1TTNA

Solution structure of the ubiquitin-like domain of human dc-ubp from dendritic cells
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
GYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dendritic cell-derived ubiquitin-like protein
publication title Solution structure of the ubiquitin-like domain of human DC-UbP from dendritic cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ttnA01
2CHXA 3AXCA 4EZLA 4N9F4 2KD0A 3APCA 1GC6A 4X57B 3QA8A 2Z0DB 2JZZA 1L2NA 2M4NA 3DVNV 2D2QA 2UYZB 1TBEA 2KJRA 2VRRB 3NS8A 1YQBA 1KOTA 2KDFB 1WMHB 5CX3A 5HKHA 3QARA 2GBRA 5D7GA 2NPTA 3IHPC 1V6EA 4IWQA 4E74A 2MA9B 2WYQA 3QK0A 3R7QA 1XQQA 2XK5A 3TCAA 2LVOA 4W9HA 3VUXA 3KYDD 2YVCA 1WI0A 2DHZA 3A9KA 3HHMA 4DBGA 2BYVE 4IM0A 4IM3A 4HDQA 1OQYA 3JVZX 4IC7B 2CHWA 4WJNA 3PSEB 2DZKA 3PRZA 4F1SA 1NI2A 2FIFA 3RCZA 1WX7A 2R2QA 2FAZA 3V61A 1V5OA 2JT4B 2K6DB 2N9PC 3PLUA 2KZRA 3MTNB 5G55A 3SD5A 3IG3A 3KW5B 3I3TB 4FHJA 4HCNB 3W1SC 3ZKJC 4AWJA 4CO7A 2MBBB 2FIDA 3A9JA 4WJOA 2FUHB 3V60A 4HXDA 1GC7A 2DYOA 2KDBA 2ZZPB 2LASA 1SGHA 2KVRA 4EEWA 1WRDB 1TZ1A 4DDID 5E6OA 2L8JA 4P7IA 2CU1A 1EO6A 2DENB 2GBKA 2OJRA 2IO0B 2JZ3B 2L3ZA 2V1YA 3IFWB 4II3B 4LDTB 3U7DA 3P2BA 1LM8B 1SE9A 3PHXB 2LJ5A 2IY1B 3L17A 2JVCA 2V4LA 4K1RB 4ASWC 2JWZA 2K6QA 2BYFA 2A5UA 3NZUA 1WGRA 2K39A 4M0WB 4XC2A 4EFOA 2KJ6A 3PREA 2CHZA 4ICUA 3QIJA 5EDSA 2KC2A 1YJ1A 2KN5A 2PE6B 1WYWB 3A1QB 2C7HA 4BBNF 1WR6E 4EUTA 2IY0B 1WE7A 4JQWC 3RYTA 4FHKA 3ZIMA 2M1MA 2ZEQA 3VQIA 3TMPB 2LXAA 2B3AA 4F7ZA 4NJ6A 2LXCA 3UINB 2RPQA 2I1JA 1P3QU 4II2B 1UH6A 1S1QB 3L13A 3TIXA 4ZRIA 3ZO5B 3DVNU 2N9XA 1GUAB 3OLMD 2CKHB 2NCNA 2L0TA 2MP2A 4F8CB 3SHQA 2R2OA 1E8WA 2BGFA 3ZUNA 3B0AA 1I35A 4YL8A 4BKGA 4WQOB 2DZJA 3QAQA 3CMMB 2KOXA 3VH4B 1E7VA 2NR2A 1XD3B 3PGEA 2NVUI 4GN1A 3DVGX 5CTRC 4WAAA 4J6IA 1UZXB 1J0GA 3PLVA 4G3XB 4XX5A 1ISNA 2MBOA 3H7PB 3ECIA 4MEMA 3UIPB 1IYFA 3HK0A 3H7SA 2I1KA 3RZWC 2LRWA 4G0NB 1WR1A 1WJ4A 3ZTDA 4BFRA 4FJVB 3D32A 4I6LB 3W1SA 4M8MA 4MJSA 5D94A 2HTHA 2K25A 3T9LA 5DPRA 2KK8A 3HM3A 2LI5A 1WJ6A 3OJ4B 2C5LC 3ML9A 4ZRKA 4BKTA 4PS7A 3ALBA 4KZ0A 3VTVA 2LVQA 2KFKA 4TUUA 3JSVA 1YX6B 3HM6X 2LZ6A 1OTRB 3UQAA 4PS3A 2IBIB 3O65B 4DHZB 2M8SA 4K7SA 3M3JA 1YX5B 2HJ8A 1KJTA 2D10A 3ZRCA 1V2YA 3EFUA 1LXDA 5D2MB 3TJPA 1U4AA 4AUQC 2BF8B 3K9OB 3H6NA 1Y8RC 2O6VB 5LXHA 2GOWA 4RM9A 1Z5SB 3KH0A 4FJZA 4HLEA 3ZNID 4ANUA 3X23A 3WALA 4DHZE 2KX0A 4DWFA 2DAJA 2NBWB 2ZCBA 3PZDA 5BO4B 2L0FA 3L0WB 2AL3A 2MBQA 4GDLB 5CHFA 2C7MB 1E8ZA 3PVLA 5E6PA 1UD7A 3VUYA 4W9CA 1UBQA 4KSKC 3OAWA 3ENEA 2FCQA 4LDTD 2ZNVB 4CHKA 4AJWA 5LLIA 4GIVA 4TQ1A 1UBIA 1WMHA 1E8YA 2EMTA 2FNJB 4RM8A 1M94A 3B1LX 3PTFC 1P98A 1WY8A 3H1UA 2HE7A 4KIKA 2N4FA 3V62A 1PQSA 2NPTB 1J8CA 3WAOA 5C1ZA 3M95A 1L7YA 2JUOA 2DZIA 2MBHA 2XK5B 3QX1A 3RD2A 3AU5A 3Q3FA 2DZMA 3DBRI 5JH5C 1V9JA 3A9KB 2LGYA 4NAWB 4DHJB 4FLHA 4ANVA 4DDGD 2L76A 3JYUA 4ZRJA 3ZLZA 3DBHI 4GXBA 1WXVA 3DDCB 3QWZB 4K7UA 1NBFC 3L08A 3JW0X 4I6PA 4OVUA 2J0MA 3KVFB 1RRBA 1GNUA 3A9JB 1WF9A 1TTNA 2DYBA 2M0XA 2JXXA 2W9NA 4G50A 3TL5A 3VDZA 3VFKA 3ZVVA 3KUZA 1WXMA 5IA7A 1EF5A 4GDKA 2KX3A 4B95A 2KQ7A 3VH3B 3ZNHB 5JZEB 2J0KA 1IPGA 4NPNA 3ZTCA 1G6JA 3GOEA 2ZVNA 1EUVB 3ZRFA 3NY5A 1R4MI 2LRUA 4BKSD 4G11A 3PPAA 2KMAA 2FCNA 4ANXA 2MSED 5KHOA 2A4ZA 1UELA 1NDDA 5DPTA 1OGWA 1A5RA 4MM3A 3A1QA 3EC8A 3APFA 4EZJA 1F9JA 3QC8B 4JLCA 1MG8A 4EOYA 1WFYA 2KDEB 2KTRA 2N1VA 4A3PA 4B6WA 3ZW3A 2KJHB 2LD9A 2FCMA 1WGDA 2ASQA 1P1AA 3AI5A 3RUIB 4M8NA 1WIAA 3UQBA 2C60A 2NBUA 1RLFA 3NZSA 4HCPB 3WIMA 2WDTB 2UWQA 2KMCA 1XT9B 2ZNVC 4HPLB 4BVUC 3APDA 2LWPA 3DOWA 3PRMB 3DPDA 1WXSA 2V3SA 2MP2B 4NJ7A 2G4SA 2O6VD 3ML8A 4MGIE 4DXAB 2MWSB 1WX8A 1Q0WB 2NS5A 4GOCA 4TKNA 2ZCCA 4GB9A 4BKSA 5L95C 1E8XA 1V80A 2OOBB 2DYMA 2DX5B 3RULA 4FA6A 2K8CA 2PJHA 1GG3A 1WM2A 2MLBA 2JRIB 4AP4C 5C23A 3KUCB 2L05A 4LCDE 1YD8U 1EF1A 2PE9A 1WGYA 4EKUA 1AARA 3W1YA 5KHQA 5JHBA 1Q5WB 2EMSA 3QJZA 3K9PB 1T0YA 3AU4A 4CYEA 4MJSB 2O2VA 2KWVB 4W9KA 2KLCA 3UIOB 4MGKE 5CHVC 5DCNA 4EZKA 5J17A 1V81A 4IUMB 4LJPB 1UGMA 1RAXA 2RSUA 1WZ0A 2KFKB 4TV3A 3CSTA 1WH3A 2JF5A 3JSVB 4BOZB 3QHTA 3L10B 2NBVB 3N30A 3KYCD 2M17A 3T8MA 2C9WB 4IW0A 4E3CA 2MBEA 2GBJA 2LUEA 2IZVB 3WAMA 3U8ZA 4XZ4A 4FJYA 2AYOB 2J7QB 3BINA 3VXWA 1S3SG 4JIOU 3A4SC 4DHJD 1V49A 2J0JA 2BWES 2G45B 2MW5A 2IYDB 2KTFA 1D3ZA 4FBJB 2D11A 4OVVA 3PT2B 2KWCA 1C1YB 1VCBA 4AOFA 4KZCA 2BWFA 4BBNC 5DPSA 2N7EA 2GBNA 1WXAA 2KWUB 3DBSA 4MDKE 3U30A 5DPWA 4WWOA 5IAAC 2BPSA 3GZNI 2G3QB 4MSQB 4W9LA 2XBBC 4B9KA 4W9EA 2KQSA 2KANA 3VTWA 1OEYJ 4NQLB 2ZVOA 3MHSD 5AZGA 2AEHA 4HWIB 3UGBB 4KV2A 2IO1B 2MQJA 4A3OA 1WM3A 2K1FA 1I42A 2D07B 3PRPB 3SU8X 3CSFA 1YIWA 2KLGA 2JY6A 4E71A 2L7RA 4HVBA 4K81A 4KDLB 3RT3B 3V6EB 3VUWA 4KIKB 3H9DA 2GBMA 3BY4B 3LJ3A 4K7WA 4W9GA 4ICVA 3VTUA 1V5TA 1Z2MA 1TGZB 2BKRB 2WX0A 3A4RA 3M63B 1ZGUB 2LGDA 4NAWA 5JHAA 4RMAA 1SIFA 2N7DA 2KKCA 3M62B 2RR9A 5J2RA 1QZEA 5FR6A 4JL9A 3OJ3A 4IWOA 2JPHA 1E5WA 2MX2A 1CMXB 3LDZE 3VAWA 3PS6A 2KNBA 1WJUA 1R4NI 4NY0A 2KXJA 1VD2A 2CS4A 4W9FA 4HJKA 3HIZA 3NHEB 4DK5A 5AEKB 4KSLC 4MH0E 3N3KB 5TR5A 3EHVA 2QHOA 3B08A 4BOSC 1H4RA 4GDKB 2BKFA 4WJQA 4GSWA 2GMIC 2WX1A 3DBLI 1JRUA 4MGYE 2AWTA 2CR5A 2REXA 3DQVA 1RFAA 5CHWA 3R7RA 1WX9A 3WAPA 4WJPA 2KO3A 3C0RB 4PYZA 3PV1A 2RGFA 3WANA 1WE6A 4KVGB 4W9DA 4NNJB 3WA0A 3KUDB 3DVGY 3RZFA 4KDIC 3IVFA 1FXTB 4NQKE 1ZW7A 2C7NB 2KTRB 5AZHA 4FULA 5G2NA 2KHWB 2IO3B 2DAFA 4HPMB 1H8CA 1KM7A 2IO2B 2KFJA 3V6CB 3VVWB 4IM2A 2KDIA 4PYUA 4ZDVA 2MRPA 5AZFA 1IP9A 5GMVA 1LFDA 2BYEA 2Z0EB 2L00B 3R3MA 2WWZA 4URKA 1Q1OA 5L83A 3IBEA 1P9DU 4JGHB 3X0WA 4ANWA 2XEWA 1OEYA 3ZNGC 4W9IA 4W9JA 3H7PA 1KLVA 3CF6E 3DCGA 1ZKHA 3ZDMC 3N32A 2N1WA 3L16A 4WWPA 2K8BA 4MELA 1BT0A 2HD5B 4I6NB 4ZYNA 1C3TA 4LJOB 3NOBA 3SDLC 2ZPNA 2Z59B 2PPHA 2LVPA 4PS8A 2JRHA 3PHWB 3UF8A 2KC1A 3EECA 4HDOA 4MSMB 2G4DB 4IG7B 1WZ3A 4IWPA 1LQBA 1J19A 3AULA 4FADA 4GMVA 4FN2A 3ZNZB 2AL6A 2PEAA 1GJZA 4A20A 5J18A 3R66C 5D6JB 3VHTC 2LGXA 2O2VB 3ZDTA 1V86A 1HE8A 2Y5BB 1WGHA 3S2AA 1K8RB 1E7UA 3QCAA 4GU2A 2O6VA 4AJYB 1WJNA 2EKEC 4HK2A 4TQ0A 4MGZE 2K8HA 3MJWA 3TBLD 3QQ8B 2N9EB 2RD0A 2YLMA 1WGGA 1P0RA 3A33B 3L54A 2ZJDA 4WWNA 2MCNB 3ONSA 2D3GA 3Q3JA 2ZPYA 5LXIB 1X1MA 4GDLA 5E6NA 2FCSA 4GGQA 1E90A
chains in the Genus database with same CATH superfamily
