1TTNA

Solution structure of the ubiquitin-like domain of human dc-ubp from dendritic cells
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
80
Chain Sequence
b'GYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVIVSQPVQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dendritic cell-derived ubiquitin-like protein
publication title Solution structure of the ubiquitin-like domain of human DC-UbP from dendritic cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ttnA01
2CHWA 4ASWC 3PTFC 3Q3JA 1WM2A 3WAPA 4TQ0A 4RM9A 5EDSA 4IUMB 1EO6A 4RMAA 3KUZA 2LRWA 2JZ3B 2N1WA 2KQSA 4I6PA 4KSLC 4HDQA 4DXAB 1U4AA 2CHXA 4DWFA 2KHWB 1VD2A 2IBIB 4E74A 3H7PA 1WE7A 4DHZE 4GGQA 3TMPB 4W9IA 2C9WB 4W9FA 4NNJB 4ZRKA 3VVWB 1OTRB 4AP4C 2I1JA 5IA7A 2D10A 2AL6A 3QC8B 1V81A 2DZKA 3ZIMA 4CHKA 1YD8U 2KX3A 2V4LA 1V5OA 4IM2A 3HM3A 3DBLI 4B6WA 2NCNA 2O6VD 2JT4B 3N32A 2KZRA 3PLVA 1E8XA 2WYQA 2NPTB 2LGDA 3HM6X 5LXIB 1ZGUB 3VDZA 3DVGX 4E71A 1WGDA 1WZ0A 4W9DA 2A4ZA 4WAAA 4G3XB 4AJYB 2HTHA 2JVCA 3OJ3A 3KW5B 4GSWA 4F8CB 1GC6A 3A33B 2WWZA 3NZUA 3X23A 2DZJA 2IY0B 2C7HA 5D2MB 3U8ZA 4ICVA 4A20A 2IO3B 4X57B 2EMTA 2YVCA 1UD7A 5AZFA 2L00B 3ZNHB 3O65B 4HPLB 3KVFB 3L54A 1GJZA 3MJWA 2DYMA 4NY0A 3S2AA 3U7DA 4WJPA 3ZNGC 5J2RA 2L8JA 4BBNC 1E5WA 4GIVA 1TTNA 2CS4A 3HIZA 3NZSA 3ZLZA 3H1UA 1H4RA 3DDCB 5DPWA 2IY1B 4XX5A 3NHEB 2V3SA 3W1YA 4LDTB 1BT0A 4FHKA 1RLFA 1I35A 4W9GA 3R7QA 3TJPA 3NY5A 4IM0A 2B3AA 4NQLB 1H8CA 2OJRA 2N7EA 4GU2A 2QHOA 1CMXB 4URKA 3VXWA 2BWES 1WI0A 4W9CA 4B95A 2PE9A 4BKSA 3PREA 2CHZA 1WY8A 3TCAA 2K6DB 3QAQA 4HDOA 2NVUI 4ICUA 1IYFA 4BKTA 4KDLB 1GNUA 1KJTA 4TV3A 4WQOB 1IP9A 2LXCA 4EOYA 2BYFA 3H7PB 3A9KA 4G50A 2BF8B 2C60A 2ZNVB 2V1YA 3K9OB 3KUDB 1F9JA 5KHOA 1WJNA 3JYUA 1RFAA 3JSVA 1TGZB 2LRUA 4EZJA 1C1YB 4DDGD 2XK5A 2DAFA 1S3SG 4XZ4A 2MP2A 4TKNA 4DDID 4GMVA 3PLUA 2FCNA 4HCPB 3GZNI 2J0KA 3VH4B 3M95A 1P3QU 1WH3A 3WIMA 3MTNB 3VFKA 2NS5A 2AWTA 3AI5A 2FIDA 2MBBB 4M8MA 2JF5A 2MWSB 1V86A 4GOCA 4F7ZA 4NAWA 1R4NI 3CF6E 4AJWA 1V6EA 3ZVVA 2XEWA 5E6PA 2KK8A 2ZVNA 4EFOA 2HD5B 4A3PA 4LJPB 4E3CA 3A9JA 5JHAA 1XT9B 3UGBB 3L10B 3A1QA 4ZYNA 5HKHA 4FBJB 2C5LC 1OQYA 1UH6A 4XC2A 1RRBA 4FLHA 2M0XA 2RPQA 2FCQA 1Q5WB 1WR6E 1WXSA 3BY4B 3QARA 4BOSC 2DHZA 1SGHA 3PSEB 1OGWA 4WJQA 4BOZB 3OJ4B 4MGKE 4WJOA 2IO0B 2CU1A 1VCBA 2IO1B 2KO3A 3GOEA 4I6LB 4MGZE 1UBQA 3T8MA 3ZNID 3RZWC 5CTRC 2BWFA 3JVZX 4HK2A 4CO7A 4YL8A 3T9LA 2KKCA 2WDTB 4HCNB 2PEAA 1NBFC 2D11A 1WXMA 1ZW7A 