUA 2P1SA 2RF1A 2X7PA 3KJTA 3UORA 5DEXA 5LOMA 1IXGA 2FNCA 3B6WA 1XC1A 1P1OA 3FJMA 2XXWA 3KN8A 3K6VA 1QUJA 1SW5A 4PFTA 3G3HA 4IGTA 2NVUB 1DMBA 2YPNA 1MY1A 2HFBA 3SESA 1JETA 5CRYA 2A5TB 4OQOA 5AA2A 3MP8A 5IAIA 5AA1A 4H5FA 2V93A 2X7QA 3MZ1A 1AOVA 1FCKA 2PVUA 4FORA 1B7ZA 2UVGA 3PMXA 1B32A 3IOVA 4WEDA 3MAMA 1MQGA 3S2VA 4KI0E 1UIVA 3RGYA 4RY1A 3ECRA 2XXYA 1B3LA 2VGQA 3VE1B 5AA4B 2XXUA 5KDTB 5FTIA 1LB9A 3SEYA 2XX9A 3QUFA 3CSBA 1D3KA 3O28A 3VLVA 2OLBA 2O7IA 1B05A 1A8FA 2ZYNA 1TFAA 3MP1A 2DWAA 3H7MA 3PV0E 2QRYA 1USYE 1JEUA 2XD3A 1TWYA 1PB9A 3IOWA 5HBCA 4ZEIA 1O64A 3MZBA 1NKXA 3KSJA 4HS7A 5CBRA 2F7CA 5CMBA 3RNNA 2F34A 4DZ1A 2ONKE 1VFEA 1IXIA 2RC8A 4RK9A 4BDMA 4O3CA 1SD3A 3O6GA 1LFIA 1LFGA 1MDQA 3E3KA 3RT6B 1NH7A 2V84A 4EF2A 1MY2A 2UVIA 4QRZA 2W7YA 1URSA 1XVYA 3RTFB 3GXAA 2QS1A 4X9TA 3RQTA 3FJGA 4U1OA 3T66A 1IQ7A 4LZ5A 1UQWA 4ZECA 3KG2A 3IL1B 2F7BA 1MXXA 4JSOA 4ISUA 2WKYA 3IB1A 3T9UA 3OD7A 4QSEA 2A5SA 1MM6A 3GZGA 1LAHE 5J1DA 4FATA 3CFLA 3LBSA 2F6GA 4ZZEA 5A5XA 3OMBA 3P7IA 4ZEKA 1BLFA 3O6HA 3M3KA 3TYHA 1LSTA 3FVKA 4NE4A 5TPAA 3B7DA 3FATA 3KFMA 4OETA 5K2XA 2DYXA 5DVJA 2UVJA 4QFOA 3CFXA 3EHTA 1N76A 5ITOA 4LA9A 5H8FA 4QFNA 2QPQA 2ZYOA 2RINA 1B3EA 4HW8A 3H6VA 3HV1A 3H06B 1UIUA 3SETA 4KD5A 2RC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNS A;  4AB5 A;  3IO4 A;  2ZYM A;  3M3L A;  1LBC A;  4MF3 A;  2Q9T A;  4ZE9 A;  4LP2 B;  1MPD A;  5TP9 B;  3C9H A;  3HHF A;  4PFU A;  5L9M A;  3B6Q A;  3LSX A;  1FQC A;  4MLQ A;  1A40 A;  4Q0C A;  2O68 A;  3FVO A;  3HCQ A;  1D9Y A;  3IOU A;  2HXW A;  3FJ7 A;  3PMW A;  5FTH A;  1QVS A;  4XKP A;  3T22 A;  3VDF A;  3G3G A;  4ZDM A;  2H25 A;  4I9D A;  3C31 A;  3DM0 A;  4R75 A;  3MVY A;  3R26 A;  3TTN A;  3LSF B;  4LUB A;  1ZMG A;  2DVC A;  3IOT A;  1FQA A;  2ZXT A;  3PGF A;  2QS3 A;  1DPE A;  3FVG A;  4L17 A;  3W15 C;  1B5H A;  2PT2 A;  3UP9 A;  3ILU B;  1DSN A;  5DT6 A;  4Q30 B;  4WKM A;  2VOZ A;  1MRP A;  2V3U A;  2OZZ A;  3V89 B;  2PBW A;  5H8Q A;  4R9G A;  1B2H A;  3FXR A;  4BDQ A;  1SBP A;  4G2Z A;  5JTY B;  4GD5 A;  3OEK A;  1HSJ A;  1DTZ A;  2Q2C A;  4QFK A;  5H8H B;  1H3D A;  1ZIU A;  2Q2A A;  3CFZ A;  1FW0 A;  4FIM A;  2D3I A;  3IJX B;  1JW5 A;  4ELR A;  3U1O A;  4ESX A;  1SW4 A;  3TCG A;  2DE2 A;  2REG A;  3PPO A;  2G93 A;  5H8N B;  2XXH A;  4DXB A;  1ZJL A;  4LVQ A;  3IOR A;  1FQB A;  2IA4 A;  5B70 A;  1DPP A;  3DEL B;  3QUJ A;  3LSW A;  3OOA A;  3G3J A;  1QJM A;  1Y4T A;  3S9N C;  3TOD A;  5I2N A;  4GF8 A;  4Z0I A;  1QKA A;  4LZ8 A;  4EXK A;  5DYH A;  4ECF A;  3C32 A;  5FHM A;  4GVO A;  1ATG A;  1SQY A;  2RKM A;  1QW0 A;  2E0S A;  1B5J A;  2VD2 A;  1KWH A;  2QS2 A;  3UGW A;  3VLU A;  1AIV A;  4XKN A;  4DCX A;  2XXI A;  3TZA A;  1BP5 A;  4G68 A;  4IB2 A;  3I5O A;  4H67 A;  2Y7P A;  3CIJ A;  1AH5 A;  2O69 A;  2Y7I A;  1FTK A;  3MZ9 A;  3FV2 A;  3QYT A;  4ESW A;  4M4G A;  2HZK A;  4U2R A;  1LAX A;  3M8U A;  4KYD A;  3FXU A;  4KHZ E;  1EZP A;  3K02 A;  1IIW A;  5M2V A;  2GFE A;  1XVX A;  3EHU A;  3HST A;  4Z7E A;  2ZYK A;  4HCY A;  2NUV A;  2DOJ A;  3LSL A;  3K2D A;  4GRK A;  4R6Y A;  4R6H A;  5I2K B;  2O51 A;  4P11 A;  1SI1 A;  3JV9 A;  4OYV A;  2Z8F A;  1CE2 A;  3I3V A;  2ZNT A;  2VD3 A;  1MQH A;  4P0G A;  4QFL A;  4R73 A;  1POY 1;  4POW A;  3TPA A;  3ZKK A;  3MJN A;  4EQ7 A;  5F1Q A;  3PD9 A;  1WVJ A;  1YPN A;  1B1X A;  3MVZ A;  1ZKB A;  1ZU0 A;  3QSL A;  3USD A;  4RA1 A;  1MY4 A;  1SI0 A;  1OVT A;  3K6W A;  4KYS A;  1AL3 A;  4OZ9 A;  3KN3 A;  4NF4 B;  5H8S A;  4YB5 A;  2H99 A;  3T96 B;  4U4X A;  2PX1 A;  1R9Q A;  4Q8R A;  1BTJ A;  4NF8 A;  3BBR A;  4OFL A;  2O1L A;  3TCF A;  2H98 A;  5EYF A;  2AL4 A;  3KEI A;  3SDF A;  4F1U A;  3MP6 A;  2DWH A;  4DXC A;  1IZ1 A;  1FQF A;  1UTB A;  3EF7 A;  4KQP A;  1H45 A;  3TTK A;  3TDJ A;  4C0R A;  4TQU Q;  2XXQ A;  2DE4 A;  5JK4 A;  1Y3P A;  2GHB A;  4YMA A;  1PBP A;  4H0W A;  1IEJ A;  3TAJ A;  3G7W A;  1N7X A;  2I0B A;  4NMY A;  1OMP A;  5HPQ A;  3FZV A;  2QJE A;  5AA2 D;  3V5A A;  3IX1 A;  3GBA A;  5I56 B;  3Q29 A;  4LZ7 A;  4YIC A;  4YAH X;  1AMF A;  2CMO A;  3LUY A;  3OO8 A;  1JVX A;  2D5W A;  4GXA A;  4R72 A;  3MPK A;  1Y1M A;  2XD2 A;  1QKB A;  1RYX A;  1MS7 A;  2QMX A;  3H6T A;  2XX8 A;  3ODB A;  4NF6 A;  3N94 A;  3GLB A;  2QMW A;  5CC2 A;  1SYH A;  1S9T A;  1LFH A;  1N84 A;  3MVW A;  1POT A;  3TQL A;  3PD8 A;  2OWT A;  3Q27 A;  1Y3Q A;  4MFI A;  1FTL A;  4I1D A;  3O29 A;  1A54 A;  4KCC A;  5KCJ B;  4OMB A;  1JVY A;  5CMM A;  1Y9U A;  2ALU A;  4KR5 A;  4H8J A;  3I6V A;  2HCA A;  2Z8E A;  5I58 A;  2E1S A;  4LQ2 A;  4QF9 A;  3GBB A;  4NF5 B;  1NH8 A;  4IO3 A;  1J1N A;  2H5Y A;  5ICT A;  3PPQ A;  3TTR A;  5K2Y A;  3OSR A;  3KZG A;  3JYR A;  4O3A A;  4Q5T A;  4BDR A;  3A3C A;  4RPN A;  3OSQ A;  1P99 A;  4OVJ A;  2UYE A;  4ONY A;  2HZL A;  4I8C A;  3U8Q A;  3G3F A;  4FEB A;  5I84 A;  3CI8 A;  2I0C A;  1MQJ A;  1M5F A;  5DVI A;  5EHS A;  2UVH A;  2DWI A;  4F31 B;  3L6H A;  1MPC A;  4THI A;  3SEV A;  2A5T A;  4FAJ A;  4ELQ A;  3T9H B;  2XXX A;  2Z22 A;  1OLC A;  2FA7 A;  4FEC A;  2P0S A;  