2V4IB 2V3PA 3APCA 1RM6C 1GC6A 4X57B 2Z0DB 4YTPB 3DHHC 5EE1A 1KOTA 1JWAD 3IT4B 5CX3A 3DBLB 2GBRA 2NPTA 1V6EA 4WQMA 4RGNA 3TCAA 1FXIA 4M02A 4LNOA 1WI0A 1KRHA 4IC7B 4HDQA 4F1SA 3PRZA 3W5UB 2R2QA 1V5OA 2N9PC 3IG3A 3KW5B 1TZOA 3A9JA 2SAKA 2G1EA 5MPOA 1SGHA 3MTNB 1EO6A 2JZ3B 1T0SC 1MG4A 2LJ5A 1V8CA 4A6QA 2BYFA 2LHDA 2A5UA 4XC2A 1WGRA 4EFOA 1MFWA 4ICUA 5EDSA 1YJ1A 2PE6B 4JQWC 3RYTA 1I4RA 1N6ZA 3NVWA 2I1JA 4II2B 2BW2A 1WWTA 2KAJA 3BWUD 2CKHB 4F8CB 5G5HA 3FC4A 1JWMD 2MHJA 3B0AA 1UGJA 1XLPA 2NR2A 3PGEA 2BBCA 1UZXB 4MEMA 1IYFA 4G0NB 1WJ4A 2QSDA 4BFRA 3W1SA 5D94A 2K25A 2KK8A 1WGKA 4RGTA 2WXPA 3ML9A 1ZE3D 3VTVA 1C9FA 3I5JC 3P4PB 3O65B 2BS4B 4YTMB 2HJ8A 2D10A 1V2YA 5D2MB 2BF8B 2W55A 3H6NA 1Y8RC 2GOWA 1JROA 1K51A 1YN5A 3Q8CA 4FJZA 4HLEA 3DBRB 2KX0A 2DAJA 2ZCBA 3U2SC 1I7HA 1UWMA 2AL3A 1MHHE 2D3BA 2GB1A 2Y3AA 2MBQA 4P16A 5E6PA 4W9CA 1UBQA 1UF0A 4KSKC 2FCQA 3TEWA 1VZ8A 1WMHA 2EMTA 2FNJB 4RM8A 1M94A 3B2GA 3L4PA 3PTFC 1P98A 2N4FA 2NPTB 1BUIC 3R2TA 3AEBB 3M95A 2KQ4X 1L7YA 1HTQA 3AU5A 2DZMA 1UUPA 4NAWB 4ANVA 4DDGD 2L76A 3Q6BA 3QWZB 1EM7A 4I6PA 3A9JB 1TY2A 1E0ZA 1WXMA 5IA7A 3BVMA 5C3JB 3ZNHB 1EUVB 4ANXA 1QKZA 3ZQ4A 1UELA 2INPE 3A1QA 3APFA 1ET6A 3KWLA 3I63C 1MG8A 1WFYA 2FCMA 3RNEC 4M8NA 4A90A 1ZXIA 2BS2B 2LEKA 3AMZA 1L0VB 3DOWA 3PRMB 4CQNA 4XE0A 2G4SA 4MGIE 2NS5A 2NMQA 4GB9A 5L95C 2DX5B 4OZBA 4AQ7A 2K8CA 2JRIB 3BVZA 1VLBA 2MJEA 1CJEA 4EKUA 1AARA 5KHQA 4RFBA 4US9A 2EMSA 4LNIA 2KWVB 4W9KA 2IDYA 4MGKE 3EGRA 1V81A 4LJPB 4R3DA 1RAXA 1WZ0A 1WH3A 1MJDA 1TY0A 1F77A 3NZ3A 1QF6A 2BWES 2MW5A 2KTFA 1D3ZA 2D11A 4OVVA 3PT2B 2TSSA 1C1YB 4AOFA 4KZCA 4BBNC 4D2KA 5DPSA 2PVGC 5DPWA 1NYRA 3U30A 5IAAC 5D3IB 3P4RB 3P42A 2G3QB 2V0GA 4YSYB 2N0SB 1RFKA 2ZVOA 3MHSD 2AEHA 2EELA 3PZ8A 2IO1B 2D07B 1FFVA 3ZYYX 4K81A 3V6EB 4W9GA 4C7ZA 1UWXA 1FCLA 1V5TA 1JWSD 4OZAA 1Z2MA 1TGZB 1IGCA 3A4RA 2LGDA 3M62B 2JPHA 3U52E 1D5ZC 1WYGA 3LDZE 1SJED 3AEDB 2KXJA 2CS4A 4A55A 3NHEB 2JQRB 5AEKB 3I57A 4BOSC 2BKFA 1N62A 2GMIC 2WX1A 1IBXA 2AWTA 1PGBA 1HEZE 1ESFA 2KO3A 4PYZA 3PV1A 3WCQA 3RZFA 1PDXA 3AEEB 3IVFA 1FM0D 1ZW7A 3N9YC 5AZHA 1TS2A 2KHWB 4A9AA 2KDIA 4PYUA 4ZOHC 4ZDVA 5AZFA 3J9CA 5GMVA 1LFDA 4YT0B 3P1MA 2L00B 2MJ3A 3MHZA 1J7CA 2KWDA 3KQ4A 4W9IA 4W9JA 3H7PA 3VR9B 3NVYA 1T0QC 2N1WA 3L16A 1KFYB 1BT0A 4I6NB 1C3TA 4WH4A 4PS8A 2JRHA 4LNNA 2QIEB 1L6UA 4IG7B 5I4DA 1J19A 3AULA 3RPFC 1YQ3B 2PTLA 4FADA 4GMVA 3ZNZB 2BYTA 2AL6A 3R66C 2K5PA 2LGXA 5H92C 1HE8A 1WJNA 2EKEC 4MGZE 2K8HA 4YXDB 2RD0A 1P0RA 1YJIA 2MCNB 4GDLA 1C4CA 1FNVA 5E6NA 2WS3B 4RH6A 3AXCA 1ET9A 3AB5A 2UYZB 2KJRA 3E9SA 2KVZA 2K0PA 3QARA 5D7GA 2MA9B 3UI3A 2WXOA 1XQQA 2JWUA 2LVOA 1R7SA 3AE8B 2L83A 4DBGA 2QJLA 4IM3A 5FR3A 3JVZX 5G5GA 2DZKA 1WX7A 2FAZA 3SD5A 3W1SC 4FHJA 1TKGA 5HHDG 2MBBB 4WJOA 3V60A 4EEWA 4WAFA 4XWWA 4DDID 2CU1A 4K7WA 2OJRA 3RI7C 3U7DA 4KGSA 4PK1A 2IY1B 3L17A 2JVCA 2JWZA 3NZUA 3RNCC 1WYWB 2C7HA 4BBNF 4EUTA 2IY0B 3ZIMA 4LNKA 1IBXB 2ZEQA 2B3AA 4F7ZA 2BB6A 3UINB 2GLSA 3P4QB 1S1QB 3L13A 4JE3B 2L0TA 2WLBA 2R2OA 1XLQA 1I35A 4YL8A 4BKGA 2RMMA 1C77A 3QAQA 4B0EA 1PFDA 4GN1A 5JXVA 2NVUI 4WAAA 3Q8EA 1J0GA 5IKCM 4ZRQA 2BVCA 3H7PB 3UIPB 3HK0A 4Q2JA 2I1KA 3RZWC 4FJVB 2AQ2B 3D32A 4M8MA 2HTHA 2LFIA 3T9LA 3HM3A 1WJ6A 4KKIA 4ZRKA 1FFUA 1TJEA 4PS7A 3JSVA 3Q3NC 3HM6X 2LZ6A 1OTRB 4PS3A 2IBIB 4DHZB 4K7SA 3M3JA 3C8YA 4WIPA 1FEHA 1KJTA 4AUQC 5LXHA 3AH7A 1Z5SB 3KH0A 4IKGA 3GB1A 3WALA 2X38A 2NBWB 3PZDA 4L1BA 5BO4B 2L0FA 2INNE 3L0WB 5GXGB 1FNWA 4GDLB 2WHIA 4H2AA 3PVLA 3EUB2 2W54A 2QEJC 2QDFA 3OAWA 4JWUC 2WXNA 5IN7A 3RNGC 2BTEA 3LYYA 1ZOYB 1E8YA 2WXMA 2DBYA 1AN8A 3NVVA 1WY8A 3V62A 1GPXA 3WAOA 1STEA 3AN1A 2JUOA 2MBHA 1V9JA 2LGYA 3NVZA 3R2IA 2RPVA 3MC9A 2RDGA 3DBHI 3RNFC 1FNUA 1GB1A 1WXVA 1NBFC 3DWGC 2J0MA 3KVFB 3ZJVA 2M19A 3KUZA 4GDKA 4B95A 2ZVNA 1V97A 3NY5A 2LRUA 3HVDA 2EKIA 4G11A 2FCNA 1NDDA 1OGWA 4EZJA 1F9JA 4EOYA 3AEFB 4A3PA 4B6WA 1N63A 1WGDA 3FAHA 3AI5A 3RUIB 1YJJA 2E6XA 1RLFA 5IOIA 1SF0A 4BVUC 3FILA 3RFZB 1WXSA 2O6VD 4K3BA 2QCZA 1AW7A 1E8XA 1V80A 2OOBB 1VRAB 4FA6A 3AEGB 1GG3A 1WM2A 2MLBA 4AP4C 5C23A 3KUCB 4B0MA 5LNK1 1EF1A 2PE9A 3AU4A 2RDBC 2FE8A 2KLCA 3UIOB 2WDVB 5J17A 2LUMA 4TV3A 4N6EB 3ABVB 3CSTA 3JSVB 3QHTA 1I4GA 3N30A 1DYQA 2C9WB 4IW0A 1SJHD 3WAMA 3U8ZA 4FJYA 2AYOB 1ACCA 3BINA 3VXWA 4FXCA 3A4SC 3LB8C 2G45B 5HG2A 4DXGA 3GE3C 3W5VB 1C4PA 1VCBA 1XO3A 2JX5A 2BWFA 3TUOA 4P6VF 1E10A 2N7EA 2KWUB 2KT7A 4MDKE 4WWOA 1HZ6A 3ZJUA 2BPSA 5C2TB 1K52A 3GZNI 1OQQA 1R4MB 4W9LA 1EU3A 1KTKA 2XBBC 4JWSC 4B9KA 2KANA 3OG5A 3RN9C 4NQLB 5AZGA 4KV2A 2INDC 2MQJA 1WM3A 4K3CA 3SU8X 3CSFA 2JY6A 2L7RA 3DWMA 4HVBA 3E56A 4ARCA 1N5WA 1ZPSA 3H9DA 2GBMA 3BY4B 3LJ3A 1ZP0B 2WX0A 3W2DA 3TEZA 1SIFA 2KKCA 2RR9A 1P7FA 2MX2A 4LTUA 2R61A 1R4NI 3AE6B 4NY0A 2RDHA 1VD2A 4RGOS 1L4ZB 4TMAB 3U4EG 2ON8A 4KSLC 4MH0E 3BK1A 3N3KB 1JCKB 3EHVA 2HTME 5AUKA 4LK0M 4GDKB 2VH2A 4HEA1 2K3UA 3B9JA 3DBLI 1SE3A 3Q2AC 2REXA 1RFAA 1WX9A 4WJPA 3VRBB 3V05A 1VZ6A 2RGFA 3WANA 2WQYB 3SFDB 4KVGB 3TSSA 3KUDB 2KACA 2ACZB 4KDIC 4XYCA 4NQKE 1ZXHA 2W82A 2IO3B 1KM7A 4IM2A 5E6JA 2WGSA 1SEBD 1KLGD 3R3MA 4TSSA 4URKA 1Q1OA 5L83A 1P9DU 2XEWA 3FILB 1OEYA 3NG0A 1XLNA 1KLVA 1NI3A 3ZDMC 4YSXB 3NJTA 3RNAC 1JWUD 1JW9D 4MELA 4ZYNA 3SDLC 2ZPNA 2PPHA 3AM9A 1WSPA 1VJKA 4HDOA 3URYA 2G4DB 4IWPA 2PEAA 4A20A 4KGTA 1IGDA 1V86A 2Y5BB 1WGHA 1K8RB 1E7UA 2O6VA 4HK2A 2WXIA 3FKYA 1FCCC 3Q8BA 2IPKD 2QILA 1X1MA 1CK1A 4GGQA 1E90A 3TJPA 2AQ1B 2CHXA 4ZHOA 2KD0A 3QA8A 2JZZA 1L2NA 3DVNV 1TBEA 5BMGA 3AE3B 4ACFA 3V3XA 2KDFB 2PLPA 1WMHB 4C80A 5HKHA 2V9HA 2WXLA 3IHPC 4IWQA 4E74A 2WYQA 3QK0A 3R7QA 2XK5A 3T3OA 4W9HA 3VUXA 2YVCA 2OHFA 2DHZA 3A9KA 4N58A 1YN4A 1D5XC 1OQYA 3PSEB 1FXAA 2N7JA 3RCZA 1DOYA 2K6DB 2JT4B 2KZRA 4XWTA 3I3TB 3ZKJC 4MT5A 4XGAB 2WU5B 2FUHB 1K53A 4HXDA 2D3AA 2ZZPB 4BAXA 1VZ7A 1WRDB 1TZ1A 2I38A 2K9XA 1DOIA 5E6OA 2L8JA 4P7IA 2DENB 2GBKA 2L3ZA 4II3B 3ZGZA 1LM8B 1SE9A 3PHXB 1V1OA 3PREA 2CHZA 3T3NA 3A1QB 3IT6B 4ZYSA 4FHKA 2M1MA 3TMPB 2LXAA 2J52A 2WP9B 3BYTB 3BZDB 4NJ6A 2RPQA 1P3QU 2FUG1 1UH6A 1Q10A 2JSVX 1KLUD 1QOFA 4ZRIA 3N1XC 2HDEA 3PZ7A 1GUAB 2XNAC 3OLMD 2NCNA 3RNBC 3SHQA 1HA5A 2LMCA 2GRIA 3BIID 3GS2A 3CMMB 5HFYA 1E7VA 3DVGX 4J6IA 4G3XB 3PO0A 2BT6A 1ISNA 2MJDA 2YEPB 2ZW1A 1WR1A 3ZTDA 4I6LB 1YMHE 4MJSA 1L0XB 4ZHPA 2CJOA 2LI5A 3OJ4B 3IAS1 3H8HA 4BKTA 1L5PA 3ALBA 4KZ0A 2LVQA 2I2YA 1N61A 4OZCA 2M8SA 2V3NA 3RMKC 4KX6B 2IGDA 1QT9A 1U4AA 2O6VB 2ONQA 4RM9A 1TIFA 2K22A 3ZNID 3X23A 4DHZE 2OEDA 1VR9A 4DWFA 2INCC 3DBHB 2JYTA 2WXQA 4USAA 1K50A 2VZKD 1E8ZA 2J4XA 1UD7A 1TS3A 4ARIA 3VUYA 3ENEA 4LDTD 4GLSC 1FRRA 4GIVA 1UBIA 1F2RC 4N59A 4M00A 3B1LX 1VDVA 3H1UA 4L23A 4C56C 3KLSX 1HQRD 1PQSA 1J8CA 2XK5B 2DZIA 1OFFA 3QX1A 1D5MC 3RD2A 5JH5C 2IGGA 3A9KB 4FLHA 3JYUA 4ZRJA 3ZLZA 3BVGA 1FD6A 4OVUA 3JW0X 2ZW0A 3AEAB 3Q14C 1RRBA 2DYBA 1TTNA 2M0XA 2W9NA 1TKEA 3ZVVA 4P1BC 3VFKA 1XCQL 2KX3A 2KMMA 5JZEB 4IOIE 2J0KA 3ZTCA 1G6JA 1LGRA 2MSED 1PGXA 2AQ3B 3CWIA 5DPTA 1A5RA 4MM3A 3ETRA 3QC8B 5BYRA 4JLCA 2WXHA 2KTRA 2N1VA 3HVZA 2LD9A 3BK2A 4HROA 2ASQA 1UNSA 1C4AA 2C60A 2NBUA 2WDTB 2UWQA 1XT9B 2ZNVC 4HPLB 2CJNA 1C79A 3APDA 2M56B 3DPDA 2V3SA 2Z8LA 2X8XX 4NJCA 3ML8A 2MWSB 1MHXA 2QMTA 1CZPA 1JMLA 1I4XA 1T3QA 4GOCA 4TKNA 3LXFA 2ZCCA 2M0AA 4OHJA 4BKSA 1B9RA 3RULA 2NTTA 1T5XD 1I4HA 1KH0A 1QOBA 2L05A 2D5GA 4LCDE 1YD8U 1WGYA 2J42A 1T0YA 4CYEA 4RNAA 4MJSB 3MC8A 3GZNB 2JXTA 5CHVC 5DCNA 4EZKA 1F0ZA 5BYSA 2LHEA 2FBWB 4IUMB 4KGRA 4WURA 1C76A 1E7PB 4BOZB 3L10B 2NBVB 3KYCD 2LUEA 4XZ4A 2J7QB 1S3SG 1I4PA 4DHJD 2IYDB 2WDQB 1EWYC 1GAQB 5H8YE 1M4VA 1R4NB 2GBNA 3DBSA 1SBBB 1P7EA 1B1ZA 4MSQB 4W9EA 3C19A 3AV8A 2KYWA 1FMAD 2H88B 3UGBB 4A3OA 3PRPB 1YIWA 4KKJA 1NENB 1SIJA 1D4BA 3RT3B 2WXFA 1L0YB 2UU7A 3AE2B 3ZJTA 4NAWA 5JHAA 4REZA 5J2RA 4IWOA 1E5WA 1CMXB 2KNBA 1FO4A 4W9FA 3HIZA 1J7AA 5TR5A 1MVKA 2QHOA 4M0WA 1H4RA 1YOVB 3AE4B 1PUTA 5IP4D 1JRUA 4MGYE 5CHWA 3SR6A 3R7RA 3WAPA 3DHIC 3C0RB 3GP7A 5HI1A 4MM3B 2C7NB 2KTRB 2BB5A 2DAFA 4HPMB 4AS1A 2PKOA 2L32A 2MRPA 2E3TA 1QOAA 4XDDA 5AUIA 3IBEA 1MPEA 1ROEA 4JGHB 3X0WA 3CF6E 3DCGA 1V1PA 3N32A 1JWBD 1TKYA 4WWPA 1N60A 4LJOB 3NOBA 3I9V1 1SB3C 3PHWB 3UF8A 4C00A 4MSMB 4FN2A 