2KWCA 5CX3A 1C3TA 2L0TA 3DPDA 5CHVC 2N9EB 2MX2A 2IZVB 4GN1A 1Z2MA 1E8ZA 2XBBC 3H7SA 4EKUA 2NR2A 2W9NA 3DBRI 2KFJA 3SD5A 2J7QB 2KJ6A 4P7IA 2L7RA 1HE8A 3U30A 3WAMA 3X0WA 4DK5A 4FJVB 5BO4B 2PPHA 2DYBA 1T0YA 3W1SC 2JUOA 2J0JA 2LVQA 2KVRA 4A3OA 2R2OA 3KYDD 4BVUC 2LJ5A 3A9KB 4KIKA 4LDTD 4EZKA 4K7WA 1WF9A 2GBJA 2Z59B 4MSMB 4FADA 5C1ZA 1ZKHA 4JQWC 1WJ4A 1S1QB 3Q3FA 2ZJDA 3APDA 2G4DB 5C23A 3LDZE 3JSVB 1XD3B 3HK0A 4AUQC 2KN5A 2XK5B 2MQJA 3ECIA 4IG7B 1WGRA 4ZRIA 2MP2B 2KMAA 2BGFA 4PYZA 2FUHB 2KDEB 3ONSA 2JRHA 3KH0A 3V62A 5AZGA 3ZDMC 4N9F4 2FCSA 3BINA 4MGIE 1OEYJ 2GMIC 1WIAA 3L16A 2MBQA 1K8RB 1P1AA 4NAWB 1L7YA 4JIOU 2OOBB 3M63B 3DCGA 3SDLC 1Y8RC 4IC7B 3OLMD 2DX5B 1LFDA 4ANVA 3ZTCA 3PHWB 3PGEA 4EUTA 3RD2A 4ANXA 3A9JB 2CKHB 3N3KB 3A1QB 2G3QB 3UIPB 2MSED 1SE9A 2KMCA 3RULA 3P2BA 2ZPNA 2GBRA 2K6QA 4IW0A 5JHBA 1UBIA 2O6VB 2ZPYA 4W9EA 2KLCA 2DZIA 2KJRA 3AULA 4DHJD 3A4RA 3DBHI 1WYWB 4CYEA 4NJ7A 3IVFA 1TBEA 1LXDA 1YX6B 1WE6A 2M17A 2NBWB 3B1LX 4GB9A 3ZKJC 5DPTA 1GC7A 1Q1OA 1E8WA 2K8HA 1P0RA 4MH0E 4FN2A 5LXHA 4JLCA 3V6CB 4M8NA 1NI2A 2J0MA 2BKFA 4HXDA 2KD0A 3IFWB 2MA9B 4MDKE 2LGXA 2FNJB 5DCNA 2JXXA 3KUCB 2ZCBA 1WX7A 3V60A 2KWUB 2G45B 2A5UA 2KDFB 3UF8A 1L2NA 3PVLA 1V9JA 4GDLB 4HWIB 3UIOB 1WGHA 1E7VA 1MG8A 1J19A 1IPGA 1E7UA 4BBNF 4NJ6A 2RSUA 1JRUA 2L0FA 2DZMA 1WGYA 2REXA 3CMMB 4PS7A 1J8CA 4DHZB 2JWZA 1GUAB 1I42A 4TQ1A 3PT2B 4NPNA 3VTWA 1EUVB 4MM3A 2BPSA 3IG3A 3QA8A 3PRMB 4WWOA 1E8YA 2RGFA 3ZUNA 1WX8A 2NBVB 4KIKB 2LVOA 3C0RB 2Z0EB 4MJSA 1UELA 1V2YA 3RUIB 4GXBA 1YIWA 4HPMB 2LZ6A 3ALBA 4PS8A 3VUXA 1GG3A 3PS6A 2KDIA 3PZDA 5E6NA 2BYVE 2GBKA 4KV2A 4HVBA 3OAWA 5G55A 2O6VA 2KANA 3QX1A 4HJKA 2KNBA 4WWPA 1WRDB 4K1RB 3V6EB 4ZDVA 3APCA 3PPAA 5KHQA 3ENEA 2FCMA 4IM3A 3WALA 2MBEA 5D7GA 4BKSD 4ANWA 4DBGA 1J0GA 1KLVA 2GBNA 2ZNVC 1FXTB 2UYZB 4FJYA 4IWPA 4MSQB 2LI5A 3NS8A 2NBUA 1SIFA 4W9HA 3SHQA 1AARA 2Z0DB 4GDKA 5DPSA 3D32A 4G0NB 3TL5A 3DVGY 1P98A 3LJ3A 3UQBA 2LASA 2LWPA 5DPRA 4HLEA 5AZHA 4GDLA 4II3B 3VUYA 3VH3B 3VUWA 3QCAA 4W9LA 2KJHB 2DYOA 2K1FA 2KC2A 1WGGA 1G6JA 4LJOB 2ZZPB 4KDIC 3DOWA 4ANUA 2HE7A 1WMHA 2M4NA 3EFUA 3EHVA 3HHMA 3WANA 1WR1A 2C7NB 2JPHA 4BKGA 2DAJA 2EMSA 3DQVA 2M1MA 5CHFA 3ML8A 3ZW3A 1OEYA 3AXCA 1WX9A 3VTVA 3UQAA 1X1MA 4MGYE 2N7DA 3VTUA 4I6NB 5LLIA 2AYOB 2KTFA 2KFKA 2AEHA 2UWQA 1WZ3A 2LD9A 5D94A 1YJ1A 1WXVA 3JW0X 2MLBA 3RCZA 5L95C 3NOBA 3AU4A 3DVNV 4J6IA 3EC8A 1LQBA 2GOWA 3K9PB 2Y5BB 5TR5A 4II2B 2M8SA 3VHTC 4K7UA 3I3TB 3TIXA 1LM8B 2IO2B 