1TT1A

Crystal structure of the glur6 ligand binding core in complex with kainate 1.93 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
total genus 87
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1tt1A02
2D5WA 2Y7IA 2F7CA 4HS7A 3A09A 1GR2A 1VFDA 3FVOA 1IITA 4BDMA 5FHOA 2PT1A 2VD3A 2OBGA 3ILUB 1AH5A 4Q8RA 1ZKBA 3O66A 3KJ7A 1LFGA 1R9QA 2Y7WA 1PEBA 4FEDA 2Y7KA 4FJPA 4L17A 4M1VA 1LFIA 3O9PA 1PB7A 1I6QA 2ZYNA 1VFEA 3IJOB 1EH3A 1TFDA 1GVCA 2CZLA 4ELQA 1M5DA 1VR5A 2F6GA 3K1PA 3E13X 3TZAA 2V93A 2O84X 1I69A 4ZE8A 1US5A 5FTIA 2QS1A 3O6GA 4GFRA 2ALUA 3OD7A 4IO6A 3TQWA 1MXYA 4DXUA 4GWOA 2YLNA 1MXWA 5TP9A 1L5TA 4YB7A 2RINA 3IJXB 3W15C 3V83A 4R72A 3CI8A 4OENA 3KJTA 4ND9A 5H8NB 4EQ7A 1A7LA 2E0SA 4KI0E 1FQBA 2V84A 4R2BA 3PMXA 4PETA 3PMVA 3TTLA 1JETA 1USYH 2I3VA 1JQFA 2Z8DA 3B6WA 2DE4A 4TLLB 3RTFB 2RCAA 1P1WA 3FJGA 2P1SA 2P2AA 4XKPA 5CMMA 5H8QA 3FD3A 4OWDA 1LB9A 5CI5A 3KEIA 4X9TA 2Q2CA 1NNTA 3QSLA 3K6XA 1AOVA 2H25A 3FV1A 3Q26A 4HCYA 3I6VA 4XTCQ 3B6QA 2F78A 2OJTA 2R6GE 1ELJA 3PU5A 3V8XB 4E0WA 3DP4A 4KHZE 1R1NA 1LFHA 5JTYB 3V5AA 3ZKKA 3KGCA 4BDQA 2M8CA 3QUJA 2F34A 1N3WA 2UVHA 3OELA 4G68A 3Q29A 4LQ2A 4LZ5A 3S4UA 3MW0A 1MQHA 4OTEA 1LAGE 3OMBA 4QSDA 1SI1A 2XXVA 2XD2A 3SETA 1VE4A 3RTWB 3DM0A 3LR1A 1LBCA 1SW1A 3KOSA 1B46A 4LATA 3TODA 3KN8A 1B2HA 1R6ZA 2Z23A 1B32A 4JDFA 4ONYA 4OFJA 3UN6A 3CR9A 2XX8A 4NF4A 4ZEFA 2NWJA 1MY4A 3GBBA 1PDAA 4P0GA 1IXCA 1EU8A 2QRYA 3H03A 5H8NA 3PMWA 1FCKA 3TDJA 2GRVA 3PPOA 1N0TA 1B3FA 2O7UA 3EPEA 5M2VA 1HSEA 3MWBA 2I48A 3OSQA 2I0BA 5L9MA 3RN8A 1FTOA 3VE1B 5CM6A 5ELVA 1M5FA 1MH3A 2AL4A 4ZDMA 3LSWA 4ZEBA 5EHSA 2QSXA 1DOTA 2DSFA 2UVIA 2VD2A 2XXYA 3TTRA 1H3DA 2AIXA 1DPPA 4GL0A 1DTGA 2Z8EA 4XKRA 4F3BA 2RKMA 3UA8A 5H8HA 5TPAA 2HXWA 4XIGQ 2ZNSA 1B4ZA 2X7PA 1AL3A 3ZKLA 1YAEA 1B0LA 1MQDA 4FECA 1RYOA 1SQYA 4DZ1A 2DVCA 1TWYA 4NF6A 1YPNA 2G29A 3O2AA 1B40A 1DMBA 4NF6B 1MPCA 3N6UA 5ICTA 2XX7A 3TCFA 5J1DA 3OENA 5DEXA 2DWHA 5JK4A 4M4GA 2Q88A 3MBPA 1B05A 2E1SA 1AMFA 3KOTA 1P1OA 1D9VA 2O69A 4RNSA 5EHMA 1MY2A 4X1BA 3IOWA 3FASA 1B52A 2A5SA 1ZBMA 3IO4A 3L6GA 4HTGA 3SEXA 1Q1KA 3CFXA 3T93B 3B6TA 3U1OA 3S9NC 5AE4A 4DXBA 1NH7A 1SVXB 1ATGA 2F36A 3K6VA 2V3TA 3KZGA 3L6HA 3N5LA 1H76A 1B9JA 3SEWA 4EXLA 1SBPA 5DYHA 3MZ1A 4QFPA 4QF9A 4ZS9A 4U4XA 1D4NA 1D3KA 2DS9A 4OERA 4QFOA 3DELB 3K01A 4FIMA 4IY5A 1ZLQA 4IB2A 2Y7RA 4KR5A 4OFOA 4QFLA 1A8EA 4U1ZA 5I59B 2F6PA 1O7TA 4H67A 4KYSA 4ECFA 1I6BA 2B3BA 2F8DA 2I4CA 1HSLA 4UACA 1XOCA 1OLAA 1Y9UA 2GFEA 3HO7A 4G8MA 3E4RA 4H6DA 1XS5A 2HCAA 3K1MA 1KWHA 3H06B 1Y3NA 4I62A 3IOTA 2DE2A 2G93A 4WEDA 3CFZA 2X26A 4JSDA 4U21A 2R71A 4THIA 5DVFA 1B3EA 3E3KA 4WXJA 2P0SA 5KDTB 1FTMA 3ILTB 1LAXA 4ZEKA 4RK9A 4DCXA 1JNFA 2XXUA 3IB1A 3GBAA 1Y1MA 1BTJA 3VLVA 4JXIA 3ZS6A 1OVTA 3FZVA 1Y3PA 4G8HA 4ZZEA 1NH8A 1MS7A 1Z7NE 4YICA 2R9JA 4OESA 4QFKA 3SDFA 1LSTA 3GZGA 2PT2A 4NWCA 4RPNA 4PFYA 4E0XA 4NWDA 3H6WA 4KPTA 2D3IA 3HN0A 2DYXA 2HFBA 3C36A 1ANFA 3MVXA 4G2ZA 4R6YA 4EUOA 3OEMA 1A54A 4GVOA 5EYFA 3QK6A 3C34A 1TT1A 3DLNA 1MY0A 3PV0E 2HAVA 1I6AA 1MXUA 3BKIB 3OXNA 4ESXA 5CC2A 3Q25A 3W9VA 1MXXA 3SEVA 3SEUA 5A5XB 4QHQA 1JW5A 2DWAA 3BFUA 3MC2A 4TQUQ 3SEYA 2DXYA 3CSBA 3U92A 5K2YA 1JVYA 3SKPA 1PB8A 1B5HA 1M5BA 3ZSFA 2OWSA 4HCWA 1EZOA 4GOTA 2F5XA 4P11A 4OETA 3TKDA 3MVZA 4F3SA 1BP5A 1QVSA 2UYFA 3OSRA 3PUWE 1MDQA 1USYE 2ZYMA 3RGYA 1S9TA 2I58A 3CSGA 1LB8A 2A5TA 3QIMA 5H8FB 1H45A 3TPAA 3TQLA 5FTHA 4ZEIA 4G8NA 1IUDA 3RNNA 4F2OA 4X48A 1FQAA 4EF1A 2B3FA 1NNFA 1B3LA 1QKBA 4JWXA 3EHTA 4KD5A 5CMBA 3TYHA 1A40A 1MG1A 1SD3A 2H9BA 2UXAA 1QULA 2YJPA 3C35A 3H6VA 1FTLA 3IOUA 3M8UA 3K4UA 4ZEDA 1NKXA 5I58A 1B58A 2RC9A 3PPNA 3B7DA 3PUVE 1IQ7A 4OHNA 4RXLA 3C31A 5I58B 1RYXA 4N6PA 1N04A 1SYIA 3ECRA 4JWOA 3T9VA 3JV9A 1SW2A 2I4BA 1LBBA 1MM7A 2QL3A 1QUJA 3CG3A 1IZ1A 2H4IA 4H1XA 4Q30B 1IXGA 3MVWA 5L9OA 1O63A 3FUZA 5TU0A 4GL8A 4KFQA 3FIRA 3O28A 3T66A 1H44A 4MLVA 1YTVA 4JBZA 4OQOA 3VXCA 2FNCA 3FV2A 1DSNA 1SDXA 4Z7EA 5L9SA 5B7DA 3MP6A 5L8DA 3TTMA 5AA2A 1S7YA 4BLAA 5I84A 2QMWA 4O3AA 4GXAA 2FYIA 1II5A 2ONSA 2XXWA 4I1DA 1LAHE 3RT8A 2O6AA 1A55A 1ZU0A 5BWJA 4H5FA 4MFIA 3R7XA 1B7UA 3K0VA 4GF8A 3H3GA 4OVJA 1LCFA 2Q9TA 3EHSA 4G68B 4PE5B 3T22A 4KYDA 2XXQA 3BFTA 4PP0A 3MJNA 1MXZA 2BJJX 4F39A 1OLCA 4YKJA 3FXRA 3PUXE 5HPQA 5DEXB 1FQEA 3O97A 4DCYA 1NNPA 4GLIA 4FE8A 2XD3A 1H43A 2PX1A 2QJEA 1B5IA 4LA9A 1UQWA 4POWA 1IXHA 2I0CA 4NF4B 2F35A 3CG1A 3M3KA 4R6HA 4IGTA 4R6KA 2Q2AA 1AIVA 4PFUA 1QKAA 4R2FA 2DP8A 1UTBA 2RCBA 4H5GA 3HV1A 2DWIA 1P99A 3MVYA 1MM6A 3U93A 2XXPA 1XVXA 1QUKA 4KYEA 4EQ9A 3LSFB 4O3CA 4OYVA 2F7BA 5HM4B 3MPLA 4LUBA 3TMGA 1Q35A 3EHUA 5I57B 2ESNA 3G3FA 1P1QA 4I8CA 3CFLA 3S9LC 3FVNA 2ONKE 3DP8A 4ELOA 4FATA 4F31B 1GGGA 3MUQA 2XXIA 4NF8A 4G68C 3VLWA 2OCUA 4WEPA 4DE8A 3G3HA 4IO5A 4YB5A 5F1QA 2VP1A 4NMYA 2DQVA 5H8HB 1IIWA 2W7YA 3VXBA 1A99A 3FGSA 3FVKA 3VVDA 2RF1A 4FAJA 3EF7A 3QAXA 1UIUA 3HPIA 3THIA 3KN3A 4UA8A 3I3VA 1VSOA 4C1TA 2PVUA 4BDRA 3KFMA 3LSLA 3N26A 2OZZA 1B7ZA 4MF3A 4DIGA 3R6UA 2OWTA 4F18A 5KDTA 3TCGA 1YCJA 2ONRA 4F1VA 4MLQA 3KBRA 5IAIA 5ICQA 4NF5B 2O7IA 2NXOA 4TOZA 5F7VA 3G3JA 1EZ9A 1GTKA 4YMAA 1HSJA 1POY1 1IXIA 2DWJA 3PUZE 2QS2A 3K6UA 3CIJA 3OO8A 2GHBA 4XXUA 3RY3A 2HAUA 3UGWA 4F3PA 3U8QA 1Y1ZA 1MPDA 1OQGA 2Q89A 4KCCA 5I2NB 2GHAA 3IX1A 4POXA 2RC8A 5CMCA 4F2QA 1XVYA 4G4PA 2ZNUA 4U1OA 1B0HA 3RPWA 3LUYA 1NMUA 4F22A 1OVBA 4YAHX 1P1NA 3H7MA 3R26A 1WODA 1SW4A 3MZBA 3VDFA 3VVFA 4U4SA 1SI0A 1WDNA 3QXMA 1B7HA 1CE2A 5AA4B 3PPPA 3K6WA 2AL5A 2VOZA 3TTKA 4U23A 4H8IA 1T0KA 3O29A 3OO9A 1WVJA 3Q27A 3FXQA 4JB7A 4G77A 4LVQA 4EQBA 3OOAA 5I57A 4EF2A 3T9XB 3C4MA 4PFWA 3K02A 1BLFA 4YB6A 5I2KB 2XX9A 1MY1A 4O3BA 5I59A 2XXXA 3IB2A 4RA1A 1XT8A 5LOMA 5BUUA 1F9BA 2HQ0A 1UTHA 5DVIA 1PB9A 2ABHA 1PBQA 3IL1B 4DDDA 5AA4A 3T96B 3IAZA 4F1UA 3IK6B 2Y7PA 1ZTYA 3PD9A 4RPOA 1PC3A 1Y4CA 4QRZA 4GIZA 1B3GA 3SERA 5KCJA 1R9LA 3FATA 1XC1A 3K1NA 3IR1A 3M3LA 1B3HA 4P0IA 3G7WA 2O51A 1O64A 4RY1A 3RUMA 4F1YA 2A5TB 3FXUA 2VGQA 5H8FA 1TXFA 3LBSA 4N13A 4IO3A 4QSEA 4YKPA 2H5YA 1JEUA 3MP1A 2V3UA 2I3WA 4LZ8A 4Q0CA 3T9UA 1NL5A 2IA4A 4R74A 3FJMA 5I2NA 5ITPA 1FTJA 3UP9A 1MH4A 4WKMA 3PPRA 2REJA 3JYRA 2QPQA 2F7AA 4MBPA 2WKYA 1D9YA 3CVGA 3MAMA 4F19A 1XHYA 5ISUA 2B65A 1QW0A 1B4HA 2XXTA 3BBRA 1OIBA 4TLMB 4GQOA 2ZNTA 4R9GA 3S9EA 2OLBA 2HZKA 2XXRA 3C33A 4JSOA 4OEUA 5AA1A 4AB6A 1SW5A 2QS4A 3OEKA 4YMBA 2DE3A 3FVGA 5TP9B 3RLFE 4AB5A 5AA2D 2UVJA 1B1XA 2ZXTA 1S50A 4I9DA 3KSXA 3T9HB 5CMKA 5I2KA 3KN7A 5DT6A 2NVUB 4ELPA 1CB6A 3CRBA 3IB0A 3G3GA 1LLSA 2ZYKA 3H4ZA 4C0RA 3TFLA 2Z22A 4NTLA 2PBWA 4DXCA 3LC8A 1Y4TA 3MZ9A 1EZPA 2KLFA 3A3CA 5JEIA 1BIYA 2X7QA 2RC7A 3TTNA 1ZMGA 3WAFA 1M5CA 3KSJA 3PPQA 4BDOA 1BKAA 4LONB 4C1UA 4DLDA 5AA2B 3S9MC 5KCJB 1SYHA 5AA3A 3LSXA 5CRYA 2F97A 4BDNA 3H6TA 3D4CA 1OQHA 3C9HA 4ZECA 4YKIA 2H98A 2ZYOA 3JZJA 1N3XA 2H99A 5JTYA 4GXSB 3IO6A 2QMXA 1JEVA 3PGFA 4IO7A 3VFJA 1M5EA 2IEEA 2Q8JA 4ELRA 5H8SA 3HHFA 1J1NA 1NNKA 4H0WA 3U72A 4X1DA 1P1UA 4OFLA 3UIFA 5KZTA 1MQIA 2ANJA 4RYAA 4AQ4A 5CBSA 3HSTA 1PBPA 4H65A 3MPKA 3EQ1A 3O6HA 1N76A 3QUFA 4XKQA 1LGBC 3I5OA 3VLUA 3H6UA 3MP8A 4IGRA 4MH5A 1OMPA 1URDA 4R73A 1JVXA 2Y84A 3QYTA 3PD8A 4NEDA 3HCQA 3IORA 4LZ7A 4U2RA 3ODBA 5CBRA 3O6IA 1POTA 3OO7A 1NFTA 4JWYA 5I56A 3F11A 1MDP1 5I56B 3UK4A 4Q5TA 1JW4A 3MQ9A 4OXVA 1Z7ME 1ZJLA 4FORA 4LP2B 1B5JA 3KG2A 4YKKA 2PYYA 4QSCA 5HBCA 4F3GA 4YZZA 3U94A 4NF8B 4HW8A 2Z8FA 3D4GA 3TUSA 3VV5A 1B51A 2DOJA 2NUVA 3OO6A 4EXKA 2FA7A 1JW1A 3FJ7A 3RQTA 4F29A 5TPAB 1Y20A 1FQFA 3C32A 1MQJA 3K00A 4RJZA 3S2VA 2UYEA 2REGA 4GRKA 4IO2A 4H8JA 1MRPA 1N7WA 4IY6A 4K3FA 1B6HA 1LCTA 4KQPA 3SESA 3E9XA 3UORA 2I6EA 1Y3QA 5ITOA 1MXVA 4EDPA 1A8FA 1FQDA 1QJMA 4R75A 2OK2A 4KCDA 4U22A 3TEPA 3EN3A 1N7XA 4NF5A 4OMBA 1LAFE 2GH9A 1FQCA 3N6TA 2DVZA 4FEBA 3USDA 1QUIA 3V89B 5FHNA 4GD5A 5DVJA 4RK2A 1B1HA 2UVGA 3TCHA 4PFTA 2XHDA 3PUYE 3DP6A 1UTBB 4QFNA 4ESWA 4ZE9A 5FHMA 2VHAA 4IO4A 3GLBA 1FTKA 2DXRA 3N94A 1DTZA 4OZ9A 1MPBA 1IEJA 3A3UA 4OEVA 3AXFA 2O1LA 1URSA 2D21A 2NOOA 4N07A 2ZMBA 1DPEA 1US4A 2V3QA 2O68A 4LQ5A 3M3FA 4XKNA 4PQJA 1MY3A 3VVEA 2YPNA 2I49A 2LAOA 4Z0IA 3G3KA 1GV8A 5B70A 5IKBA 1MQGA 1RKMA 3W9WA 4BDLA 1UIVA 3RT6B 3TAJA 4ZZAA 2XXHA 1UTHB 1URGA 2V25A 4YU0A 3HHGA 5A5XA 1ZIUA 1FW0A 3ONMA 5K2XA 5DTBA 2HEUA 2THIA 5H8QB 1TFAA 2O1MA 2PMSA 2HZLA 3IOVA 3K2DA 4R9FA 3TELA 4NE4A 2CMOA 2AYSA 2QS3A 3GXAA 3Q28A 3WAEA 1N84A 4ISUA 3P7IA 3G3IA