3ONM A;  1O7T A;  3V8X B;  4XIG Q;  1GTK A;  5ISU A;  3DLN A;  3HHG A;  1FTO A;  4ZED A;  1UTH B;  4WEP A;  3MW0 A;  2V3Q A;  4IY6 A;  3K01 A;  1R6Z A;  4U21 A;  5AA4 A;  3HPI A;  4JDF A;  5KDT A;  2O6A A;  3DP6 A;  3Q26 A;  2THI A;  1NMU A;  4F3S A;  1Z7M E;  4ZZA A;  5I59 B;  3CVG A;  4TOZ A;  1MQI A;  4ELP A;  3VFJ A;  4RJZ A;  1MG1 A;  4U4S A;  4N6P A;  1SDX A;  1XS5 A;  3KN7 A;  4OEN A;  3EN3 A;  5CMK A;  2M8C A;  5ITP A;  3K6X A;  3QAX A;  1PDA A;  4R9F A;  4GL0 A;  3H4Z A;  1PEB A;  3VXB A;  1MXZ A;  2F5X A;  5I57 B;  1Y4C A;  3MVX A;  4LON B;  2QL3 A;  1Q35 A;  2NXO A;  3U94 A;  3IB2 A;  4OEV A;  3D4G A;  4OTE A;  4QFP A;  1S7Y A;  4OHN A;  4O3B A;  3K1N A;  4EXL A;  4F3B A;  1DOT A;  3BFU A;  1N3X A;  4G4P A;  3VVD A;  2KLF A;  3RT8 A;  3UA8 A;  3PUV E;  3PUZ E;  1FTJ A;  3N26 A;  4UAC A;  3OEN A;  4YKJ A;  2DE3 A;  3E9X A;  3E4R A;  4YU0 A;  3KOT A;  1MY3 A;  4H5G A;  3SEX A;  1NFT A;  2F97 A;  2XXV A;  2XHD A;  3V83 A;  2H9B A;  2OK2 A;  4GLI A;  3TEP A;  3FD3 A;  2D21 A;  1N04 A;  4F2Q A;  5KZT A;  4R6K A;  3H03 A;  4POX A;  4F1Y A;  3O6I A;  3C36 A;  1CB6 A;  1PB7 A;  4DXU A;  2GRV A;  2XX7 A;  1I69 A;  5DEX B;  1B0H A;  3EQ1 A;  4DE8 A;  2GH9 A;  2VP1 A;  3QIM A;  1Z7N E;  3AXF A;  1LB8 A;  5FHO A;  4RYA A;  3CSG A;  2QSX A;  4JWX A;  1NNF A;  4KFQ A;  3S9L C;  5AA2 B;  1FQE A;  2DP8 A;  4JSD A;  2FYI A;  3O66 A;  3W9W A;  4G8M A;  3L6G A;  2I58 A;  2F78 A;  1I6Q A;  3OXN A;  5JEI A;  1GVC A;  1P1Q A;  3MQ9 A;  5CI5 A;  5CBS A;  4OWD A;  5B7D A;  5TP9 A;  2I3W A;  2ONR A;  3SEW A;  2OBG A;  4IO7 A;  2UXA A;  4JBZ A;  3ILT B;  3MUQ A;  3FXQ A;  4MLV A;  4KPT A;  1I6A A;  3TEL A;  4PQJ A;  1B1H A;  1NNK A;  4YZZ A;  1M5C A;  1P1N A;  4DCY A;  5BUU A;  4IO6 A;  1B0L A;  4F3G A;  4G77 A;  1H44 A;  5CM6 A;  1VFD A;  2F7A A;  4FED A;  3A09 A;  2O1M A;  4TLL B;  4HCW A;  3F11 A;  3CG3 A;  3OEM A;  4U1Z A;  3RPW A;  1M5E A;  3O97 A;  4E0X A;  3LC8 A;  4MBP A;  1I6B A;  1MXY A;  4F1V A;  4I62 A;  4G8N A;  4EQB A;  5DVF A;  1GGG A;  5FHN A;  3OEL A;  1R1N A;  1H76 A;  2Z8D A;  3C33 A;  3SKP A;  1SW2 A;  4DDD A;  5IKB A;  4QSC A;  1ZTY A;  1TFD A;  3UIF A;  4XXU A;  4GL8 A;  5JTY A;  4F3P A;  4F22 A;  3E13 X;  3PPN A;  1Y3N A;  4YKP A;  5H8H A;  5L9O A;  1BKA A;  2HEU A;  2IEE A;  1A99 A;  1BIY A;  1FQD A;  3T9V A;  2I3V A;  2DXY A;  2DS9 A;  4ZS9 A;  5AE4 A;  2NOO A;  5HM4 B;  2ONS A;  3TMG A;  4N07 A;  4MH5 A;  3A3U A;  5H8N A;  3KBR A;  4K3F A;  1IXC A;  3OO6 A;  1VR5 A;  4HTG A;  3IB0 A;  3TQW A;  3LR1 A;  4GXS B;  1RYO A;  1WDN A;  4X1D A;  4QHQ A;  3U72 A;  4PP0 A;  1D9V A;  3ZS6 A;  4OER A;  5A5X B;  5TPA B;  4AQ4 A;  1QUI A;  3MBP A;  1TT1 A;  1OIB A;  3JZJ A;  2Q88 A;  3W9V A;  2XXP A;  5H8F B;  3B6T A;  3QK6 A;  4AB6 A;  3FAS A;  3K4U A;  3UK4 A;  1MH4 A;  2Z23 A;  4TLM B;  3TTL A;  5F7V A;  1A8E A;  3R6U A;  1EH3 A;  1LBB A;  1OLA A;  3FVN A;  4GOT A;  3PPR A;  2ZNS A;  2B3B A;  1LGB C;  2Q89 A;  4R2B A;  3R7X A;  3FGS A;  3CRB A;  4NWC A;  1IUD A;  3K0V A;  3RUM A;  4BDL A;  3OO9 A;  3S4U A;  3K1M A;  1XT8 A;  1Q1K A;  2RCA A;  4JWY A;  1DTG A;  2PYY A;  1A7L A;  1URD A;  2I49 A;  3TKD A;  4JXI A;  1GR2 A;  3RTW B;  2HAU A;  4R2F A;  2Y7R A;  1MY0 A;  1MQD A;  3HN0 A;  1PB8 A;  1JNF A;  4G8H A;  1MXU A;  2Q8J A;  2ANJ A;  1LLS A;  4EF1 A;  1LCF A;  2F35 A;  3FV1 A;  1B3H A;  1LAF E;  3PUY E;  2HAV A;  3TCH A;  4BDO A;  3CR9 A;  5I2K A;  3OO7 A;  5EHM A;  4YB6 A;  4C1T A;  4PFW A;  5ICQ A;  4F2O A;  4U23 A;  1LAG E;  3K00 A;  4DLD A;  4LAT A;  2VHA A;  2Y7W A;  4XTC Q;  1YCJ A;  1USY H;  4GFR A;  2Y84 A;  1R9L A;  4XKQ A;  1ZLQ A;  3M3F A;  4FE8 A;  2O7U A;  4QSD A;  5H8Q B;  1O63 A;  1IIT A;  1B46 A;  1B51 A;  1QUK A;  1B3G A;  1RKM A;  3C34 A;  2V3T A;  1JW4 A;  4NF4 A;  4E0W A;  3PU5 A;  1B4Z A;  2I6E A;  2HQ0 A;  2R9J A;  2AIX A;  1MM7 A;  5L8D A;  1YAE A;  3VV5 A;  1N0T A;  3ZSF A;  1GV8 A;  1ANF A;  3IK6 B;  3QXM A;  3K6U A;  1WOD A;  2ABH A;  3TFL A;  2O84 X;  4F29 A;  2DSF A;  1A55 A;  5TU0 A;  2ZNU A;  4KCD A;  3IR1 A;  4X48 A;  3O2A A;  1EZ9 A;  2NWJ A;  5I2N B;  3IO6 A;  4IGR A;  1OQG A;  4GWO A;  2F6P A;  1TXF A;  3K1P A;  1B52 A;  2PMS A;  2DVZ A;  1MH3 A;  1XHY A;  1B5I A;  2OJT A;  2I48 A;  1FTM A;  2YJP A;  4PE5 B;  3C4M A;  1MXV A;  4BDN A;  1N3W A;  5I56 A;  4NWD A;  4H65 A;  3PUW E;  4GQO A;  4OEU A;  1XOC A;  1YTV A;  3CG1 A;  4G68 B;  2F8D A;  3VVF A;  3D4C A;  3SER A;  3H6U A;  4PET A;  1M5B A;  4JWO A;  1JW1 A;  1URG A;  4M1V A;  3U92 A;  3KOS A;  1B40 A;  4ZE8 A;  1SW1 A;  4ZEB A;  4YB7 A;  3T93 B;  5L9S A;  2YLN A;  3Q25 A;  3G3K A;  4C1U A;  1B3F A;  5KCJ A;  3TTM A;  1NNP A;  4IO4 A;  1B7H A;  2DXR A;  5ELV A;  4BLA A;  1PBQ A;  3BKI B;  3H3G A;  3TUS A;  4NF5 A;  2I4B A;  4F19 A;  1L5T A;  2BJJ X;  3KSX A;  4N13 A;  4X1B A;  1HSL A;  1HSE A;  2AL5 A;  4DIG A;  4EUO A;  2AYS A;  1MPB A;  4P0I A;  4EDP A;  2F36 A;  1IXH A;  2P2A A;  3VXC A;  4RPO A;  2ESN A;  4OES A;  3DP4 A;  1II5 A;  2B3F A;  3MPL A;  3S9E A;  