4BFRA 5FR6A 1WM3A 2ASQA 3ZRCA 3ZTDA 1V80A 2CR5A 2KTRA 3A4SC 3PRZA 2D3GA 4AOFA 4B9KA 2MBOA 4K81A 4M0WB 3WAOA 4PYUA 2O2VA 5D6JB 3V61A 4OVUA 2EKEC 3QQ8B 3W1SA 4RM8A 3TBLD 1A5RA 3ZNZB 2LUEA 1WJUA 2BYEA 4MJSB 3PV1A 3L08A 2LGYA 5IAAC 3MHSD 3VAWA 3PHXB 4PS3A 2KC1A 2N9XA 4FHJA 1P9DU 4WWNA 3QHTA 3WA0A 2C7MB 2KWVB 1WFYA 2ZEQA 3B08A 2KXJA 1UZXB 2YLMA 2I1KA 3B0AA 1PQSA 3DVNU 3ZO5B 2BKRB 4AWJA 1UGMA 4FA6A 3AU5A 2N1VA 4KVGB 4FULA 3KYCD 3ZRFA 5G2NA 2K39A 2RR9A 4EZLA 1D3ZA 3APFA 3VQIA 5J17A 1Z5SB 4GDKB 2AL3A 2JRIB 4KSKC 1Q0WB 4JGHB 3DBSA 1EF5A 3UINB 4IWOA 3R3MA 5JZEB 3L17A 3QIJA 2KQ7A 1NDDA 4K7SA 2WX0A 2D07B 3RYTA 4OVVA 4KZCA 4FJZA 1R4MI 3ZDTA 2FAZA 3L0WB 4EEWA 2KLGA 2NPTA 2L76A 5CHWA 5L83A 2LVPA 4IWQA 1KM7A 3EECA 2ZCCA 2JZZA 1V5TA 3IBEA 3ML9A 5GMVA 2JY6A 3CSTA 4W9KA 3PRPB 5AEKB 1WMHB 3H6NA 4W9JA 2RD0A 1TZ1A 3RT3B 1QZEA 1XQQA 2KDBA 3M62B 2IYDB 1WJ6A 4JL9A 4WJNA 3M3JA 2KX0A 2ZVOA 1WXAA 3SU8X 2GBMA 2L05A 3QJZA 1YX5B 4MELA 2MCNB 2KFKB 2PE6B 4LCDE 3CSFA 4G11A 4DHJB 4KZ0A 5J18A 2PJHA 1YQBA 2K25A 2MRPA 4ZRJA 3R7RA 2WX1A 2KOXA 2MBHA 3QWZB 5JH5C 5E6OA 1EF1A 4MEMA 2VRRB 2G4SA 3L13A 2MW5A 3N30A 4NQKE 3R66C 2R2QA 2DENB 2KTRB 3RZFA 1ISNA 1E90A 2D2QA 2K8CA 1RAXA 2K8BA 4TUUA 1KOTA 2LXAA 2O2VB 2N4FA 1V49A 3H9DA 2L3ZA 2HJ8A 2FIFA 3IHPC 4F1SA 2N9PC 1M94A 3QK0A
chains in the Genus database with same CATH superfamily
2M56B 3AEFB 1WM2A 1V1OA 1QKZA 5C3JB 3AEBB 3B2FA 2AX5A 2IBIB 2IJ0A 1KLGD 3TMPB 3FC4A 4NNJB 3HRDD 2WXHA 2I1JA 2AL6A 2DZKA 1AN8A 3HM3A 3DBLI 4B6WA 4R3DA 1R4MB 1IUEA 1HTQA 3HM6X 5LXIB 2WXLA 3VDZA 4E71A 1WZ0A 2HDEA 4G3XB 2BT6A 1GC6A 4NJCA 3A33B 1Y56A 2WXJA 4K3BA 3NZUA 2IY0B 4JWUC 2IO3B 2MH7A 3KWLA 3O65B 3KVFB 1K52A 2J52A 4WJPA 1KTKA 5J2RA 1D5XC 4BBNC 1YQ4B 1E5WA 1TKEA 2PMVA 1FO4A 1H4RA 5DPWA 4XX5A 3IAM1 4W9GA 3R7QA 2INNE 1TIFA 1ZE3D 1KRHA 1KLUD 1D6EC 2DLBA 4XDDA 4BKSA 1T3QA 3PREA 3TCAA 3VR8B 2K6DB 4XYCA 1ZPSA 2NVUI 1HXYD 4WQOB 1IP9A 3A9KA 2PLPA 5KHOA 1WJNA 1QOFA 3JYUA 2D3CA 2LRUA 1ZOYB 1S3SG 4DDID 4QAYA 1E9MA 1WH3A 3MTNB 2NS5A 1JRPA 2AWTA 4ITKA 3R2TA 2FIDA 3RMKC 4F7ZA 4GOCA 2PKOA 3NS1A 5BYRA 1QOAA 2HD5B 4A3PA 5JHAA 1XT9B 3DHIC 1HTOA 5G5GA 1RFKA 2N9KA 5HKHA 3UI3A 1OQYA 4RGNA 1WR6E 1WXSA 2KYWA 3C19A 4WJQA 1JQ4A 1OGWA 1UNSA 4WJOA 5G5HA 2VH1A 3RZWC 4HK2A 4AS1A 2WDTB 1I4XA 4PT5A 1C3TA 4KX6B 5CHVC 1SF0A 2MX2A 3N9YC 3DBRI 3P4RB 2ACZB 2KFJA 3AE3B 4RNAA 2J7QB 2KJ6A 4P7IA 3MHZA 3WAMA 4RGOS 3X0WA 3IT6B 4KGSA 1DOIA 1ZDXA 3W1SC 2M0AA 2WXRA 4WWMA 