3AECB 5J18A 3P4SB 4HRSA 5D6JB 1QOGA 5BYQA 4J3OD 3ZDTA 3EA6A 3OWEB 3QCAA 4GU2A 4AJYB 1JALA 3GE8C 1CQVA 3MJWA 3TBLD 2N9EB 2YLMA 3B2FA 1WGGA 3L54A 4WWNA 2ZJDA 3ONSA 3Q3JA 2ZPYA 1WE6A 1I4QA 4EZLA 4N9F4 3BYYB 1BXTA 2H89B 2M4NA 2D2QA 3NRZA 2SEBD 2VRRB 3NS8A 1YQBA 4DXFA 1DGJA 3KYDD 3HHMA 2BYVE 4IM0A 2PMVA 2CU3A 2DLBA 4WJNA 1RYJA 2CHWA 1LO5D 1AWDA 1NI2A 2FIFA 2JYEA 3V61A 3PLUA 5G55A 4HCNB 4AWJA 4CO7A 2WU2B 2FIDA 1E6EB 1GC7A 2DYOA 2KDBA 5EE9A 1PGAA 2VZKB 2LASA 2KVRA 4XDCA 1YN3A 3NS1A 2WXJA 2MH7A 1TYGB 2BQQA 2IO0B 4LDTB 1N5XA 2V1YA 3IFWB 2ICIA 1YQ4B 3P2BA 2V4LA 4K1RB 4ASWC 2K6QA 3KWVA 4M0WB 2K39A 2KJ6A 1E9MA 3QIJA 2KC2A 1EWCA 3AE9B 2KN5A 2G9HD 1WR6E 2LGIA 2WNMA 2W3SA 1J7BA 1WE7A 3MP9A 3ZXVA 3VQIA 3MJ5A 4L2YA 1SXTA 2LXCA 3AE7B 3HUIA 3TIXA 3ZO5B 3DVNU 3TEXA 2N9XA 1NYQA 2LGSA 4RGMA 2MP2A 2YEPF 1E8WA 2BGFA 3ZUNA 4WQOB 4C4VA 2DNFA 2DZJA 3VRAB 2KOXA 3VH4B 2J53A 1XD3B 5CTRC 1FRDA 3Q69A 3PLVA 2XN9C 4XX5A 1F1HA 1C78A 2MBOA 4HPPA 3ECIA 3H7SA 1L4DB 1V1PB 2LRWA 1AYFA 5DPRA 2C5LC 4A8XC 2KFKA 4TUUA 3CIRB 2PW9A 1YX6B 4O1NA 1DOXA 3UQAA 1YX5B 2L52A 3ZRCA 3EFUA 1LXDA 4HKZE 1XLOA 3K9OB 2D3CA 4RF1A 1PYWD 2PIAA 3DHGC 4HKQA 4ANUA 2WXKA 4OVZA 1NVID 3W9CB 1T0RC 5BMHA 5EE3A 4OW0A 5CHFA 2C7MB 4YSZB 1TT5B 1IUEA 2ZNVB 4CHKA 1HZ5A 4AJWA 5LLIA 1QILA 4TQ1A 3N20C 2HJ1A 2HE7A 3IAM1 4KIKA 3Q8FA 5C1ZA 1HXYD 1Y56A 1TS4A 1SSNA 3Q3FA 3DBRI 4QAYA 5IO9A 4DHJB 2QC8A 1XF5L 4GXBA 4K7UA 3DDCB 3L08A 2LJIA 1GNUA 3IXSA 1WF9A 3VDZA 3TL5A 2JXXA 4G50A 4PT5A 1EF5A 2KQ7A 3VH3B 3AE1B 1IPGA 4NPNA 1SE2A 3GOEA 1QQRA 3ZRFA 1R4MI 4BKSD 3PPAA 2KMAA 5KHOA 2A4ZA 3Q3MC 1A70A 3EC8A 3HRDD 3MFGA 2KDEB 3ZW3A 2KJHB 2Q5WD 1P1AA 1OQRA 1WIAA 4JPSA 3UQBA 3NZSA 1MI0A 4HCPB 4NAMA 3WIMA 2JU6X 4BZAA 2KMCA 4US8A 1XCTL 3N1ZC 2LWPA 3P63A 4RCOA 1FIQA 1ZDXA 1NEKB 2MP2B 1WXQA 4NJ7A 4DXAB 1WX8A 3N1YC 1Q0WB 1WRIA 3EFCA 5FK9C 4C4VB 1HTOA 4S0RA 2DYMA 4C7YA 2PJHA 4ITKA 4ZRPA 2GI9A 1T6BX 3W1YA 2Y5CA 5JHBA 1Q5WB 3QJZA 3K9PB 1XXGA 2O2VA 3Q3OC 4LNFA 1TS5A 1UGMA 2RSUA 2KFKB 1SE4A 5BMIA 2JF5A 2IJ0A 4NZLB 1XEEA 2M17A 3T8MA 4E3CA 2MBEA 2GBJA 2IZVB 2KN4A 1ZDVA 4YWGG 2Y5PA 4JIOU 1GOZA 4MACA 1V49A 1F2RI 1QLBB 2J0JA 1BMLC 2NTSA 4FBJB 5FKAC 1FPYA 4YTNB 2KWCA 1D6EC 1WXAA 1KF6B 2OJWA 1GB4A 2KQSA 3MC0B 3VTWA 2N9KA 1OEYJ 4RF0A 2PVOD 4HWIB 2K1FA 1I42A 3VR8B 2KLGA 4E71A 1JRPA 4KDLB 3VUWA 4KIKB 3VTUA 4ICVA 2BKRB 3M63B 1ZGUB 4RMAA 2N7DA 2WXRA 1QZEA 5FR6A 4JL9A 1F52A 3OJ3A 1ZUD2 1RWSA 2W3RA 3U7ZA 3VAWA 3PS6A 1WJUA 4HJKA 1JQ4A 2DWQA 4DK5A 3O13A 5T8IA 3B08A 2WXGA 3SEBA 4LLGM 2MEKA 4HJGE 4GSWA 4WJQA 3ZXRA 2CR5A 3DQVA 1L6VA 4W9DA 4NNJB 3WA0A 3DVGY 1FXTB 2IGHA 4M01A 4FULA 4WWMA 5G2NA 2B76B 1H8CA 2IO2B 2KFJA 4P1CC 3V6CB 3VVWB 1IP9A 4S17A 1YNTE 2BYEA 3R8BA 2Z0EB 2VH1A 2JZPA 4JX1C 5EE0A 2WWZA 4ANWA 1ENFA 3ZNGC 4IDIA 3AE5B 5D3DA 1ZKHA 2WDRB 2AX5A 2K8BA 2HD5B 2L1AA 2Z59B 2LVPA 3NUHB 2KC1A 3EECA 4MH8A 1WZ3A 1LQBA 4DQOC 1GJZA 3VHTC 2O2VB 3SFEB 2N9LA 5TSSA 3S2AA 4UDUC 4TQ0A 2KDMA 3TEYA 3QQ8B 2BS3B 1EU4A 3A33B 2D3GA 3Q8AA 4EE2A 5LXIB 2FCSA
chains in the Genus database with same CATH topology
2CHXA 3AXCA 4EZLA 4N9F4 2KD0A 3APCA 1GC6A 4X57B 3QA8A 2Z0DB 2JZZA 1L2NA 2M4NA 3DVNV 2D2QA 2UYZB 1TBEA 2KJRA 2VRRB 3NS8A 1YQBA 1KOTA 2KDFB 1WMHB 5CX3A 5HKHA 3QARA 2GBRA 5D7GA 2NPTA 3IHPC 1V6EA 4IWQA 4E74A 2MA9B 2WYQA 3QK0A 3R7QA 1XQQA 2XK5A 3TCAA 2LVOA 4W9HA 3VUXA 3KYDD 2YVCA 1WI0A 2DHZA 3A9KA 3HHMA 4DBGA 2BYVE 4IM0A 4IM3A 4HDQA 1OQYA 3JVZX 4IC7B 2CHWA 4WJNA 3PSEB 2DZKA 3PRZA 4F1SA 1NI2A 2FIFA 3RCZA 1WX7A 2R2QA 2FAZA 3V61A 1V5OA 2JT4B 2K6DB 2N9PC 3PLUA 2KZRA 3MTNB 5G55A 3SD5A 3IG3A 3KW5B 3I3TB 4FHJA 4HCNB 3W1SC 3ZKJC 4AWJA 4CO7A 2MBBB 2FIDA 3A9JA 4WJOA 2FUHB 3V60A 4HXDA 1GC7A 2DYOA 2KDBA 2ZZPB 2LASA 1SGHA 2KVRA 4EEWA 1WRDB 1TZ1A 4DDID 5E6OA 2L8JA 4P7IA 2CU1A 1EO6A 2DENB 2GBKA 2OJRA 2IO0B 2JZ3B 2L3ZA 2V1YA 3IFWB 4II3B 4LDTB 3U7DA 3P2BA 1LM8B 1SE9A 3PHXB 2LJ5A 2IY1B 3L17A 2JVCA 2V4LA 4K1RB 4ASWC 2JWZA 2K6QA 2BYFA 2A5UA 3NZUA 1WGRA 2K39A 4M0WB 4XC2A 4EFOA 2KJ6A 3PREA 2CHZA 4ICUA 3QIJA 5EDSA 2KC2A 1YJ1A 2KN5A 2PE6B 1WYWB 3A1QB 2C7HA 4BBNF 1WR6E 4EUTA 2IY0B 1WE7A 4JQWC 3RYTA 4FHKA 3ZIMA 2M1MA 2ZEQA 3VQIA 3TMPB 2LXAA 2B3AA 4F7ZA 4NJ6A 2LXCA 3UINB 2RPQA 2I1JA 1P3QU 4II2B 1UH6A 1S1QB 3L13A 3TIXA 4ZRIA 3ZO5B 3DVNU 2N9XA 1GUAB 3OLMD 2CKHB 2NCNA 2L0TA 2MP2A 4F8CB 3SHQA 2R2OA 1E8WA 2BGFA 3ZUNA 3B0AA 1I35A 4YL8A 4BKGA 4WQOB 2DZJA 3QAQA 3CMMB 2KOXA 3VH4B 1E7VA 2NR2A 1XD3B 3PGEA 2NVUI 4GN1A 3DVGX 5CTRC 4WAAA 4J6IA 1UZXB 1J0GA 3PLVA 4G3XB 4XX5A 1ISNA 2MBOA 3H7PB 3ECIA 4MEMA 3UIPB 1IYFA 3HK0A 3H7SA 2I1KA 3RZWC 2LRWA 4G0NB 1WR1A 1WJ4A 3ZTDA 4BFRA 4FJVB 3D32A 4I6LB 3W1SA 4M8MA 4MJSA 5D94A 2HTHA 2K25A 3T9LA 5DPRA 2KK8A 3HM3A 2LI5A 1WJ6A 3OJ4B 2C5LC 3ML9A 4ZRKA 4BKTA 4PS7A 3ALBA 4KZ0A 3VTVA 2LVQA 2KFKA 4TUUA 3JSVA 1YX6B 3HM6X 2LZ6A 1OTRB 3UQAA 4PS3A 2IBIB 3O65B 4DHZB 2M8SA 4K7SA 3M3JA 1YX5B 2HJ8A 1KJTA 2D10A 3ZRCA 1V2YA 3EFUA 1LXDA 5D2MB 3TJPA 1U4AA 4AUQC 2BF8B 3K9OB 3H6NA 1Y8RC 2O6VB 5LXHA 2GOWA 4RM9A 1Z5SB 3KH0A 4FJZA 4HLEA 3ZNID 4ANUA 3X23A 3WALA 4DHZE 2KX0A 4DWFA 2DAJA 2NBWB 2ZCBA 3PZDA 5BO4B 2L0FA 3L0WB 2AL3A 2MBQA 4GDLB 5CHFA 2C7MB 1E8ZA 3PVLA 5E6PA 1UD7A 3VUYA 4W9CA 1UBQA 4KSKC 3OAWA 3ENEA 2FCQA 4LDTD 2ZNVB 4CHKA 4AJWA 5LLIA 4GIVA 4TQ1A 1UBIA 1WMHA 1E8YA 2EMTA 2FNJB 4RM8A 1M94A 3B1LX 3PTFC 1P98A 1WY8A 3H1UA 2HE7A 4KIKA 2N4FA 3V62A 1PQSA 2NPTB 1J8CA 3WAOA 5C1ZA 3M95A 1L7YA 2JUOA 2DZIA 2MBHA 2XK5B 3QX1A 3RD2A 3AU5A 3Q3FA 2DZMA 3DBRI 5JH5C 1V9JA 3A9KB 2LGYA 4NAWB 4DHJB 4FLHA 4ANVA 4DDGD 2L76A 3JYUA 4ZRJA 3ZLZA 3DBHI 4GXBA 1WXVA 3DDCB 3QWZB 4K7UA 1NBFC 3L08A 3JW0X 4I6PA 4OVUA 2J0MA 3KVFB 1RRBA 1GNUA 3A9JB 1WF9A 1TTNA 2DYBA 2M0XA 2JXXA 2W9NA 4G50A 3TL5A 3VDZA 3VFKA 3ZVVA 3KUZA 1WXMA 5IA7A 1EF5A 4GDKA 2KX3A 4B95A 2KQ7A 3VH3B 3ZNHB 5JZEB 2J0KA 1IPGA 4NPNA 3ZTCA 1G6JA 3GOEA 2ZVNA 1EUVB 3ZRFA 3NY5A 1R4MI 2LRUA 4BKSD 4G11A 3PPAA 2KMAA 2FCNA 4ANXA 2MSED 5KHOA 2A4ZA 1UELA 1NDDA 5DPTA 1OGWA 1A5RA 4MM3A 3A1QA 3EC8A 3APFA 4EZJA 1F9JA 3QC8B 4JLCA 1MG8A 4EOYA 1WFYA 2KDEB 2KTRA 2N1VA 4A3PA 4B6WA 3ZW3A 2KJHB 2LD9A 2FCMA 1WGDA 2ASQA 1P1AA 3AI5A 3RUIB 4M8NA 1WIAA 3UQBA 2C60A 2NBUA 1RLFA 3NZSA 4HCPB 3WIMA 2WDTB 2UWQA 2KMCA 1XT9B 2ZNVC 4HPLB 4BVUC 3APDA 2LWPA 3DOWA 3PRMB 3DPDA 1WXSA 2V3SA 2MP2B 4NJ7A 2G4SA 2O6VD 3ML8A 4MGIE 4DXAB 2MWSB 1WX8A 1Q0WB 2NS5A 4GOCA 4TKNA 2ZCCA 4GB9A 4BKSA 5L95C 1E8XA 1V80A 2OOBB 2DYMA 2DX5B 3RULA 4FA6A 2K8CA 2PJHA 1GG3A 1WM2A 2MLBA 2JRIB 4AP4C 5C23A 3KUCB 2L05A 4LCDE 1YD8U 1EF1A 2PE9A 1WGYA 4EKUA 1AARA 3W1YA 5KHQA 5JHBA 1Q5WB 2EMSA 3QJZA 3K9PB 1T0YA 3AU4A 4CYEA 4MJSB 2O2VA 2KWVB 4W9KA 2KLCA 3UIOB 4MGKE 5CHVC 5DCNA 4EZKA 5J17A 1V81A 4IUMB 4LJPB 1UGMA 1RAXA 2RSUA 1WZ0A 2KFKB 4TV3A 3CSTA 1WH3A 2JF5A 3JSVB 4BOZB 3QHTA 3L10B 2NBVB 3N30A 3KYCD 2M17A 3T8MA 2C9WB 4IW0A 4E3CA 2MBEA 2GBJA 2LUEA 2IZVB 3WAMA 3U8ZA 4XZ4A 4FJYA 2AYOB 2J7QB 3BINA 3VXWA 1S3SG 4JIOU 3A4SC 4DHJD 1V49A 2J0JA 2BWES 2G45B 2MW5A 2IYDB 2KTFA 1D3ZA 4FBJB 2D11A 4OVVA 3PT2B 2KWCA 1C1YB 1VCBA 4AOFA 4KZCA 2BWFA 4BBNC 5DPSA 2N7EA 2GBNA 1WXAA 2KWUB 3DBSA 4MDKE 3U30A 5DPWA 4WWOA 5IAAC 2BPSA 3GZNI 2G3QB 4MSQB 4W9LA 2XBBC 4B9KA 4W9EA 2KQSA 2KANA 3VTWA 1OEYJ 4NQLB 