4PFY A;  4OXV A;  4R74 A;  3RN8 A;  2H4I A;  3FUZ A;  3FIR A;  1F9B A;  1SYI A;  3O9P A;  1OQH A;  2CZL A;  2XXR A;  1Y20 A;  4ZEF A;  1LCT A;  4XKR A;  3VLW A;  3SEU A;  3HO7 A;  5DTB A;  5AA3 A;  4RXL A;  1H43 A;  4NED A;  4IO5 A;  2PT1 A;  3PMV A;  3Q28 A;  4OFO A;  3WAE A;  4NF8 B;  1D4N A;  1B7U A;  2XXT A;  1EZO A;  1SVX B;  1UTH A;  3EHS A;  3G3I A;  1EU8 A;  1OVB A;  3MC2 A;  4YMB A;  3RY3 A;  4H1X A;  2GHA A;  3N6T A;  1UTB B;  4IY5 A;  1US5 A;  4ELO A;  4IO2 A;  3ZKL A;  4H6D A;  2QS4 A;  1B6H A;  1US4 A;  1ZBM A;  2DWJ A;  4RK2 A;  2DQV A;  1MXW A;  3S9M C;  1Y1Z A;  4GIZ A;  3WAF A;  2G29 A;  5I59 A;  1NNT A;  2ZMB A;  3IAZ A;  1ELJ A;  3N6U A;  1VE4 A;  3EPE A;  4EQ9 A;  3KGC A;  4F39 A;  2R71 A;  1T0K A;  1JEV A;  3T9X B;  1B4H A;  3H6W A;  1P1U A;  2V25 A;  3RLF E;  3N5L A;  2I4C A;  3C35 A;  1P1W A;  3PUX E;  4UA8 A;  4LQ5 A;  5I57 A;  4FJP A;  1QUL A;  3DP8 A;  2OWS A;  4NF6 B;  2B65 A;  3U93 A;  4JB7 A;  4YKI A;  3BFT A;  3PPP A;  3VVE A;  2RCB A;  4NTL A;  3UN6 A;  2X26 A;  3IJO B;  1NL5 A;  2LAO A;  1M5D A;  4F18 A;  5I58 B;  1N7W A;  4U22 A;  3THI A;  1S50 A;  2R6G E;  1B9J A;  1PC3 A;  1VSO A;  3MWB A;  3KJ7 A;  4ND9 A;  5CMC A;  4H8I A;  4G68 C;  2Y7K A;  1MDP 1;  5BWJ A;  1JQF A;  4KYE A;  2RC7 A;  4WXJ A;  4YKK A;  2REJ A;  2UYF A;  4OFJ A;  1B58 A;  2OCU A;  2P1S A;  2RF1 A;  2X7P A;  3KJT A;  3UOR A;  5DEX A;  5LOM A;  1IXG A;  2FNC A;  3B6W A;  1XC1 A;  1P1O A;  3FJM A;  2XXW A;  3KN8 A;  3K6V A;  1QUJ A;  1SW5 A;  4PFT A;  3G3H A;  4IGT A;  2NVU B;  1DMB A;  2YPN A;  1MY1 A;  2HFB A;  3SES A;  1JET A;  5CRY A;  2A5T B;  4OQO A;  5AA2 A;  3MP8 A;  5IAI A;  5AA1 A;  4H5F A;  2V93 A;  2X7Q A;  3MZ1 A;  1AOV A;  1FCK A;  2PVU A;  4FOR A;  1B7Z A;  2UVG A;  3PMX A;  1B32 A;  3IOV A;  4WED A;  3MAM A;  1MQG A;  3S2V A;  4KI0 E;  1UIV A;  3RGY A;  4RY1 A;  3ECR A;  2XXY A;  1B3L A;  2VGQ A;  3VE1 B;  5AA4 B;  2XXU A;  5KDT B;  5FTI A;  1LB9 A;  3SEY A;  2XX9 A;  3QUF A;  3CSB A;  1D3K A;  3O28 A;  3VLV A;  2OLB A;  2O7I A;  1B05 A;  1A8F A;  2ZYN A;  1TFA A;  3MP1 A;  2DWA A;  3H7M A;  3PV0 E;  2QRY A;  1USY E;  1JEU A;  2XD3 A;  1TWY A;  1PB9 A;  3IOW A;  5HBC A;  4ZEI A;  1O64 A;  3MZB A;  1NKX A;  3KSJ A;  4HS7 A;  5CBR A;  2F7C A;  5CMB A;  3RNN A;  2F34 A;  4DZ1 A;  2ONK E;  1VFE A;  1IXI A;  2RC8 A;  4RK9 A;  4BDM A;  4O3C A;  1SD3 A;  3O6G A;  1LFI A;  1LFG A;  1MDQ A;  3E3K A;  3RT6 B;  1NH7 A;  2V84 A;  4EF2 A;  1MY2 A;  2UVI A;  4QRZ A;  2W7Y A;  1URS A;  1XVY A;  3RTF B;  3GXA A;  2QS1 A;  4X9T A;  3RQT A;  3FJG A;  4U1O A;  3T66 A;  1IQ7 A;  4LZ5 A;  1UQW A;  4ZEC A;  3KG2 A;  3IL1 B;  2F7B A;  1MXX A;  4JSO A;  4ISU A;  2WKY A;  3IB1 A;  3T9U A;  3OD7 A;  4QSE A;  2A5S A;  1MM6 A;  3GZG A;  1LAH E;  5J1D A;  4FAT A;  3CFL A;  3LBS A;  2F6G A;  4ZZE A;  5A5X A;  3OMB A;  3P7I A;  4ZEK A;  1BLF A;  3O6H A;  3M3K A;  3TYH A;  1LST A;  3FVK A;  4NE4 A;  5TPA A;  3B7D A;  3FAT A;  3KFM A;  4OET A;  5K2X A;  2DYX A;  5DVJ A;  2UVJ A;  4QFO A;  3CFX A;  3EHT A;  1N76 A;  5ITO A;  4LA9 A;  5H8F A;  4QFN A;  2QPQ A;  2ZYO A;  2RIN A;  1B3E A;  4HW8 A;  3H6V A;  3HV1 A;  3H06 B;  1UIU A;  3SET A;  4KD5 A;  2RC9 A; 
#chains in the Genus database with same CATH topology
 4RNS A;  4AB5 A;  3IO4 A;  2ZYM A;  3M3L A;  1LBC A;  4AS4 A;  4MF3 A;  2Q9T A;  4ZE9 A;  4LP2 B;  1MPD A;  5TP9 B;  3C9H A;  2GQ1 A;  3HHF A;  4MNP A;  4GX3 A;  4PFU A;  5L9M A;  2XWV A;  3B6Q A;  3LSX A;  1FQC A;  4MLQ A;  1A40 A;  4Q0C A;  1YYZ A;  1FPG A;  2O68 A;  3FVO A;  3HCQ A;  1D9Y A;  3IOU A;  2HXW A;  3FJ7 A;  3PMW A;  5FTH A;  2CEY A;  1QVS A;  4N8G A;  4PDH A;  4XKP A;  3T22 A;  3VDF A;  2CZK A;  3G3G A;  3RYD A;  4ZDM A;  1YXI A;  2H25 A;  4I9D A;  3C31 A;  3DM0 A;  4R75 A;  3MVY A;  3R26 A;  4QBA A;  3TTN A;  3LSF B;  4LUB A;  1ZMG A;  2DVC A;  3IOT A;  2HHM A;  1FQA A;  2ZXT A;  3PGF A;  2QS3 A;  1DPE A;  3FVG A;  4L17 A;  3W15 C;  1B5H A;  2PT2 A;  3UP9 A;  3ILU B;  1DSN A;  5DT6 A;  4Q30 B;  4WKM A;  2VOZ A;  1MRP A;  2V3U A;  2OZZ A;  5DW8 A;  3V89 B;  2PBW A;  5H8Q A;  4R9G A;  1B2H A;  3FXR A;  4BDQ A;  4N6K A;  1SBP A;  4G2Z A;  5JTY B;  4GD5 A;  3T0J A;  3OEK A;  1HSJ A;  1DTZ A;  1RDZ A;  2Q2C A;  4QFK A;  2QVR A;  5H8H B;  1H3D A;  1ZIU A;  2HPG A;  2Q2A A;  3CFZ A;  1FW0 A;  4FIM A;  2D3I A;  3IJX B;  3RPL A;  4X8R A;  4GBW A;  1JW5 A;  4ELR A;  3U1O A;  4ESX A;  1SW4 A;  3TCG A;  2DE2 A;  2REG A;  4XEQ A;  3PPO A;  2G93 A;  1FPB A;  5H8N B;  2XXH A;  4DXB A;  3CHG A;  1ZJL A;  1FPF A;  4LVQ A;  3IOR A;  1FQB A;  2IA4 A;  5B70 A;  1DPP A;  3DEL B;  3EKI A;  3QUJ A;  3LSW A;  3OOA A;  3G3J A;  1QJM A;  1Y4T A;  3S9N C;  3TOD A;  5I2N A;  4GF8 A;  4Z0I A;  1QKA A;  4LZ8 A;  4EXK A;  5DYH A;  1FTA A;  4ECF A;  3C32 A;  1FRP A;  5FHM A;  4GVO A;  1ATG A;  1SQY A;  2RKM A;  1QW0 A;  2E0S A;  1B5J A;  2VD2 A;  1KWH A;  2QS2 A;  3UGW A;  3VLU A;  1AIV A;  4OVR A;  4XKN A;  4DCX A;  2XXI A;  4QXD A;  3TZA A;  1BP5 A;  4G68 A;  4IB2 A;  3I5O A;  