chains in the Genus database with same CATH superfamily
2D5WA 2F7CA 4HS7A 4BDMA 3FVOA 5FHOA 3ILUB 1AH5A 4MNIA 1LFGA 3UP9A 2Y7KA 4O3AA 3O9PA 2ZYNA 1VR5A 4NX1A 5I5PA 3O6GA 4GFRA 4IO6A 1MXYA 4DXUA 4GWOA 3IJXB 3CI8A 5H8NB 1A7LA 1FQBA 2KR0A 3PMXA 3TTLA 1JETA 2I3VA 4BDLA 4N15A 2RCAA 4XKPA 4I40A 1LB9A 5CI5A 3RPLA 3K6XA 2JJKA 2F78A 3PU5A 1VDWA 3QUJA 1N3WA 3S4UA 3MW0A 1LBCA 3FXBA 3KOSA 1B46A 4LATA 4ONYA 1B32A 3UN6A 4OFJA 1FBDA 1MY4A 4P0GA 3PMWA 2WYPA 3EPEA 5T3JA 5CM6A 1FTOA 1MH3A 2AL4A 5ET7A 2QSXA 2XXYA 1FBEA 2AIXA 1DPPA 1DTGA 4F3BA 1IMBA 4X8RA 5TPAA 2ZNSA 3ZKLA 1TWYA 1DMBA 4NF6B 3OENA 5IGAA 5JK4A 2PFYA 1B05A 3KOTA 1P1OA 3FASA 2A5SA 1ZBMA 3IO4A 1Q1KA 3CFXA 4JVIA 4EXLA 4IR8A 5DYHA 3MZ1A 1D4NA 1D3KA 2Y5LA 4OERA 4IY5A 2Y7RA 1A8EA 2F6PA 4H67A 4UACA 4H6DA 1XOCA 2GFEA 2HCAA 2FIXA 4WEDA 1FPFA 2X26A 4JSDA 4THIA 1B3EA 2P0SA 4ZEKA 5EQ8A 4XFEA 1BTJA 1FPJA 1MS7A 4H45A 2R9JA 4PFRA 2PT2A 2D3IA 1A54A 4GVOA 5EYFA 3BKIB 2R8TA 1JP4A 4N4UA 4QHQA 1JW5A 3BFUA 3MC2A 3SEYA 1AWBA 5FBPA 1B5HA 1M5BA 2QFLA 3NOHA 3TQLA 2Y5KA 4G8NA 1IUDA 1B3LA 4JWXA 5CMBA 3EHTA 1SD3A 3H6VA 3C35A 3B7DA 3PUVE 3C31A 3JV9A 4OA4A 4H1XA 3MVWA 4HXVA 4GL8A 4MLVA 1YTVA 5B7DA 2FYIA 1ZU0A 3R7XA 1FTAA 2F3BA 4GF8A 3H3GA 1EYIA 4G68B 4KYDA 3BFTA 4PF6A 4YKJA 3O97A 4GLIA 1AIVA 2Q2AA 4PFUA 4R2FA 1UTBA 4H5GA 4NF0A 4EQ9A 3MPLA 4X04A 3S9LC 4O8MA 3CFLA 5IM2A 5EYGA 3DP8A 3QMFA 4MHFA 2OCUA 1NV3A 4IO5A 3VXBA 3FVKA 3VVDA 2RF1A 3EF7A 4UA8A 3I3VA 4I3YA 4C1TA 2PVUA 4BDRA 3N26A 3LSLA 4DIGA 2OWTA 1NV6A 3TCGA 3KBRA 2O7IA 4PAFA 2DWJA 3RY3A 2QS2A 3UGWA 3OO8A 4F3PA 1OQGA 5I2NB 4POXA 2RC8A 4F2QA 3D1RA 1OVBA 3R26A 3K6WA 4U23A 4LVQA 4G77A 3OOAA 4EF2A 4FBPA 3T9XB 4YB6A 1BLFA 2XXXA 3SZPA 1F9BA 4GBVA 4GWXA 1PB9A 1PBQA 4DDDA 4F1UA 1DCUA 2Y7PA 4RPOA 1PC3A 4GIZA 1B3GA 3SERA 1XC1A 2GQ1A 4P0IA 1B3HA 3RUMA 4PCDA 4IO3A 2FIEA 4QSEA 2H5YA 4Q0CA 2IA4A 3FJMA 3LV0A 4WKMA 2REJA 3JYRA 4MBPA 1D9YA 3CVGA 4NHBA 1QW0A 3ROJA 5AA1A 3OEKA 1FPBA 4I9DA 3T9HB 3HFUA 3KN7A 4ELPA 3CRBA 1EZPA 2PBWA 1IMDA 3LC8A 1QGXA 3KSJA 1BKAA 4LONB 4DLDA 4PBHA 4BDNA 3D4CA 2H99A 3IO6A 4IO7A 1NV7A 1M5EA 2IEEA 2Q8JA 5H8SA 4H0WA 4OFLA 5KZTA 2ANJA 1PBPA 3QUFA 3I5OA 4IGRA 1OMPA 1NUYA 2Y84A 4MJOA 3IORA 2ZZWA 1POTA 3OO7A 1FJ6A 1JW4A 4PDHA 4FORA 3KG2A 1YZ0A 4HW8A 3TUSA 3VV5A 2NUVA 2FA7A 4F29A 4JVCA 1FQFA 3C32A 2UYEA 4IY6A 1MRPA 1B6HA 3E9XA 5ITOA 2OK2A 4KCDA 4NF5A 3N6TA 2F3DA 5DVJA 1B1HA 2UVGA 4QFNA 4ZE9A 1D9QA 1IMEA 4IO4A 1MPBA 1URSA 1DPEA 2O68A 4XKNA 4PQJA 2I49A 3W9WA 1ZIUA 1FW0A 5DTBA 2MKZA 4E0XA 4LN5A 2CMOA 2AYSA 4ISUA 5M2VA 3A09A 2OX3A 2OBGA 3CHGA 2Y7WA 4L17A 3TKDA 1I6QA 4ELQA 2F6GA 2XWVA 2V93A 1FSAA 1I69A 2QS1A 3OD7A 2RINA 1FPDA 4OENA 3KJTA 4ND9A 4EQ7A 1BK4A 2V84A 3PMVA 2Z8DA 3B6WA 1JQFA 2DE4A 1P1WA 2P1SA 1FJ9A 2Q2CA 1NNTA 3QSLA 1AOVA 1YXIA 2OJTA 2B4LA 5JTYB 3OELA 4G68A 1EYKA 2XXVA 2XD2A 1VE4A 3RTWB 3KN8A 2Z23A 3GBBA 1PDAA 1EU8A 3TDJA 3H03A 5H8NA 4HE0A 3PPOA 1B3FA 3MWBA 4HE1A 5L9MA 5ELVA 1M5FA 3LSWA 4ZEBA 2DSFA 1H3DA 2RKMA 3UA8A 4XIGQ 2XXKA 5EQAA 4QBAA 1RYOA 5IZZA 2CZIA 2G29A 3O2AA 1MPCA 2FVZA 2DWHA 4PE3A 2CEXA 2O69A 4RNSA 4X1BA 1B52A 3SEXA 4DXBA 1NH7A 1ATGA 2V3TA 3SEWA 1RDYA 3FBPA 4U4XA 2DS9A 4XF5A 4QFOA 3K01A 4FIMA 2B3BA 1OLAA 3HO7A 5DW8A 4H46A 3H06B 2G93A 2R71A 5DVFA 3ILTB 2XXUA 3GBAA 1NV5A 1Y1MA 3ZS6A 1Y3PA 4G8HA 4ZZEA 1Z7NE 4QFKA 4DI4B 4N17A 3SDFA 3GZGA 4NWDA 3H6WA 4KPTA 3MVXA 4G2ZA 3C34A 1TT1A 3DLNA 2HAVA 1MXUA 5CC2A 3W9VA 1MXXA 3E79A 1JVYA 1PB8A 3ZSFA 4HCWA 4GOTA 4P11A 3MVZA 1BP5A 1LB8A 5H8FB 3B8BA 1G0IA 5FTHA 4X48A 1FQAA 4EF1A 1NUWA 4NGUA 2YJPA 2H9BA 4DE8A 2UXAA 3IOUA 1NKXA 5I58A 2RC9A 3PPNA 5I58B 1RYXA 2QVRA 4JWOA 1SW2A 2I4BA 1LBBA 1MM7A 2H4IA 4Q30B 1IXGA 2B4MA 3FIRA 4JBZA 4Z7EA 5AA2A 1S7YA 2ONSA 2O6AA 2FHYA 5BWJA 4H5FA 4MFIA 4OVJA 1FBCA 2XXQA 4PP0A 1MXZA 2BJJX 4F39A 3PUXE 4AS4A 1NNPA 2XD3A 1LBXA 1B5IA 4LA9A 1UQWA 1IXHA 4NF4B 3M3KA 3CG1A 4IGTA 3KC1A 2DP8A 4MNPA 3MVYA 1QUKA 4O3CA 2F7BA 3TMGA 3G3FA 4I8CA 3FVNA 3VLWA 3G3HA 5F1QA 2VP1A 2W7YA 3QAXA 1UIUA 4G61A 3THIA 3KN3A 3BIGA 1B7ZA 4MMPA 1NUZA 5IAIA 1DK4A 1GTKA 4MAGA 4XXUA 2GHBA 5CMCA 2ZNUA 4U1OA 1B0HA 5I7IA 1WODA 1SW4A 3VVFA 5AE4A 4U4SA 4OVRA 1CE2A 2VOZA 1T0KA 5I3SA 3Q27A 2QVVA 4PBQA 3K02A 4O3BA 1XT8A 2PFZA 1FRPA 1UTHA 3IL1B 3T96B 3IAZA 1ZTYA 1NV4A 5KCJA 1R9LA 3FATA 3M3LA 3G7WA 1O64A 4F1YA 2A5TB 3FXUA 2VGQA 1TXFA 3LBSA 1JEUA 2I3WA 2P3VA 5I2NA 5ITPA 1FTJA 1MH4A 4F19A 2QPQA 2WKYA 2B65A 1B4HA 2XXTA 4GQOA 4R9GA 4AB6A 4JSOA 2VT5A 2QS4A 1LBWA 2DE3A 5TP9B 3RLFE 5I57B 2ZXTA 5CMKA 3KSXA 2PCRA 1YYZA 3H4ZA 3TFLA 3T1BA 5JEIA 2RC7A 3TTNA 1ZMGA 3WAFA 1SYHA 3LSXA 2F97A 1OQHA 4YKIA 2H98A 2ZYOA 1SPIA 4PC9A 2VPNA 3U72A 1J1NA 4X1DA 2WBBA 2Q8MA 3UIFA 4AQ4A 3MPKA 3EQ1A 1N76A 3H6UA 4MH5A 1FPLA 2HPGA 1URDA 3PD8A 4U2RA 1MDP1 1Z7ME 2PYYA 4QSCA 4NF8B 3D4GA 1B51A 1K9ZA 3OO6A 3RQTA 1Y20A 4P3LA 3S2VA 4IO2A 4KQPA 1LCTA 3IFAA 3UORA 1FBFA 1Y3QA 1MXVA 1A8FA 1QJMA 4U22A 3TEPA 1NV0A 2DVZA 1QUIA 3U65A 5FHNA 1G0HA 4RK2A 3TCHA 2XHDA 1UTBB 4PF8A 3N94A 4OZ9A 4GWSA 3A3UA 4OEVA 3AXFA 2O1LA 2NOOA 2D21A 2ZMBA 2V3QA 3M3FA 2YPNA 4Z0IA 3G3KA 1GV8A 5B70A 1UIVA 4NN3A 3RT6B 3TAJA 2XXHA 4PGNA 3HHGA 3ONMA 2XA5A 3TELA 4NAPA 4R9FA 2QS3A 4GWWA 4ELRA 2Y7IA 4UABA 1VFDA 2PT1A 1ZKBA 3KJ7A 1R9QA 1PEBA 1PB7A 1VFEA 1GVCA 1EH3A 2CZLA 1US5A 5FTIA 3TQWA 5TP9A 1L5TA 4YB7A 4KXPA 3V83A 2E0SA 4N8YA 3FJGA 5H8QA 4OWDA 4GX4A 4X9TA 2WYKA 2P3NA 3B6QA 3B50A 1ELJA 4QXDA 3V8XB 3DP4A 1EYJA 1R1NA 3V5AA 3ZKKA 4BDQA 2UVHA 4LZ5A 1MQHA 4OTEA 3OMBA 4QSDA 1SI1A 3LR1A 3TODA 1B2HA 1R6ZA 4JDFA 3CR9A 2XX8A 4NF4A 4ZEFA 2NWJA 1IXCA 1FCKA 1N0TA 2O7UA 1HSEA 3OSQA 2I0BA 3RN8A 4O94A 3VE1B 4GWUA 4ZDMA 1DOTA 4XKRA 4GL0A 2Z8EA 1FPIA 1FBHA 2HXWA 1B4ZA 4N6KA 1YAEA 1B0LA 1MQDA 4FECA 1SQYA 1IMFA 4NF6A 1YPNA 1B40A 4OVQA 1KZ8A 5DEXA 3MBPA 2E1SA 4N91A 1D9VA 5EHMA 1XI6A 4HTGA 4OVTA 3T93B 1SVXB 2F36A 3N5LA 3KZGA 2ZZXA 2DDKA 4QFPA 3DELB 5I59B 1O7TA 4KYSA 2F8DA 3LUZA 1Y9UA 3E4RA 3K1MA 1KWHA 3MYUA 4PFIA 2DE2A 3E3KA 4WXJA 1FTMA 1LAXA 4RK9A 4DCXA 1FBGA 3VLVA 1NH8A 1IMAA 1LSTA 2DYXA 4EUOA 3OEMA 3QK6A 3OXNA 3PTYA 3SEVA 2DWAA 4TQUQ 2DXYA 2XWIA 3U92A 3SKPA 2F5XA 4F3SA 3OSRA 3PUWE 1MDQA 1USYE 1S9TA 1FPEA 1H45A 4F2OA 2B3FA 1A40A 1MG1A 1QULA 3M8UA 1IQ7A 4OHNA 4RXLA 4N6PA 1SYIA 3T9VA 4EXKA 3CG3A 1IZ1A 3FUZA 5TU0A 4KFQA 3O28A 3FV2A 1DSNA 1SDXA 5L8DA 3TTMA 4BLAA 2QMWA 1LAHE 3RT8A 3K0VA 2Q9TA 3MJNA 2QVUA 1OLCA 3FXRA 5DEXB 1FQEA 4DCYA 2QJEA 1RDZA 2ZZVA 3T0JA 2L5VA 4R6KA 5ESYA 5EYHA 4DI3D 1FPKA 2RCBA 3HV1A 2DWIA 1P99A 3U93A 2XXPA 1XVXA 4KYEA 3LSFB 2CZHA 1P1QA 2ONKE 4F31B 2XXIA 5F24A 4G68C 4MCOA 4YB5A 5H8HB 4NMYA 2DQVA 1IIWA 1A99A 3FGSA 4FAJA 3KFMA 2OZZA 2BJIA 3R6UA 4GX3A 4MLQA 1NV2A 4NF5B 4TOZA 4N81A 1EZ9A 1HSJA 1POY1 2Q74A 3CIJA 3K6UA 2HAUA 3U8QA 1Y1ZA 2XWKA 4KCCA 2GHAA 3IX1A 2WEFA 1XVYA 4OVPA 3RPWA 3LUYA 1NMUA 5LTCA 4YAHX 3H7MA 3VDFA 3MZBA 1WDNA 3QXMA 1B7HA 3PPPA 3TTKA 3OO9A 3FXQA 5I57A 4PFWA 1MY1A 4RA1A 4PDDA 2HQ0A 5DVIA 2ABHA 5AA4A 1DBZA 1RDXA 4QRZA 4LZ8A 1NL5A 3PPRA 3MAMA 3E78A 3BBRA 1OIBA 5IZ3A 4OEUA 2XXRA 3C33A 1SW5A 4YMBA 4AB5A 1B1XA 1S50A 5I2KA 5DT6A 2NVUB 3IB0A 3G3GA 4NTLA 4DXCA 1Y4TA 2KLFA 2V4CA 1M5CA 4BDOA 4C1UA 3S9MC 5KCJB 3C9HA 1FPGA 3BIHA 3JZJA 1N3XA 5JTYA 4P1LA 3VFJA 2QMXA 1JEVA 3HHFA 1P1UA 3GYYA 4RYAA 5CBSA 3HSTA 1FBPA 3O6HA 1LGBC 3VLUA 3QYTA 4NEDA 5CBRA 3ODBA 4JWYA 1NFTA 4Q5TA 3MQ9A 4OXVA 1ZJLA 3KC0A 4YKKA 5IZ1A 3U94A 4MEVA 4P8BA 2Z8FA 2DOJA 1JW1A 3FJ7A 3RYDA 2FBPA 3SESA 2WX9A 4EDPA 4P56A 4R75A 3EN3A 1N7XA 4OMBA 2HHMA 1LAFE 2GH9A 4HE2A 4GD5A 4PFTA 3DP6A 3GLBA 1FTKA 1IEJA 4AS5A 4MIJA 4LQ5A 4MX6A 2LAOA 5IKBA 4ZZAA 1URGA 2V25A 5K2XA 2HEUA 5H8QB 2THIA 4N8GA 2O1MA 3K2DA 5AA4B 4NE4A 3Q28A 1N84A 3P7IA 4GX6A 1GR2A 5EQ9A 1IITA 2VD3A 4Q8RA 4FJPA 3O66A 5HM4B 4FEDA 1INPA 4M1VA 1LFIA 3IJOB 1TFDA 1M5DA 3K1PA 3E13X 3TZAA 2O84X 4ZE8A 2ALUA 2YLNA 1MXWA 5ET6A 3W15C 4R72A 4KI0E 4R2BA 4PETA 1USYH 4TLLB 3RTFB 5CMMA 2P2AA 4GBWA 3FD3A 3KEIA 2H25A 3FV1A 3Q26A 4HCYA 3I6VA 4XTCQ 2R6GE 4E0WA 4KHZE 1LFHA 3KGCA 2M8CA 2F34A 4LQ2A 3Q29A 5EQ7A 4PFBA 1LAGE 3SETA 4OANA 3DM0A 1SW1A 2QRYA 2GRVA 2I48A 5EHSA 2VPOA 2UVIA 2VD2A 3TTRA 5H8HA 4JVDA 3MSTA 2X7PA 1AL3A 4DZ1A 2DVCA 5J1DA 3N6UA 2XX7A 3TCFA 4M4GA 2Q88A 5J16A 1AMFA 4P1EA 1MY2A 3IOWA 3L6GA 3B6TA 3U1OA 3S9NC 