5HG2A 3TSSA 1WJ4A 1S1QB 3Q3FA 3SFEB 4CQNA 3LDZE 3HK0A 2KN5A 4LLGM 1C77A 5BYQA 1I4HA 4M00A 3ZNHB 2MP2B 2KMAA 2N9LA 1TKYA 2GMIC 1BUIC 1HA5A 3LYYA 2MBQA 4NAWB 1L7YA 2OOBB 3M63B 1Y8RC 3ZTCA 3OG5A 2CKHB 1KF6B 2KDMA 2O6VB 4W9EA 2DZIA 4DHJD 3GB1A 3Q8FA 3DBHI 4CYEA 3IVFA 1TBEA 3B1LX 4GB9A 3ZKJC 4FN2A 5LXHA 4M8NA 2VZKB 4HXDA 4MDKE 2ONQA 1Q10A 4RFBA 1WX7A 2KDFB 3UF8A 5AUIA 1L4DB 1WGHA 1PGXA 1PGAA 2RSUA 1JRUA 1F1HA 1UWMA 2REXA 1J8CA 4DHZB 1BXTA 4A9AA 3QA8A 3PRMB 3URYA 4ZRQA 1R7SA 4KIKB 3EUB2 2Z0EB 4GXBA 4EE2A 2BYVE 2GBKA 4KV2A 4RGMA 5G55A 2O6VA 2WU2B 1TS5A 4K1RB 2WS3B 3ENEA 4IM3A 2MJDA 1KLVA 3BYYB 1UUPA 4FJYA 4MSQB 3U7ZA 2NBUA 2WXKA 2MJ3A 5DPSA 4OZBA 3DVGY 3RPFC 3LB8C 3LJ3A 3AB5A 2LASA 4HLEA 4IOIE 3QCAA 4W9LA 2KJHB 5IKCM 2KC2A 4IDIA 1G6JA 4LJOB 2NMQA 2WP9B 4KDIC 2D3AA 1K51A 3HHMA 1MVKA 4LNKA 2C7NB 2OJWA 3DQVA 1QF6A 3ZXRA 1UGJA 4LTUA 3IXSA 4LNOA 1MPEA 3VTUA 1STEA 2KTFA 2KFKA 2AEHA 3JW0X 3Q3MC 3DVNV 1LQBA 2Y5BB 3U52E 2K3UA 3U2SC 2M8SA 4K7UA 3I3TB 4BFRA 5FR6A 1WM3A 2ASQA 3HVZA 2MBOA 3WAOA 4AQ7A 2JX5A 2VZKD 2EKEC 3W1SA 2WDQB 4BAXA 3L08A 5IAAC 2KC1A 4FHJA 2YLMA 1PQSA 3ZO5B 4B0MA 2BKRB 2J53A 4AWJA 5H8YE 2N1VA 1P7FA 3KYCD 2BB6A 2RR9A 1D3ZA 3APFA 1GOZA 2JRIB 3RFZB 4A90A 1Q0WB 3DBSA 3BVMA 1OQRA 1EF5A 3OWEB 4MT5A 3R3MA 2D07B 4OVVA 1JW9D 4KZCA 4YSXB 2FAZA 4XE0A 2NPTA 5L83A 5CHWA 4YSZB 1SJHD 3IBEA 3ML9A 2ICIA 2RDGA 4W9JA 3H6NA 2WU5B 3RT3B 1QZEA 1T6BX 1WJ6A 1ROEA 2ZVOA 3SU8X 2L05A 1TJEA 1FM0D 2M19A 1ENFA 4L23A 2MRPA 3GS2A 2VH2A 4MEMA 1V1PB 3TEYA 3CWIA 3L13A 4C7ZA 1VZ7A 1ISNA 4TUUA 2GB1A 2K8BA 2N4FA 1V49A 1A70A 3Q8AA 3IHPC 4KKJA 2N9PC 3QK0A 5C2TB 4ASWC 3BK2A 1I4PA 4HKQA 5IOIA 3ZXVA 2JZ3B 2N1WA 2G1EA 4DXAB 1U4AA 2CU3A 1FFVA 2CHXA 5IO9A 4DWFA 1VD2A 1YJIA 3LXFA 4GGQA 3VVWB 2AQ3B 1JALA 4AP4C 3FKYA 1QLBB 4YT0B 2V4LA 4GLSC 3FILB 3N32A 4XDCA 1BMLC 3PLVA 2LJIA 1D4BA 1QILA 3DVGX 2A4ZA 4WAAA 2JVCA 1MFWA 1XEEA 3X23A 5D2MB 3NVZA 3W5VB 1VLBA 4LNFA 2DBYA 1JWBD 2EMTA 3AN1A 1UD7A 2K22A 2L00B 4S0RA 4C4VA 4HPLB 1FD6A 4NY0A 3U7DA 2L8JA 4C00A 3HIZA 3NHEB 3RNFC 1YQ3B 4LDTB 1BT0A 1RLFA 1F0ZA 2MEKA 4NQLB 2OJRA 3HUIA 1M4VA 1PYWD 1AWDA 2QHOA 1CMXB 1L6VA 2ZW0A 3VXWA 3ABVB 5AUKA 2L1AA 3CIRB 2PE9A 3PZ7A 1ZP0B 1WY8A 5BMIA 5TSSA 1YN4A 4BKTA 1GNUA 1KJTA 2LXCA 1RWSA 2Y5CA 2KVZA 1L0YB 2V1YA 3EFCA 2BW2A 2K9XA 1C1YB 4DDGD 2XK5A 2DAFA 3WCQA 4GMVA 4HCPB 3WIMA 4M02A 5EE1A 3AI5A 2BVCA 2MBBB 5FKAC 1V86A 1LGRA 2V3PA 3NZ3A 1VZ8A 4MH8A 3L10B 2W55A 4FBJB 2C5LC 1FNVA 4FLHA 2RPQA 