4H67 A;  2ZZX A;  2Y7P A;  3CIJ A;  1AH5 A;  2O69 A;  2Y7I A;  1FTK A;  3MZ9 A;  3FV2 A;  3QYT A;  3BIG A;  4ESW A;  4M4G A;  2P3V A;  4JVI A;  1DBZ A;  2HZK A;  4U2R A;  4I40 A;  1LAX A;  3M8U A;  4KYD A;  3FXU A;  2XWI A;  4KHZ E;  1EZP A;  1INP A;  3K02 A;  1IIW A;  5M2V A;  2GFE A;  1XVX A;  3EHU A;  3HST A;  4Z7E A;  4NAP A;  2ZYK A;  4HCY A;  2NUV A;  2XWO A;  2DOJ A;  3LSL A;  5A5L A;  3K2D A;  4GRK A;  4R6Y A;  4R6H A;  5I2K B;  2B4M A;  2O51 A;  4O7I A;  4P11 A;  1SI1 A;  3JV9 A;  4OYV A;  2Z8F A;  5IZ3 A;  3NOH A;  1CE2 A;  3I3V A;  2ZNT A;  2VD3 A;  1MQH A;  4P0G A;  4QFL A;  5ESY A;  1FBF A;  4R73 A;  1POY 1;  4POW A;  3TPA A;  3ZKK A;  3MJN A;  4PFR A;  4EQ7 A;  5F1Q A;  3PD9 A;  2VT5 A;  1WVJ A;  1YPN A;  1B1X A;  1NV5 A;  3MVZ A;  1ZKB A;  1ZU0 A;  3QSL A;  3USD A;  4RA1 A;  1MY4 A;  3QMF A;  1SI0 A;  1OVT A;  3K6W A;  4KYS A;  1AL3 A;  4OZ9 A;  3KN3 A;  4NF4 B;  5H8S A;  4YB5 A;  2H99 A;  3T96 B;  4U4X A;  2PX1 A;  1R9Q A;  4Q8R A;  1BTJ A;  4NF8 A;  3BBR A;  4OFL A;  2O1L A;  3TCF A;  2H98 A;  5EYF A;  2AL4 A;  3KEI A;  1FBD A;  3SDF A;  3PTY A;  4HXV A;  4F1U A;  2WYK A;  3MP6 A;  2DWH A;  4DXC A;  1IZ1 A;  1FQF A;  1UTB A;  3EF7 A;  4KQP A;  1H45 A;  3TTK A;  3TDJ A;  4C0R A;  2WYP A;  4TQU Q;  2XXQ A;  2DE4 A;  5JK4 A;  1Y3P A;  2GHB A;  4YMA A;  1PBP A;  4H0W A;  1IEJ A;  4JVC A;  3TAJ A;  4GWS A;  3G7W A;  4P3L A;  1N7X A;  2I0B A;  4NMY A;  1OMP A;  5HPQ A;  3FZV A;  2QJE A;  4GX4 A;  5AA2 D;  3IX1 A;  3V5A A;  3GBA A;  5I56 B;  3Q29 A;  4LZ7 A;  4YIC A;  4YAH X;  1AMF A;  2CMO A;  3LUY A;  3OO8 A;  5ET7 A;  1JVX A;  2D5W A;  4GXA A;  4R72 A;  3MPK A;  1Y1M A;  2XD2 A;  1QKB A;  1RYX A;  1MS7 A;  2QMX A;  3H6T A;  2XX8 A;  3ODB A;  4NF6 A;  3N94 A;  3GLB A;  2QMW A;  5CC2 A;  1SYH A;  1S9T A;  1LFH A;  1N84 A;  3MVW A;  1POT A;  3TQL A;  2CZH A;  3PD8 A;  2OWT A;  3Q27 A;  1Y3Q A;  4MEV A;  4MFI A;  1FTL A;  4I1D A;  3O29 A;  1A54 A;  4KCC A;  5KCJ B;  2QVU A;  4OMB A;  1JVY A;  4N6D A;  5CMM A;  1Y9U A;  2ALU A;  4KR5 A;  4H8J A;  4P9K A;  3I6V A;  1LBY A;  2HCA A;  2Z8E A;  5I58 A;  2E1S A;  4LQ2 A;  4QF9 A;  4JVD A;  4PE3 A;  3GBB A;  4NF5 B;  1NH8 A;  4IO3 A;  1J1N A;  3HFU A;  2H5Y A;  5ICT A;  3PPQ A;  3TTR A;  4PFI A;  5K2Y A;  3OSR A;  4O7M A;  2OX3 A;  5EQ7 A;  3KZG A;  4MNC A;  3A29 A;  3JYR A;  4O3A A;  4Q5T A;  4BDR A;  3A3C A;  4RPN A;  3MYU A;  3OSQ A;  1P99 A;  1NV4 A;  4OVJ A;  2UYE A;  4ONY A;  2HZL A;  4I8C A;  2VPO A;  3U8Q A;  3G3F A;  4FEB A;  5I84 A;  3CI8 A;  2I0C A;  1MQJ A;  1M5F A;  5DVI A;  5EHS A;  2UVH A;  2DWI A;  4F31 B;  1FPE A;  3L6H A;  1IMA A;  1MPC A;  4NHB A;  4THI A;  3SEV A;  3B50 A;  2A5T A;  4FAJ A;  4HE1 A;  4ELQ A;  3T9H B;  1FPJ A;  2XXX A;  2Z22 A;  1OLC A;  2FA7 A;  4FEC A;  2P0S A;  3ONM A;  1O7T A;  3V8X B;  4XIG Q;  4N15 A;  5T3J A;  1GTK A;  5ISU A;  3LUZ A;  3DLN A;  3HHG A;  1FTO A;  1DCU A;  1FBH A;  4ZED A;  1UTH B;  4WEP A;  2WBD A;  3MW0 A;  2Q74 A;  2V3Q A;  4IY6 A;  3K01 A;  1R6Z A;  4U21 A;  5AA4 A;  3HPI A;  4JDF A;  5KDT A;  1FJ6 A;  2O6A A;  4PGN A;  3DP6 A;  3Q26 A;  2THI A;  4PAK A;  1NMU A;  4F3S A;  1Z7M E;  4I3Y A;  4ZZA A;  5I59 B;  1FBG A;  3CVG A;  4TOZ A;  1MQI A;  4ELP A;  5F24 A;  3VFJ A;  4RJZ A;  1MG1 A;  3FXB A;  1KA0 A;  4U4S A;  4N6P A;  1SDX A;  1XS5 A;  3KN7 A;  4OEN A;  3EN3 A;  5CMK A;  2PFY A;  2M8C A;  5ITP A;  3K6X A;  3QAX A;  1PDA A;  4R9F A;  4GL0 A;  3H4Z A;  1PEB A;  3VXB A;  1MXZ A;  2BJI A;  2F5X A;  5I57 B;  1FBC A;  1Y4C A;  3MVX A;  4LON B;  2QL3 A;  1Q35 A;  2NXO A;  3U94 A;  4GBV A;  3IB2 A;  4OEV A;  4X04 A;  3D4G A;  4OTE A;  4QFP A;  4PGP A;  1S7Y A;  4OHN A;  4O3B A;  3K1N A;  4EXL A;  4F3B A;  1DOT A;  4UAB A;  3BFU A;  1N3X A;  4G4P A;  3VVD A;  2KLF A;  3RT8 A;  3UA8 A;  3PUV E;  3PUZ E;  1FTJ A;  3N26 A;  4UAC A;  2FIX A;  3OEN A;  4YKJ A;  2DE3 A;  3E9X A;  3E4R A;  4YU0 A;  3KOT A;  1MY3 A;  4GWY A;  1NV6 A;  4H5G A;  4PCD A;  3SEX A;  4NGU A;  1NFT A;  2F97 A;  2XXV A;  2XHD A;  3V83 A;  2H9B A;  2OK2 A;  4GLI A;  4OA4 A;  3TEP A;  3FD3 A;  2D21 A;  1K9Z A;  1N04 A;  4F2Q A;  5KZT A;  4R6K A;  1IMC A;  3H03 A;  4POX A;  4F1Y A;  3O6I A;  3C36 A;  1CB6 A;  1PB7 A;  4DXU A;  2GRV A;  2XX7 A;  1I69 A;  4MCO A;  5DEX B;  1B0H A;  3EQ1 A;  4N17 A;  4DE8 A;  2GH9 A;  2VP1 A;  3QIM A;  1Z7N E;  3AXF A;  1LB8 A;  2WBB A;  5FHO A;  4RYA A;  3CSG A;  2QSX A;  4JWX A;  1AWB A;  1NNF A;  4KFQ A;  3S9L C;  5AA2 B;  1FQE A;  2DP8 A;  4JSD A;  4N81 A;  5LTC A;  2FYI A;  3O66 A;  3W9W A;  4G8M A;  4HE0 A;  3L6G A;  2I58 A;  2F78 A;  1I6Q A;  4NF0 A;  3OXN A;  5JEI A;  1GVC A;  1P1Q A;  3MQ9 A;  5CI5 A;  5CBS A;  2PCR A;  4OWD A;  5B7D A;  5TP9 A;  2I3W A;  2ONR A;  3SEW A;  2OBG A;  4IO7 A;  2UXA A;  4JBZ A;  3ILT B;  3MUQ A;  4H46 A;  3FXQ A;  4MLV A;  4N4U A;  4KPT A;  1I6A A;  3TEL A;  4PQJ A;  1B1H A;  1NNK A;  4YZZ A;  1M5C A;  1P1N A;  4DCY A;  1FPI A;  5BUU A;  4IO6 A;  1B0L A;  4F3G A;  4G77 A;  1H44 A;  5CM6 A;  1VFD A;  2F7A A;  