2ZVOA 3MHSD 5AZGA 2AEHA 4HWIB 3UGBB 4KV2A 2IO1B 2MQJA 4A3OA 1WM3A 2K1FA 1I42A 2D07B 3PRPB 3SU8X 3CSFA 1YIWA 2KLGA 2JY6A 4E71A 2L7RA 4HVBA 4K81A 4KDLB 3RT3B 3V6EB 3VUWA 4KIKB 3H9DA 2GBMA 3BY4B 3LJ3A 4K7WA 4W9GA 4ICVA 3VTUA 1V5TA 1Z2MA 1TGZB 2BKRB 2WX0A 3A4RA 3M63B 1ZGUB 2LGDA 4NAWA 5JHAA 4RMAA 1SIFA 2N7DA 2KKCA 3M62B 2RR9A 5J2RA 1QZEA 5FR6A 4JL9A 3OJ3A 4IWOA 2JPHA 1E5WA 2MX2A 1CMXB 3LDZE 3VAWA 3PS6A 2KNBA 1WJUA 1R4NI 4NY0A 2KXJA 1VD2A 2CS4A 4W9FA 4HJKA 3HIZA 3NHEB 4DK5A 5AEKB 4KSLC 4MH0E 3N3KB 5TR5A 3EHVA 2QHOA 3B08A 4BOSC 1H4RA 4GDKB 2BKFA 4WJQA 4GSWA 2GMIC 2WX1A 3DBLI 1JRUA 4MGYE 2AWTA 2CR5A 2REXA 3DQVA 1RFAA 5CHWA 3R7RA 1WX9A 3WAPA 4WJPA 2KO3A 3C0RB 4PYZA 3PV1A 2RGFA 3WANA 1WE6A 4KVGB 4W9DA 4NNJB 3WA0A 3KUDB 3DVGY 3RZFA 4KDIC 3IVFA 1FXTB 4NQKE 1ZW7A 2C7NB 2KTRB 5AZHA 4FULA 5G2NA 2KHWB 2IO3B 2DAFA 4HPMB 1H8CA 1KM7A 2IO2B 2KFJA 3V6CB 3VVWB 4IM2A 2KDIA 4PYUA 4ZDVA 2MRPA 5AZFA 1IP9A 5GMVA 1LFDA 2BYEA 2Z0EB 2L00B 3R3MA 2WWZA 4URKA 1Q1OA 5L83A 3IBEA 1P9DU 4JGHB 3X0WA 4ANWA 2XEWA 1OEYA 3ZNGC 4W9IA 4W9JA 3H7PA 1KLVA 3CF6E 3DCGA 1ZKHA 3ZDMC 3N32A 2N1WA 3L16A 4WWPA 2K8BA 4MELA 1BT0A 2HD5B 4I6NB 4ZYNA 1C3TA 4LJOB 3NOBA 3SDLC 2ZPNA 2Z59B 2PPHA 2LVPA 4PS8A 2JRHA 3PHWB 3UF8A 2KC1A 3EECA 4HDOA 4MSMB 2G4DB 4IG7B 1WZ3A 4IWPA 1LQBA 1J19A 3AULA 4FADA 4GMVA 4FN2A 3ZNZB 2AL6A 2PEAA 1GJZA 4A20A 5J18A 3R66C 5D6JB 3VHTC 2LGXA 2O2VB 3ZDTA 1V86A 1HE8A 2Y5BB 1WGHA 3S2AA 1K8RB 1E7UA 3QCAA 4GU2A 2O6VA 4AJYB 1WJNA 2EKEC 4HK2A 4TQ0A 4MGZE 2K8HA 3MJWA 3TBLD 3QQ8B 2N9EB 2RD0A 2YLMA 1WGGA 1P0RA 3A33B 3L54A 2ZJDA 4WWNA 2MCNB 3ONSA 2D3GA 3Q3JA 2ZPYA 5LXIB 1X1MA 4GDLA 5E6NA 2FCSA 4GGQA 1E90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHX A;  3AXC A;  4EZL A;  4N9F 4;  2KD0 A;  3APC A;  1GC6 A;  4X57 B;  3QA8 A;  2Z0D B;  2JZZ A;  1L2N A;  2M4N A;  3DVN V;  2D2Q A;  2UYZ B;  1TBE A;  2KJR A;  2VRR B;  3NS8 A;  1YQB A;  1KOT A;  2KDF B;  1WMH B;  5CX3 A;  5HKH A;  3QAR A;  2GBR A;  5D7G A;  2NPT A;  3IHP C;  1V6E A;  4IWQ A;  4E74 A;  2MA9 B;  2WYQ A;  3QK0 A;  3R7Q A;  1XQQ A;  2XK5 A;  3TCA A;  2LVO A;  4W9H A;  3VUX A;  3KYD D;  2YVC A;  1WI0 A;  2DHZ A;  3A9K A;  3HHM A;  4DBG A;  2BYV E;  4IM0 A;  4IM3 A;  4HDQ A;  1OQY A;  3JVZ X;  4IC7 B;  2CHW A;  4WJN A;  3PSE B;  2DZK A;  3PRZ A;  4F1S A;  1NI2 A;  2FIF A;  3RCZ A;  1WX7 A;  2R2Q A;  2FAZ A;  3V61 A;  1V5O A;  2JT4 B;  2K6D B;  2N9P C;  3PLU A;  2KZR A;  3MTN B;  5G55 A;  3SD5 A;  3IG3 A;  3KW5 B;  3I3T B;  4FHJ A;  4HCN B;  3W1S C;  3ZKJ C;  4AWJ A;  4CO7 A;  2MBB B;  2FID A;  3A9J A;  4WJO A;  2FUH B;  3V60 A;  4HXD A;  1GC7 A;  2DYO A;  2KDB A;  2ZZP B;  2LAS A;  1SGH A;  2KVR A;  4EEW A;  1WRD B;  1TZ1 A;  4DDI D;  5E6O A;  2L8J A;  4P7I A;  2CU1 A;  1EO6 A;  2DEN B;  2GBK A;  2OJR A;  2IO0 B;  2JZ3 B;  2L3Z A;  2V1Y A;  3IFW B;  4II3 B;  4LDT B;  3U7D A;  3P2B A;  1LM8 B;  1SE9 A;  3PHX B;  2LJ5 A;  2IY1 B;  3L17 A;  2JVC A;  2V4L A;  4K1R B;  4ASW C;  2JWZ A;  2K6Q A;  2BYF A;  2A5U A;  3NZU A;  1WGR A;  2K39 A;  4M0W B;  4XC2 A;  4EFO A;  2KJ6 A;  3PRE A;  2CHZ A;  4ICU A;  3QIJ A;  5EDS A;  2KC2 A;  1YJ1 A;  2KN5 A;  2PE6 B;  1WYW B;  3A1Q B;  2C7H A;  4BBN F;  1WR6 E;  4EUT A;  2IY0 B;  1WE7 A;  4JQW C;  3RYT A;  4FHK A;  3ZIM A;  2M1M A;  2ZEQ A;  3VQI A;  3TMP B;  2LXA A;  2B3A A;  4F7Z A;  4NJ6 A;  2LXC A;  3UIN B;  2RPQ A;  2I1J A;  1P3Q U;  4II2 B;  1UH6 A;  1S1Q B;  3L13 A;  3TIX A;  4ZRI A;  3ZO5 B;  3DVN U;  2N9X A;  1GUA B;  3OLM D;  2CKH B;  2NCN A;  2L0T A;  2MP2 A;  4F8C B;  3SHQ A;  2R2O A;  1E8W A;  2BGF A;  3ZUN A;  3B0A A;  1I35 A;  4YL8 A;  4BKG A;  4WQO B;  2DZJ A;  3QAQ A;  3CMM B;  2KOX A;  3VH4 B;  1E7V A;  2NR2 A;  1XD3 B;  3PGE A;  2NVU I;  4GN1 A;  3DVG X;  5CTR C;  4WAA A;  4J6I A;  1UZX B;  1J0G A;  3PLV A;  4G3X B;  4XX5 A;  1ISN A;  2MBO A;  3H7P B;  3ECI A;  4MEM A;  3UIP B;  1IYF A;  3HK0 A;  3H7S A;  2I1K A;  3RZW C;  2LRW A;  4G0N B;  1WR1 A;  1WJ4 A;  3ZTD A;  4BFR A;  4FJV B;  3D32 A;  4I6L B;  3W1S A;  4M8M A;  4MJS A;  5D94 A;  2HTH A;  2K25 A;  3T9L A;  5DPR A;  2KK8 A;  3HM3 A;  2LI5 A;  1WJ6 A;  3OJ4 B;  2C5L C;  3ML9 A;  4ZRK A;  4BKT A;  4PS7 A;  3ALB A;  4KZ0 A;  3VTV A;  2LVQ A;  2KFK A;  4TUU A;  3JSV A;  1YX6 B;  3HM6 X;  2LZ6 A;  1OTR B;  3UQA A;  4PS3 A;  2IBI B;  3O65 B;  4DHZ B;  2M8S A;  4K7S A;  3M3J A;  1YX5 B;  2HJ8 A;  1KJT A;  2D10 A;  3ZRC A;  1V2Y A;  3EFU A;  1LXD A;  5D2M B;  3TJP A;  1U4A A;  4AUQ C;  2BF8 B;  3K9O B;  3H6N A;  1Y8R C;  2O6V B;  5LXH A;  2GOW A;  4RM9 A;  1Z5S B;  3KH0 A;  4FJZ A;  4HLE A;  3ZNI D;  4ANU A;  3X23 A;  3WAL A;  4DHZ E;  2KX0 A;  4DWF A;  2DAJ A;  2NBW B;  2ZCB A;  3PZD A;  5BO4 B;  2L0F A;  3L0W B;  2AL3 A;  2MBQ A;  4GDL B;  5CHF A;  2C7M B;  1E8Z A;  3PVL A;  5E6P A;  1UD7 A;  3VUY A;  4W9C A;  1UBQ A;  4KSK C;  3OAW A;  3ENE A;  2FCQ A;  4LDT D;  2ZNV B;  4CHK A;  4AJW A;  5LLI A;  4GIV A;  4TQ1 A;  1UBI A;  1WMH A;  1E8Y A;  2EMT A;  2FNJ B;  4RM8 A;  1M94 A;  3B1L X;  3PTF C;  1P98 A;  1WY8 A;  3H1U A;  2HE7 A;  4KIK A;  2N4F A;  3V62 A;  1PQS A;  2NPT B;  1J8C A;  3WAO A;  5C1Z A;  3M95 A;  1L7Y A;  2JUO A;  2DZI A;  2MBH A;  2XK5 B;  3QX1 A;  3RD2 A;  3AU5 A;  3Q3F A;  2DZM A;  3DBR I;  5JH5 C;  1V9J A;  3A9K B;  2LGY A;  4NAW B;  4DHJ B;  4FLH A;  4ANV A;  4DDG D;  2L76 A;  3JYU A;  4ZRJ A;  3ZLZ A;  3DBH I;  4GXB A;  1WXV A;  3DDC B;  3QWZ B;  4K7U A;  1NBF C;  3L08 A;  3JW0 X;  4I6P A;  4OVU A;  2J0M A;  3KVF B;  1RRB A;  1GNU A;  3A9J B;  1WF9 A;  1TTN A;  2DYB A;  2M0X A;  2JXX A;  2W9N A;  4G50 A;  3TL5 A;  3VDZ A;  3VFK A;  3ZVV A;  3KUZ A;  1WXM A;  5IA7 A;  1EF5 A;  4GDK A;  2KX3 A;  4B95 A;  2KQ7 A;  3VH3 B;  3ZNH B;  5JZE B;  2J0K A;  1IPG A;  4NPN A;  3ZTC A;  1G6J A;  3GOE A;  2ZVN A;  1EUV B;  3ZRF A;  3NY5 A;  1R4M I;  2LRU A;  4BKS D;  4G11 A;  3PPA A;  2KMA A;  2FCN A;  4ANX A;  2MSE D;  5KHO A;  2A4Z A;  1UEL A;  1NDD A;  5DPT A;  1OGW A;  1A5R A;  4MM3 A;  3A1Q A;  3EC8 A;  3APF A;  4EZJ A;  1F9J A;  3QC8 B;  4JLC A;  1MG8 A;  4EOY A;  1WFY A;  2KDE B;  2KTR A;  2N1V A;  4A3P A;  4B6W A;  3ZW3 A;  2KJH B;  2LD9 A;  2FCM A;  1WGD A;  2ASQ A;  1P1A A;  3AI5 A;  3RUI B;  4M8N A;  1WIA A;  3UQB A;  2C60 A;  2NBU A;  1RLF A;  3NZS A;  4HCP B;  3WIM A;  2WDT B;  2UWQ A;  2KMC A;  1XT9 B;  2ZNV C;  4HPL B;  4BVU C;  3APD A;  2LWP A;  3DOW A;  3PRM B;  3DPD A;  1WXS A;  2V3S A;  2MP2 B;  4NJ7 A;  2G4S A;  2O6V D;  3ML8 A;  4MGI E;  4DXA B;  2MWS B;  1WX8 A;  1Q0W B;  2NS5 A;  4GOC A;  4TKN A;  2ZCC A;  4GB9 A;  4BKS A;  5L95 C;  1E8X A;  1V80 A;  2OOB B;  2DYM A;  2DX5 B;  3RUL A;  4FA6 A;  2K8C A;  2PJH A;  1GG3 A;  1WM2 A;  2MLB A;  2JRI B;  4AP4 C;  5C23 A;  3KUC B;  2L05 A;  4LCD E;  1YD8 U;  1EF1 A;  2PE9 A;  1WGY A;  4EKU A;  1AAR A;  3W1Y A;  5KHQ A;  5JHB A;  1Q5W B;  2EMS A;  3QJZ A;  3K9P B;  1T0Y A;  3AU4 A;  4CYE A;  4MJS B;  2O2V A;  2KWV B;  4W9K A;  2KLC A;  3UIO B;  4MGK E;  5CHV C;  5DCN A;  4EZK A;  5J17 A;  1V81 A;  4IUM B;  4LJP B;  1UGM A;  1RAX A;  2RSU A;  1WZ0 A;  2KFK B;  4TV3 A;  3CST A;  1WH3 