3K6VA 3L6HA 1H76A 1B9JA 1SBPA 4OVSA 4QF9A 4ZS9A 2HXRA 1ZLQA 4IB2A 4KR5A 4OFOA 4QFLA 4U1ZA 4ECFA 1I6BA 2I4CA 1HSLA 4G8MA 2CZKA 1XS5A 1Y3NA 4I62A 3IOTA 3CFZA 4U21A 5KDTB 1JNFA 3IB1A 4JXIA 1OVTA 3FZVA 5LDZA 4YICA 1NUXA 4OESA 4NWCA 4RPNA 4PFYA 4N6DA 3HN0A 5AA3A 3C36A 1ANFA 4R6YA 4GWYA 1MY0A 3PV0E 1I6AA 3Q25A 5A5XB 3SEUA 3CSBA 5A5LA 5K2YA 4PAKA 2OWSA 1EZOA 4OETA 1QVSA 2UYFA 3RGYA 2ZYMA 2I58A 3CSGA 2A5TA 3QIMA 3TPAA 4ZEIA 3RNNA 4NQ8A 4XEQA 1NNFA 1QKBA 3TYHA 4KD5A 4GRKA 4ZEDA 1FTLA 3K4UA 1B58A 1N04A 3ECRA 2QL3A 1QUJA 1KA0A 5L9OA 1O63A 3T66A 1H44A 4OQOA 3VXCA 4I3EA 2FNCA 3RPLB 5L9SA 4O7MA 3MP6A 5I84A 1NV1A 4GXAA 1II5A 2XXWA 2CEYA 4I1DA 1A55A 1B7UA 1LCFA 3EHSA 1LEVA 4PE5B 3T22A 5HPQA 4NG7A 4FE8A 1H43A 2PX1A 4POWA 2I0CA 2F35A 4R6HA 1KA1A 1QKAA 2KQZA 1MM6A 1IMCA 4OYVA 4LUBA 1Q35A 3EHUA 2ESNA 4ELOA 4FATA 1GGGA 3MUQA 4NF8A 4WEPA 4ESXA 1CNQA 4P9KA 3HPIA 1VSOA 4MF3A 4F18A 5KDTA 1YCJA 2ONRA 4F1VA 5ICQA 2NXOA 5F7VA 3G3JA 4YMAA 3PUZE 1IXIA 2Q89A 1MPDA 4G4PA 4F22A 1P1NA 1SI0A 5IZ3B 2AL5A 4H8IA 3O29A 1WVJA 4EQBA 4JB7A 4GWZA 3C4MA 5I2KB 1LBYA 2XX9A 5I59A 5LOMA 3IB2A 5BUUA 3KBZA 3IK6B 3PD9A 1Y4CA 3K1NA 3IR1A 2O51A 4RY1A 5H8FA 4N13A 4YKPA 3MP1A 2V3UA 3A29A 3T9UA 4R74A 2F7AA 5ISUA 1XHYA 4TLMB 3S9EA 2ZNTA 2OLBA 2HZKA 3FVGA 5AA2D 2UVJA 1CB6A 5ET8A 1LLSA 2ZYKA 1NI9A 4C0RA 2Z22A 3MZ9A 3A3CA 1BIYA 2X7QA 5ET5A 4PGPA 3PPQA 5AA2B 1Q9DA 5CRYA 3H6TA 4ZECA 4GXSB 3PGFA 1NNKA 1MQIA 4H65A 1K9YA 4XKQA 3MP8A 4R73A 1JVXA 3HCQA 4LZ7A 5I56A 3O6IA 3F11A 5I56B 3UK4A 4MNCA 4LP2B 1B5JA 4F3GA 5HBCA 4YZZA 4P47A 3EKIA 5TPAB 3K00A 1MQJA 4RJZA 2REGA 2OWZA 4H8JA 1N7WA 4K3FA 4PAIA 2I6EA 1FQDA 1FQCA 4FEBA 3V89B 3USDA 4ESWA 1LBVA 3PUYE 4PTKA 5FHMA 2VHAA 1LBZA 2DXRA 1DTZA 4N07A 3ISPA 1US4A 2XWOA 3IFCA 3VVEA 1MY3A 1MQGA 1RKMA 4O7IA 5A5XA 1UTHB 4YU0A 2WBDA 1TFAA 3IOVA 2PMSA 2HZLA 5ICTA 3GXAA 3WAEA 2HFBA 3G3IA
chains in the Genus database with same CATH topology
2D5WA 2Y7IA 2F7CA 4HS7A 3A09A 1GR2A 1VFDA 3FVOA 1IITA 4BDMA 5FHOA 2PT1A 2VD3A 2OBGA 3ILUB 1AH5A 4Q8RA 1ZKBA 3O66A 3KJ7A 1LFGA 1R9QA 2Y7WA 1PEBA 4FEDA 2Y7KA 4FJPA 4L17A 4M1VA 1LFIA 3O9PA 1PB7A 1I6QA 2ZYNA 1VFEA 3IJOB 1EH3A 1TFDA 1GVCA 2CZLA 4ELQA 1M5DA 1VR5A 2F6GA 3K1PA 3E13X 3TZAA 2V93A 2O84X 1I69A 4ZE8A 1US5A 5FTIA 2QS1A 3O6GA 4GFRA 2ALUA 3OD7A 4IO6A 3TQWA 1MXYA 4DXUA 4GWOA 2YLNA 1MXWA 5TP9A 1L5TA 4YB7A 2RINA 3IJXB 3W15C 3V83A 4R72A 3CI8A 4OENA 3KJTA 4ND9A 5H8NB 4EQ7A 1A7LA 2E0SA 4KI0E 1FQBA 2V84A 4R2BA 3PMXA 4PETA 3PMVA 3TTLA 1JETA 1USYH 2I3VA 1JQFA 2Z8DA 3B6WA 2DE4A 4TLLB 3RTFB 2RCAA 1P1WA 3FJGA 2P1SA 2P2AA 4XKPA 5CMMA 5H8QA 3FD3A 4OWDA 1LB9A 5CI5A 3KEIA 4X9TA 2Q2CA 1NNTA 3QSLA 3K6XA 1AOVA 2H25A 3FV1A 3Q26A 4HCYA 3I6VA 4XTCQ 3B6QA 2F78A 2OJTA 2R6GE 1ELJA 3PU5A 3V8XB 4E0WA 3DP4A 4KHZE 1R1NA 1LFHA 5JTYB 3V5AA 3ZKKA 3KGCA 4BDQA 2M8CA 3QUJA 2F34A 1N3WA 2UVHA 3OELA 4G68A 3Q29A 4LQ2A 4LZ5A 3S4UA 3MW0A 1MQHA 4OTEA 1LAGE 3OMBA 4QSDA 1SI1A 2XXVA 2XD2A 3SETA 1VE4A 3RTWB 3DM0A 3LR1A 1LBCA 1SW1A 3KOSA 1B46A 4LATA 3TODA 3KN8A 1B2HA 1R6ZA 2Z23A 1B32A 4JDFA 4ONYA 4OFJA 3UN6A 3CR9A 2XX8A 4NF4A 4ZEFA 2NWJA 1MY4A 3GBBA 1PDAA 4P0GA 1IXCA 1EU8A 2QRYA 3H03A 5H8NA 3PMWA 1FCKA 3TDJA 2GRVA 3PPOA 1N0TA 1B3FA 2O7UA 3EPEA 5M2VA 1HSEA 3MWBA 2I48A 3OSQA 2I0BA 5L9MA 3RN8A 1FTOA 3VE1B 5CM6A 5ELVA 1M5FA 1MH3A 2AL4A 4ZDMA 3LSWA 4ZEBA 5EHSA 2QSXA 1DOTA 2DSFA 2UVIA 2VD2A 2XXYA 3TTRA 1H3DA 2AIXA 1DPPA 4GL0A 1DTGA 2Z8EA 4XKRA 4F3BA 2RKMA 3UA8A 5H8HA 5TPAA 2HXWA 4XIGQ 2ZNSA 1B4ZA 2X7PA 1AL3A 3ZKLA 1YAEA 1B0LA 1MQDA 4FECA 1RYOA 1SQYA 4DZ1A 2DVCA 1TWYA 4NF6A 1YPNA 2G29A 3O2AA 1B40A 1DMBA 4NF6B 1MPCA 3N6UA 5ICTA 2XX7A 3TCFA 5J1DA 3OENA 5DEXA 2DWHA 5JK4A 4M4GA 2Q88A 3MBPA 1B05A 2E1SA 1AMFA 3KOTA 1P1OA 1D9VA 2O69A 4RNSA 5EHMA 1MY2A 4X1BA 3IOWA 3FASA 1B52A 2A5SA 1ZBMA 3IO4A 3L6GA 4HTGA 3SEXA 1Q1KA 3CFXA 3T93B 3B6TA 3U1OA 3S9NC 5AE4A 4DXBA 1NH7A 1SVXB 1ATGA 2F36A 3K6VA 2V3TA 3KZGA 3L6HA 3N5LA 1H76A 1B9JA 3SEWA 4EXLA 1SBPA 5DYHA 3MZ1A 4QFPA 4QF9A 4ZS9A 4U4XA 1D4NA 1D3KA 2DS9A 4OERA 4QFOA 3DELB 3K01A 4FIMA 4IY5A 1ZLQA 4IB2A 2Y7RA 4KR5A 4OFOA 4QFLA 1A8EA 4U1ZA 5I59B 2F6PA 1O7TA 4H67A 4KYSA 4ECFA 1I6BA 2B3BA 2F8DA 2I4CA 1HSLA 4UACA 1XOCA 1OLAA 1Y9UA 2GFEA 3HO7A 4G8MA 3E4RA 4H6DA 1XS5A 2HCAA 3K1MA 1KWHA 3H06B 1Y3NA 4I62A 3IOTA 2DE2A 2G93A 4WEDA 3CFZA 2X26A 4JSDA 4U21A 2R71A 4THIA 5DVFA 1B3EA 3E3KA 4WXJA 2P0SA 5KDTB 1FTMA 3ILTB 1LAXA 4ZEKA 4RK9A 4DCXA 1JNFA 2XXUA 3IB1A 3GBAA 1Y1MA 1BTJA 3VLVA 4JXIA 3ZS6A 1OVTA 3FZVA 1Y3PA 4G8HA 4ZZEA 1NH8A 1MS7A 1Z7NE 4YICA 2R9JA 4OESA 4QFKA 3SDFA 1LSTA 3GZGA 2PT2A 4NWCA 4RPNA 4PFYA 4E0XA 4NWDA 3H6WA 4KPTA 2D3IA 3HN0A 2DYXA 2HFBA 3C36A 1ANFA 3MVXA 4G2ZA 4R6YA 4EUOA 3OEMA 1A54A 4GVOA 5EYFA 3QK6A 3C34A 1TT1A 3DLNA 1MY0A 3PV0E 2HAVA 1I6AA 1MXUA 3BKIB 3OXNA 4ESXA 5CC2A 3Q25A 3W9VA 1MXXA 3SEVA 3SEUA 5A5XB 4QHQA 1JW5A 2DWAA 3BFUA 3MC2A 4TQUQ 3SEYA 2DXYA 3CSBA 3U92A 5K2YA 1JVYA 3SKPA 1PB8A 1B5HA 1M5BA 3ZSFA 2OWSA 4HCWA 1EZOA 4GOTA 2F5XA 4P11A 4OETA 3TKDA 3MVZA 4F3SA 1BP5A 1QVSA 2UYFA 3OSRA 3PUWE 1MDQA 1USYE 2ZYMA 3RGYA 1S9TA 2I58A 3CSGA 1LB8A 2A5TA 3QIMA 5H8FB 1H45A 3TPAA 3TQLA 5FTHA 4ZEIA 4G8NA 1IUDA 3RNNA 4F2OA 4X48A 1FQAA 4EF1A 2B3FA 1NNFA 1B3LA 1QKBA 4JWXA 3EHTA 4KD5A 5CMBA 3TYHA 1A40A 1MG1A 1SD3A 2H9BA 2UXAA 1QULA 2YJPA 3C35A 3H6VA 1FTLA 3IOUA 3M8UA 3K4UA 4ZEDA 1NKXA 5I58A 1B58A 2RC9A 3PPNA 3B7DA 3PUVE 1IQ7A 4OHNA 4RXLA 3C31A 5I58B 1RYXA 4N6PA 1N04A 1SYIA 3ECRA 4JWOA 3T9VA 3JV9A 1SW2A 2I4BA 1LBBA 1MM7A 2QL3A 1QUJA 3CG3A 1IZ1A 2H4IA 4H1XA 4Q30B 1IXGA 3MVWA 5L9OA 1O63A 3FUZA 5TU0A 4GL8A 4KFQA 3FIRA 3O28A 3T66A 1H44A 4MLVA 1YTVA 4JBZA 4OQOA 3VXCA 2FNCA 3FV2A 1DSNA 1SDXA 4Z7EA 5L9SA 5B7DA 3MP6A 5L8DA 3TTMA 5AA2A 1S7YA 4BLAA 5I84A 2QMWA 4O3AA 4GXAA 2FYIA 1II5A 2ONSA 2XXWA 4I1DA 1LAHE 3RT8A 2O6AA 1A55A 1ZU0A 5BWJA 4H5FA 4MFIA 3R7XA 1B7UA 3K0VA 4GF8A 3H3GA 4OVJA 1LCFA 2Q9TA 3EHSA 4G68B 4PE5B 3T22A 4KYDA 2XXQA 3BFTA 4PP0A 3MJNA 1MXZA 2BJJX 4F39A 1OLCA 4YKJA 3FXRA 3PUXE 5HPQA 5DEXB 1FQEA 3O97A 4DCYA 1NNPA 4GLIA 4FE8A 2XD3A 1H43A 2PX1A 2QJEA 1B5IA 4LA9A 1UQWA 4POWA 1IXHA 2I0CA 4NF4B 2F35A 3CG1A 3M3KA 4R6HA 4IGTA 4R6KA 2Q2AA 1AIVA 4PFUA 1QKAA 4R2FA 2DP8A 1UTBA 2RCBA 4H5GA 3HV1A 2DWIA 1P99A 3MVYA 1MM6A 3U93A 2XXPA 1XVXA 1QUKA 4KYEA 4EQ9A 3LSFB 4O3CA 4OYVA 2F7BA 5HM4B 3MPLA 4LUBA 3TMGA 1Q35A 3EHUA 5I57B 2ESNA 3G3FA 1P1QA 4I8CA 3CFLA 3S9LC 3FVNA 2ONKE 3DP8A 4ELOA 4FATA 4F31B 1GGGA 3MUQA 2XXIA 4NF8A 4G68C 3VLWA 2OCUA 4WEPA 4DE8A 3G3HA 4IO5A 4YB5A 5F1QA 2VP1A 4NMYA 2DQVA 5H8HB 1IIWA 2W7YA 3VXBA 1A99A 3FGSA 3FVKA 3VVDA 2RF1A 4FAJA 3EF7A 3QAXA 1UIUA 3HPIA 3THIA 3KN3A 4UA8A 3I3VA 1VSOA 4C1TA 2PVUA 4BDRA 3KFMA 3LSLA 3N26A 2OZZA 1B7ZA 4MF3A 4DIGA 3R6UA 2OWTA 4F18A 5KDTA 3TCGA 1YCJA 2ONRA 4F1VA 4MLQA 3KBRA 5IAIA 5ICQA 4NF5B 2O7IA 2NXOA 4TOZA 5F7VA 3G3JA 1EZ9A 1GTKA 4YMAA 1HSJA 1POY1 1IXIA 2DWJA 3PUZE 2QS2A 3K6UA 3CIJA 3OO8A 2GHBA 4XXUA 3RY3A 2HAUA 3UGWA 4F3PA 3U8QA 1Y1ZA 1MPDA 1OQGA 2Q89A 4KCCA 5I2NB 2GHAA 3IX1A 4POXA 2RC8A 5CMCA 4F2QA 1XVYA 4G4PA 2ZNUA 4U1OA 1B0HA 3RPWA 3LUYA 1NMUA 4F22A 1OVBA 4YAHX 1P1NA 3H7MA 3R26A 1WODA 1SW4A 3MZBA 3VDFA 3VVFA 4U4SA 1SI0A 1WDNA 3QXMA 1B7HA 1CE2A 5AA4B 3PPPA 3K6WA 2AL5A 2VOZA 3TTKA 4U23A 4H8IA 1T0KA 3O29A 3OO9A 1WVJA 3Q27A 3FXQA 4JB7A 4G77A 4LVQA 4EQBA 3OOAA 5I57A 4EF2A 3T9XB 3C4MA 4PFWA 3K02A 1BLFA 4YB6A 5I2KB 2XX9A 1MY1A 4O3BA 5I59A 2XXXA 3IB2A 4RA1A 1XT8A 5LOMA 5BUUA 1F9BA 2HQ0A 1UTHA 5DVIA 1PB9A 2ABHA 1PBQA 3IL1B 4DDDA 5AA4A 3T96B 3IAZA 4F1UA 3IK6B 2Y7PA 1ZTYA 3PD9A 4RPOA 1PC3A 1Y4CA 4QRZA 4GIZA 1B3GA 3SERA 5KCJA 1R9LA 3FATA 1XC1A 3K1NA 3IR1A 3M3LA 1B3HA 4P0IA 3G7WA 2O51A 1O64A 4RY1A 3RUMA 4F1YA 2A5TB 3FXUA 2VGQA 5H8FA 1TXFA 3LBSA 4N13A 4IO3A 4QSEA 4YKPA 2H5YA 1JEUA 3MP1A 2V3UA 2I3WA 4LZ8A 4Q0CA 3T9UA 1NL5A 2IA4A 4R74A 3FJMA 5I2NA 5ITPA 1FTJA 3UP9A 1MH4A 4WKMA 3PPRA 2REJA 3JYRA 2QPQA 2F7AA 4MBPA 2WKYA 1D9YA 3CVGA 3MAMA 4F19A 1XHYA 5ISUA 2B65A 1QW0A 1B4HA 2XXTA 3BBRA 1OIBA 4TLMB 4GQOA 2ZNTA 4R9GA 3S9EA 2OLBA 2HZKA 2XXRA 3C33A 4JSOA 4OEUA 5AA1A 4AB6A 1SW5A 2QS4A 3OEKA 4YMBA 2DE3A 3FVGA 5TP9B 3RLFE 4AB5A 5AA2D 2UVJA 1B1XA 2ZXTA 1S50A 4I9DA 3KSXA 3T9HB 5CMKA 5I2KA 3KN7A 5DT6A 2NVUB 4ELPA 1CB6A 3CRBA 3IB0A 3G3GA 1LLSA 2ZYKA 3H4ZA 4C0RA 3TFLA 2Z22A 4NTLA 2PBWA 4DXCA 3LC8A 1Y4TA 3MZ9A 1EZPA 2KLFA 3A3CA 