4FED A;  3A09 A;  2O1M A;  5I3S A;  4TLL B;  4HCW A;  3F11 A;  3CG3 A;  1G0I A;  3OEM A;  4U1Z A;  3RPW A;  1M5E A;  3O97 A;  4E0X A;  3LC8 A;  4MBP A;  1I6B A;  1MXY A;  4F1V A;  1BK4 A;  4I62 A;  4G8N A;  4EQB A;  5DVF A;  1GGG A;  5FHN A;  3OEL A;  1R1N A;  5LDZ A;  1K9Y A;  1H76 A;  2Z8D A;  3C33 A;  3SKP A;  2P3N A;  4N8Y A;  1SW2 A;  4DDD A;  5IKB A;  2Y5K A;  4QSC A;  1ZTY A;  1FPL A;  1TFD A;  3UIF A;  4XXU A;  4GL8 A;  5JTY A;  4F3P A;  4F22 A;  3E13 X;  3PPN A;  1Y3N A;  4YKP A;  5H8H A;  3U65 A;  5L9O A;  4P1E A;  1BKA A;  1NUZ A;  2HEU A;  1CNQ A;  1IMB A;  2IEE A;  1A99 A;  4IR8 A;  3KC1 A;  1BIY A;  1FQD A;  3T9V A;  2I3V A;  2DXY A;  2DS9 A;  4ZS9 A;  5AE4 A;  2NOO A;  5HM4 B;  2ONS A;  3TMG A;  4N07 A;  4MH5 A;  3A3U A;  5H8N A;  3KBR A;  4K3F A;  1IXC A;  3OO6 A;  1VR5 A;  4HTG A;  1NUY A;  3IB0 A;  3TQW A;  3LR1 A;  3E78 A;  4GXS B;  1RYO A;  1WDN A;  4X1D A;  5EQ8 A;  4QHQ A;  4PBH A;  3U72 A;  4PP0 A;  1D9V A;  3ZS6 A;  4PTK A;  4OER A;  5A5X B;  4MMP A;  2KR0 A;  5TPA B;  4AQ4 A;  1QUI A;  3IFC A;  3MBP A;  1TT1 A;  1OIB A;  3JZJ A;  1KZ8 A;  2Q88 A;  3W9V A;  2XXP A;  5H8F B;  3B6T A;  3QK6 A;  4AB6 A;  1NV3 A;  2CZI A;  3FAS A;  3K4U A;  3UK4 A;  1MH4 A;  2Z23 A;  4MJO A;  4TLM B;  4OAN A;  3TTL A;  5F7V A;  1A8E A;  3R6U A;  4GWW A;  1EH3 A;  1LBB A;  1OLA A;  2JJK A;  3FVN A;  4GOT A;  3PPR A;  2ZNS A;  2B3B A;  1LGB C;  2Q89 A;  3MST A;  2ZZW A;  4R2B A;  3R7X A;  3FGS A;  3CRB A;  4NWC A;  1IUD A;  3K0V A;  3RUM A;  4BDL A;  3OO9 A;  3S4U A;  3K1M A;  1XT8 A;  1Q1K A;  2RCA A;  4JWY A;  1DTG A;  2PYY A;  1A7L A;  1URD A;  2I49 A;  3TKD A;  4GWX A;  4JXI A;  1GR2 A;  3RTW B;  2HAU A;  4R2F A;  2Y7R A;  1MY0 A;  1MQD A;  3HN0 A;  1PB8 A;  1JNF A;  4G8H A;  1MXU A;  2Q8J A;  4OVQ A;  2ANJ A;  1LLS A;  4EF1 A;  1LCF A;  2F35 A;  3FV1 A;  1B3H A;  1LAF E;  3PUY E;  2HAV A;  3TCH A;  4BDO A;  3CR9 A;  5I2K A;  3OO7 A;  3E79 A;  5EHM A;  4YB6 A;  4C1T A;  4PFW A;  5ICQ A;  4F2O A;  4U23 A;  1LAG E;  2WX9 A;  1EYI A;  3K00 A;  4DLD A;  4LAT A;  2VHA A;  2Y7W A;  1G0H A;  4XTC Q;  1FJ9 A;  1YCJ A;  1USY H;  1NV1 A;  4GFR A;  2Y84 A;  1R9L A;  4NG7 A;  1FSA A;  4XKQ A;  1ZLQ A;  3M3F A;  4FE8 A;  2O7U A;  4QSD A;  5H8Q B;  1O63 A;  1EYJ A;  1IIT A;  1B46 A;  1B51 A;  1QUK A;  1B3G A;  1RKM A;  3C34 A;  4DI4 B;  2V3T A;  1JW4 A;  4FBP A;  4NF4 A;  4PF8 A;  4E0W A;  3PU5 A;  1B4Z A;  2I6E A;  2HQ0 A;  2R9J A;  2AIX A;  1MM7 A;  5L8D A;  3RPL B;  2HXR A;  1YAE A;  4P56 A;  3VV5 A;  1N0T A;  1FBP A;  3ZSF A;  1GV8 A;  1ANF A;  3IK6 B;  3BIH A;  3QXM A;  3K6U A;  1WOD A;  2ABH A;  3TFL A;  2O84 X;  4F29 A;  2DSF A;  1A55 A;  5TU0 A;  2ZNU A;  4KCD A;  4MIJ A;  3IR1 A;  4X48 A;  3O2A A;  1EZ9 A;  2NWJ A;  5I2N B;  3IO6 A;  4IGR A;  3SZP A;  1OQG A;  4GWO A;  2F6P A;  1TXF A;  4PAF A;  3K1P A;  1B52 A;  2PMS A;  2DVZ A;  3KBZ A;  1MH3 A;  1XHY A;  1B5I A;  1SPI A;  2OJT A;  2I48 A;  1FTM A;  2YJP A;  4PE5 B;  4O8M A;  3C4M A;  1MXV A;  4BDN A;  1N3W A;  5I56 A;  4NWD A;  4H65 A;  3PUW E;  4GQO A;  4OEU A;  4KXP A;  1XOC A;  1YTV A;  3CG1 A;  4G68 B;  2F8D A;  3VVF A;  3D4C A;  1NUW A;  3SER A;  3H6U A;  4PET A;  1M5B A;  4JWO A;  2Q8M A;  1JW1 A;  1URG A;  4M1V A;  3U92 A;  4XFE A;  3KOS A;  1B40 A;  4ZE8 A;  1SW1 A;  4ZEB A;  4HE2 A;  4OVS A;  4MAG A;  4YB7 A;  3T93 B;  5L9S A;  3B8B A;  2YLN A;  2B4L A;  3Q25 A;  3G3K A;  4GX6 A;  4C1U A;  2R8T A;  1B3F A;  5KCJ A;  4AS5 A;  2XXK A;  3TTM A;  1NNP A;  4MX6 A;  4IO4 A;  1B7H A;  2DXR A;  5ELV A;  2VPN A;  4BLA A;  1PBQ A;  1QGX A;  1NV0 A;  3BKI B;  2WEF A;  3H3G A;  3TUS A;  4NF5 A;  2I4B A;  4F19 A;  2FHY A;  1L5T A;  2BJJ X;  1NV2 A;  3KSX A;  4N13 A;  2ZZV A;  4X1B A;  1HSL A;  1HSE A;  2AL5 A;  4DIG A;  4EUO A;  2AYS A;  1MPB A;  4P0I A;  4EDP A;  2F36 A;  1IXH A;  2P2A A;  3VXC A;  4RPO A;  2ESN A;  4OES A;  3DP4 A;  5IZ3 B;  1II5 A;  5IZZ A;  2B3F A;  3MPL A;  3S9E A;  4PFY A;  4OXV A;  4R74 A;  1LBX A;  5ET5 A;  3RN8 A;  2H4I A;  4PFB A;  4GWU A;  2XA5 A;  3FUZ A;  3FIR A;  1F9B A;  1SYI A;  3O9P A;  1OQH A;  1IME A;  2CZL A;  2XXR A;  1Y20 A;  4ZEF A;  1LCT A;  4XKR A;  5EYH A;  3VLW A;  3SEU A;  3HO7 A;  1NI9 A;  5DTB A;  5AA3 A;  4RXL A;  1H43 A;  4NED A;  4IO5 A;  2PT1 A;  3PMV A;  3Q28 A;  1RDY A;  4OFO A;  4OVT A;  3WAE A;  4NF8 B;  4DI3 D;  1D4N A;  1B7U A;  2XXT A;  1EZO A;  1SVX B;  1UTH A;  3EHS A;  3G3I A;  1EU8 A;  1EYK A;  1OVB A;  3MC2 A;  4YMB A;  3RY3 A;  4H1X A;  5ET6 A;  2GHA A;  3T1B A;  3N6T A;  1UTB B;  4IY5 A;  1US5 A;  4ELO A;  4IO2 A;  3ZKL A;  4H6D A;  2QS4 A;  2XWK A;  1B6H A;  1US4 A;  1RDX A;  1ZBM A;  2DWJ A;  4RK2 A;  2DQV A;  4MHF A;  1MXW A;  3S9M C;  1Y1Z A;  5I7I A;  2OWZ A;  4GIZ A;  3WAF A;  4P1L A;  2G29 A;  5I59 A;  1IMD A;  1NNT A;  2ZMB A;  3IAZ A;  1ELJ A;  3N6U A;  1VE4 A;  3EPE A;  1D9Q A;  3KGC A;  3GYY A;  4EQ9 A;  4F39 A;  2R71 A;  1T0K A;  1JEV A;  1Q9D A;  3T9X B;  1B4H A;  3H6W A;  1P1U A;  1NV7 A;  2V25 A;  3RLF E;  3N5L A;  2I4C A;  