A;  2JF5 A;  3JSV B;  4BOZ B;  3QHT A;  3L10 B;  2NBV B;  3N30 A;  3KYC D;  2M17 A;  3T8M A;  2C9W B;  4IW0 A;  4E3C A;  2MBE A;  2GBJ A;  2LUE A;  2IZV B;  3WAM A;  3U8Z A;  4XZ4 A;  4FJY A;  2AYO B;  2J7Q B;  3BIN A;  3VXW A;  1S3S G;  4JIO U;  3A4S C;  4DHJ D;  1V49 A;  2J0J A;  2BWE S;  2G45 B;  2MW5 A;  2IYD B;  2KTF A;  1D3Z A;  4FBJ B;  2D11 A;  4OVV A;  3PT2 B;  2KWC A;  1C1Y B;  1VCB A;  4AOF A;  4KZC A;  2BWF A;  4BBN C;  5DPS A;  2N7E A;  2GBN A;  1WXA A;  2KWU B;  3DBS A;  4MDK E;  3U30 A;  5DPW A;  4WWO A;  5IAA C;  2BPS A;  3GZN I;  2G3Q B;  4MSQ B;  4W9L A;  2XBB C;  4B9K A;  4W9E A;  2KQS A;  2KAN A;  3VTW A;  1OEY J;  4NQL B;  2ZVO A;  3MHS D;  5AZG A;  2AEH A;  4HWI B;  3UGB B;  4KV2 A;  2IO1 B;  2MQJ A;  4A3O A;  1WM3 A;  2K1F A;  1I42 A;  2D07 B;  3PRP B;  3SU8 X;  3CSF A;  1YIW A;  2KLG A;  2JY6 A;  4E71 A;  2L7R A;  4HVB A;  4K81 A;  4KDL B;  3RT3 B;  3V6E B;  3VUW A;  4KIK B;  3H9D A;  2GBM A;  3BY4 B;  3LJ3 A;  4K7W A;  4W9G A;  4ICV A;  3VTU A;  1V5T A;  1Z2M A;  1TGZ B;  2BKR B;  2WX0 A;  3A4R A;  3M63 B;  1ZGU B;  2LGD A;  4NAW A;  5JHA A;  4RMA A;  1SIF A;  2N7D A;  2KKC A;  3M62 B;  2RR9 A;  5J2R A;  1QZE A;  5FR6 A;  4JL9 A;  3OJ3 A;  4IWO A;  2JPH A;  1E5W A;  2MX2 A;  1CMX B;  3LDZ E;  3VAW A;  3PS6 A;  2KNB A;  1WJU A;  1R4N I;  4NY0 A;  2KXJ A;  1VD2 A;  2CS4 A;  4W9F A;  4HJK A;  3HIZ A;  3NHE B;  4DK5 A;  5AEK B;  4KSL C;  4MH0 E;  3N3K B;  5TR5 A;  3EHV A;  2QHO A;  3B08 A;  4BOS C;  1H4R A;  4GDK B;  2BKF A;  4WJQ A;  4GSW A;  2GMI C;  2WX1 A;  3DBL I;  1JRU A;  4MGY E;  2AWT A;  2CR5 A;  2REX A;  3DQV A;  1RFA A;  5CHW A;  3R7R A;  1WX9 A;  3WAP A;  4WJP A;  2KO3 A;  3C0R B;  4PYZ A;  3PV1 A;  2RGF A;  3WAN A;  1WE6 A;  4KVG B;  4W9D A;  4NNJ B;  3WA0 A;  3KUD B;  3DVG Y;  3RZF A;  4KDI C;  3IVF A;  1FXT B;  4NQK E;  1ZW7 A;  2C7N B;  2KTR B;  5AZH A;  4FUL A;  5G2N A;  2KHW B;  2IO3 B;  2DAF A;  4HPM B;  1H8C A;  1KM7 A;  2IO2 B;  2KFJ A;  3V6C B;  3VVW B;  4IM2 A;  2KDI A;  4PYU A;  4ZDV A;  2MRP A;  5AZF A;  1IP9 A;  5GMV A;  1LFD A;  2BYE A;  2Z0E B;  2L00 B;  3R3M A;  2WWZ A;  4URK A;  1Q1O A;  5L83 A;  3IBE A;  1P9D U;  4JGH B;  3X0W A;  4ANW A;  2XEW A;  1OEY A;  3ZNG C;  4W9I A;  4W9J A;  3H7P A;  1KLV A;  3CF6 E;  3DCG A;  1ZKH A;  3ZDM C;  3N32 A;  2N1W A;  3L16 A;  4WWP A;  2K8B A;  4MEL A;  1BT0 A;  2HD5 B;  4I6N B;  4ZYN A;  1C3T A;  4LJO B;  3NOB A;  3SDL C;  2ZPN A;  2Z59 B;  2PPH A;  2LVP A;  4PS8 A;  2JRH A;  3PHW B;  3UF8 A;  2KC1 A;  3EEC A;  4HDO A;  4MSM B;  2G4D B;  4IG7 B;  1WZ3 A;  4IWP A;  1LQB A;  1J19 A;  3AUL A;  4FAD A;  4GMV A;  4FN2 A;  3ZNZ B;  2AL6 A;  2PEA A;  1GJZ A;  4A20 A;  5J18 A;  3R66 C;  5D6J B;  3VHT C;  2LGX A;  2O2V B;  3ZDT A;  1V86 A;  1HE8 A;  2Y5B B;  1WGH A;  3S2A A;  1K8R B;  1E7U A;  3QCA A;  4GU2 A;  2O6V A;  4AJY B;  1WJN A;  2EKE C;  4HK2 A;  4TQ0 A;  4MGZ E;  2K8H A;  3MJW A;  3TBL D;  3QQ8 B;  2N9E B;  2RD0 A;  2YLM A;  1WGG A;  1P0R A;  3A33 B;  3L54 A;  2ZJD A;  4WWN A;  2MCN B;  3ONS A;  2D3G A;  3Q3J A;  2ZPY A;  5LXI B;  1X1M A;  4GDL A;  5E6N A;  2FCS A;  4GGQ A;  1E90 A; 
#chains in the Genus database with same CATH topology
 2V4I B;  2V3P A;  3APC A;  1RM6 C;  1GC6 A;  4X57 B;  2Z0D B;  4YTP B;  3DHH C;  5EE1 A;  1KOT A;  1JWA D;  3IT4 B;  5CX3 A;  3DBL B;  2GBR A;  2NPT A;  1V6E A;  4WQM A;  4RGN A;  3TCA A;  1FXI A;  4M02 A;  4LNO A;  1WI0 A;  1KRH A;  4IC7 B;  4HDQ A;  4F1S A;  3PRZ A;  3W5U B;  2R2Q A;  1V5O A;  2N9P C;  3IG3 A;  3KW5 B;  1TZO A;  3A9J A;  2SAK A;  2G1E A;  5MPO A;  1SGH A;  3MTN B;  1EO6 A;  2JZ3 B;  1T0S C;  1MG4 A;  2LJ5 A;  1V8C A;  4A6Q A;  2BYF A;  2LHD A;  2A5U A;  4XC2 A;  1WGR A;  4EFO A;  1MFW A;  4ICU A;  5EDS A;  1YJ1 A;  2PE6 B;  4JQW C;  3RYT A;  1I4R A;  1N6Z A;  3NVW A;  2I1J A;  4II2 B;  2BW2 A;  1WWT A;  2KAJ A;  3BWU D;  2CKH B;  4F8C B;  5G5H A;  3FC4 A;  1JWM D;  2MHJ A;  3B0A A;  1UGJ A;  1XLP A;  2NR2 A;  3PGE A;  2BBC A;  1UZX B;  4MEM A;  1IYF A;  4G0N B;  1WJ4 A;  2QSD A;  4BFR A;  3W1S A;  5D94 A;  2K25 A;  2KK8 A;  1WGK A;  4RGT A;  2WXP A;  3ML9 A;  1ZE3 D;  3VTV A;  1C9F A;  3I5J C;  3P4P B;  3O65 B;  2BS4 B;  4YTM B;  2HJ8 A;  2D10 A;  1V2Y A;  5D2M B;  2BF8 B;  2W55 A;  3H6N A;  1Y8R C;  2GOW A;  1JRO A;  1K51 A;  1YN5 A;  3Q8C A;  4FJZ A;  4HLE A;  3DBR B;  2KX0 A;  2DAJ A;  2ZCB A;  3U2S C;  1I7H A;  1UWM A;  2AL3 A;  1MHH E;  2D3B A;  2GB1 A;  2Y3A A;  2MBQ A;  4P16 A;  5E6P A;  4W9C A;  1UBQ A;  1UF0 A;  4KSK C;  2FCQ A;  3TEW A;  1VZ8 A;  1WMH A;  2EMT A;  2FNJ B;  4RM8 A;  1M94 A;  3B2G A;  3L4P A;  3PTF C;  1P98 A;  2N4F A;  2NPT B;  1BUI C;  3R2T A;  3AEB B;  3M95 A;  2KQ4 X;  1L7Y A;  1HTQ A;  3AU5 A;  2DZM A;  1UUP A;  4NAW B;  4ANV A;  4DDG D;  2L76 A;  3Q6B A;  3QWZ B;  1EM7 A;  4I6P A;  3A9J B;  1TY2 A;  1E0Z A;  1WXM A;  5IA7 A;  3BVM A;  5C3J B;  3ZNH B;  1EUV B;  4ANX A;  1QKZ A;  3ZQ4 A;  1UEL A;  2INP E;  3A1Q A;  3APF A;  1ET6 A;  3KWL A;  3I63 C;  1MG8 A;  1WFY A;  2FCM A;  3RNE C;  4M8N A;  4A90 A;  1ZXI A;  2BS2 B;  2LEK A;  3AMZ A;  1L0V B;  3DOW A;  3PRM B;  4CQN A;  4XE0 A;  2G4S A;  4MGI E;  2NS5 A;  2NMQ A;  4GB9 A;  5L95 C;  2DX5 B;  4OZB A;  4AQ7 A;  2K8C A;  2JRI B;  3BVZ A;  1VLB A;  2MJE A;  1CJE A;  4EKU A;  1AAR A;  5KHQ A;  4RFB A;  4US9 A;  2EMS A;  4LNI A;  2KWV B;  4W9K A;  2IDY A;  4MGK E;  3EGR A;  1V81 A;  4LJP B;  4R3D A;  1RAX A;  1WZ0 A;  1WH3 A;  1MJD A;  1TY0 A;  1F77 A;  3NZ3 A;  1QF6 A;  2BWE S;  2MW5 A;  2KTF A;  1D3Z A;  2D11 A;  4OVV A;  3PT2 B;  2TSS A;  1C1Y B;  4AOF A;  4KZC A;  4BBN C;  4D2K A;  5DPS A;  2PVG C;  5DPW A;  1NYR A;  3U30 A;  5IAA C;  5D3I B;  3P4R B;  3P42 A;  2G3Q B;  2V0G A;  4YSY B;  2N0S B;  1RFK A;  2ZVO A;  3MHS D;  2AEH A;  2EEL A;  3PZ8 A;  2IO1 B;  2D07 B;  1FFV A;  3ZYY X;  4K81 A;  3V6E B;  4W9G A;  4C7Z A;  1UWX A;  1FCL A;  1V5T A;  1JWS D;  4OZA A;  1Z2M A;  1TGZ B;  1IGC A;  3A4R A;  2LGD A;  3M62 B;  2JPH A;  3U52 E;  1D5Z C;  1WYG A;  3LDZ E;  1SJE D;  3AED B;  2KXJ A;  2CS4 A;  4A55 A;  3NHE B;  2JQR B;  5AEK B;  3I57 A;  4BOS C;  2BKF A;  1N62 A;  2GMI C;  2WX1 A;  1IBX A;  2AWT A;  1PGB A;  1HEZ E;  1ESF A;  2KO3 A;  4PYZ A;  3PV1 A;  3WCQ A;  3RZF A;  1PDX A;  3AEE B;  3IVF A;  1FM0 D;  1ZW7 A;  3N9Y C;  5AZH A;  1TS2 A;  2KHW B;  4A9A A;  2KDI A;  4PYU A;  4ZOH C;  4ZDV A;  5AZF A;  3J9C A;  5GMV A;  1LFD A;  4YT0 B;  3P1M A;  2L00 B;  2MJ3 A;  3MHZ A;  1J7C A;  2KWD A;  3KQ4 A;  4W9I A;  4W9J A;  3H7P A;  3VR9 B;  3NVY A;  1T0Q C;  2N1W A;  3L16 A;  1KFY B;  1BT0 A;  4I6N B;  1C3T A;  4WH4 A;  4PS8 A;  2JRH A;  4LNN A;  2QIE B;  1L6U A;  4IG7 B;  5I4D A;  1J19 A;  3AUL A;  3RPF C;  1YQ3 B;  2PTL A;  4FAD A;  4GMV A;  3ZNZ B;  2BYT A;  2AL6 A;  3R66 C;  2K5P A;  2LGX A;  5H92 C;  1HE8 A;  1WJN A;  2EKE C;  4MGZ E;  2K8H A;  4YXD B;  2RD0 A;  1P0R A;  1YJI A;  2MCN B;  4GDL A;  1C4C A;  1FNV A;  5E6N A;  2WS3 B;  4RH6 A;  3AXC A;  1ET9 A;  3AB5 A;  2UYZ B;  2KJR A;  3E9S A;  2KVZ A;  2K0P A;  3QAR A;  5D7G A;  2MA9 B;  