3QARA 1FFUA 1SGHA 3PSEB 3AEDB 3OJ4B 4RF1A 1SXTA 4N58A 1VCBA 5HFYA 3I9V1 3ZNID 4CO7A 4YL8A 3T9LA 2D11A 2IZVB 2JYTA 4GN1A 1Z2MA 1EWCA 5GXGB 2D5GA 1HQRD 1TY2A 3P4PB 5H92C 3TEWA 4DK5A 4FJVB 2PPHA 2DYBA 1T0YA 2JUOA 2J0JA 4UDUC 2KVRA 3A9KB 4LDTD 1GB1A 1WF9A 2GBJA 2H88B 3W9CB 2KAJA 4JQWC 1C78A 5C23A 2IGGA 1L4ZB 3MJ5A 2BGFA 2FUHB 3ONSA 2JRHA 4US8A 1OEYJ 4OZAA 4WQMA 4C56C 2FBWB 4HEA1 3RNCC 4KGRA 4JIOU 1QOBA 4IC7B 2N0SB 4H2AA 3N3KB 3UIPB 1JROA 2KMCA 2LUMA 3P2BA 2K6QA 2H89B 2ZPYA 1WYWB 1YX6B 1WE6A 1FXAA 5DPTA 1Q1OA 1P0RA 1MHXA 4MH0E 3DHGC 2LMCA 2MJEA 2J0MA 2BKFA 1HEZE 2KD0A 3IFWB 2LGXA 2ZCBA 2G45B 3ZJVA 2V3NA 4HWIB 2R61A 2QC8A 2YEPB 1J19A 2AQ2B 4NJ6A 1RYJA 4PS7A 4OZCA 2LHEA 2JWZA 1I42A 3PT2B 4NPNA 1ZDVA 1EUVB 4MM3A 2BPSA 1PGBA 1E8YA 4P1CC 2FUG1 3C0RB 1LO5D 4MJSA 1YIWA 2N7JA 1MI0A 2LZ6A 4HPMB 3PS6A 2KDIA 4HVBA 1DGJA 4HJKA 2LGIA 3PPAA 1C79A 5EE3A 4BKSD 3Q8EA 2V9HA 2ZNVC 2QEJC 4IWPA 2LI5A 1ZUD2 4RGTA 4W9HA 2JU6X 4G0NB 1P98A 3UQBA 1YNTE 5AZHA 1GAQB 1YN3A 3C8YA 2DYOA 3N1ZC 3AE5B 1WGGA 1SE2A 3BIID 1V8CA 1T5XD 2KT7A 4ANUA 1E6EB 3EFUA 3EHVA 2X8XX 2JXTA 2DAJA 2EMSA 3AXCA 1WX9A 2N7DA 1TT5B 2KMMA 1TY0A 2UWQA 4TMAB 1YJ1A 3RCZA 5L95C 3NOBA 5TR5A 2BQQA 3TIXA 2JWUA 3ZRCA 2KTRA 3PRZA 1L0VB 4K81A 2K0PA 3H8HA 2O2VA 2BS3B 4OVUA 1R4NB 5FK9C 3QQ8B 4RM8A 3TBLD 2LUEA 1MJDA 2BYEA 4D2KA 3AE6B 3MHSD 2LFIA 3VRAB 1QT9A 4WWNA 3QHTA 2KWVB 3B08A 5I4DA 2KXJA 3P4SB 2EELA 4FA6A 5G2NA 3B9JA 5J17A 2AL3A 4KSKC 3SFDB 4JGHB 3BVGA 3L17A 2KQ7A 1NDDA 4K7SA 2WX0A 4N59A 3RYTA 2GLSA 4KKIA 1WRIA 4EEWA 2KLGA 2L76A 2QSDA 3RNBC 1KM7A 3EECA 2JZZA 5GMVA 1NVID 3BWUD 2JY6A 3PRPB 4N6EB 3M3JA 2KX0A 1WXAA 1YX5B 4MELA 2OEDA 2MCNB 2KFKB 2PE6B 1EWYC 4LCDE 3CSFA 4HKZE 2BYTA 4KZ0A 4BZAA 2K25A 2ZW1A 2KOXA 3SR6A 3N30A 2R2QA 2WXOA 2DENB 4J3OD 2K8CA 1RAXA 1KOTA 1C4CA 2IPKD 5EE9A 2FIFA 4L2YA 4F1SA 1E10A 2WDVB 1M94A 5BYSA 1E0ZA 2V0GA 3DWGC 3WAPA 1EO6A 4RMAA 2LRWA 2KQSA 4I6PA 1E7PB 4KSLC 4HDQA 4RF0A 1IGCA 1C4AA 1HZ5A 1JWMD 4E74A 3H7PA 1J7AA 1ACCA 2C9WB 4W9IA 2RPVA 1XLPA 4ZRKA 4XWWA 4ZHPA 2DWQA 3ZIMA 1V5OA 4IM2A 1D5ZC 2O6VD 2JT4B 2KZRA 2NPTB 2LGDA 3R2IA 1ZGUB 4W9DA 1FPYA 1YMHE 2JZPA 5T8IA 3VRBB 2WWZA 3NUHB 2QDFA 2DZJA 1KFYB 2JYEA 4A20A 4X57B 2YVCA 5AZFA 1N5WA 3L54A 1GJZA 3MJWA 1MHHE 4O1NA 4Q2JA 4HRSA 4GIVA 4C7YA 2CS4A 3H1UA 3DDCB 2IY1B 3W1YA 1F77A 4FHKA 4RCOA 2L83A 3DWMA 1I35A 2IDYA 3BZDB 1NENB 3TJPA 1SJED 4JWSC 1PDXA 3AMZA 2L52A 4IM0A 2B3AA 4DXGA 2N7EA 4GU2A 1CJEA 1WI0A 2BWES 4B95A 