5JEIA 1BIYA 2X7QA 2RC7A 3TTNA 1ZMGA 3WAFA 1M5CA 3KSJA 3PPQA 4BDOA 1BKAA 4LONB 4C1UA 4DLDA 5AA2B 3S9MC 5KCJB 1SYHA 5AA3A 3LSXA 5CRYA 2F97A 4BDNA 3H6TA 3D4CA 1OQHA 3C9HA 4ZECA 4YKIA 2H98A 2ZYOA 3JZJA 1N3XA 2H99A 5JTYA 4GXSB 3IO6A 2QMXA 1JEVA 3PGFA 4IO7A 3VFJA 1M5EA 2IEEA 2Q8JA 4ELRA 5H8SA 3HHFA 1J1NA 1NNKA 4H0WA 3U72A 4X1DA 1P1UA 4OFLA 3UIFA 5KZTA 1MQIA 2ANJA 4RYAA 4AQ4A 5CBSA 3HSTA 1PBPA 4H65A 3MPKA 3EQ1A 3O6HA 1N76A 3QUFA 4XKQA 1LGBC 3I5OA 3VLUA 3H6UA 3MP8A 4IGRA 4MH5A 1OMPA 1URDA 4R73A 1JVXA 2Y84A 3QYTA 3PD8A 4NEDA 3HCQA 3IORA 4LZ7A 4U2RA 3ODBA 5CBRA 3O6IA 1POTA 3OO7A 1NFTA 4JWYA 5I56A 3F11A 1MDP1 5I56B 3UK4A 4Q5TA 1JW4A 3MQ9A 4OXVA 1Z7ME 1ZJLA 4FORA 4LP2B 1B5JA 3KG2A 4YKKA 2PYYA 4QSCA 5HBCA 4F3GA 4YZZA 3U94A 4NF8B 4HW8A 2Z8FA 3D4GA 3TUSA 3VV5A 1B51A 2DOJA 2NUVA 3OO6A 4EXKA 2FA7A 1JW1A 3FJ7A 3RQTA 4F29A 5TPAB 1Y20A 1FQFA 3C32A 1MQJA 3K00A 4RJZA 3S2VA 2UYEA 2REGA 4GRKA 4IO2A 4H8JA 1MRPA 1N7WA 4IY6A 4K3FA 1B6HA 1LCTA 4KQPA 3SESA 3E9XA 3UORA 2I6EA 1Y3QA 5ITOA 1MXVA 4EDPA 1A8FA 1FQDA 1QJMA 4R75A 2OK2A 4KCDA 4U22A 3TEPA 3EN3A 1N7XA 4NF5A 4OMBA 1LAFE 2GH9A 1FQCA 3N6TA 2DVZA 4FEBA 3USDA 1QUIA 3V89B 5FHNA 4GD5A 5DVJA 4RK2A 1B1HA 2UVGA 3TCHA 4PFTA 2XHDA 3PUYE 3DP6A 1UTBB 4QFNA 4ESWA 4ZE9A 5FHMA 2VHAA 4IO4A 3GLBA 1FTKA 2DXRA 3N94A 1DTZA 4OZ9A 1MPBA 1IEJA 3A3UA 4OEVA 3AXFA 2O1LA 1URSA 2D21A 2NOOA 4N07A 2ZMBA 1DPEA 1US4A 2V3QA 2O68A 4LQ5A 3M3FA 4XKNA 4PQJA 1MY3A 3VVEA 2YPNA 2I49A 2LAOA 4Z0IA 3G3KA 1GV8A 5B70A 5IKBA 1MQGA 1RKMA 3W9WA 4BDLA 1UIVA 3RT6B 3TAJA 4ZZAA 2XXHA 1UTHB 1URGA 2V25A 4YU0A 3HHGA 5A5XA 1ZIUA 1FW0A 3ONMA 5K2XA 5DTBA 2HEUA 2THIA 5H8QB 1TFAA 2O1MA 2PMSA 2HZLA 3IOVA 3K2DA 4R9FA 3TELA 4NE4A 2CMOA 2AYSA 2QS3A 3GXAA 3Q28A 3WAEA 1N84A 4ISUA 3P7IA 3G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5W A;  2Y7I A;  2F7C A;  4HS7 A;  3A09 A;  1GR2 A;  1VFD A;  3FVO A;  1IIT A;  4BDM A;  5FHO A;  2PT1 A;  2VD3 A;  2OBG A;  3ILU B;  1AH5 A;  4Q8R A;  1ZKB A;  3O66 A;  3KJ7 A;  1LFG A;  1R9Q A;  2Y7W A;  1PEB A;  4FED A;  2Y7K A;  4FJP A;  4L17 A;  4M1V A;  1LFI A;  3O9P A;  1PB7 A;  1I6Q A;  2ZYN A;  1VFE A;  3IJO B;  1EH3 A;  1TFD A;  1GVC A;  2CZL A;  4ELQ A;  1M5D A;  1VR5 A;  2F6G A;  3K1P A;  3E13 X;  3TZA A;  2V93 A;  2O84 X;  1I69 A;  4ZE8 A;  1US5 A;  5FTI A;  2QS1 A;  3O6G A;  4GFR A;  2ALU A;  3OD7 A;  4IO6 A;  3TQW A;  1MXY A;  4DXU A;  4GWO A;  2YLN A;  1MXW A;  5TP9 A;  1L5T A;  4YB7 A;  2RIN A;  3IJX B;  3W15 C;  3V83 A;  4R72 A;  3CI8 A;  4OEN A;  3KJT A;  4ND9 A;  5H8N B;  4EQ7 A;  1A7L A;  2E0S A;  4KI0 E;  1FQB A;  2V84 A;  4R2B A;  3PMX A;  4PET A;  3PMV A;  3TTL A;  1JET A;  1USY H;  2I3V A;  1JQF A;  2Z8D A;  3B6W A;  2DE4 A;  4TLL B;  3RTF B;  2RCA A;  1P1W A;  3FJG A;  2P1S A;  2P2A A;  4XKP A;  5CMM A;  5H8Q A;  3FD3 A;  4OWD A;  1LB9 A;  5CI5 A;  3KEI A;  4X9T A;  2Q2C A;  1NNT A;  3QSL A;  3K6X A;  1AOV A;  2H25 A;  3FV1 A;  3Q26 A;  4HCY A;  3I6V A;  4XTC Q;  3B6Q A;  2F78 A;  2OJT A;  2R6G E;  1ELJ A;  3PU5 A;  3V8X B;  4E0W A;  3DP4 A;  4KHZ E;  1R1N A;  1LFH A;  5JTY B;  3V5A A;  3ZKK A;  3KGC A;  4BDQ A;  2M8C A;  3QUJ A;  2F34 A;  1N3W A;  2UVH A;  3OEL A;  4G68 A;  3Q29 A;  4LQ2 A;  4LZ5 A;  3S4U A;  3MW0 A;  1MQH A;  4OTE A;  1LAG E;  3OMB A;  4QSD A;  1SI1 A;  2XXV A;  2XD2 A;  3SET A;  1VE4 A;  3RTW B;  3DM0 A;  3LR1 A;  1LBC A;  1SW1 A;  3KOS A;  1B46 A;  4LAT A;  3TOD A;  3KN8 A;  1B2H A;  1R6Z A;  2Z23 A;  1B32 A;  4JDF A;  4ONY A;  4OFJ A;  3UN6 A;  3CR9 A;  2XX8 A;  4NF4 A;  4ZEF A;  2NWJ A;  1MY4 A;  3GBB A;  1PDA A;  4P0G A;  1IXC A;  1EU8 A;  2QRY A;  3H03 A;  5H8N A;  3PMW A;  1FCK A;  3TDJ A;  2GRV A;  3PPO A;  1N0T A;  1B3F A;  2O7U A;  3EPE A;  5M2V A;  1HSE A;  3MWB A;  2I48 A;  3OSQ A;  2I0B A;  5L9M A;  3RN8 A;  1FTO A;  3VE1 B;  5CM6 A;  5ELV A;  1M5F A;  1MH3 A;  2AL4 A;  4ZDM A;  3LSW A;  4ZEB A;  5EHS A;  2QSX A;  1DOT A;  2DSF A;  2UVI A;  2VD2 A;  2XXY A;  3TTR A;  1H3D A;  2AIX A;  1DPP A;  4GL0 A;  1DTG A;  2Z8E A;  4XKR A;  4F3B A;  2RKM A;  3UA8 A;  5H8H A;  5TPA A;  2HXW A;  4XIG Q;  2ZNS A;  1B4Z A;  2X7P A;  1AL3 A;  3ZKL A;  1YAE A;  1B0L A;  1MQD A;  4FEC A;  1RYO A;  1SQY A;  4DZ1 A;  2DVC A;  1TWY A;  4NF6 A;  1YPN A;  2G29 A;  3O2A A;  1B40 A;  1DMB A;  4NF6 B;  1MPC A;  3N6U A;  5ICT A;  2XX7 A;  3TCF A;  5J1D A;  3OEN A;  5DEX A;  2DWH A;  5JK4 A;  4M4G A;  2Q88 A;  3MBP A;  1B05 A;  2E1S A;  1AMF A;  3KOT A;  1P1O A;  1D9V A;  2O69 A;  4RNS A;  5EHM A;  1MY2 A;  4X1B A;  3IOW A;  3FAS A;  1B52 A;  2A5S A;  1ZBM A;  3IO4 A;  3L6G A;  4HTG A;  3SEX A;  1Q1K A;  3CFX A;  3T93 B;  3B6T A;  3U1O A;  3S9N C;  5AE4 A;  4DXB A;  1NH7 A;  1SVX B;  1ATG A;  2F36 A;  3K6V A;  2V3T A;  3KZG A;  3L6H A;  3N5L A;  1H76 A;  1B9J A;  3SEW A;  4EXL A;  1SBP A;  5DYH A;  3MZ1 A;  4QFP A;  4QF9 A;  4ZS9 A;  4U4X A;  1D4N A;  1D3K A;  2DS9 A;  4OER A;  4QFO A;  3DEL B;  3K01 A;  4FIM A;  4IY5 A;  1ZLQ A;  4IB2 A;  2Y7R A;  4KR5 A;  4OFO A;  4QFL A;  1A8E A;  4U1Z A;  5I59 B;  2F6P A;  1O7T A;  4H67 A;  4KYS A;  4ECF A;  1I6B A;  2B3B A;  2F8D A;  2I4C A;  1HSL A;  4UAC A;  1XOC A;  1OLA A;  1Y9U A;  2GFE A;  3HO7 A;  4G8M A;  3E4R A;  4H6D A;  1XS5 A;  2HCA A;  3K1M A;  1KWH A;  3H06 B;  1Y3N A;  4I62 A;  3IOT A;  2DE2 A;  2G93 A;  4WED A;  3CFZ A;  2X26 A;  4JSD A;  4U21 A;  2R71 A;  4THI A;  5DVF A;  1B3E A;  3E3K A;  4WXJ A;  2P0S A;  5KDT B;  1FTM A;  3ILT B;  1LAX A;  4ZEK A;  4RK9 A;  4DCX A;  1JNF A;  2XXU A;  3IB1 A;  3GBA A;  1Y1M A;  1BTJ A;  3VLV A;  4JXI A;  3ZS6 A;  1OVT A;  3FZV A;  1Y3P A;  4G8H A;  4ZZE A;  1NH8 A;  1MS7 A;  1Z7N E;  4YIC A;  2R9J A;  4OES A;  4QFK A;  3SDF A;  1LST A;  3GZG A;  2PT2 A;  4NWC A;  4RPN A;  4PFY A;  4E0X A;  4NWD A;  3H6W A;  4KPT A;  2D3I A;  3HN0 A;  2DYX A;  2HFB A;  3C36 A;  1ANF A;  3MVX A;  4G2Z A;  4R6Y A;  4EUO A;  3OEM A;  1A54 A;  4GVO A;  5EYF A;  3QK6 A;  3C34 A;  1TT1 A;  3DLN A;  1MY0 A;  3PV0 E;  2HAV A;  1I6A A;  1MXU A;  3BKI B;  3OXN A;  4ESX A;  5CC2 A;  3Q25 A;  3W9V A;  1MXX A;  3SEV A;  3SEU A;  5A5X B;  4QHQ A;  1JW5 A;  2DWA A;  3BFU A;  3MC2 A;  4TQU Q;  3SEY A;  2DXY A;  3CSB A;  3U92 A;  5K2Y A;  1JVY A;  3SKP A;  1PB8 A;  1B5H A;  1M5B A;  3ZSF A;  2OWS A;  4HCW A;  1EZO A;  4GOT A;  2F5X A;  4P11 A;  4OET A;  3TKD A;  3MVZ A;  4F3S A;  1BP5 A;  1QVS A;  2UYF A;  3OSR A;  3PUW E;  1MDQ A;  1USY E;  2ZYM A;  3RGY A;  1S9T A;  2I58 A;  3CSG A;  1LB8 A;  2A5T A;  3QIM A;  5H8F B;  1H45 A;  3TPA A;  3TQL A;  5FTH A;  4ZEI A;  4G8N A;  1IUD A;  3RNN A;  4F2O A;  4X48 A;  1FQA A;  4EF1 A;  2B3F A;  1NNF A;  1B3L A;  1QKB A;  4JWX A;  3EHT A;  4KD5 A;  5CMB A;  3TYH A;  1A40 A;  1MG1 A;  1SD3 A;  2H9B A;  2UXA A;  1QUL A;  2YJP A;  3C35 A;  3H6V A;  1FTL A;  3IOU A;  3M8U A;  3K4U A;  4ZED A;  1NKX A;  5I58 A;  1B58 A;  2RC9 A;  3PPN A;  3B7D A;  3PUV E;  1IQ7 A;  4OHN A;  4RXL A;  3C31 A;  5I58 B;  1RYX A;  4N6P A;  1N04 A;  1SYI A;  3ECR A;  4JWO A;  3T9V A;  3JV9 A;  1SW2 A;  2I4B A;  1LBB A;  1MM7 A;  2QL3 A;  1QUJ A;  3CG3 A;  1IZ1 A;  2H4I A;  4H1X A;  4Q30 B;  1IXG A;  3MVW A;  5L9O A;  1O63 A;  3FUZ A;  5TU0 A;  4GL8 A;  4KFQ A;  3FIR A;  3O28 A;  3T66 A;  1H44 A;  4MLV A;  1YTV A;  4JBZ A;  4OQO A;  3VXC A;  2FNC A;  3FV2 A;  1DSN A;  1SDX A;  4Z7E A;  5L9S A;  5B7D A;  3MP6 A;  5L8D A;  3TTM A;  5AA2 A;  1S7Y A;  4BLA A;  5I84 A;  2QMW A;  4O3A A;  4GXA A;  2FYI A;  1II5 A;  2ONS A;  2XXW A;  4I1D A;  1LAH E;  3RT8 A;  2O6A A;  1A55 A;  1ZU0 A;  5BWJ A;  4H5F A;  4MFI A;  3R7X A;  1B7U A;  3K0V A;  4GF8 A;  3H3G A;  4OVJ A;  1LCF A;  2Q9T A;  3EHS A;  4G68 B;  4PE5 B;  3T22 A;  4KYD A;  2XXQ A;  3BFT A;  4PP0 A;  3MJN A;  1MXZ A;  2BJJ X;  4F39 A;  1OLC A;  4YKJ A;  3FXR A;  3PUX E;  5HPQ A;  5DEX B;  1FQE A;  3O97 A;  4DCY A;  1NNP A;  4GLI A;  4FE8 A;  2XD3 A;  1H43 A;  2PX1 A;  2QJE A;  1B5I A;  4LA9 A;  1UQW A;  4POW A;  1IXH A;  2I0C A;  4NF4 B;  2F35 A;  3CG1 A;  3M3K A;  4R6H A;  4IGT A;  4R6K A;  2Q2A A;  1AIV A;  4PFU A;  1QKA A;  4R2F A;  2DP8 A;  1UTB A;  2RCB A;  4H5G A;  3HV1 A;  2DWI A;  1P99 A;  3MVY A;  1MM6 A;  3U93 A;  2XXP A;  1XVX A;  1QUK A;  4KYE