3UI3 A;  2WXO A;  1XQQ A;  2JWU A;  2LVO A;  1R7S A;  3AE8 B;  2L83 A;  4DBG A;  2QJL A;  4IM3 A;  5FR3 A;  3JVZ X;  5G5G A;  2DZK A;  1WX7 A;  2FAZ A;  3SD5 A;  3W1S C;  4FHJ A;  1TKG A;  5HHD G;  2MBB B;  4WJO A;  3V60 A;  4EEW A;  4WAF A;  4XWW A;  4DDI D;  2CU1 A;  4K7W A;  2OJR A;  3RI7 C;  3U7D A;  4KGS A;  4PK1 A;  2IY1 B;  3L17 A;  2JVC A;  2JWZ A;  3NZU A;  3RNC C;  1WYW B;  2C7H A;  4BBN F;  4EUT A;  2IY0 B;  3ZIM A;  4LNK A;  1IBX B;  2ZEQ A;  2B3A A;  4F7Z A;  2BB6 A;  3UIN B;  2GLS A;  3P4Q B;  1S1Q B;  3L13 A;  4JE3 B;  2L0T A;  2WLB A;  2R2O A;  1XLQ A;  1I35 A;  4YL8 A;  4BKG A;  2RMM A;  1C77 A;  3QAQ A;  4B0E A;  1PFD A;  4GN1 A;  5JXV A;  2NVU I;  4WAA A;  3Q8E A;  1J0G A;  5IKC M;  4ZRQ A;  2BVC A;  3H7P B;  3UIP B;  3HK0 A;  4Q2J A;  2I1K A;  3RZW C;  4FJV B;  2AQ2 B;  3D32 A;  4M8M A;  2HTH A;  2LFI A;  3T9L A;  3HM3 A;  1WJ6 A;  4KKI A;  4ZRK A;  1FFU A;  1TJE A;  4PS7 A;  3JSV A;  3Q3N C;  3HM6 X;  2LZ6 A;  1OTR B;  4PS3 A;  2IBI B;  4DHZ B;  4K7S A;  3M3J A;  3C8Y A;  4WIP A;  1FEH A;  1KJT A;  4AUQ C;  5LXH A;  3AH7 A;  1Z5S B;  3KH0 A;  4IKG A;  3GB1 A;  3WAL A;  2X38 A;  2NBW B;  3PZD A;  4L1B A;  5BO4 B;  2L0F A;  2INN E;  3L0W B;  5GXG B;  1FNW A;  4GDL B;  2WHI A;  4H2A A;  3PVL A;  3EUB 2;  2W54 A;  2QEJ C;  2QDF A;  3OAW A;  4JWU C;  2WXN A;  5IN7 A;  3RNG C;  2BTE A;  3LYY A;  1ZOY B;  1E8Y A;  2WXM A;  2DBY A;  1AN8 A;  3NVV A;  1WY8 A;  3V62 A;  1GPX A;  3WAO A;  1STE A;  3AN1 A;  2JUO A;  2MBH A;  1V9J A;  2LGY A;  3NVZ A;  3R2I A;  2RPV A;  3MC9 A;  2RDG A;  3DBH I;  3RNF C;  1FNU A;  1GB1 A;  1WXV A;  1NBF C;  3DWG C;  2J0M A;  3KVF B;  3ZJV A;  2M19 A;  3KUZ A;  4GDK A;  4B95 A;  2ZVN A;  1V97 A;  3NY5 A;  2LRU A;  3HVD A;  2EKI A;  4G11 A;  2FCN A;  1NDD A;  1OGW A;  4EZJ A;  1F9J A;  4EOY A;  3AEF B;  4A3P A;  4B6W A;  1N63 A;  1WGD A;  3FAH A;  3AI5 A;  3RUI B;  1YJJ A;  2E6X A;  1RLF A;  5IOI A;  1SF0 A;  4BVU C;  3FIL A;  3RFZ B;  1WXS A;  2O6V D;  4K3B A;  2QCZ A;  1AW7 A;  1E8X A;  1V80 A;  2OOB B;  1VRA B;  4FA6 A;  3AEG B;  1GG3 A;  1WM2 A;  2MLB A;  4AP4 C;  5C23 A;  3KUC B;  4B0M A;  5LNK 1;  1EF1 A;  2PE9 A;  3AU4 A;  2RDB C;  2FE8 A;  2KLC A;  3UIO B;  2WDV B;  5J17 A;  2LUM A;  4TV3 A;  4N6E B;  3ABV B;  3CST A;  3JSV B;  3QHT A;  1I4G A;  3N30 A;  1DYQ A;  2C9W B;  4IW0 A;  1SJH D;  3WAM A;  3U8Z A;  4FJY A;  2AYO B;  1ACC A;  3BIN A;  3VXW A;  4FXC A;  3A4S C;  3LB8 C;  2G45 B;  5HG2 A;  4DXG A;  3GE3 C;  3W5V B;  1C4P A;  1VCB A;  1XO3 A;  2JX5 A;  2BWF A;  3TUO A;  4P6V F;  1E10 A;  2N7E A;  2KWU B;  2KT7 A;  4MDK E;  4WWO A;  1HZ6 A;  3ZJU A;  2BPS A;  5C2T B;  1K52 A;  3GZN I;  1OQQ A;  1R4M B;  4W9L A;  1EU3 A;  1KTK A;  2XBB C;  4JWS C;  4B9K A;  2KAN A;  3OG5 A;  3RN9 C;  4NQL B;  5AZG A;  4KV2 A;  2IND C;  2MQJ A;  1WM3 A;  4K3C A;  3SU8 X;  3CSF A;  2JY6 A;  2L7R A;  3DWM A;  4HVB A;  3E56 A;  4ARC A;  1N5W A;  1ZPS A;  3H9D A;  2GBM A;  3BY4 B;  3LJ3 A;  1ZP0 B;  2WX0 A;  3W2D A;  3TEZ A;  1SIF A;  2KKC A;  2RR9 A;  1P7F A;  2MX2 A;  4LTU A;  2R61 A;  1R4N I;  3AE6 B;  4NY0 A;  2RDH A;  1VD2 A;  4RGO S;  1L4Z B;  4TMA B;  3U4E G;  2ON8 A;  4KSL C;  4MH0 E;  3BK1 A;  3N3K B;  1JCK B;  3EHV A;  2HTM E;  5AUK A;  4LK0 M;  4GDK B;  2VH2 A;  4HEA 1;  2K3U A;  3B9J A;  3DBL I;  1SE3 A;  3Q2A C;  2REX A;  1RFA A;  1WX9 A;  4WJP A;  3VRB B;  3V05 A;  1VZ6 A;  2RGF A;  3WAN A;  2WQY B;  3SFD B;  4KVG B;  3TSS A;  3KUD B;  2KAC A;  2ACZ B;  4KDI C;  4XYC A;  4NQK E;  1ZXH A;  2W82 A;  2IO3 B;  1KM7 A;  4IM2 A;  5E6J A;  2WGS A;  1SEB D;  1KLG D;  3R3M A;  4TSS A;  4URK A;  1Q1O A;  5L83 A;  1P9D U;  2XEW A;  3FIL B;  1OEY A;  3NG0 A;  1XLN A;  1KLV A;  1NI3 A;  3ZDM C;  4YSX B;  3NJT A;  3RNA C;  1JWU D;  1JW9 D;  4MEL A;  4ZYN A;  3SDL C;  2ZPN A;  2PPH A;  3AM9 A;  1WSP A;  1VJK A;  4HDO A;  3URY A;  2G4D B;  4IWP A;  2PEA A;  4A20 A;  4KGT A;  1IGD A;  1V86 A;  2Y5B B;  1WGH A;  1K8R B;  1E7U A;  2O6V A;  4HK2 A;  2WXI A;  3FKY A;  1FCC C;  3Q8B A;  2IPK D;  2QIL A;  1X1M A;  1CK1 A;  4GGQ A;  1E90 A;  3TJP A;  2AQ1 B;  2CHX A;  4ZHO A;  2KD0 A;  3QA8 A;  2JZZ A;  1L2N A;  3DVN V;  1TBE A;  5BMG A;  3AE3 B;  4ACF A;  3V3X A;  2KDF B;  2PLP A;  1WMH B;  4C80 A;  5HKH A;  2V9H A;  2WXL A;  3IHP C;  4IWQ A;  4E74 A;  2WYQ A;  3QK0 A;  3R7Q A;  2XK5 A;  3T3O A;  4W9H A;  3VUX A;  2YVC A;  2OHF A;  2DHZ A;  3A9K A;  4N58 A;  1YN4 A;  1D5X C;  1OQY A;  3PSE B;  1FXA A;  2N7J A;  3RCZ A;  1DOY A;  2K6D B;  2JT4 B;  2KZR A;  4XWT A;  3I3T B;  3ZKJ C;  4MT5 A;  4XGA B;  2WU5 B;  2FUH B;  1K53 A;  4HXD A;  2D3A A;  2ZZP B;  4BAX A;  1VZ7 A;  1WRD B;  1TZ1 A;  2I38 A;  2K9X A;  1DOI A;  5E6O A;  2L8J A;  4P7I A;  2DEN B;  2GBK A;  2L3Z A;  4II3 B;  3ZGZ A;  1LM8 B;  1SE9 A;  3PHX B;  1V1O A;  3PRE A;  2CHZ A;  3T3N A;  3A1Q B;  3IT6 B;  4ZYS A;  4FHK A;  2M1M A;  3TMP B;  2LXA A;  2J52 A;  2WP9 B;  3BYT B;  3BZD B;  4NJ6 A;  2RPQ A;  1P3Q U;  2FUG 1;  1UH6 A;  1Q10 A;  2JSV X;  1KLU D;  1QOF A;  4ZRI A;  3N1X C;  2HDE A;  3PZ7 A;  1GUA B;  2XNA C;  3OLM D;  2NCN A;  3RNB C;  3SHQ A;  1HA5 A;  2LMC A;  2GRI A;  3BII D;  3GS2 A;  3CMM B;  5HFY A;  1E7V A;  3DVG X;  4J6I A;  4G3X B;  3PO0 A;  2BT6 A;  1ISN A;  2MJD A;  2YEP B;  2ZW1 A;  1WR1 A;  3ZTD A;  4I6L B;  1YMH E;  4MJS A;  1L0X B;  4ZHP A;  2CJO A;  2LI5 A;  3OJ4 B;  3IAS 1;  3H8H A;  4BKT A;  1L5P A;  3ALB A;  4KZ0 A;  2LVQ A;  2I2Y A;  1N61 A;  4OZC A;  2M8S A;  2V3N A;  3RMK C;  4KX6 B;  2IGD A;  1QT9 A;  1U4A A;  2O6V B;  2ONQ A;  4RM9 A;  1TIF A;  2K22 A;  3ZNI D;  3X23 A;  4DHZ E;  2OED A;  1VR9 A;  4DWF A;  2INC C;  3DBH B;  2JYT A;  2WXQ A;  4USA A;  1K50 A;  2VZK D;  1E8Z A;  2J4X A;  1UD7 A;  1TS3 A;  4ARI A;  3VUY A;  3ENE A;  4LDT D;  4GLS C;  1FRR A;  4GIV A;  1UBI A;  1F2R C;  4N59 A;  4M00 A;  3B1L X;  1VDV A;  3H1U A;  4L23 A;  4C56 C;  3KLS X;  1HQR D;  1PQS A;  1J8C A;  2XK5 B;  2DZI A;  1OFF A;  3QX1 A;  1D5M C;  3RD2 A;  5JH5 C;  2IGG A;  3A9K B;  4FLH A;  3JYU A;  4ZRJ A;  3ZLZ A;  3BVG A;  1FD6 A;  4OVU A;  3JW0 X;  2ZW0 A;  3AEA B;  3Q14 C;  1RRB A;  2DYB A;  1TTN A;  2M0X A;  2W9N A;  1TKE A;  3ZVV A;  4P1B C;  3VFK A;  1XCQ L;  2KX3 A;  2KMM A;  5JZE B;  4IOI E;  2J0K A;  3ZTC A;  1G6J A;  1LGR A;  2MSE D;  1PGX A;  2AQ3 B;  3CWI A;  5DPT A;  1A5R A;  4MM3 A;  3ETR A;  3QC8 B;  5BYR A;  4JLC A;  2WXH A;  2KTR A;  2N1V A;  3HVZ A;  2LD9 A;  3BK2 A;  4HRO A;  2ASQ A;  1UNS A;  1C4A A;  2C60 A;  2NBU A;  2WDT B;  2UWQ A;  1XT9 B;  2ZNV C;  4HPL B;  2CJN A;  1C79 A;  3APD A;  2M56 B;  3DPD A;  2V3S A;  2Z8L A;  2X8X X;  4NJC A;  3ML8 A;  2MWS B;  1MHX A;  2QMT A;  1CZP A;  1JML A;  1I4X A;  1T3Q A;  4GOC A;  4TKN A;  3LXF A;  2ZCC A;  2M0A A;  4OHJ A;  4BKS A;  1B9R A;  3RUL A;  2NTT A;  1T5X D;  1I4H A;  1KH0 A;  1QOB A;  2L05 A;  2D5G A;  4LCD E;  1YD8 U;  1WGY A;  2J42 A;  1T0Y A;  4CYE A;  4RNA A;  4MJS B;  3MC8 A;  3GZN B;  2JXT A;  5CHV C;  5DCN A;  4EZK A;  1F0Z A;  5BYS A;  2LHE A;  2FBW B;  4IUM B;  4KGR A;  4WUR A;  1C76 A;  1E7P