5IN7A 2CHZA 3QAQA 1IYFA 1SE3A 4KDLB 2JQRB 4TV3A 4EOYA 2BYFA 1ET9A 4ACFA 5HHDG 3AH7A 5IP4D 1F2RC 3I63C 2WXGA 1YOVB 2KN4A 1RFAA 3JSVA 1TGZB 4EZJA 4OVZA 1NYQA 4JX1C 3AE4B 4TKNA 3GZNI 2J0KA 3VH4B 2RMMA 3M95A 3RNEC 2INDC 1EM7A 3CF6E 4AJWA 3I57A 3ZVVA 2ZVNA 4IKGA 4LJPB 3A9JA 3UGBB 1NEKB 3A1QA 1TS2A 3HVDA 1TS3A 4ZYNA 4XC2A 1MG4A 1RRBA 3PZ8A 2FCQA 4BOSC 3BY4B 2DHZA 4C4VB 4MGKE 3E9SA 2CU1A 2IGHA 2IO1B 3GOEA 4ZHOA 4MGZE 1UBQA 4A55A 3T8MA 5CTRC 3JVZX 1DYQA 2KKCA 1VZ6A 5CX3A 1ZW7A 2K5PA 2L0TA 1L5PA 2N9EB 3ZJTA 2XBBC 4EKUA 3H7SA 2NR2A 4WURA 1JWAD 2L7RA 2I2YA 3DHHC 4A3OA 2R2OA 3KYDD 4EZKA 2YEPF 4K7WA 3AM9A 2Z59B 4MSMB 4FADA 5C1ZA 2ZJDA 2EKIA 2G4DB 3APDA 4AUQC 1XD3B 3RN9C 2XK5B 3ECIA 1WGRA 4PYZA 3NVVA 3V62A 4WIPA 3BINA 4MGIE 5D3IB 3L16A 1P1AA 3KWVA 4REZA 2WLBA 3SDLC 3OLMD 3TEZA 3PHWB 1TS4A 4EUTA 4ANXA 1N60A 1SE9A 3RULA 2ZPNA 2GBRA 4IW0A 5JHBA 2KJRA 3Q14C 3A4RA 4NJ7A 1LXDA 2M17A 1E8WA 1VJKA 3AEEB 1TZOA 4PK1A 4JLCA 3V6CB 1IGDA 5E6JA 1JMLA 2BTEA 2MA9B 3EA6A 2FNJB 2JXXA 3KUCB 3V60A 4M01A 5HI1A 2A5UA 3EGRA 2L32A 3ZYYX 4C80A 2W54A 4GDLB 1E7VA 1MG8A 1FRDA 4BBNF 1XXGA 1WGYA 2DZMA 3DBLB 4TQ1A 3VTWA 1FCCC 3ZQ4A 2RGFA 1WX8A 2NBVB 4ZYSA 2LVOA 1UELA 1VRAB 1V2YA 1F2RI 3ALBA 4S17A 2KACA 1GG3A 3VUXA 3PZDA 5E6NA 4ARIA 3OAWA 3QX1A 3V6EB 2KNBA 3AEGB 2WXIA 1ESFA 3APCA 2KQ4X 5KHQA 4ARCA 2PTLA 3WALA 1NI3A 2MBEA 5D7GA 4ANWA 2GBNA 1FXTB 3W5UB 3FAHA 2UYZB 1EU3A 1SIFA 2D3BA 2IGDA 3BVZA 1AARA 1SEBD 3SHQA 3AV8A 4GDKA 5DPRA 1WYGA 2BS2B 1J7CA 3RNAC 2J42A 4GDLA 4II3B 3VUYA 3Q69A 2K1FA 3Q2AC 1AYFA 1FNUA 3Q8CA 1XF5L 3DOWA 1I4GA 4YXDB 4WH4A 2HE7A 1WMHA 1WR1A 2JPHA 4BKGA 3PO0A 3ML8A 1XLQA 3AECB 1IBXA 3BK1A 3KQ4A 2LD9A 5D94A 2MLBA 2B76B 2PVOD 3AU4A 4II2B 3VHTC 2IO2B 4K3CA 3TEXA 1V80A 2CR5A 3A4SC 3IT4B 4MM3B 5D6JB 2Y3AA 3V61A 1A5RA 1WJUA 4MJSB 1QOGA 1N62A 2LGYA 3VAWA 4PS3A 3ZJUA 4NAMA 1P9DU 3NG0A 1UZXB 1SBBB 2I1KA 2WGSA 4LK0M 1UGMA 3AU5A 4YTNB 4KVGB 4FULA 3ZRFA 2E6XA 4OHJA 3GE8C 3VQIA 2ON8A 2DNFA 1ZXHA 3SEBA 3Q6BA 1L6UA 5JZEB 3QIJA 3O13A 1TYGB 2W82A 4JE3B 2CJOA 1R4MI 4FJZA 3L0WB 3DBRB 2LVPA 3RNGC 2ZCCA 1N63A 1V5TA 2G9HD 3CSTA 3N1YC 3MC0B 2J4XA 1TZ1A 2WQYB 1N5XA 4JL9A 2IYDB 4WJNA 1GPXA 4XWTA 3QJZA 2WXNA 1OFFA 4G11A 4DHJB 3BYTB 3KLSX 3R7RA 4P1BC 2WX1A 5JH5C 2MBHA 3QWZB 5E6OA 2G4SA 2MW5A 1ZXIA 2BBCA 3R66C 2KTRB 3RZFA 1E90A 2D2QA 4YTPB 2LXAA 2O2VB 1JCKB 2PVGC 3H9DA 2L3ZA 2HJ8A 5JXVA 2CHWA 3PTFC 3Q3JA 4TQ0A 4RM9A 5EDSA 4IUMB 3KUZA 1T0SC 4TSSA 5MPOA 1B1ZA 3DBHB 2KHWB 