3C35 A;  1P1W A;  3PUX E;  4UA8 A;  4LQ5 A;  4OVP A;  5I57 A;  4FJP A;  1QUL A;  3DP8 A;  2OWS A;  4NF6 B;  2V4C A;  2B65 A;  3U93 A;  4JB7 A;  4YKI A;  3BFT A;  5EQA A;  3PPP A;  3VVE A;  5IGA A;  2RCB A;  4NTL A;  1JP4 A;  4NN3 A;  3UN6 A;  2F3B A;  2X26 A;  3IJO B;  1NL5 A;  2LAO A;  1M5D A;  2FIE A;  2DDK A;  4F18 A;  5I58 B;  1XI6 A;  2QFL A;  5FBP A;  1FBE A;  1N7W A;  4U22 A;  3THI A;  1S50 A;  2R6G E;  3FBP A;  1B9J A;  2F3D A;  1PC3 A;  1VSO A;  3MWB A;  3KJ7 A;  4GWZ A;  4ND9 A;  5CMC A;  3IFA A;  4H8I A;  4LN5 A;  4G68 C;  2Y7K A;  1MDP 1;  5BWJ A;  1JQF A;  4KYE A;  2RC7 A;  4WXJ A;  4YKK A;  2REJ A;  1VDW A;  2UYF A;  4OFJ A;  1B58 A;  2OCU A;  2P1S A;  1DK4 A;  2RF1 A;  2X7P A;  3KJT A;  3UOR A;  5DEX A;  4PC9 A;  5LOM A;  1IXG A;  2FNC A;  3B6W A;  4MNI A;  1XC1 A;  1P1O A;  3FJM A;  2XXW A;  3KN8 A;  3K6V A;  1QUJ A;  4O94 A;  1SW5 A;  4PFT A;  3G3H A;  4IGT A;  4P8B A;  2NVU B;  1DMB A;  2YPN A;  1MY1 A;  4PF6 A;  2HFB A;  3SES A;  1JET A;  2QVV A;  5CRY A;  2A5T B;  4H45 A;  4OQO A;  5AA2 A;  5IM2 A;  3MP8 A;  5IAI A;  5AA1 A;  4H5F A;  2V93 A;  2FBP A;  2X7Q A;  3MZ1 A;  1AOV A;  1FCK A;  2PVU A;  4FOR A;  4N91 A;  1B7Z A;  2UVG A;  3PMX A;  1B32 A;  3IOV A;  4WED A;  3MAM A;  1MQG A;  3S2V A;  4KI0 E;  1UIV A;  3RGY A;  4RY1 A;  3ECR A;  1YZ0 A;  2XXY A;  1B3L A;  2VGQ A;  3VE1 B;  5AA4 B;  2XXU A;  5KDT B;  5FTI A;  1LB9 A;  3SEY A;  2XX9 A;  3QUF A;  3CSB A;  1D3K A;  3O28 A;  2CEX A;  3VLV A;  1LEV A;  4PDD A;  2OLB A;  2O7I A;  1B05 A;  1A8F A;  2ZYN A;  1TFA A;  3MP1 A;  2DWA A;  1LBZ A;  3H7M A;  3PV0 E;  2QRY A;  1USY E;  1JEU A;  2XD3 A;  1TWY A;  1PB9 A;  3LV0 A;  3IOW A;  5HBC A;  4ZEI A;  1O64 A;  5ET8 A;  3MZB A;  1NKX A;  3KSJ A;  4HS7 A;  5CBR A;  2F7C A;  5CMB A;  3RNN A;  2F34 A;  2KQZ A;  4NX1 A;  2FVZ A;  2MKZ A;  4DZ1 A;  2ONK E;  1VFE A;  1KA1 A;  1IXI A;  2RC8 A;  4RK9 A;  1FPK A;  5EQ9 A;  4BDM A;  4O3C A;  1SD3 A;  3O6G A;  3ISP A;  1LFI A;  1LFG A;  1MDQ A;  3E3K A;  3RT6 B;  1NH7 A;  2V84 A;  4EF2 A;  4XF5 A;  1MY2 A;  2UVI A;  4QRZ A;  2W7Y A;  1URS A;  1XVY A;  4P47 A;  3RTF B;  3GXA A;  1LBW A;  2PFZ A;  3KC0 A;  2QS1 A;  4X9T A;  3RQT A;  1IMF A;  3FJG A;  4U1O A;  3T66 A;  1IQ7 A;  4LZ5 A;  4NQ8 A;  1UQW A;  5IZ1 A;  4ZEC A;  5EYG A;  3KG2 A;  3IL1 B;  2F7B A;  1MXX A;  4I3E A;  4JSO A;  4ISU A;  2WKY A;  3IB1 A;  3T9U A;  4G61 A;  3OD7 A;  4QSE A;  5I5P A;  2A5S A;  1MM6 A;  3GZG A;  1LAH E;  5J1D A;  4FAT A;  3CFL A;  3LBS A;  2F6G A;  4ZZE A;  5A5X A;  3OMB A;  3P7I A;  1NUX A;  2L5V A;  1BLF A;  3O6H A;  4ZEK A;  3M3K A;  3TYH A;  1LST A;  3FVK A;  3ROJ A;  4NE4 A;  5TPA A;  3B7D A;  1LBV A;  3FAT A;  3KFM A;  5J16 A;  3D1R A;  4OET A;  5K2X A;  4PAI A;  2DYX A;  5DVJ A;  2UVJ A;  1FPD A;  4PBQ A;  4QFO A;  3CFX A;  3EHT A;  1N76 A;  5ITO A;  4LA9 A;  5H8F A;  4QFN A;  2QPQ A;  2ZYO A;  2RIN A;  1B3E A;  4HW8 A;  2Y5L A;  3H6V A;  3HV1 A;  3H06 B;  1UIU A;  3SET A;  4KD5 A;  2RC9 A; 
#chains in the Genus database with same CATH homology
 4RNS A;  4AB5 A;  3IO4 A;  2ZYM A;  3M3L A;  1LBC A;  4MF3 A;  2Q9T A;  4ZE9 A;  4LP2 B;  1MPD A;  5TP9 B;  3C9H A;  3HHF A;  4PFU A;  5L9M A;  3B6Q A;  3LSX A;  1FQC A;  4MLQ A;  1A40 A;  4Q0C A;  2O68 A;  3FVO A;  3HCQ A;  1D9Y A;  3IOU A;  2HXW A;  3FJ7 A;  3PMW A;  5FTH A;  1QVS A;  4XKP A;  3T22 A;  3VDF A;  3G3G A;  4ZDM A;  2H25 A;  4I9D A;  3C31 A;  3DM0 A;  4R75 A;  3MVY A;  3R26 A;  3TTN A;  3LSF B;  4LUB A;  1ZMG A;  2DVC A;  3IOT A;  1FQA A;  2ZXT A;  3PGF A;  2QS3 A;  1DPE A;  3FVG A;  4L17 A;  3W15 C;  1B5H A;  2PT2 A;  3UP9 A;  3ILU B;  1DSN A;  5DT6 A;  4Q30 B;  4WKM A;  2VOZ A;  1MRP A;  2V3U A;  2OZZ A;  3V89 B;  2PBW A;  5H8Q A;  4R9G A;  1B2H A;  3FXR A;  4BDQ A;  1SBP A;  4G2Z A;  5JTY B;  4GD5 A;  3OEK A;  1HSJ A;  1DTZ A;  2Q2C A;  4QFK A;  5H8H B;  1H3D A;  1ZIU A;  2Q2A A;  3CFZ A;  1FW0 A;  4FIM A;  2D3I A;  3IJX B;  1JW5 A;  4ELR A;  3U1O A;  4ESX A;  1SW4 A;  3TCG A;  2DE2 A;  2REG A;  3PPO A;  2G93 A;  5H8N B;  2XXH A;  4DXB A;  1ZJL A;  4LVQ A;  3IOR A;  1FQB A;  2IA4 A;  5B70 A;  1DPP A;  3DEL B;  3QUJ A;  3LSW A;  3OOA A;  3G3J A;  1QJM A;  1Y4T A;  3S9N C;  3TOD A;  5I2N A;  4GF8 A;  4Z0I A;  1QKA A;  4LZ8 A;  4EXK A;  5DYH A;  4ECF A;  3C32 A;  5FHM A;  4GVO A;  1ATG A;  1SQY A;  2RKM A;  1QW0 A;  2E0S A;  1B5J A;  2VD2 A;  1KWH A;  2QS2 A;  3UGW A;  3VLU A;  1AIV A;  4XKN A;  4DCX A;  2XXI A;  3TZA A;  1BP5 A;  4G68 A;  4IB2 A;  3I5O A;  4H67 A;  2Y7P A;  3CIJ A;  1AH5 A;  2O69 A;  2Y7I A;  1FTK A;  3MZ9 A;  3FV2 A;  3QYT A;  4ESW A;  4M4G A;  2HZK A;  4U2R A;  1LAX A;  3M8U A;  4KYD A;  3FXU A;  4KHZ E;  1EZP A;  3K02 A;  1IIW A;  5M2V A;  2GFE A;  1XVX A;  3EHU A;  3HST A;  4Z7E A;  2ZYK A;  4HCY A;  2NUV A;  2DOJ A;  3LSL A;  3K2D A;  4GRK A;  4R6Y A;  4R6H A;  5I2K B;  2O51 A;  4P11 A;  1SI1 A;  3JV9 A;  4OYV A;  2Z8F A;  1CE2 A;  3I3V A;  2ZNT A;  2VD3 A;  1MQH A;  4P0G A;  4QFL A;  4R73 A;  1POY 1;  4POW A;  3TPA A;  3ZKK A;  