B;  4BOZ B;  3L10 B;  2NBV B;  3KYC D;  2LUE A;  4XZ4 A;  2J7Q B;  1S3S G;  1I4P A;  4DHJ D;  2IYD B;  2WDQ B;  1EWY C;  1GAQ B;  5H8Y E;  1M4V A;  1R4N B;  2GBN A;  3DBS A;  1SBB B;  1P7E A;  1B1Z A;  4MSQ B;  4W9E A;  3C19 A;  3AV8 A;  2KYW A;  1FMA D;  2H88 B;  3UGB B;  4A3O A;  3PRP B;  1YIW A;  4KKJ A;  1NEN B;  1SIJ A;  1D4B A;  3RT3 B;  2WXF A;  1L0Y B;  2UU7 A;  3AE2 B;  3ZJT A;  4NAW A;  5JHA A;  4REZ A;  5J2R A;  4IWO A;  1E5W A;  1CMX B;  2KNB A;  1FO4 A;  4W9F A;  3HIZ A;  1J7A A;  5TR5 A;  1MVK A;  2QHO A;  4M0W A;  1H4R A;  1YOV B;  3AE4 B;  1PUT A;  5IP4 D;  1JRU A;  4MGY E;  5CHW A;  3SR6 A;  3R7R A;  3WAP A;  3DHI C;  3C0R B;  3GP7 A;  5HI1 A;  4MM3 B;  2C7N B;  2KTR B;  2BB5 A;  2DAF A;  4HPM B;  4AS1 A;  2PKO A;  2L32 A;  2MRP A;  2E3T A;  1QOA A;  4XDD A;  5AUI A;  3IBE A;  1MPE A;  1ROE A;  4JGH B;  3X0W A;  3CF6 E;  3DCG A;  1V1P A;  3N32 A;  1JWB D;  1TKY A;  4WWP A;  1N60 A;  4LJO B;  3NOB A;  3I9V 1;  1SB3 C;  3PHW B;  3UF8 A;  4C00 A;  4MSM B;  4FN2 A;  3AEC B;  5J18 A;  3P4S B;  4HRS A;  5D6J B;  1QOG A;  5BYQ A;  4J3O D;  3ZDT A;  3EA6 A;  3OWE B;  3QCA A;  4GU2 A;  4AJY B;  1JAL A;  3GE8 C;  1CQV A;  3MJW A;  3TBL D;  2N9E B;  2YLM A;  3B2F A;  1WGG A;  3L54 A;  4WWN A;  2ZJD A;  3ONS A;  3Q3J A;  2ZPY A;  1WE6 A;  1I4Q A;  4EZL A;  4N9F 4;  3BYY B;  1BXT A;  2H89 B;  2M4N A;  2D2Q A;  3NRZ A;  2SEB D;  2VRR B;  3NS8 A;  1YQB A;  4DXF A;  1DGJ A;  3KYD D;  3HHM A;  2BYV E;  4IM0 A;  2PMV A;  2CU3 A;  2DLB A;  4WJN A;  1RYJ A;  2CHW A;  1LO5 D;  1AWD A;  1NI2 A;  2FIF A;  2JYE A;  3V61 A;  3PLU A;  5G55 A;  4HCN B;  4AWJ A;  4CO7 A;  2WU2 B;  2FID A;  1E6E B;  1GC7 A;  2DYO A;  2KDB A;  5EE9 A;  1PGA A;  2VZK B;  2LAS A;  2KVR A;  4XDC A;  1YN3 A;  3NS1 A;  2WXJ A;  2MH7 A;  1TYG B;  2BQQ A;  2IO0 B;  4LDT B;  1N5X A;  2V1Y A;  3IFW B;  2ICI A;  1YQ4 B;  3P2B A;  2V4L A;  4K1R B;  4ASW C;  2K6Q A;  3KWV A;  4M0W B;  2K39 A;  2KJ6 A;  1E9M A;  3QIJ A;  2KC2 A;  1EWC A;  3AE9 B;  2KN5 A;  2G9H D;  1WR6 E;  2LGI A;  2WNM A;  2W3S A;  1J7B A;  1WE7 A;  3MP9 A;  3ZXV A;  3VQI A;  3MJ5 A;  4L2Y A;  1SXT A;  2LXC A;  3AE7 B;  3HUI A;  3TIX A;  3ZO5 B;  3DVN U;  3TEX A;  2N9X A;  1NYQ A;  2LGS A;  4RGM A;  2MP2 A;  2YEP F;  1E8W A;  2BGF A;  3ZUN A;  4WQO B;  4C4V A;  2DNF A;  2DZJ A;  3VRA B;  2KOX A;  3VH4 B;  2J53 A;  1XD3 B;  5CTR C;  1FRD A;  3Q69 A;  3PLV A;  2XN9 C;  4XX5 A;  1F1H A;  1C78 A;  2MBO A;  4HPP A;  3ECI A;  3H7S A;  1L4D B;  1V1P B;  2LRW A;  1AYF A;  5DPR A;  2C5L C;  4A8X C;  2KFK A;  4TUU A;  3CIR B;  2PW9 A;  1YX6 B;  4O1N A;  1DOX A;  3UQA A;  1YX5 B;  2L52 A;  3ZRC A;  3EFU A;  1LXD A;  4HKZ E;  1XLO A;  3K9O B;  2D3C A;  4RF1 A;  1PYW D;  2PIA A;  3DHG C;  4HKQ A;  4ANU A;  2WXK A;  4OVZ A;  1NVI D;  3W9C B;  1T0R C;  5BMH A;  5EE3 A;  4OW0 A;  5CHF A;  2C7M B;  4YSZ B;  1TT5 B;  1IUE A;  2ZNV B;  4CHK A;  1HZ5 A;  4AJW A;  5LLI A;  1QIL A;  4TQ1 A;  3N20 C;  2HJ1 A;  2HE7 A;  3IAM 1;  4KIK A;  3Q8F A;  5C1Z A;  1HXY D;  1Y56 A;  1TS4 A;  1SSN A;  3Q3F A;  3DBR I;  4QAY A;  5IO9 A;  4DHJ B;  2QC8 A;  1XF5 L;  4GXB A;  4K7U A;  3DDC B;  3L08 A;  2LJI A;  1GNU A;  3IXS A;  1WF9 A;  3VDZ A;  3TL5 A;  2JXX A;  4G50 A;  4PT5 A;  1EF5 A;  2KQ7 A;  3VH3 B;  3AE1 B;  1IPG A;  4NPN A;  1SE2 A;  3GOE A;  1QQR A;  3ZRF A;  1R4M I;  4BKS D;  3PPA A;  2KMA A;  5KHO A;  2A4Z A;  3Q3M C;  1A70 A;  3EC8 A;  3HRD D;  3MFG A;  2KDE B;  3ZW3 A;  2KJH B;  2Q5W D;  1P1A A;  1OQR A;  1WIA A;  4JPS A;  3UQB A;  3NZS A;  1MI0 A;  4HCP B;  4NAM A;  3WIM A;  2JU6 X;  4BZA A;  2KMC A;  4US8 A;  1XCT L;  3N1Z C;  2LWP A;  3P63 A;  4RCO A;  1FIQ A;  1ZDX A;  1NEK B;  2MP2 B;  1WXQ A;  4NJ7 A;  4DXA B;  1WX8 A;  3N1Y C;  1Q0W B;  1WRI A;  3EFC A;  5FK9 C;  4C4V B;  1HTO A;  4S0R A;  2DYM A;  4C7Y A;  2PJH A;  4ITK A;  4ZRP A;  2GI9 A;  1T6B X;  3W1Y A;  2Y5C A;  5JHB A;  1Q5W B;  3QJZ A;  3K9P B;  1XXG A;  2O2V A;  3Q3O C;  4LNF A;  1TS5 A;  1UGM A;  2RSU A;  2KFK B;  1SE4 A;  5BMI A;  2JF5 A;  2IJ0 A;  4NZL B;  1XEE A;  2M17 A;  3T8M A;  4E3C A;  2MBE A;  2GBJ A;  2IZV B;  2KN4 A;  1ZDV A;  4YWG G;  2Y5P A;  4JIO U;  1GOZ A;  4MAC A;  1V49 A;  1F2R I;  1QLB B;  2J0J A;  1BML C;  2NTS A;  4FBJ B;  5FKA C;  1FPY A;  4YTN B;  2KWC A;  1D6E C;  1WXA A;  1KF6 B;  2OJW A;  1GB4 A;  2KQS A;  3MC0 B;  3VTW A;  2N9K A;  1OEY J;  4RF0 A;  2PVO D;  4HWI B;  2K1F A;  1I42 A;  3VR8 B;  2KLG A;  4E71 A;  1JRP A;  4KDL B;  3VUW A;  4KIK B;  3VTU A;  4ICV A;  2BKR B;  3M63 B;  1ZGU B;  4RMA A;  2N7D A;  2WXR A;  1QZE A;  5FR6 A;  4JL9 A;  1F52 A;  3OJ3 A;  1ZUD 2;  1RWS A;  2W3R A;  3U7Z A;  3VAW A;  3PS6 A;  1WJU A;  4HJK A;  1JQ4 A;  2DWQ A;  4DK5 A;  3O13 A;  5T8I A;  3B08 A;  2WXG A;  3SEB A;  4LLG M;  2MEK A;  4HJG E;  4GSW A;  4WJQ A;  3ZXR A;  2CR5 A;  3DQV A;  1L6V A;  4W9D A;  4NNJ B;  3WA0 A;  3DVG Y;  1FXT B;  2IGH A;  4M01 A;  4FUL A;  4WWM A;  5G2N A;  2B76 B;  1H8C A;  2IO2 B;  2KFJ A;  4P1C C;  3V6C B;  3VVW B;  1IP9 A;  4S17 A;  1YNT E;  2BYE A;  3R8B A;  2Z0E B;  2VH1 A;  2JZP A;  4JX1 C;  5EE0 A;  2WWZ A;  4ANW A;  1ENF A;  3ZNG C;  4IDI A;  3AE5 B;  5D3D A;  1ZKH A;  2WDR B;  2AX5 A;  2K8B A;  2HD5 B;  2L1A A;  2Z59 B;  2LVP A;  3NUH B;  2KC1 A;  3EEC A;  4MH8 A;  1WZ3 A;  1LQB A;  4DQO C;  1GJZ A;  3VHT C;  2O2V B;  3SFE B;  2N9L A;  5TSS A;  3S2A A;  4UDU C;  4TQ0 A;  2KDM A;  3TEY A;  3QQ8 B;  2BS3 B;  1EU4 A;  3A33 B;  2D3G A;  3Q8A A;  4EE2 A;  5LXI B;  2FCS A; 
#chains in the Genus database with same CATH homology
 2CHX A;  3AXC A;  4EZL A;  4N9F 4;  2KD0 A;  3APC A;  1GC6 A;  4X57 B;  3QA8 A;  2Z0D B;  2JZZ A;  1L2N A;  2M4N A;  3DVN V;  2D2Q A;  2UYZ B;  1TBE A;  2KJR A;  2VRR B;  3NS8 A;  1YQB A;  1KOT A;  2KDF B;  1WMH B;  5CX3 A;  5HKH A;  3QAR A;  2GBR A;  5D7G A;  2NPT A;  3IHP C;  1V6E A;  4IWQ A;  4E74 A;  2MA9 B;  2WYQ A;  3QK0 A;  3R7Q A;  1XQQ A;  2XK5 A;  3TCA A;  2LVO A;  4W9H A;  3VUX A;  3KYD D;  2YVC A;  1WI0 A;  2DHZ A;  3A9K A;  3HHM A;  4DBG A;  2BYV E;  4IM0 A;  4IM3 A;  4HDQ A;  1OQY A;  3JVZ X;  4IC7 B;  2CHW A;  4WJN A;  3PSE B;  2DZK A;  3PRZ A;  4F1S A;  1NI2 A;  2FIF A;  3RCZ A;  1WX7 A;  2R2Q A;  2FAZ A;  3V61 A;  1V5O A;  2JT4 B;  2K6D B;  2N9P C;  3PLU A;  2KZR A;  3MTN B;  5G55 A;  3SD5 A;  3IG3 A;  3KW5 B;  3I3T B;  4FHJ A;  4HCN B;  3W1S C;  3ZKJ C;  4AWJ A;  4CO7 A;  2MBB B;  2FID A;  3A9J A;  4WJO A;  2FUH B;  3V60 A;  4HXD A;  1GC7 A;  2DYO A;  2KDB A;  2ZZP B;  2LAS A;  1SGH A;  2KVR A;  4EEW A;  1WRD B;  1TZ1 A;  4DDI D;  5E6O A;  2L8J A;  4P7I A;  2CU1 A;  1EO6 A;  2DEN B;  2GBK A;  2OJR A;  2IO0 B;  2JZ3 B;  2L3Z A;  2V1Y A;  3IFW B;  4II3 B;  4LDT B;  3U7D A;  3P2B A;  1LM8 B;  1SE9 A;  3PHX B;  2LJ5 A;  2IY1 B;  3L17 A;  2JVC A;  2V4L A;  4K1R B;  4ASW C;  2JWZ A;  2K6Q A;  2BYF A;  2A5U A;  3NZU A;  1WGR A;  2K39 A;  4M0W B;  4XC2 A;  4EFO A;  2KJ6 A;  3PRE A;  2CHZ A;  4ICU A;  3QIJ A;  5EDS A;  2KC2 A;  1YJ1 A;  2KN5 A;  2PE6 B;  1WYW B;  3A1Q B;  2C7H A;  4BBN F;  1WR6 E;  4EUT A;  2IY0 B;  