3T3NA 1WE7A 2BS4B 4DHZE 1DOYA 1D5MC 1ET6A 4W9FA 1OTRB 1CK1A 3P1MA 5IA7A 1NYRA 2D10A 3QC8B 1V81A 4CHKA 1YD8U 2KX3A 4HPPA 4P6VF 2NCNA 1PUTA 1E8XA 2WYQA 3TUOA 1TKGA 1WGDA 1RM6C 4USAA 1C76A 2HTHA 3OJ3A 3KW5B 4GSWA 3V05A 4F8CB 2C7HA 3U8ZA 4B0EA 3AE2B 3W2DA 4ICVA 4HJGE 4A8XC 2DYMA 3S2AA 3MC8A 3ZNGC 1L0XB 1TTNA 3NZSA 3ZLZA 3ZGZA 4US9A 2V3SA 1XLNA 4WAFA 2QIEB 2HJ1A 3NY5A 1H8CA 4OW0A 4URKA 4W9CA 1T0RC 4HDOA 3RI7C 4ICUA 3U4EG 2WXPA 3H7PB 4G50A 2BF8B 2WNMA 2C60A 1FXIA 2JSVX 2ZNVB 3K9OB 3KUDB 2INCC 1FMAD 1F9JA 1WSPA 1VR9A 4XZ4A 2MP2A 3PLUA 2FCNA 3J9CA 1P3QU 2W3SA 3VFKA 1XLOA 2CJNA 4M8MA 2JF5A 2MWSB 2QCZA 4NAWA 1CQVA 1R4NI 4ZOHC 1FNWA 2MHJA 1V6EA 2XEWA 5E6PA 2KK8A 4EFOA 4E3CA 2KWDA 1UH6A 2M0XA 1Q5WB 1AW7A 4BOZB 3NVYA 5FR3A 2LEKA 2IO0B 1UF0A 2AQ1B 4NZLB 2KO3A 2LHDA 4I6LB 3NRZA 1KH0A 2BWFA 2GRIA 1UWXA 2TSSA 4HCNB 2PEAA 1NBFC 1WXMA 2KWCA 3DPDA 5EE0A 4DQOC 3NVWA 1E8ZA 2W9NA 1T0QC 1WXQA 2UU7A 3SD5A 1HE8A 3U30A 1V97A 3AE7B 3AE8B 5BO4B 2RDHA 2LVQA 2W3RA 4LNIA 4BVUC 2LJ5A 4KIKA 2BB5A 1ZKHA 3V3XA 1DOXA 3R8BA 3JSVB 2QMTA 2MQJA 4IG7B 4AJYB 4ZRIA 4L1BA 2KDEB 3KH0A 2V4IB 5AZGA 3ZDMC 4N9F4 2FCSA 2PW9A 5D3DA 1HZ6A 3GZNB 1FRRA 1WIAA 2SEBD 4FXCA 3MP9A 1K8RB 5BMHA 3I5JC 3DCGA 1WGKA 5LNK1 2DX5B 1LFDA 4ANVA 3PGEA 3RD2A 3A9JB 3A1QB 2G3QB 1PFDA 2MSED 1SB3C 1GB4A 1UBIA 1YJJA 2KLCA 3AULA 2PIAA 1K50A 1XCQL 1XCTL 1J7BA 2NBWB 3VR9B 1GC7A 2K8HA 2INPE 4P16A 1NI2A 3P4QB 1FCLA 4DXFA 1N6ZA 3MC9A 5DCNA 1JWSD 3P63A 2WDRB 2KWUB 1L2NA 3N1XC 1QQRA 3PVLA 1V9JA 3ETRA 3UIOB 1E7UA 1IPGA 3B2GA 2L0FA 3CMMB 1GUAB 4A6QA 2XN9C 3IG3A 4WWOA 3ZUNA 3Q3NC 3RUIB 2I38A 2WXFA 2NTTA 4PS8A 2WXQA 2HTME 2KANA 1N61A 4WWPA 1WRDB 1I7HA 2RDBC 4ZDVA 3L4PA 1EU4A 2FCMA 4DBGA 1J0GA 2QJLA 4YSYB 2X38A 3NS8A 2Z0DB 3D32A 3TL5A 1I4QA 2LWPA 4MACA 3P42A 3VUWA 4JPSA 3VH3B 3AE1B 1K53A 2GI9A 1XO3A 2Q5WD 2SAKA 2ZZPB 3AEAB 1VDVA 2M4NA 3WANA 1OQQA 2M1MA 5CHFA 3ZW3A 4HROA 1OEYA 4YWGG 3UQAA 1X1MA 4MGYE 4I6NB 5LLIA 2AYOB 1WZ3A 3N20C 5BMGA 1WXVA 4RH6A 4J6IA 3EC8A 2GOWA 3K9PB 2WXMA 1JWUD 1V1PA 1LM8B 2OHFA 4LNNA 3ZTDA 4B9KA 4AOFA 2D3GA 4M0WB 4PYUA 1C4PA 3ZNZB 3PV1A 3AE9B 3IAS1 3PHXB 2N9XA 4YTMB 3WA0A 2C7MB 1WFYA 1WWTA 2ZEQA 3NJTA 3B0AA 3DVNU 1CZPA 1B9RA 1SSNA 2K39A 3Q3OC 4EZLA 1Z5SB 4GDKB 2WHIA 3UINB 4IWOA 1C9FA 3E56A 3FILA 2LGSA 4XGAB 2QILA 3ZDTA 3Q8BA 4IWQA 2NTSA 2E3TA 2Z8LA 4W9KA 4M0WA 5AEKB 1WMHB 1FEHA 1SIJA 2FE8A 1F52A 2RD0A 1XQQA 2KDBA 3M62B 3MFGA 1IBXB 2GBMA 1P7EA 1FIQA 1YN5A 4ZRPA 1SE4A 3T3OA 5J18A 2PJHA 1YQBA 4KGTA 4ZRJA 2XNAC 1EF1A 2VRRB 1I4RA 3GP7A 4NQKE 2Y5PA 3GE3C 3VTVA