A;  4EQ9 A;  3LSF B;  4O3C A;  4OYV A;  2F7B A;  5HM4 B;  3MPL A;  4LUB A;  3TMG A;  1Q35 A;  3EHU A;  5I57 B;  2ESN A;  3G3F A;  1P1Q A;  4I8C A;  3CFL A;  3S9L C;  3FVN A;  2ONK E;  3DP8 A;  4ELO A;  4FAT A;  4F31 B;  1GGG A;  3MUQ A;  2XXI A;  4NF8 A;  4G68 C;  3VLW A;  2OCU A;  4WEP A;  4DE8 A;  3G3H A;  4IO5 A;  4YB5 A;  5F1Q A;  2VP1 A;  4NMY A;  2DQV A;  5H8H B;  1IIW A;  2W7Y A;  3VXB A;  1A99 A;  3FGS A;  3FVK A;  3VVD A;  2RF1 A;  4FAJ A;  3EF7 A;  3QAX A;  1UIU A;  3HPI A;  3THI A;  3KN3 A;  4UA8 A;  3I3V A;  1VSO A;  4C1T A;  2PVU A;  4BDR A;  3KFM A;  3LSL A;  3N26 A;  2OZZ A;  1B7Z A;  4MF3 A;  4DIG A;  3R6U A;  2OWT A;  4F18 A;  5KDT A;  3TCG A;  1YCJ A;  2ONR A;  4F1V A;  4MLQ A;  3KBR A;  5IAI A;  5ICQ A;  4NF5 B;  2O7I A;  2NXO A;  4TOZ A;  5F7V A;  3G3J A;  1EZ9 A;  1GTK A;  4YMA A;  1HSJ A;  1POY 1;  1IXI A;  2DWJ A;  3PUZ E;  2QS2 A;  3K6U A;  3CIJ A;  3OO8 A;  2GHB A;  4XXU A;  3RY3 A;  2HAU A;  3UGW A;  4F3P A;  3U8Q A;  1Y1Z A;  1MPD A;  1OQG A;  2Q89 A;  4KCC A;  5I2N B;  2GHA A;  3IX1 A;  4POX A;  2RC8 A;  5CMC A;  4F2Q A;  1XVY A;  4G4P A;  2ZNU A;  4U1O A;  1B0H A;  3RPW A;  3LUY A;  1NMU A;  4F22 A;  1OVB A;  4YAH X;  1P1N A;  3H7M A;  3R26 A;  1WOD A;  1SW4 A;  3MZB A;  3VDF A;  3VVF A;  4U4S A;  1SI0 A;  1WDN A;  3QXM A;  1B7H A;  1CE2 A;  5AA4 B;  3PPP A;  3K6W A;  2AL5 A;  2VOZ A;  3TTK A;  4U23 A;  4H8I A;  1T0K A;  3O29 A;  3OO9 A;  1WVJ A;  3Q27 A;  3FXQ A;  4JB7 A;  4G77 A;  4LVQ A;  4EQB A;  3OOA A;  5I57 A;  4EF2 A;  3T9X B;  3C4M A;  4PFW A;  3K02 A;  1BLF A;  4YB6 A;  5I2K B;  2XX9 A;  1MY1 A;  4O3B A;  5I59 A;  2XXX A;  3IB2 A;  4RA1 A;  1XT8 A;  5LOM A;  5BUU A;  1F9B A;  2HQ0 A;  1UTH A;  5DVI A;  1PB9 A;  2ABH A;  1PBQ A;  3IL1 B;  4DDD A;  5AA4 A;  3T96 B;  3IAZ A;  4F1U A;  3IK6 B;  2Y7P A;  1ZTY A;  3PD9 A;  4RPO A;  1PC3 A;  1Y4C A;  4QRZ A;  4GIZ A;  1B3G A;  3SER A;  5KCJ A;  1R9L A;  3FAT A;  1XC1 A;  3K1N A;  3IR1 A;  3M3L A;  1B3H A;  4P0I A;  3G7W A;  2O51 A;  1O64 A;  4RY1 A;  3RUM A;  4F1Y A;  2A5T B;  3FXU A;  2VGQ A;  5H8F A;  1TXF A;  3LBS A;  4N13 A;  4IO3 A;  4QSE A;  4YKP A;  2H5Y A;  1JEU A;  3MP1 A;  2V3U A;  2I3W A;  4LZ8 A;  4Q0C A;  3T9U A;  1NL5 A;  2IA4 A;  4R74 A;  3FJM A;  5I2N A;  5ITP A;  1FTJ A;  3UP9 A;  1MH4 A;  4WKM A;  3PPR A;  2REJ A;  3JYR A;  2QPQ A;  2F7A A;  4MBP A;  2WKY A;  1D9Y A;  3CVG A;  3MAM A;  4F19 A;  1XHY A;  5ISU A;  2B65 A;  1QW0 A;  1B4H A;  2XXT A;  3BBR A;  1OIB A;  4TLM B;  4GQO A;  2ZNT A;  4R9G A;  3S9E A;  2OLB A;  2HZK A;  2XXR A;  3C33 A;  4JSO A;  4OEU A;  5AA1 A;  4AB6 A;  1SW5 A;  2QS4 A;  3OEK A;  4YMB A;  2DE3 A;  3FVG A;  5TP9 B;  3RLF E;  4AB5 A;  5AA2 D;  2UVJ A;  1B1X A;  2ZXT A;  1S50 A;  4I9D A;  3KSX A;  3T9H B;  5CMK A;  5I2K A;  3KN7 A;  5DT6 A;  2NVU B;  4ELP A;  1CB6 A;  3CRB A;  3IB0 A;  3G3G A;  1LLS A;  2ZYK A;  3H4Z A;  4C0R A;  3TFL A;  2Z22 A;  4NTL A;  2PBW A;  4DXC A;  3LC8 A;  1Y4T A;  3MZ9 A;  1EZP A;  2KLF A;  3A3C A;  5JEI A;  1BIY A;  2X7Q A;  2RC7 A;  3TTN A;  1ZMG A;  3WAF A;  1M5C A;  3KSJ A;  3PPQ A;  4BDO A;  1BKA A;  4LON B;  4C1U A;  4DLD A;  5AA2 B;  3S9M C;  5KCJ B;  1SYH A;  5AA3 A;  3LSX A;  5CRY A;  2F97 A;  4BDN A;  3H6T A;  3D4C A;  1OQH A;  3C9H A;  4ZEC A;  4YKI A;  2H98 A;  2ZYO A;  3JZJ A;  1N3X A;  2H99 A;  5JTY A;  4GXS B;  3IO6 A;  2QMX A;  1JEV A;  3PGF A;  4IO7 A;  3VFJ A;  1M5E A;  2IEE A;  2Q8J A;  4ELR A;  5H8S A;  3HHF A;  1J1N A;  1NNK A;  4H0W A;  3U72 A;  4X1D A;  1P1U A;  4OFL A;  3UIF A;  5KZT A;  1MQI A;  2ANJ A;  4RYA A;  4AQ4 A;  5CBS A;  3HST A;  1PBP A;  4H65 A;  3MPK A;  3EQ1 A;  3O6H A;  1N76 A;  3QUF A;  4XKQ A;  1LGB C;  3I5O A;  3VLU A;  3H6U A;  3MP8 A;  4IGR A;  4MH5 A;  1OMP A;  1URD A;  4R73 A;  1JVX A;  2Y84 A;  3QYT A;  3PD8 A;  4NED A;  3HCQ A;  3IOR A;  4LZ7 A;  4U2R A;  3ODB A;  5CBR A;  3O6I A;  1POT A;  3OO7 A;  1NFT A;  4JWY A;  5I56 A;  3F11 A;  1MDP 1;  5I56 B;  3UK4 A;  4Q5T A;  1JW4 A;  3MQ9 A;  4OXV A;  1Z7M E;  1ZJL A;  4FOR A;  4LP2 B;  1B5J A;  3KG2 A;  4YKK A;  2PYY A;  4QSC A;  5HBC A;  4F3G A;  4YZZ A;  3U94 A;  4NF8 B;  4HW8 A;  2Z8F A;  3D4G A;  3TUS A;  3VV5 A;  1B51 A;  2DOJ A;  2NUV A;  3OO6 A;  4EXK A;  2FA7 A;  1JW1 A;  3FJ7 A;  3RQT A;  4F29 A;  5TPA B;  1Y20 A;  1FQF A;  3C32 A;  1MQJ A;  3K00 A;  4RJZ A;  3S2V A;  2UYE A;  2REG A;  4GRK A;  4IO2 A;  4H8J A;  1MRP A;  1N7W A;  4IY6 A;  4K3F A;  1B6H A;  1LCT A;  4KQP A;  3SES A;  3E9X A;  3UOR A;  2I6E A;  1Y3Q A;  5ITO A;  1MXV A;  4EDP A;  1A8F A;  1FQD A;  1QJM A;  4R75 A;  2OK2 A;  4KCD A;  4U22 A;  3TEP A;  3EN3 A;  1N7X A;  4NF5 A;  4OMB A;  1LAF E;  2GH9 A;  1FQC A;  3N6T A;  2DVZ A;  4FEB A;  3USD A;  1QUI A;  3V89 B;  5FHN A;  4GD5 A;  5DVJ A;  4RK2 A;  1B1H A;  2UVG A;  3TCH A;  4PFT A;  2XHD A;  3PUY E;  3DP6 A;  1UTB B;  4QFN A;  4ESW A;  4ZE9 A;  5FHM A;  2VHA A;  4IO4 A;  3GLB A;  1FTK A;  2DXR A;  3N94 A;  1DTZ A;  4OZ9 A;  1MPB A;  1IEJ A;  3A3U A;  4OEV A;  3AXF A;  2O1L A;  1URS A;  2D21 A;  2NOO A;  4N07 A;  2ZMB A;  1DPE A;  1US4 A;  2V3Q A;  2O68 A;  4LQ5 A;  3M3F A;  4XKN A;  4PQJ A;  1MY3 A;  3VVE A;  2YPN A;  2I49 A;  2LAO A;  4Z0I A;  3G3K A;  1GV8 A;  5B70 A;  5IKB A;  1MQG A;  1RKM A;  3W9W A;  4BDL A;  1UIV A;  3RT6 B;  3TAJ A;  4ZZA A;  2XXH A;  1UTH B;  1URG A;  2V25 A;  4YU0 A;  3HHG A;  5A5X A;  1ZIU A;  1FW0 A;  3ONM A;  5K2X A;  5DTB A;  2HEU A;  2THI A;  5H8Q B;  1TFA A;  2O1M A;  2PMS A;  2HZL A;  3IOV A;  3K2D A;  4R9F A;  3TEL A;  4NE4 A;  2CMO A;  2AYS A;  2QS3 A;  3GXA A;  3Q28 A;  3WAE A;  1N84 A;  4ISU A;  3P7I A;  3G3I A; 
#chains in the Genus database with same CATH topology
 2D5W A;  2F7C A;  4HS7 A;  4BDM A;  3FVO A;  5FHO A;  3ILU B;  1AH5 A;  4MNI A;  1LFG A;  3UP9 A;  2Y7K A;  4O3A A;  3O9P A;  2ZYN A;  1VR5 A;  4NX1 A;  5I5P A;  3O6G A;  4GFR A;  4IO6 A;  1MXY A;  4DXU A;  4GWO A;  3IJX B;  3CI8 A;  5H8N B;  1A7L A;  1FQB A;  2KR0 A;  3PMX A;  3TTL A;  1JET A;  2I3V A;  4BDL A;  4N15 A;  2RCA A;  4XKP A;  4I40 A;  1LB9 A;  5CI5 A;  3RPL A;  3K6X A;  2JJK A;  2F78 A;  3PU5 A;  1VDW A;  3QUJ A;  1N3W A;  3S4U A;  3MW0 A;  1LBC A;  3FXB A;  3KOS A;  1B46 A;  4LAT A;  4ONY A;  1B32 A;  3UN6 A;  4OFJ A;  1FBD A;  1MY4 A;  4P0G A;  3PMW A;  2WYP A;  3EPE A;  5T3J A;  5CM6 A;  1FTO A;  1MH3 A;  2AL4 A;  5ET7 A;  2QSX A;  2XXY A;  1FBE A;  2AIX A;  1DPP A;  1DTG A;  4F3B A;  1IMB A;  4X8R A;  5TPA A;  2ZNS A;  3ZKL A;  1TWY A;  1DMB A;  4NF6 B;  3OEN A;  5IGA A;  5JK4 A;  2PFY A;  1B05 A;  3KOT A;  1P1O A;  3FAS A;  2A5S A;  1ZBM A;  3IO4 A;  1Q1K A;  3CFX A;  4JVI A;  4EXL A;  4IR8 A;  5DYH A;  3MZ1 A;  1D4N A;  1D3K A;  2Y5L A;  4OER A;  4IY5 A;  2Y7R A;  1A8E A;  2F6P A;  4H67 A;  4UAC A;  4H6D A;  1XOC A;  2GFE A;  2HCA A;  2FIX A;  4WED A;  1FPF A;  2X26 A;  4JSD A;  4THI A;  1B3E A;  2P0S A;  4ZEK A;  5EQ8 A;  4XFE A;  1BTJ A;  1FPJ A;  1MS7 A;  4H45 A;  2R9J A;  4PFR A;  2PT2 A;  2D3I A;  1A54 A;  4GVO A;  5EYF A;  3BKI B;  2R8T A;  1JP4 A;  4N4U A;  4QHQ A;  1JW5 A;  3BFU A;  3MC2 A;  3SEY A;  1AWB A;  5FBP A;  1B5H A;  1M5B A;  2QFL A;  3NOH A;  3TQL A;  2Y5K A;  4G8N A;  1IUD A;  1B3L A;  4JWX A;  5CMB A;  3EHT A;  1SD3 A;  3H6V A;  3C35 A;  3B7D A;  3PUV E;  3C31 A;  3JV9 A;  4OA4 A;  4H1X A;  3MVW A;  4HXV A;  4GL8 A;  4MLV A;  1YTV A;  5B7D A;  2FYI A;  1ZU0 A;  3R7X A;  1FTA A;  2F3B A;  4GF8 A;  3H3G A;  1EYI A;  4G68 B;  4KYD A;  3BFT A;  4PF6 A;  4YKJ A;  3O97 A;  4GLI A;  1AIV A;  2Q2A A;  4PFU A;  4R2F A;  1UTB A;  4H5G A;  4NF0 A;  4EQ9 A;  3MPL A;  4X04 A;  3S9L C;  4O8M A;  3CFL A;  5IM2 A;  5EYG A;  3DP8 A;  3QMF A;  4MHF A;  2OCU A;  1NV3 A;  4IO5 A;  3VXB A;  3FVK A;  3VVD A;  2RF1 A;  3EF7 A;  4UA8 A;  3I3V A;  4I3Y A;  4C1T A;  2PVU A;  4BDR A;  3N26 A;  3LSL A;  4DIG A;  2OWT A;  1NV6 A;  3TCG A;  3KBR A;  2O7I A;  4PAF A;  2DWJ A;  3RY3 A;  2QS2 A;  3UGW A;  3OO8 A;  4F3P A;  1OQG A;  5I2N B;  4POX A;  2RC8 A;  4F2Q A;  3D1R A;  1OVB A;  3R26 A;  3K6W A;  4U23 A;  4LVQ A;  4G77 A;  3OOA A;  4EF2 A;  4FBP A;  3T9X B;  4YB6 A;  1BLF A;  2XXX A;  3SZP A;  1F9B A;  4GBV A;  