1WE7 A;  4JQW C;  3RYT A;  4FHK A;  3ZIM A;  2M1M A;  2ZEQ A;  3VQI A;  3TMP B;  2LXA A;  2B3A A;  4F7Z A;  4NJ6 A;  2LXC A;  3UIN B;  2RPQ A;  2I1J A;  1P3Q U;  4II2 B;  1UH6 A;  1S1Q B;  3L13 A;  3TIX A;  4ZRI A;  3ZO5 B;  3DVN U;  2N9X A;  1GUA B;  3OLM D;  2CKH B;  2NCN A;  2L0T A;  2MP2 A;  4F8C B;  3SHQ A;  2R2O A;  1E8W A;  2BGF A;  3ZUN A;  3B0A A;  1I35 A;  4YL8 A;  4BKG A;  4WQO B;  2DZJ A;  3QAQ A;  3CMM B;  2KOX A;  3VH4 B;  1E7V A;  2NR2 A;  1XD3 B;  3PGE A;  2NVU I;  4GN1 A;  3DVG X;  5CTR C;  4WAA A;  4J6I A;  1UZX B;  1J0G A;  3PLV A;  4G3X B;  4XX5 A;  1ISN A;  2MBO A;  3H7P B;  3ECI A;  4MEM A;  3UIP B;  1IYF A;  3HK0 A;  3H7S A;  2I1K A;  3RZW C;  2LRW A;  4G0N B;  1WR1 A;  1WJ4 A;  3ZTD A;  4BFR A;  4FJV B;  3D32 A;  4I6L B;  3W1S A;  4M8M A;  4MJS A;  5D94 A;  2HTH A;  2K25 A;  3T9L A;  5DPR A;  2KK8 A;  3HM3 A;  2LI5 A;  1WJ6 A;  3OJ4 B;  2C5L C;  3ML9 A;  4ZRK A;  4BKT A;  4PS7 A;  3ALB A;  4KZ0 A;  3VTV A;  2LVQ A;  2KFK A;  4TUU A;  3JSV A;  1YX6 B;  3HM6 X;  2LZ6 A;  1OTR B;  3UQA A;  4PS3 A;  2IBI B;  3O65 B;  4DHZ B;  2M8S A;  4K7S A;  3M3J A;  1YX5 B;  2HJ8 A;  1KJT A;  2D10 A;  3ZRC A;  1V2Y A;  3EFU A;  1LXD A;  5D2M B;  3TJP A;  1U4A A;  4AUQ C;  2BF8 B;  3K9O B;  3H6N A;  1Y8R C;  2O6V B;  5LXH A;  2GOW A;  4RM9 A;  1Z5S B;  3KH0 A;  4FJZ A;  4HLE A;  3ZNI D;  4ANU A;  3X23 A;  3WAL A;  4DHZ E;  2KX0 A;  4DWF A;  2DAJ A;  2NBW B;  2ZCB A;  3PZD A;  5BO4 B;  2L0F A;  3L0W B;  2AL3 A;  2MBQ A;  4GDL B;  5CHF A;  2C7M B;  1E8Z A;  3PVL A;  5E6P A;  1UD7 A;  3VUY A;  4W9C A;  1UBQ A;  4KSK C;  3OAW A;  3ENE A;  2FCQ A;  4LDT D;  2ZNV B;  4CHK A;  4AJW A;  5LLI A;  4GIV A;  4TQ1 A;  1UBI A;  1WMH A;  1E8Y A;  2EMT A;  2FNJ B;  4RM8 A;  1M94 A;  3B1L X;  3PTF C;  1P98 A;  1WY8 A;  3H1U A;  2HE7 A;  4KIK A;  2N4F A;  3V62 A;  1PQS A;  2NPT B;  1J8C A;  3WAO A;  5C1Z A;  3M95 A;  1L7Y A;  2JUO A;  2DZI A;  2MBH A;  2XK5 B;  3QX1 A;  3RD2 A;  3AU5 A;  3Q3F A;  2DZM A;  3DBR I;  5JH5 C;  1V9J A;  3A9K B;  2LGY A;  4NAW B;  4DHJ B;  4FLH A;  4ANV A;  4DDG D;  2L76 A;  3JYU A;  4ZRJ A;  3ZLZ A;  3DBH I;  4GXB A;  1WXV A;  3DDC B;  3QWZ B;  4K7U A;  1NBF C;  3L08 A;  3JW0 X;  4I6P A;  4OVU A;  2J0M A;  3KVF B;  1RRB A;  1GNU A;  3A9J B;  1WF9 A;  1TTN A;  2DYB A;  2M0X A;  2JXX A;  2W9N A;  4G50 A;  3TL5 A;  3VDZ A;  3VFK A;  3ZVV A;  3KUZ A;  1WXM A;  5IA7 A;  1EF5 A;  4GDK A;  2KX3 A;  4B95 A;  2KQ7 A;  3VH3 B;  3ZNH B;  5JZE B;  2J0K A;  1IPG A;  4NPN A;  3ZTC A;  1G6J A;  3GOE A;  2ZVN A;  1EUV B;  3ZRF A;  3NY5 A;  1R4M I;  2LRU A;  4BKS D;  4G11 A;  3PPA A;  2KMA A;  2FCN A;  4ANX A;  2MSE D;  5KHO A;  2A4Z A;  1UEL A;  1NDD A;  5DPT A;  1OGW A;  1A5R A;  4MM3 A;  3A1Q A;  3EC8 A;  3APF A;  4EZJ A;  1F9J A;  3QC8 B;  4JLC A;  1MG8 A;  4EOY A;  1WFY A;  2KDE B;  2KTR A;  2N1V A;  4A3P A;  4B6W A;  3ZW3 A;  2KJH B;  2LD9 A;  2FCM A;  1WGD A;  2ASQ A;  1P1A A;  3AI5 A;  3RUI B;  4M8N A;  1WIA A;  3UQB A;  2C60 A;  2NBU A;  1RLF A;  3NZS A;  4HCP B;  3WIM A;  2WDT B;  2UWQ A;  2KMC A;  1XT9 B;  2ZNV C;  4HPL B;  4BVU C;  3APD A;  2LWP A;  3DOW A;  3PRM B;  3DPD A;  1WXS A;  2V3S A;  2MP2 B;  4NJ7 A;  2G4S A;  2O6V D;  3ML8 A;  4MGI E;  4DXA B;  2MWS B;  1WX8 A;  1Q0W B;  2NS5 A;  4GOC A;  4TKN A;  2ZCC A;  4GB9 A;  4BKS A;  5L95 C;  1E8X A;  1V80 A;  2OOB B;  2DYM A;  2DX5 B;  3RUL A;  4FA6 A;  2K8C A;  2PJH A;  1GG3 A;  1WM2 A;  2MLB A;  2JRI B;  4AP4 C;  5C23 A;  3KUC B;  2L05 A;  4LCD E;  1YD8 U;  1EF1 A;  2PE9 A;  1WGY A;  4EKU A;  1AAR A;  3W1Y A;  5KHQ A;  5JHB A;  1Q5W B;  2EMS A;  3QJZ A;  3K9P B;  1T0Y A;  3AU4 A;  4CYE A;  4MJS B;  2O2V A;  2KWV B;  4W9K A;  2KLC A;  3UIO B;  4MGK E;  5CHV C;  5DCN A;  4EZK A;  5J17 A;  1V81 A;  4IUM B;  4LJP B;  1UGM A;  1RAX A;  2RSU A;  1WZ0 A;  2KFK B;  4TV3 A;  3CST A;  1WH3 A;  2JF5 A;  3JSV B;  4BOZ B;  3QHT A;  3L10 B;  2NBV B;  3N30 A;  3KYC D;  2M17 A;  3T8M A;  2C9W B;  4IW0 A;  4E3C A;  2MBE A;  2GBJ A;  2LUE A;  2IZV B;  3WAM A;  3U8Z A;  4XZ4 A;  4FJY A;  2AYO B;  2J7Q B;  3BIN A;  3VXW A;  1S3S G;  4JIO U;  3A4S C;  4DHJ D;  1V49 A;  2J0J A;  2BWE S;  2G45 B;  2MW5 A;  2IYD B;  2KTF A;  1D3Z A;  4FBJ B;  2D11 A;  4OVV A;  3PT2 B;  2KWC A;  1C1Y B;  1VCB A;  4AOF A;  4KZC A;  2BWF A;  4BBN C;  5DPS A;  2N7E A;  2GBN A;  1WXA A;  2KWU B;  3DBS A;  4MDK E;  3U30 A;  5DPW A;  4WWO A;  5IAA C;  2BPS A;  3GZN I;  2G3Q B;  4MSQ B;  4W9L A;  2XBB C;  4B9K A;  4W9E A;  2KQS A;  2KAN A;  3VTW A;  1OEY J;  4NQL B;  2ZVO A;  3MHS D;  5AZG A;  2AEH A;  4HWI B;  3UGB B;  4KV2 A;  2IO1 B;  2MQJ A;  4A3O A;  1WM3 A;  2K1F A;  1I42 A;  2D07 B;  3PRP B;  3SU8 X;  3CSF A;  1YIW A;  2KLG A;  2JY6 A;  4E71 A;  2L7R A;  4HVB A;  4K81 A;  4KDL B;  3RT3 B;  3V6E B;  3VUW A;  4KIK B;  3H9D A;  2GBM A;  3BY4 B;  3LJ3 A;  4K7W A;  4W9G A;  4ICV A;  3VTU A;  1V5T A;  1Z2M A;  1TGZ B;  2BKR B;  2WX0 A;  3A4R A;  3M63 B;  1ZGU B;  2LGD A;  4NAW A;  5JHA A;  4RMA A;  1SIF A;  2N7D A;  2KKC A;  3M62 B;  2RR9 A;  5J2R A;  1QZE A;  5FR6 A;  4JL9 A;  3OJ3 A;  4IWO A;  2JPH A;  1E5W A;  2MX2 A;  1CMX B;  3LDZ E;  3VAW A;  3PS6 A;  2KNB A;  1WJU A;  1R4N I;  4NY0 A;  2KXJ A;  1VD2 A;  2CS4 A;  4W9F A;  4HJK A;  3HIZ A;  3NHE B;  4DK5 A;  5AEK B;  4KSL C;  4MH0 E;  3N3K B;  5TR5 A;  3EHV A;  2QHO A;  3B08 A;  4BOS C;  1H4R A;  4GDK B;  2BKF A;  4WJQ A;  4GSW A;  2GMI C;  2WX1 A;  3DBL I;  1JRU A;  4MGY E;  2AWT A;  2CR5 A;  2REX A;  3DQV A;  1RFA A;  5CHW A;  3R7R A;  1WX9 A;  3WAP A;  4WJP A;  2KO3 A;  3C0R B;  4PYZ A;  3PV1 A;  2RGF A;  3WAN A;  1WE6 A;  4KVG B;  4W9D A;  4NNJ B;  3WA0 A;  3KUD B;  3DVG Y;  3RZF A;  4KDI C;  3IVF A;  1FXT B;  4NQK E;  1ZW7 A;  2C7N B;  2KTR B;  5AZH A;  4FUL A;  5G2N A;  2KHW B;  2IO3 B;  2DAF A;  4HPM B;  1H8C A;  1KM7 A;  2IO2 B;  2KFJ A;  3V6C B;  3VVW B;  4IM2 A;  2KDI A;  4PYU A;  4ZDV A;  2MRP A;  5AZF A;  1IP9 A;  5GMV A;  1LFD A;  2BYE A;  2Z0E B;  2L00 B;  3R3M A;  2WWZ A;  4URK A;  1Q1O A;  5L83 A;  3IBE A;  1P9D U;  4JGH B;  3X0W A;  4ANW A;  2XEW A;  1OEY A;  3ZNG C;  4W9I A;  4W9J A;  3H7P A;  1KLV A;  3CF6 E;  3DCG A;  1ZKH A;  3ZDM C;  3N32 A;  2N1W A;  3L16 A;  4WWP A;  2K8B A;  4MEL A;  1BT0 A;  2HD5 B;  4I6N B;  4ZYN A;  1C3T A;  4LJO B;  3NOB A;  3SDL C;  2ZPN A;  2Z59 B;  2PPH A;  2LVP A;  4PS8 A;  2JRH A;  3PHW B;  3UF8 A;  2KC1 A;  3EEC A;  4HDO A;  4MSM B;  2G4D B;  4IG7 B;  1WZ3 A;  4IWP A;  1LQB A;  1J19 A;  3AUL A;  4FAD A;  4GMV A;  4FN2 A;  3ZNZ B;  2AL6 A;  2PEA A;  1GJZ A;  4A20 A;  5J18 A;  3R66 C;  5D6J B;  3VHT C;  2LGX A;  2O2V B;  3ZDT A;  1V86 A;  1HE8 A;  2Y5B B;  1WGH A;  3S2A A;  1K8R B;  1E7U A;  3QCA A;  4GU2 A;  2O6V A;  4AJY B;  1WJN A;  2EKE C;  4HK2 A;  4TQ0 A;  4MGZ E;  2K8H A;  3MJW A;  3TBL D;  3QQ8 B;  2N9E B;  2RD0 A;  2YLM A;  1WGG A;  1P0R A;  3A33 B;  3L54 A;  2ZJD A;  4WWN A;  2MCN B;  3ONS A;  2D3G A;  3Q3J A;  2ZPY A;  5LXI B;  1X1M A;  4GDL A;  5E6N A;  2FCS A;  4GGQ A;  1E90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...