3MJN A;  4EQ7 A;  5F1Q A;  3PD9 A;  1WVJ A;  1YPN A;  1B1X A;  3MVZ A;  1ZKB A;  1ZU0 A;  3QSL A;  3USD A;  4RA1 A;  1MY4 A;  1SI0 A;  1OVT A;  3K6W A;  4KYS A;  1AL3 A;  4OZ9 A;  3KN3 A;  4NF4 B;  5H8S A;  4YB5 A;  2H99 A;  3T96 B;  4U4X A;  2PX1 A;  1R9Q A;  4Q8R A;  1BTJ A;  4NF8 A;  3BBR A;  4OFL A;  2O1L A;  3TCF A;  2H98 A;  5EYF A;  2AL4 A;  3KEI A;  3SDF A;  4F1U A;  3MP6 A;  2DWH A;  4DXC A;  1IZ1 A;  1FQF A;  1UTB A;  3EF7 A;  4KQP A;  1H45 A;  3TTK A;  3TDJ A;  4C0R A;  4TQU Q;  2XXQ A;  2DE4 A;  5JK4 A;  1Y3P A;  2GHB A;  4YMA A;  1PBP A;  4H0W A;  1IEJ A;  3TAJ A;  3G7W A;  1N7X A;  2I0B A;  4NMY A;  1OMP A;  5HPQ A;  3FZV A;  2QJE A;  5AA2 D;  3V5A A;  3IX1 A;  3GBA A;  5I56 B;  3Q29 A;  4LZ7 A;  4YIC A;  4YAH X;  1AMF A;  2CMO A;  3LUY A;  3OO8 A;  1JVX A;  2D5W A;  4GXA A;  4R72 A;  3MPK A;  1Y1M A;  2XD2 A;  1QKB A;  1RYX A;  1MS7 A;  2QMX A;  3H6T A;  2XX8 A;  3ODB A;  4NF6 A;  3N94 A;  3GLB A;  2QMW A;  5CC2 A;  1SYH A;  1S9T A;  1LFH A;  1N84 A;  3MVW A;  1POT A;  3TQL A;  3PD8 A;  2OWT A;  3Q27 A;  1Y3Q A;  4MFI A;  1FTL A;  4I1D A;  3O29 A;  1A54 A;  4KCC A;  5KCJ B;  4OMB A;  1JVY A;  5CMM A;  1Y9U A;  2ALU A;  4KR5 A;  4H8J A;  3I6V A;  2HCA A;  2Z8E A;  5I58 A;  2E1S A;  4LQ2 A;  4QF9 A;  3GBB A;  4NF5 B;  1NH8 A;  4IO3 A;  1J1N A;  2H5Y A;  5ICT A;  3PPQ A;  3TTR A;  5K2Y A;  3OSR A;  3KZG A;  3JYR A;  4O3A A;  4Q5T A;  4BDR A;  3A3C A;  4RPN A;  3OSQ A;  1P99 A;  4OVJ A;  2UYE A;  4ONY A;  2HZL A;  4I8C A;  3U8Q A;  3G3F A;  4FEB A;  5I84 A;  3CI8 A;  2I0C A;  1MQJ A;  1M5F A;  5DVI A;  5EHS A;  2UVH A;  2DWI A;  4F31 B;  3L6H A;  1MPC A;  4THI A;  3SEV A;  2A5T A;  4FAJ A;  4ELQ A;  3T9H B;  2XXX A;  2Z22 A;  1OLC A;  2FA7 A;  4FEC A;  2P0S A;  3ONM A;  1O7T A;  3V8X B;  4XIG Q;  1GTK A;  5ISU A;  3DLN A;  3HHG A;  1FTO A;  4ZED A;  1UTH B;  4WEP A;  3MW0 A;  2V3Q A;  4IY6 A;  3K01 A;  1R6Z A;  4U21 A;  5AA4 A;  3HPI A;  4JDF A;  5KDT A;  2O6A A;  3DP6 A;  3Q26 A;  2THI A;  1NMU A;  4F3S A;  1Z7M E;  4ZZA A;  5I59 B;  3CVG A;  4TOZ A;  1MQI A;  4ELP A;  3VFJ A;  4RJZ A;  1MG1 A;  4U4S A;  4N6P A;  1SDX A;  1XS5 A;  3KN7 A;  4OEN A;  3EN3 A;  5CMK A;  2M8C A;  5ITP A;  3K6X A;  3QAX A;  1PDA A;  4R9F A;  4GL0 A;  3H4Z A;  1PEB A;  3VXB A;  1MXZ A;  2F5X A;  5I57 B;  1Y4C A;  3MVX A;  4LON B;  2QL3 A;  1Q35 A;  2NXO A;  3U94 A;  3IB2 A;  4OEV A;  3D4G A;  4OTE A;  4QFP A;  1S7Y A;  4OHN A;  4O3B A;  3K1N A;  4EXL A;  4F3B A;  1DOT A;  3BFU A;  1N3X A;  4G4P A;  3VVD A;  2KLF A;  3RT8 A;  3UA8 A;  3PUV E;  3PUZ E;  1FTJ A;  3N26 A;  4UAC A;  3OEN A;  4YKJ A;  2DE3 A;  3E9X A;  3E4R A;  4YU0 A;  3KOT A;  1MY3 A;  4H5G A;  3SEX A;  1NFT A;  2F97 A;  2XXV A;  2XHD A;  3V83 A;  2H9B A;  2OK2 A;  4GLI A;  3TEP A;  3FD3 A;  2D21 A;  1N04 A;  4F2Q A;  5KZT A;  4R6K A;  3H03 A;  4POX A;  4F1Y A;  3O6I A;  3C36 A;  1CB6 A;  1PB7 A;  4DXU A;  2GRV A;  2XX7 A;  1I69 A;  5DEX B;  1B0H A;  3EQ1 A;  4DE8 A;  2GH9 A;  2VP1 A;  3QIM A;  1Z7N E;  3AXF A;  1LB8 A;  5FHO A;  4RYA A;  3CSG A;  2QSX A;  4JWX A;  1NNF A;  4KFQ A;  3S9L C;  5AA2 B;  1FQE A;  2DP8 A;  4JSD A;  2FYI A;  3O66 A;  3W9W A;  4G8M A;  3L6G A;  2I58 A;  2F78 A;  1I6Q A;  3OXN A;  5JEI A;  1GVC A;  1P1Q A;  3MQ9 A;  5CI5 A;  5CBS A;  4OWD A;  5B7D A;  5TP9 A;  2I3W A;  2ONR A;  3SEW A;  2OBG A;  4IO7 A;  2UXA A;  4JBZ A;  3ILT B;  3MUQ A;  3FXQ A;  4MLV A;  4KPT A;  1I6A A;  3TEL A;  4PQJ A;  1B1H A;  1NNK A;  4YZZ A;  1M5C A;  1P1N A;  4DCY A;  5BUU A;  4IO6 A;  1B0L A;  4F3G A;  4G77 A;  1H44 A;  5CM6 A;  1VFD A;  2F7A A;  4FED A;  3A09 A;  2O1M A;  4TLL B;  4HCW A;  3F11 A;  3CG3 A;  3OEM A;  4U1Z A;  3RPW A;  1M5E A;  3O97 A;  4E0X A;  3LC8 A;  4MBP A;  1I6B A;  1MXY A;  4F1V A;  4I62 A;  4G8N A;  4EQB A;  5DVF A;  1GGG A;  5FHN A;  3OEL A;  1R1N A;  1H76 A;  2Z8D A;  3C33 A;  3SKP A;  1SW2 A;  4DDD A;  5IKB A;  4QSC A;  1ZTY A;  1TFD A;  3UIF A;  4XXU A;  4GL8 A;  5JTY A;  4F3P A;  4F22 A;  3E13 X;  3PPN A;  1Y3N A;  4YKP A;  5H8H A;  5L9O A;  1BKA A;  2HEU A;  2IEE A;  1A99 A;  1BIY A;  1FQD A;  3T9V A;  2I3V A;  2DXY A;  2DS9 A;  4ZS9 A;  5AE4 A;  2NOO A;  5HM4 B;  2ONS A;  3TMG A;  4N07 A;  4MH5 A;  3A3U A;  5H8N A;  3KBR A;  4K3F A;  1IXC A;  3OO6 A;  1VR5 A;  4HTG A;  3IB0 A;  3TQW A;  3LR1 A;  4GXS B;  1RYO A;  1WDN A;  4X1D A;  4QHQ A;  3U72 A;  4PP0 A;  1D9V A;  3ZS6 A;  4OER A;  5A5X B;  5TPA B;  4AQ4 A;  1QUI A;  3MBP A;  1TT1 A;  1OIB A;  3JZJ A;  2Q88 A;  3W9V A;  2XXP A;  5H8F B;  3B6T A;  3QK6 A;  4AB6 A;  3FAS A;  3K4U A;  3UK4 A;  1MH4 A;  2Z23 A;  4TLM B;  3TTL A;  5F7V A;  1A8E A;  3R6U A;  1EH3 A;  1LBB A;  1OLA A;  3FVN A;  4GOT A;  3PPR A;  2ZNS A;  2B3B A;  1LGB C;  2Q89 A;  4R2B A;  3R7X A;  3FGS A;  3CRB A;  4NWC A;  1IUD A;  3K0V A;  3RUM A;  4BDL A;  3OO9 A;  3S4U A;  3K1M A;  1XT8 A;  1Q1K A;  2RCA A;  4JWY A;  1DTG A;  2PYY A;  1A7L A;  1URD A;  2I49 A;  3TKD A;  4JXI A;  1GR2 A;  3RTW B;  2HAU A;  4R2F A;  2Y7R A;  1MY0 A;  1MQD A;  3HN0 A;  1PB8 