4GWX A;  1PB9 A;  1PBQ A;  4DDD A;  4F1U A;  1DCU A;  2Y7P A;  4RPO A;  1PC3 A;  4GIZ A;  1B3G A;  3SER A;  1XC1 A;  2GQ1 A;  4P0I A;  1B3H A;  3RUM A;  4PCD A;  4IO3 A;  2FIE A;  4QSE A;  2H5Y A;  4Q0C A;  2IA4 A;  3FJM A;  3LV0 A;  4WKM A;  2REJ A;  3JYR A;  4MBP A;  1D9Y A;  3CVG A;  4NHB A;  1QW0 A;  3ROJ A;  5AA1 A;  3OEK A;  1FPB A;  4I9D A;  3T9H B;  3HFU A;  3KN7 A;  4ELP A;  3CRB A;  1EZP A;  2PBW A;  1IMD A;  3LC8 A;  1QGX A;  3KSJ A;  1BKA A;  4LON B;  4DLD A;  4PBH A;  4BDN A;  3D4C A;  2H99 A;  3IO6 A;  4IO7 A;  1NV7 A;  1M5E A;  2IEE A;  2Q8J A;  5H8S A;  4H0W A;  4OFL A;  5KZT A;  2ANJ A;  1PBP A;  3QUF A;  3I5O A;  4IGR A;  1OMP A;  1NUY A;  2Y84 A;  4MJO A;  3IOR A;  2ZZW A;  1POT A;  3OO7 A;  1FJ6 A;  1JW4 A;  4PDH A;  4FOR A;  3KG2 A;  1YZ0 A;  4HW8 A;  3TUS A;  3VV5 A;  2NUV A;  2FA7 A;  4F29 A;  4JVC A;  1FQF A;  3C32 A;  2UYE A;  4IY6 A;  1MRP A;  1B6H A;  3E9X A;  5ITO A;  2OK2 A;  4KCD A;  4NF5 A;  3N6T A;  2F3D A;  5DVJ A;  1B1H A;  2UVG A;  4QFN A;  4ZE9 A;  1D9Q A;  1IME A;  4IO4 A;  1MPB A;  1URS A;  1DPE A;  2O68 A;  4XKN A;  4PQJ A;  2I49 A;  3W9W A;  1ZIU A;  1FW0 A;  5DTB A;  2MKZ A;  4E0X A;  4LN5 A;  2CMO A;  2AYS A;  4ISU A;  5M2V A;  3A09 A;  2OX3 A;  2OBG A;  3CHG A;  2Y7W A;  4L17 A;  3TKD A;  1I6Q A;  4ELQ A;  2F6G A;  2XWV A;  2V93 A;  1FSA A;  1I69 A;  2QS1 A;  3OD7 A;  2RIN A;  1FPD A;  4OEN A;  3KJT A;  4ND9 A;  4EQ7 A;  1BK4 A;  2V84 A;  3PMV A;  2Z8D A;  3B6W A;  1JQF A;  2DE4 A;  1P1W A;  2P1S A;  1FJ9 A;  2Q2C A;  1NNT A;  3QSL A;  1AOV A;  1YXI A;  2OJT A;  2B4L A;  5JTY B;  3OEL A;  4G68 A;  1EYK A;  2XXV A;  2XD2 A;  1VE4 A;  3RTW B;  3KN8 A;  2Z23 A;  3GBB A;  1PDA A;  1EU8 A;  3TDJ A;  3H03 A;  5H8N A;  4HE0 A;  3PPO A;  1B3F A;  3MWB A;  4HE1 A;  5L9M A;  5ELV A;  1M5F A;  3LSW A;  4ZEB A;  2DSF A;  1H3D A;  2RKM A;  3UA8 A;  4XIG Q;  2XXK A;  5EQA A;  4QBA A;  1RYO A;  5IZZ A;  2CZI A;  2G29 A;  3O2A A;  1MPC A;  2FVZ A;  2DWH A;  4PE3 A;  2CEX A;  2O69 A;  4RNS A;  4X1B A;  1B52 A;  3SEX A;  4DXB A;  1NH7 A;  1ATG A;  2V3T A;  3SEW A;  1RDY A;  3FBP A;  4U4X A;  2DS9 A;  4XF5 A;  4QFO A;  3K01 A;  4FIM A;  2B3B A;  1OLA A;  3HO7 A;  5DW8 A;  4H46 A;  3H06 B;  2G93 A;  2R71 A;  5DVF A;  3ILT B;  2XXU A;  3GBA A;  1NV5 A;  1Y1M A;  3ZS6 A;  1Y3P A;  4G8H A;  4ZZE A;  1Z7N E;  4QFK A;  4DI4 B;  4N17 A;  3SDF A;  3GZG A;  4NWD A;  3H6W A;  4KPT A;  3MVX A;  4G2Z A;  3C34 A;  1TT1 A;  3DLN A;  2HAV A;  1MXU A;  5CC2 A;  3W9V A;  1MXX A;  3E79 A;  1JVY A;  1PB8 A;  3ZSF A;  4HCW A;  4GOT A;  4P11 A;  3MVZ A;  1BP5 A;  1LB8 A;  5H8F B;  3B8B A;  1G0I A;  5FTH A;  4X48 A;  1FQA A;  4EF1 A;  1NUW A;  4NGU A;  2YJP A;  2H9B A;  4DE8 A;  2UXA A;  3IOU A;  1NKX A;  5I58 A;  2RC9 A;  3PPN A;  5I58 B;  1RYX A;  2QVR A;  4JWO A;  1SW2 A;  2I4B A;  1LBB A;  1MM7 A;  2H4I A;  4Q30 B;  1IXG A;  2B4M A;  3FIR A;  4JBZ A;  4Z7E A;  5AA2 A;  1S7Y A;  2ONS A;  2O6A A;  2FHY A;  5BWJ A;  4H5F A;  4MFI A;  4OVJ A;  1FBC A;  2XXQ A;  4PP0 A;  1MXZ A;  2BJJ X;  4F39 A;  3PUX E;  4AS4 A;  1NNP A;  2XD3 A;  1LBX A;  1B5I A;  4LA9 A;  1UQW A;  1IXH A;  4NF4 B;  3M3K A;  3CG1 A;  4IGT A;  3KC1 A;  2DP8 A;  4MNP A;  3MVY A;  1QUK A;  4O3C A;  2F7B A;  3TMG A;  3G3F A;  4I8C A;  3FVN A;  3VLW A;  3G3H A;  5F1Q A;  2VP1 A;  2W7Y A;  3QAX A;  1UIU A;  4G61 A;  3THI A;  3KN3 A;  3BIG A;  1B7Z A;  4MMP A;  1NUZ A;  5IAI A;  1DK4 A;  1GTK A;  4MAG A;  4XXU A;  2GHB A;  5CMC A;  2ZNU A;  4U1O A;  1B0H A;  5I7I A;  1WOD A;  1SW4 A;  3VVF A;  5AE4 A;  4U4S A;  4OVR A;  1CE2 A;  2VOZ A;  1T0K A;  5I3S A;  3Q27 A;  2QVV A;  4PBQ A;  3K02 A;  4O3B A;  1XT8 A;  2PFZ A;  1FRP A;  1UTH A;  3IL1 B;  3T96 B;  3IAZ A;  1ZTY A;  1NV4 A;  5KCJ A;  1R9L A;  3FAT A;  3M3L A;  3G7W A;  1O64 A;  4F1Y A;  2A5T B;  3FXU A;  2VGQ A;  1TXF A;  3LBS A;  1JEU A;  2I3W A;  2P3V A;  5I2N A;  5ITP A;  1FTJ A;  1MH4 A;  4F19 A;  2QPQ A;  2WKY A;  2B65 A;  1B4H A;  2XXT A;  4GQO A;  4R9G A;  4AB6 A;  4JSO A;  2VT5 A;  2QS4 A;  1LBW A;  2DE3 A;  5TP9 B;  3RLF E;  5I57 B;  2ZXT A;  5CMK A;  3KSX A;  2PCR A;  1YYZ A;  3H4Z A;  3TFL A;  3T1B A;  5JEI A;  2RC7 A;  3TTN A;  1ZMG A;  3WAF A;  1SYH A;  3LSX A;  2F97 A;  1OQH A;  4YKI A;  2H98 A;  2ZYO A;  1SPI A;  4PC9 A;  2VPN A;  3U72 A;  1J1N A;  4X1D A;  2WBB A;  2Q8M A;  3UIF A;  4AQ4 A;  3MPK A;  3EQ1 A;  1N76 A;  3H6U A;  4MH5 A;  1FPL A;  2HPG A;  1URD A;  3PD8 A;  4U2R A;  1MDP 1;  1Z7M E;  2PYY A;  4QSC A;  4NF8 B;  3D4G A;  1B51 A;  1K9Z A;  3OO6 A;  3RQT A;  1Y20 A;  4P3L A;  3S2V A;  4IO2 A;  4KQP A;  1LCT A;  3IFA A;  3UOR A;  1FBF A;  1Y3Q A;  1MXV A;  1A8F A;  1QJM A;  4U22 A;  3TEP A;  1NV0 A;  2DVZ A;  1QUI A;  3U65 A;  5FHN A;  1G0H A;  4RK2 A;  3TCH A;  2XHD A;  1UTB B;  4PF8 A;  3N94 A;  4OZ9 A;  4GWS A;  3A3U A;  4OEV A;  3AXF A;  2O1L A;  2NOO A;  2D21 A;  2ZMB A;  2V3Q A;  3M3F A;  2YPN A;  4Z0I A;  3G3K A;  1GV8 A;  5B70 A;  1UIV A;  4NN3 A;  3RT6 B;  3TAJ A;  2XXH A;  4PGN A;  3HHG A;  3ONM A;  2XA5 A;  3TEL A;  4NAP A;  4R9F A;  2QS3 A;  4GWW A;  4ELR A;  2Y7I A;  4UAB A;  1VFD A;  2PT1 A;  1ZKB A;  3KJ7 A;  1R9Q A;  1PEB A;  1PB7 A;  1VFE A;  1GVC A;  1EH3 A;  2CZL A;  1US5 A;  5FTI A;  3TQW A;  5TP9 A;  1L5T A;  4YB7 A;  4KXP A;  3V83 A;  2E0S A;  4N8Y A;  3FJG A;  5H8Q A;  4OWD A;  4GX4 A;  4X9T A;  2WYK A;  2P3N A;  3B6Q A;  3B50 A;  1ELJ A;  4QXD A;  3V8X B;  3DP4 A;  1EYJ A;  1R1N A;  3V5A A;  3ZKK A;  4BDQ A;  2UVH A;  4LZ5 A;  1MQH A;  4OTE A;  3OMB A;  4QSD A;  1SI1 A;  3LR1 A;  3TOD A;  1B2H A;  1R6Z A;  4JDF A;  3CR9 A;  2XX8 A;  4NF4 A;  4ZEF A;  2NWJ A;  1IXC A;  1FCK A;  1N0T A;  2O7U A;  1HSE A;  3OSQ A;  2I0B A;  3RN8 A;  4O94 A;  3VE1 B;  4GWU A;  4ZDM A;  1DOT A;  4XKR A;  4GL0 A;  2Z8E A;  1FPI A;  1FBH A;  2HXW A;  1B4Z A;  4N6K A;  1YAE A;  1B0L A;  1MQD A;  4FEC A;  1SQY A;  1IMF A;  4NF6 A;  1YPN A;  1B40 A;  4OVQ A;  1KZ8 A;  5DEX A;  3MBP A;  2E1S A;  4N91 A;  1D9V A;  5EHM A;  1XI6 A;  4HTG A;  4OVT A;  3T93 B;  1SVX B;  2F36 A;  3N5L A;  3KZG A;  2ZZX A;  2DDK A;  4QFP A;  3DEL B;  5I59 B;  1O7T A;  4KYS A;  2F8D A;  3LUZ A;  1Y9U A;  3E4R A;  3K1M A;  1KWH A;  3MYU A;  4PFI A;  2DE2 A;  3E3K A;  4WXJ A;  1FTM A;  1LAX A;  4RK9 A;  4DCX A;  1FBG A;  3VLV A;  1NH8 A;  1IMA A;  1LST A;  2DYX A;  4EUO A;  3OEM A;  3QK6 A;  3OXN A;  3PTY A;  3SEV A;  2DWA A;  4TQU Q;  2DXY A;  2XWI A;  3U92 A;  3SKP A;  2F5X A;  4F3S A;  3OSR A;  3PUW E;  1MDQ A;  1USY E;  1S9T A;  1FPE A;  1H45 A;  4F2O A;  2B3F A;  1A40 A;  1MG1 A;  1QUL A;  3M8U A;  1IQ7 A;  4OHN A;  4RXL A;  4N6P A;  1SYI A;  3T9V A;  4EXK A;  3CG3 A;  1IZ1 A;  3FUZ A;  5TU0 A;  4KFQ A;  3O28 A;  3FV2 A;  1DSN A;  1SDX A;  5L8D A;  3TTM A;  4BLA A;  2QMW A;  1LAH E;  3RT8 A;  3K0V A;  2Q9T A;  3MJN A;  2QVU A;  1OLC A;  3FXR A;  5DEX B;  1FQE A;  4DCY A;  2QJE A;  1RDZ A;  2ZZV A;  3T0J A;  2L5V A;  4R6K A;  5ESY A;  5EYH A;  4DI3 D;  1FPK A;  2RCB A;  3HV1 A;  2DWI A;  1P99 A;  3U93 A;  2XXP A;  1XVX A;  4KYE A;  3LSF B;  2CZH A;  1P1Q A;  2ONK E;  4F31 B;  2XXI A;  5F24 A;  4G68 C;  4MCO A;  4YB5 A;  5H8H B;  4NMY A;  2DQV A;  1IIW A;  1A99 A;  3FGS A;  4FAJ A;  3KFM A;  2OZZ A;  2BJI A;  3R6U A;  4GX3 A;  4MLQ A;  1NV2 A;  4NF5 B;  4TOZ A;  4N81 A;  1EZ9 A;  1HSJ A;  1POY 1;  2Q74 A;  3CIJ A;  3K6U A;  2HAU A;  3U8Q A;  1Y1Z A;  2XWK A;  4KCC A;  2GHA A;  3IX1 A;  2WEF A;  1XVY A;  4OVP A;  3RPW A;  3LUY A;  1NMU A;  5LTC A;  4YAH X;  3H7M A;  3VDF A;  3MZB A;  1WDN A;  3QXM A;  1B7H A;  3PPP A;  3TTK A;  3OO9 A;  3FXQ A;  5I57 A;  4PFW A;  1MY1 A;  4RA1 A;  4PDD A;  2HQ0 A;  5DVI A;  2ABH A;  5AA4 A;  1DBZ A;  1RDX A;  4QRZ A;  4LZ8 A;  1NL5 A;  3PPR A;  3MAM A;  3E78 A;  3BBR A;  1OIB A;  5IZ3 A;  4OEU A;  2XXR A;  3C33 A;  1SW5 A;  4YMB A;  4AB5 A;  1B1X A;  1S50 A;  5I2K A;  5DT6 A;  2NVU B;  3IB0 A;  3G3G A;  4NTL A;  4DXC A;  1Y4T A;  2KLF A;  2V4C A;  1M5C A;  4BDO A;  4C1U A;  3S9M C;  5KCJ B;  3C9H A;  1FPG A;  3BIH A;  3JZJ A;  1N3X A;  5JTY A;  4P1L A;  3VFJ A;  2QMX A;  1JEV A;  3HHF A;  1P1U A;  3GYY A;  4RYA A;  5CBS A;  3HST A;  1FBP A;  3O6H A;  