A;  1JNF A;  4G8H A;  1MXU A;  2Q8J A;  2ANJ A;  1LLS A;  4EF1 A;  1LCF A;  2F35 A;  3FV1 A;  1B3H A;  1LAF E;  3PUY E;  2HAV A;  3TCH A;  4BDO A;  3CR9 A;  5I2K A;  3OO7 A;  5EHM A;  4YB6 A;  4C1T A;  4PFW A;  5ICQ A;  4F2O A;  4U23 A;  1LAG E;  3K00 A;  4DLD A;  4LAT A;  2VHA A;  2Y7W A;  4XTC Q;  1YCJ A;  1USY H;  4GFR A;  2Y84 A;  1R9L A;  4XKQ A;  1ZLQ A;  3M3F A;  4FE8 A;  2O7U A;  4QSD A;  5H8Q B;  1O63 A;  1IIT A;  1B46 A;  1B51 A;  1QUK A;  1B3G A;  1RKM A;  3C34 A;  2V3T A;  1JW4 A;  4NF4 A;  4E0W A;  3PU5 A;  1B4Z A;  2I6E A;  2HQ0 A;  2R9J A;  2AIX A;  1MM7 A;  5L8D A;  1YAE A;  3VV5 A;  1N0T A;  3ZSF A;  1GV8 A;  1ANF A;  3IK6 B;  3QXM A;  3K6U A;  1WOD A;  2ABH A;  3TFL A;  2O84 X;  4F29 A;  2DSF A;  1A55 A;  5TU0 A;  2ZNU A;  4KCD A;  3IR1 A;  4X48 A;  3O2A A;  1EZ9 A;  2NWJ A;  5I2N B;  3IO6 A;  4IGR A;  1OQG A;  4GWO A;  2F6P A;  1TXF A;  3K1P A;  1B52 A;  2PMS A;  2DVZ A;  1MH3 A;  1XHY A;  1B5I A;  2OJT A;  2I48 A;  1FTM A;  2YJP A;  4PE5 B;  3C4M A;  1MXV A;  4BDN A;  1N3W A;  5I56 A;  4NWD A;  4H65 A;  3PUW E;  4GQO A;  4OEU A;  1XOC A;  1YTV A;  3CG1 A;  4G68 B;  2F8D A;  3VVF A;  3D4C A;  3SER A;  3H6U A;  4PET A;  1M5B A;  4JWO A;  1JW1 A;  1URG A;  4M1V A;  3U92 A;  3KOS A;  1B40 A;  4ZE8 A;  1SW1 A;  4ZEB A;  4YB7 A;  3T93 B;  5L9S A;  2YLN A;  3Q25 A;  3G3K A;  4C1U A;  1B3F A;  5KCJ A;  3TTM A;  1NNP A;  4IO4 A;  1B7H A;  2DXR A;  5ELV A;  4BLA A;  1PBQ A;  3BKI B;  3H3G A;  3TUS A;  4NF5 A;  2I4B A;  4F19 A;  1L5T A;  2BJJ X;  3KSX A;  4N13 A;  4X1B A;  1HSL A;  1HSE A;  2AL5 A;  4DIG A;  4EUO A;  2AYS A;  1MPB A;  4P0I A;  4EDP A;  2F36 A;  1IXH A;  2P2A A;  3VXC A;  4RPO A;  2ESN A;  4OES A;  3DP4 A;  1II5 A;  2B3F A;  3MPL A;  3S9E A;  4PFY A;  4OXV A;  4R74 A;  3RN8 A;  2H4I A;  3FUZ A;  3FIR A;  1F9B A;  1SYI A;  3O9P A;  1OQH A;  2CZL A;  2XXR A;  1Y20 A;  4ZEF A;  1LCT A;  4XKR A;  3VLW A;  3SEU A;  3HO7 A;  5DTB A;  5AA3 A;  4RXL A;  1H43 A;  4NED A;  4IO5 A;  2PT1 A;  3PMV A;  3Q28 A;  4OFO A;  3WAE A;  4NF8 B;  1D4N A;  1B7U A;  2XXT A;  1EZO A;  1SVX B;  1UTH A;  3EHS A;  3G3I A;  1EU8 A;  1OVB A;  3MC2 A;  4YMB A;  3RY3 A;  4H1X A;  2GHA A;  3N6T A;  1UTB B;  4IY5 A;  1US5 A;  4ELO A;  4IO2 A;  3ZKL A;  4H6D A;  2QS4 A;  1B6H A;  1US4 A;  1ZBM A;  2DWJ A;  4RK2 A;  2DQV A;  1MXW A;  3S9M C;  1Y1Z A;  4GIZ A;  3WAF A;  2G29 A;  5I59 A;  1NNT A;  2ZMB A;  3IAZ A;  1ELJ A;  3N6U A;  1VE4 A;  3EPE A;  4EQ9 A;  3KGC A;  4F39 A;  2R71 A;  1T0K A;  1JEV A;  3T9X B;  1B4H A;  3H6W A;  1P1U A;  2V25 A;  3RLF E;  3N5L A;  2I4C A;  3C35 A;  1P1W A;  3PUX E;  4UA8 A;  4LQ5 A;  5I57 A;  4FJP A;  1QUL A;  3DP8 A;  2OWS A;  4NF6 B;  2B65 A;  3U93 A;  4JB7 A;  4YKI A;  3BFT A;  3PPP A;  3VVE A;  2RCB A;  4NTL A;  3UN6 A;  2X26 A;  3IJO B;  1NL5 A;  2LAO A;  1M5D A;  4F18 A;  5I58 B;  1N7W A;  4U22 A;  3THI A;  1S50 A;  2R6G E;  1B9J A;  1PC3 A;  1VSO A;  3MWB A;  3KJ7 A;  4ND9 A;  5CMC A;  4H8I A;  4G68 C;  2Y7K A;  1MDP 1;  5BWJ A;  1JQF A;  4KYE A;  2RC7 A;  4WXJ A;  4YKK A;  2REJ A;  2UYF A;  4OFJ A;  1B58 A;  2OCU A;  2P1S A;  2RF1 A;  2X7P A;  3KJT A;  3UOR A;  5DEX A;  5LOM A;  1IXG A;  2FNC A;  3B6W A;  1XC1 A;  1P1O A;  3FJM A;  2XXW A;  3KN8 A;  3K6V A;  1QUJ A;  1SW5 A;  4PFT A;  3G3H A;  4IGT A;  2NVU B;  1DMB A;  2YPN A;  1MY1 A;  2HFB A;  3SES A;  1JET A;  5CRY A;  2A5T B;  4OQO A;  5AA2 A;  3MP8 A;  5IAI A;  5AA1 A;  4H5F A;  2V93 A;  2X7Q A;  3MZ1 A;  1AOV A;  1FCK A;  2PVU A;  4FOR A;  1B7Z A;  2UVG A;  3PMX A;  1B32 A;  3IOV A;  4WED A;  3MAM A;  1MQG A;  3S2V A;  4KI0 E;  1UIV A;  3RGY A;  4RY1 A;  3ECR A;  2XXY A;  1B3L A;  2VGQ A;  3VE1 B;  5AA4 B;  2XXU A;  5KDT B;  5FTI A;  1LB9 A;  3SEY A;  2XX9 A;  3QUF A;  3CSB A;  1D3K A;  3O28 A;  3VLV A;  2OLB A;  2O7I A;  1B05 A;  1A8F A;  2ZYN A;  1TFA A;  3MP1 A;  2DWA A;  3H7M A;  3PV0 E;  2QRY A;  1USY E;  1JEU A;  2XD3 A;  1TWY A;  1PB9 A;  3IOW A;  5HBC A;  4ZEI A;  1O64 A;  3MZB A;  1NKX A;  3KSJ A;  4HS7 A;  5CBR A;  2F7C A;  5CMB A;  3RNN A;  2F34 A;  4DZ1 A;  2ONK E;  1VFE A;  1IXI A;  2RC8 A;  4RK9 A;  4BDM A;  4O3C A;  1SD3 A;  3O6G A;  1LFI A;  1LFG A;  1MDQ A;  3E3K A;  3RT6 B;  1NH7 A;  2V84 A;  4EF2 A;  1MY2 A;  2UVI A;  4QRZ A;  2W7Y A;  1URS A;  1XVY A;  3RTF B;  3GXA A;  2QS1 A;  4X9T A;  3RQT A;  3FJG A;  4U1O A;  3T66 A;  1IQ7 A;  4LZ5 A;  1UQW A;  4ZEC A;  3KG2 A;  3IL1 B;  2F7B A;  1MXX A;  4JSO A;  4ISU A;  2WKY A;  3IB1 A;  3T9U A;  3OD7 A;  4QSE A;  2A5S A;  1MM6 A;  3GZG A;  1LAH E;  5J1D A;  4FAT A;  3CFL A;  3LBS A;  2F6G A;  4ZZE A;  5A5X A;  3OMB A;  3P7I A;  4ZEK A;  1BLF A;  3O6H A;  3M3K A;  3TYH A;  1LST A;  3FVK A;  4NE4 A;  5TPA A;  3B7D A;  3FAT A;  3KFM A;  4OET A;  5K2X A;  2DYX A;  5DVJ A;  2UVJ A;  4QFO A;  3CFX A;  3EHT A;  1N76 A;  5ITO A;  4LA9 A;  5H8F A;  4QFN A;  2QPQ A;  2ZYO A;  2RIN A;  1B3E A;  4HW8 A;  3H6V A;  3HV1 A;  3H06 B;  1UIU A;  3SET A;  4KD5 A;  2RC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...