1LGB C;  3VLU A;  3QYT A;  4NED A;  5CBR A;  3ODB A;  4JWY A;  1NFT A;  4Q5T A;  3MQ9 A;  4OXV A;  1ZJL A;  3KC0 A;  4YKK A;  5IZ1 A;  3U94 A;  4MEV A;  4P8B A;  2Z8F A;  2DOJ A;  1JW1 A;  3FJ7 A;  3RYD A;  2FBP A;  3SES A;  2WX9 A;  4EDP A;  4P56 A;  4R75 A;  3EN3 A;  1N7X A;  4OMB A;  2HHM A;  1LAF E;  2GH9 A;  4HE2 A;  4GD5 A;  4PFT A;  3DP6 A;  3GLB A;  1FTK A;  1IEJ A;  4AS5 A;  4MIJ A;  4LQ5 A;  4MX6 A;  2LAO A;  5IKB A;  4ZZA A;  1URG A;  2V25 A;  5K2X A;  2HEU A;  5H8Q B;  2THI A;  4N8G A;  2O1M A;  3K2D A;  5AA4 B;  4NE4 A;  3Q28 A;  1N84 A;  3P7I A;  4GX6 A;  1GR2 A;  5EQ9 A;  1IIT A;  2VD3 A;  4Q8R A;  4FJP A;  3O66 A;  5HM4 B;  4FED A;  1INP A;  4M1V A;  1LFI A;  3IJO B;  1TFD A;  1M5D A;  3K1P A;  3E13 X;  3TZA A;  2O84 X;  4ZE8 A;  2ALU A;  2YLN A;  1MXW A;  5ET6 A;  3W15 C;  4R72 A;  4KI0 E;  4R2B A;  4PET A;  1USY H;  4TLL B;  3RTF B;  5CMM A;  2P2A A;  4GBW A;  3FD3 A;  3KEI A;  2H25 A;  3FV1 A;  3Q26 A;  4HCY A;  3I6V A;  4XTC Q;  2R6G E;  4E0W A;  4KHZ E;  1LFH A;  3KGC A;  2M8C A;  2F34 A;  4LQ2 A;  3Q29 A;  5EQ7 A;  4PFB A;  1LAG E;  3SET A;  4OAN A;  3DM0 A;  1SW1 A;  2QRY A;  2GRV A;  2I48 A;  5EHS A;  2VPO A;  2UVI A;  2VD2 A;  3TTR A;  5H8H A;  4JVD A;  3MST A;  2X7P A;  1AL3 A;  4DZ1 A;  2DVC A;  5J1D A;  3N6U A;  2XX7 A;  3TCF A;  4M4G A;  2Q88 A;  5J16 A;  1AMF A;  4P1E A;  1MY2 A;  3IOW A;  3L6G A;  3B6T A;  3U1O A;  3S9N C;  3K6V A;  3L6H A;  1H76 A;  1B9J A;  1SBP A;  4OVS A;  4QF9 A;  4ZS9 A;  2HXR A;  1ZLQ A;  4IB2 A;  4KR5 A;  4OFO A;  4QFL A;  4U1Z A;  4ECF A;  1I6B A;  2I4C A;  1HSL A;  4G8M A;  2CZK A;  1XS5 A;  1Y3N A;  4I62 A;  3IOT A;  3CFZ A;  4U21 A;  5KDT B;  1JNF A;  3IB1 A;  4JXI A;  1OVT A;  3FZV A;  5LDZ A;  4YIC A;  1NUX A;  4OES A;  4NWC A;  4RPN A;  4PFY A;  4N6D A;  3HN0 A;  5AA3 A;  3C36 A;  1ANF A;  4R6Y A;  4GWY A;  1MY0 A;  3PV0 E;  1I6A A;  3Q25 A;  5A5X B;  3SEU A;  3CSB A;  5A5L A;  5K2Y A;  4PAK A;  2OWS A;  1EZO A;  4OET A;  1QVS A;  2UYF A;  3RGY A;  2ZYM A;  2I58 A;  3CSG A;  2A5T A;  3QIM A;  3TPA A;  4ZEI A;  3RNN A;  4NQ8 A;  4XEQ A;  1NNF A;  1QKB A;  3TYH A;  4KD5 A;  4GRK A;  4ZED A;  1FTL A;  3K4U A;  1B58 A;  1N04 A;  3ECR A;  2QL3 A;  1QUJ A;  1KA0 A;  5L9O A;  1O63 A;  3T66 A;  1H44 A;  4OQO A;  3VXC A;  4I3E A;  2FNC A;  3RPL B;  5L9S A;  4O7M A;  3MP6 A;  5I84 A;  1NV1 A;  4GXA A;  1II5 A;  2XXW A;  2CEY A;  4I1D A;  1A55 A;  1B7U A;  1LCF A;  3EHS A;  1LEV A;  4PE5 B;  3T22 A;  5HPQ A;  4NG7 A;  4FE8 A;  1H43 A;  2PX1 A;  4POW A;  2I0C A;  2F35 A;  4R6H A;  1KA1 A;  1QKA A;  2KQZ A;  1MM6 A;  1IMC A;  4OYV A;  4LUB A;  1Q35 A;  3EHU A;  2ESN A;  4ELO A;  4FAT A;  1GGG A;  3MUQ A;  4NF8 A;  4WEP A;  4ESX A;  1CNQ A;  4P9K A;  3HPI A;  1VSO A;  4MF3 A;  4F18 A;  5KDT A;  1YCJ A;  2ONR A;  4F1V A;  5ICQ A;  2NXO A;  5F7V A;  3G3J A;  4YMA A;  3PUZ E;  1IXI A;  2Q89 A;  1MPD A;  4G4P A;  4F22 A;  1P1N A;  1SI0 A;  5IZ3 B;  2AL5 A;  4H8I A;  3O29 A;  1WVJ A;  4EQB A;  4JB7 A;  4GWZ A;  3C4M A;  5I2K B;  1LBY A;  2XX9 A;  5I59 A;  5LOM A;  3IB2 A;  5BUU A;  3KBZ A;  3IK6 B;  3PD9 A;  1Y4C A;  3K1N A;  3IR1 A;  2O51 A;  4RY1 A;  5H8F A;  4N13 A;  4YKP A;  3MP1 A;  2V3U A;  3A29 A;  3T9U A;  4R74 A;  2F7A A;  5ISU A;  1XHY A;  4TLM B;  3S9E A;  2ZNT A;  2OLB A;  2HZK A;  3FVG A;  5AA2 D;  2UVJ A;  1CB6 A;  5ET8 A;  1LLS A;  2ZYK A;  1NI9 A;  4C0R A;  2Z22 A;  3MZ9 A;  3A3C A;  1BIY A;  2X7Q A;  5ET5 A;  4PGP A;  3PPQ A;  5AA2 B;  1Q9D A;  5CRY A;  3H6T A;  4ZEC A;  4GXS B;  3PGF A;  1NNK A;  1MQI A;  4H65 A;  1K9Y A;  4XKQ A;  3MP8 A;  4R73 A;  1JVX A;  3HCQ A;  4LZ7 A;  5I56 A;  3O6I A;  3F11 A;  5I56 B;  3UK4 A;  4MNC A;  4LP2 B;  1B5J A;  4F3G A;  5HBC A;  4YZZ A;  4P47 A;  3EKI A;  5TPA B;  3K00 A;  1MQJ A;  4RJZ A;  2REG A;  2OWZ A;  4H8J A;  1N7W A;  4K3F A;  4PAI A;  2I6E A;  1FQD A;  1FQC A;  4FEB A;  3V89 B;  3USD A;  4ESW A;  1LBV A;  3PUY E;  4PTK A;  5FHM A;  2VHA A;  1LBZ A;  2DXR A;  1DTZ A;  4N07 A;  3ISP A;  1US4 A;  2XWO A;  3IFC A;  3VVE A;  1MY3 A;  1MQG A;  1RKM A;  4O7I A;  5A5X A;  1UTH B;  4YU0 A;  2WBD A;  1TFA A;  3IOV A;  2PMS A;  2HZL A;  5ICT A;  3GXA A;  3WAE A;  2HFB A;  3G3I A; 
#chains in the Genus database with same CATH homology
 2D5W A;  2Y7I A;  2F7C A;  4HS7 A;  3A09 A;  1GR2 A;  1VFD A;  3FVO A;  1IIT A;  4BDM A;  5FHO A;  2PT1 A;  2VD3 A;  2OBG A;  3ILU B;  1AH5 A;  4Q8R A;  1ZKB A;  3O66 A;  3KJ7 A;  1LFG A;  1R9Q A;  2Y7W A;  1PEB A;  4FED A;  2Y7K A;  4FJP A;  4L17 A;  4M1V A;  1LFI A;  3O9P A;  1PB7 A;  1I6Q A;  2ZYN A;  1VFE A;  3IJO B;  1EH3 A;  1TFD A;  1GVC A;  2CZL A;  4ELQ A;  1M5D A;  1VR5 A;  2F6G A;  3K1P A;  3E13 X;  3TZA A;  2V93 A;  2O84 X;  1I69 A;  4ZE8 A;  1US5 A;  5FTI A;  2QS1 A;  3O6G A;  4GFR A;  2ALU A;  3OD7 A;  4IO6 A;  3TQW A;  1MXY A;  4DXU A;  4GWO A;  2YLN A;  1MXW A;  5TP9 A;  1L5T A;  4YB7 A;  2RIN A;  3IJX B;  3W15 C;  3V83 A;  4R72 A;  3CI8 A;  4OEN A;  3KJT A;  4ND9 A;  5H8N B;  4EQ7 A;  1A7L A;  2E0S A;  4KI0 E;  1FQB A;  2V84 A;  4R2B A;  3PMX A;  4PET A;  3PMV A;  3TTL A;  1JET A;  1USY H;  2I3V A;  1JQF A;  2Z8D A;  3B6W A;  2DE4 A;  4TLL B;  3RTF B;  2RCA A;  1P1W A;  3FJG A;  2P1S A;  2P2A A;  4XKP A;  5CMM A;  5H8Q A;  3FD3 A;  4OWD A;  1LB9 A;  5CI5 A;  3KEI A;  4X9T A;  2Q2C A;  1NNT A;  3QSL A;  3K6X A;  1AOV A;  2H25 A;  3FV1 A;  3Q26 A;  4HCY A;  3I6V A;  4XTC Q;  3B6Q A;  2F78 A;  2OJT A;  2R6G E;  1ELJ A;  3PU5 A;  3V8X B;  4E0W A;  3DP4 A;  4KHZ E;  1R1N A;  1LFH A;  5JTY B;  3V5A A;  3ZKK A;  3KGC A;  4BDQ A;  2M8C A;  3QUJ A;  2F34 A;  1N3W A;  2UVH A;  3OEL A;  4G68 A;  3Q29 A;  4LQ2 A;  4LZ5 A;  3S4U A;  3MW0 A;  1MQH A;  4OTE A;  1LAG E;  3OMB A;  4QSD A;  1SI1 A;  2XXV A;  2XD2 A;  3SET A;  1VE4 A;  3RTW B;  3DM0 A;  3LR1 A;  1LBC A;  1SW1 A;  3KOS A;  1B46 A;  4LAT A;  3TOD A;  3KN8 A;  1B2H A;  1R6Z A;  2Z23 A;  1B32 A;  4JDF A;  4ONY A;  4OFJ A;  3UN6 A;  3CR9 A;  2XX8 A;  4NF4 A;  4ZEF A;  2NWJ A;  1MY4 A;  3GBB A;  1PDA A;  4P0G A;  1IXC A;  1EU8 A;  2QRY A;  3H03 A;  5H8N A;  3PMW A;  1FCK A;  3TDJ A;  2GRV A;  3PPO A;  1N0T A;  1B3F A;  2O7U A;  3EPE A;  5M2V A;  1HSE A;  3MWB A;  2I48 A;  3OSQ A;  2I0B A;  5L9M A;  3RN8 A;  1FTO A;  3VE1 B;  5CM6 A;  5ELV A;  1M5F A;  1MH3 A;  2AL4 A;  4ZDM A;  3LSW A;  4ZEB A;  5EHS A;  2QSX A;  1DOT A;  2DSF A;  2UVI A;  2VD2 A;  2XXY A;  3TTR A;  1H3D A;  2AIX A;  1DPP A;  4GL0 A;  1DTG A;  2Z8E A;  4XKR A;  4F3B A;  2RKM A;  3UA8 A;  5H8H A;  5TPA A;  2HXW A;  4XIG Q;  2ZNS A;  1B4Z A;  2X7P A;  1AL3 A;  3ZKL A;  1YAE A;  1B0L A;  1MQD A;  4FEC A;  1RYO A;  1SQY A;  4DZ1 A;  2DVC A;  1TWY A;  4NF6 A;  1YPN A;  2G29 A;  3O2A A;  1B40 A;  1DMB A;  4NF6 B;  1MPC A;  3N6U A;  5ICT A;  2XX7 A;  3TCF A;  5J1D A;  3OEN A;  5DEX A;  2DWH A;  5JK4 A;  4M4G A;  2Q88 A;  3MBP A;  1B05 A;  2E1S A;  1AMF A;  3KOT A;  1P1O A;  1D9V A;  2O69 A;  4RNS A;  5EHM A;  1MY2 A;  4X1B A;  3IOW A;  3FAS A;  1B52 A;  2A5S A;  1ZBM A;  3IO4 A;  3L6G A;  4HTG A;  3SEX A;  1Q1K A;  3CFX A;  3T93 B;  3B6T A;  3U1O A;  3S9N C;  5AE4 A;  4DXB A;  1NH7 A;  1SVX B;  1ATG A;  2F36 A;  3K6V A;  2V3T A;  3KZG A;  3L6H A;  3N5L A;  1H76 A;  1B9J A;  3SEW A;  4EXL A;  1SBP A;  5DYH A;  3MZ1 A;  4QFP A;  4QF9 A;  4ZS9 A;  4U4X A;  1D4N A;  1D3K A;  2DS9 A;  4OER A;  4QFO A;  3DEL B;  3K01 A;  4FIM A;  4IY5 A;  1ZLQ A;  4IB2 A;  2Y7R A;  4KR5 A;  4OFO A;  4QFL A;  1A8E A;  4U1Z A;  5I59 B;  2F6P A;  1O7T A;  4H67 A;  4KYS A;  4ECF A;  1I6B A;  2B3B A;  2F8D A;  2I4C A;  1HSL A;  4UAC A;  1XOC A;  1OLA A;  1Y9U A;  2GFE A;  3HO7 A;  4G8M A;  3E4R A;  4H6D A;  1XS5 A;  2HCA A;  3K1M A;  1KWH A;  3H06 B;  1Y3N A;  4I62 A;  3IOT A;  2DE2 A;  2G93 A;  4WED A;  3CFZ A;  2X26 A;  4JSD A;  4U21 A;  2R71 A;  4THI A;  5DVF A;  1B3E A;  3E3K A;  4WXJ A;  2P0S A;  5KDT B;  1FTM A;  3ILT B;  1LAX A;  4ZEK A;  4RK9 A;  4DCX A;  1JNF A;  2XXU A;  3IB1 A;  3GBA A;  1Y1M A;  1BTJ A;  3VLV A;  4JXI A;  3ZS6 A;  1OVT A;  3FZV A;  1Y3P A;  4G8H A;  4ZZE A;  1NH8 A;  1MS7 A;  1Z7N E;  4YIC A;  2R9J A;  4OES A;  4QFK A;  3SDF A;  1LST A;  3GZG A;  2PT2 A;  4NWC A;  4RPN A;  4PFY A;  4E0X A;  4NWD A;  3H6W A;  4KPT A;  2D3I A;  3HN0 A;  2DYX A;  2HFB A;  3C36 A;  1ANF A;  3MVX A;  4G2Z A;  4R6Y A;  4EUO A;  3OEM A;  1A54 A;  4GVO A;  5EYF A;  3QK6 A;  3C34 A;  1TT1 A;  3DLN A;  1MY0 A;  3PV0 E;  2HAV A;  1I6A A;  1MXU A;  3BKI B;  3OXN A;  4ESX A;  5CC2 A;  3Q25 A;  3W9V A;  1MXX A;  3SEV A;  3SEU A;  5A5X B;  4QHQ A;  1JW5 A;  2DWA A;  3BFU A;  3MC2 A;  4TQU Q;  3SEY A;  2DXY A;  3CSB A;  3U92 A;  5K2Y A;  1JVY A;  3SKP A;  1PB8 A;  1B5H A;  1M5B A;  3ZSF A;  2OWS A;  4HCW A;  1EZO A;  4GOT A;  2F5X A;  4P11 A;  4OET A;  3TKD A;  3MVZ A;  4F3S A;  1BP5 A;  1QVS A;  2UYF A;  3OSR A;  3PUW E;  1MDQ A;  1USY E;  2ZYM A;  3RGY A;  1S9T A;  2I58 A;  3CSG A;  1LB8 A;  2A5T A;  3QIM A;  5H8F B;  1H45 A;  3TPA A;  3TQL A;  5FTH A;  4ZEI A;  4G8N A;  1IUD A;  3RNN A;  4F2O A;  4X48 A;  1FQA A;  4EF1 A;  2B3F A;  1NNF A;  1B3L A;  1QKB A;  4JWX A;  3EHT A;  4KD5 A;  5CMB A;  3TYH A;  1A40 A;  1MG1 A;  1SD3 A;  2H9B A;  2UXA A;  1QUL A;  2YJP A;  3C35 A;  3H6V A;  1FTL A;  3IOU A;  3M8U A;  3K4U A;  4ZED A;  1NKX A;  5I58 A;  1B58 A;  2RC9 A;  3PPN A;  3B7D A;  3PUV E;  1IQ7 A;  4OHN A;  4RXL A;  3C31 A;  5I58 B;  1RYX A;  4N6P A;  1N04 A;  1SYI A;  3ECR A;  4JWO A;  3T9V A;  3JV9 A;  1SW2 A;  2I4B A;  1LBB A;  1MM7 A;  2QL3 A;  1QUJ A;  3CG3 A;  1IZ1 A;  2H4I A;  4H1X A;  4Q30 B;  1IXG A;  3MVW A;  5L9O A;  1O63 A;  3FUZ A;  5TU0 A;  4GL8 A;  4KFQ A;  3FIR A;  3O28 A;  3T66 A;  1H44 A;  4MLV A;  1YTV A;  4JBZ A;  4OQO A;  3VXC A;  2FNC A;  3FV2 A;  1DSN A;  1SDX A;  4Z7E A;  5L9S A;  5B7D A;  3MP6 A;  5L8D A;  3TTM A;  5AA2 A;  1S7Y A;  4BLA A;  5I84 A;  2QMW A;  4O3A A;  4GXA A;  2FYI A;  1II5 A;  2ONS A;  2XXW A;  4I1D A;  1LAH E;  3RT8 A;  2O6A A;  1A55 A;  1ZU0 A;  5BWJ A;  4H5F A;  4MFI A;  3R7X A;  1B7U A;  3K0V A;  4GF8 A;  3H3G A;  4OVJ A;  1LCF A;  2Q9T A;  3EHS A;  4G68 B;  4PE5 B;  3T22 A;  4KYD A;  2XXQ A;  3BFT A;  4PP0 A;  3MJN A;  1MXZ A;  2BJJ X;  4F39 A;  1OLC A;  4YKJ A;  3FXR A;  3PUX E;  5HPQ A;  5DEX B;  1FQE A;  3O97 A;  4DCY A;  1NNP A;  4GLI A;  4FE8 A;  2XD3 A;  1H43 A;  2PX1 A;  2QJE A;  1B5I A;  4LA9 A;  1UQW A;  4POW A;  1IXH A;  2I0C A;  4NF4 B;  2F35 A;  3CG1 A;  3M3K A;  4R6H A;  4IGT A;  4R6K A;  2Q2A A;  1AIV A;  4PFU A;  1QKA A;  4R2F A;  2DP8 A;  1UTB A;  2RCB A;  4H5G A;  3HV1 A;  2DWI A;  1P99 A;  3MVY A;  1MM6 A;  3U93 A;  2XXP A;  1XVX A;  1QUK A;  4KYE A;  4EQ9 A;  3LSF B;  4O3C A;  4OYV A;  2F7B A;  5HM4 B;  3MPL A;  4LUB A;  3TMG A;  1Q35 A;  3EHU A;  5I57 B;  2ESN A;  3G3F A;  1P1Q A;  4I8C A;  3CFL A;  3S9L C;  3FVN A;  2ONK E;  3DP8 A;  4ELO A;  4FAT A;  4F31 B;  1GGG A;  3MUQ A;  2XXI A;  4NF8 A;  4G68 C;  3VLW A;  2OCU A;  4WEP A;  4DE8 A;  3G3H A;  4IO5 A;  4YB5 A;  5F1Q A;  2VP1 A;  4NMY A;  2DQV A;  5H8H B;  1IIW A;  2W7Y A;  3VXB A;  1A99 A;  3FGS A;  3FVK A;  3VVD A;  2RF1 A;  4FAJ A;  3EF7 A;  3QAX A;  1UIU A;  3HPI A;  3THI A;  3KN3 A;  4UA8 A;  3I3V A;  1VSO A;  4C1T A;  2PVU A;  4BDR A;  3KFM A;  3LSL A;  3N26 A;  2OZZ A;  1B7Z A;  4MF3 A;  4DIG A;  3R6U A;  2OWT A;  4F18 A;  5KDT A;  3TCG A;  1YCJ A;  2ONR A;  4F1V A;  4MLQ A;  3KBR A;  5IAI A;  5ICQ A;  4NF5 B;  2O7I A;  2NXO A;  4TOZ A;  5F7V A;  3G3J A;  1EZ9 A;  1GTK A;  4YMA A;  1HSJ A;  1POY 1;  1IXI A;  2DWJ A;  3PUZ E;  2QS2 A;  3K6U A;  3CIJ A;  3OO8 A;  2GHB A;  4XXU A;  3RY3 A;  2HAU A;  3UGW A;  4F3P A;  3U8Q A;  1Y1Z A;  1MPD A;  1OQG A;  2Q89 A;  4KCC A;  5I2N B;  2GHA A;  3IX1 A;  4POX A;  2RC8 A;  5CMC A;  4F2Q A;  1XVY A;  4G4P A;  2ZNU A;  4U1O A;  1B0H A;  3RPW A;  3LUY A;  1NMU A;  4F22 A;  1OVB A;  4YAH X;  1P1N A;  3H7M A;  3R26 A;  1WOD A;  1SW4 A;  3MZB A;  3VDF A;  3VVF A;  4U4S A;  1SI0 A;  1WDN A;  3QXM A;  1B7H A;  1CE2 A;  5AA4 B;  3PPP A;  3K6W A;  2AL5 A;  2VOZ A;  3TTK A;  4U23 A;  4H8I A;  1T0K A;  3O29 A;  3OO9 A;  1WVJ A;  3Q27 A;  3FXQ A;  4JB7 A;  4G77 A;  4LVQ A;  4EQB A;  3OOA A;  5I57 A;  4EF2 A;  3T9X B;  3C4M A;  4PFW A;  3K02 A;  1BLF A;  4YB6 A;  5I2K B;  2XX9 A;  1MY1 A;  4O3B A;  5I59 A;  2XXX A;  3IB2 A;  4RA1 A;  1XT8 A;  5LOM A;  5BUU A;  1F9B A;  2HQ0 A;  1UTH A;  5DVI A;  1PB9 A;  2ABH A;  1PBQ A;  3IL1 B;  4DDD A;  5AA4 A;  3T96 B;  3IAZ A;  4F1U A;  3IK6 B;  2Y7P A;  1ZTY A;  3PD9 A;  4RPO A;  1PC3 A;  1Y4C A;  4QRZ A;  4GIZ A;  1B3G A;  3SER A;  5KCJ A;  1R9L A;  3FAT A;  1XC1 A;  3K1N A;  3IR1 A;  3M3L A;  1B3H A;  4P0I A;  3G7W A;  2O51 A;  1O64 A;  4RY1 A;  3RUM A;  4F1Y A;  2A5T B;  3FXU A;  2VGQ A;  5H8F A;  1TXF A;  3LBS A;  4N13 A;  4IO3 A;  4QSE A;  4YKP A;  2H5Y A;  1JEU A;  3MP1 A;  2V3U A;  2I3W A;  4LZ8 A;  4Q0C A;  3T9U A;  1NL5 A;  2IA4 A;  4R74 A;  3FJM A;  5I2N A;  5ITP A;  1FTJ A;  3UP9 A;  1MH4 A;  4WKM A;  3PPR A;  2REJ A;  3JYR A;  2QPQ A;  2F7A A;  4MBP A;  2WKY A;  1D9Y A;  3CVG A;  3MAM A;  4F19 A;  1XHY A;  5ISU A;  2B65 A;  1QW0 A;  1B4H A;  2XXT A;  3BBR A;  1OIB A;  4TLM B;  4GQO A;  2ZNT A;  4R9G A;  3S9E A;  2OLB A;  2HZK A;  2XXR A;  3C33 A;  4JSO A;  4OEU A;  5AA1 A;  4AB6 A;  1SW5 A;  2QS4 A;  3OEK A;  4YMB A;  2DE3 A;  3FVG A;  5TP9 B;  3RLF E;  4AB5 A;  5AA2 D;  2UVJ A;  1B1X A;  2ZXT A;  1S50 A;  4I9D A;  3KSX A;  3T9H B;  5CMK A;  5I2K A;  3KN7 A;  5DT6 A;  2NVU B;  4ELP A;  1CB6 A;  3CRB A;  3IB0 A;  3G3G A;  1LLS A;  2ZYK A;  3H4Z A;  4C0R A;  3TFL A;  2Z22 A;  4NTL A;  2PBW A;  4DXC A;  3LC8 A;  1Y4T A;  3MZ9 A;  1EZP A;  2KLF A;  3A3C A;  5JEI A;  1BIY A;  2X7Q A;  2RC7 A;  3TTN A;  1ZMG A;  3WAF A;  1M5C A;  3KSJ A;  3PPQ A;  4BDO A;  1BKA A;  4LON B;  4C1U A;  4DLD A;  5AA2 B;  3S9M C;  5KCJ B;  1SYH A;  5AA3 A;  3LSX A;  5CRY A;  2F97 A;  4BDN A;  3H6T A;  3D4C A;  1OQH A;  3C9H A;  4ZEC A;  4YKI A;  2H98 A;  2ZYO A;  3JZJ A;  1N3X A;  2H99 A;  5JTY A;  4GXS B;  3IO6 A;  2QMX A;  1JEV A;  3PGF A;  4IO7 A;  3VFJ A;  1M5E A;  2IEE A;  2Q8J A;  4ELR A;  5H8S A;  3HHF A;  1J1N A;  1NNK A;  4H0W A;  3U72 A;  4X1D A;  1P1U A;  4OFL A;  3UIF A;  5KZT A;  1MQI A;  2ANJ A;  4RYA A;  4AQ4 A;  5CBS A;  3HST A;  1PBP A;  4H65 A;  3MPK A;  3EQ1 A;  3O6H A;  1N76 A;  3QUF A;  4XKQ A;  1LGB C;  3I5O A;  3VLU A;  3H6U A;  3MP8 A;  4IGR A;  4MH5 A;  1OMP A;  1URD A;  4R73 A;  1JVX A;  2Y84 A;  3QYT A;  3PD8 A;  4NED A;  3HCQ A;  3IOR A;  4LZ7 A;  4U2R A;  3ODB A;  5CBR A;  3O6I A;  1POT A;  3OO7 A;  1NFT A;  4JWY A;  5I56 A;  3F11 A;  1MDP 1;  5I56 B;  3UK4 A;  4Q5T A;  1JW4 A;  3MQ9 A;  4OXV A;  1Z7M E;  1ZJL A;  4FOR A;  4LP2 B;  1B5J A;  3KG2 A;  4YKK A;  2PYY A;  4QSC A;  5HBC A;  4F3G A;  4YZZ A;  3U94 A;  4NF8 B;  4HW8 A;  2Z8F A;  3D4G A;  3TUS A;  3VV5 A;  1B51 A;  2DOJ A;  2NUV A;  3OO6 A;  4EXK A;  2FA7 A;  1JW1 A;  3FJ7 A;  3RQT A;  4F29 A;  5TPA B;  1Y20 A;  1FQF A;  3C32 A;  1MQJ A;  3K00 A;  4RJZ A;  3S2V A;  2UYE A;  2REG A;  4GRK A;  4IO2 A;  4H8J A;  1MRP A;  1N7W A;  4IY6 A;  4K3F A;  1B6H A;  1LCT A;  4KQP A;  3SES A;  3E9X A;  3UOR A;  2I6E A;  1Y3Q A;  5ITO A;  1MXV A;  4EDP A;  1A8F A;  1FQD A;  1QJM A;  4R75 A;  2OK2 A;  4KCD A;  4U22 A;  3TEP A;  3EN3 A;  1N7X A;  4NF5 A;  4OMB A;  1LAF E;  2GH9 A;  1FQC A;  3N6T A;  2DVZ A;  4FEB A;  3USD A;  1QUI A;  3V89 B;  5FHN A;  4GD5 A;  5DVJ A;  4RK2 A;  1B1H A;  2UVG A;  3TCH A;  4PFT A;  2XHD A;  3PUY E;  3DP6 A;  1UTB B;  4QFN A;  4ESW A;  4ZE9 A;  5FHM A;  2VHA A;  4IO4 A;  3GLB A;  1FTK A;  2DXR A;  3N94 A;  1DTZ A;  4OZ9 A;  1MPB A;  1IEJ A;  3A3U A;  4OEV A;  3AXF A;  2O1L A;  1URS A;  2D21 A;  2NOO A;  4N07 A;  2ZMB A;  1DPE A;  1US4 A;  2V3Q A;  2O68 A;  4LQ5 A;  3M3F A;  4XKN A;  4PQJ A;  1MY3 A;  3VVE A;  2YPN A;  2I49 A;  2LAO A;  4Z0I A;  3G3K A;  1GV8 A;  5B70 A;  5IKB A;  1MQG A;  1RKM A;  3W9W A;  4BDL A;  1UIV A;  3RT6 B;  3TAJ A;  4ZZA A;  2XXH A;  1UTH B;  1URG A;  2V25 A;  4YU0 A;  3HHG A;  5A5X A;  1ZIU A;  1FW0 A;  3ONM A;  5K2X A;  5DTB A;  2HEU A;  2THI A;  5H8Q B;  1TFA A;  2O1M A;  2PMS A;  2HZL A;  3IOV A;  3K2D A;  4R9F A;  3TEL A;  4NE4 A;  2CMO A;  2AYS A;  2QS3 A;  3GXA A;  3Q28 A;  3WAE A;  1N84 A;  4ISU A;  3P7I A;  3G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...