chains in the Genus database with same CATH topology
2CHWA 4ASWC 3PTFC 3Q3JA 1WM2A 3WAPA 4TQ0A 4RM9A 5EDSA 4IUMB 1EO6A 4RMAA 3KUZA 2LRWA 2JZ3B 2N1WA 2KQSA 4I6PA 4KSLC 4HDQA 4DXAB 1U4AA 2CHXA 4DWFA 2KHWB 1VD2A 2IBIB 4E74A 3H7PA 1WE7A 4DHZE 4GGQA 3TMPB 4W9IA 2C9WB 4W9FA 4NNJB 4ZRKA 3VVWB 1OTRB 4AP4C 2I1JA 5IA7A 2D10A 2AL6A 3QC8B 1V81A 2DZKA 3ZIMA 4CHKA 1YD8U 2KX3A 2V4LA 1V5OA 4IM2A 3HM3A 3DBLI 4B6WA 2NCNA 2O6VD 2JT4B 3N32A 2KZRA 3PLVA 1E8XA 2WYQA 2NPTB 2LGDA 3HM6X 5LXIB 1ZGUB 3VDZA 3DVGX 4E71A 1WGDA 1WZ0A 4W9DA 2A4ZA 4WAAA 4G3XB 4AJYB 2HTHA 2JVCA 3OJ3A 3KW5B 4GSWA 4F8CB 1GC6A 3A33B 2WWZA 3NZUA 3X23A 2DZJA 2IY0B 2C7HA 5D2MB 3U8ZA 4ICVA 4A20A 2IO3B 4X57B 2EMTA 2YVCA 1UD7A 5AZFA 2L00B 3ZNHB 3O65B 4HPLB 3KVFB 3L54A 1GJZA 3MJWA 2DYMA 4NY0A 3S2AA 3U7DA 4WJPA 3ZNGC 5J2RA 2L8JA 4BBNC 1E5WA 4GIVA 1TTNA 2CS4A 3HIZA 3NZSA 3ZLZA 3H1UA 1H4RA 3DDCB 5DPWA 2IY1B 4XX5A 3NHEB 2V3SA 3W1YA 4LDTB 1BT0A 4FHKA 1RLFA 1I35A 4W9GA 3R7QA 3TJPA 3NY5A 4IM0A 2B3AA 4NQLB 1H8CA 2OJRA 2N7EA 4GU2A 2QHOA 1CMXB 4URKA 3VXWA 2BWES 1WI0A 4W9CA 4B95A 2PE9A 4BKSA 3PREA 2CHZA 1WY8A 3TCAA 2K6DB 3QAQA 4HDOA 2NVUI 4ICUA 1IYFA 4BKTA 4KDLB 1GNUA 1KJTA 4TV3A 4WQOB 1IP9A 2LXCA 4EOYA 2BYFA 3H7PB 3A9KA 4G50A 2BF8B 2C60A 2ZNVB 2V1YA 3K9OB 3KUDB 1F9JA 5KHOA 1WJNA 3JYUA 1RFAA 3JSVA 1TGZB 2LRUA 4EZJA 1C1YB 4DDGD 2XK5A 2DAFA 1S3SG 4XZ4A 2MP2A 4TKNA 4DDID 4GMVA 3PLUA 2FCNA 4HCPB 3GZNI 2J0KA 3VH4B 3M95A 1P3QU 1WH3A 3WIMA 3MTNB 3VFKA 2NS5A 2AWTA 3AI5A 2FIDA 2MBBB 4M8MA 2JF5A 2MWSB 1V86A 4GOCA 4F7ZA 4NAWA 1R4NI 3CF6E 4AJWA 1V6EA 3ZVVA 2XEWA 5E6PA 2KK8A 2ZVNA 4EFOA 2HD5B 4A3PA 4LJPB 4E3CA 3A9JA 5JHAA 1XT9B 3UGBB 3L10B 3A1QA 4ZYNA 5HKHA 4FBJB 2C5LC 1OQYA 1UH6A 4XC2A 1RRBA 4FLHA 2M0XA 2RPQA 2FCQA 1Q5WB 1WR6E 1WXSA 3BY4B 3QARA 4BOSC 2DHZA 1SGHA 3PSEB 1OGWA 4WJQA 4BOZB 3OJ4B 4MGKE 4WJOA 2IO0B 2CU1A 1VCBA 2IO1B 2KO3A 3GOEA 4I6LB 4MGZE 1UBQA 3T8MA 3ZNID 3RZWC 5CTRC 2BWFA 3JVZX 4HK2A 4CO7A 4YL8A 3T9LA 2KKCA 2WDTB 4HCNB 2PEAA 1NBFC 2D11A 1WXMA 1ZW7A 2KWCA 5CX3A 1C3TA 2L0TA 3DPDA 5CHVC 2N9EB 2MX2A 2IZVB 4GN1A 1Z2MA 1E8ZA 2XBBC 3H7SA 4EKUA 2NR2A 2W9NA 3DBRI 2KFJA 3SD5A 2J7QB 2KJ6A 4P7IA 2L7RA 1HE8A 3U30A 3WAMA 3X0WA 4DK5A 4FJVB 5BO4B 2PPHA 2DYBA 1T0YA 3W1SC 2JUOA 2J0JA 2LVQA 2KVRA 4A3OA 2R2OA 3KYDD 4BVUC 2LJ5A 3A9KB 4KIKA 4LDTD 4EZKA 4K7WA 1WF9A 2GBJA 2Z59B 4MSMB 4FADA 5C1ZA 1ZKHA 4JQWC 1WJ4A 1S1QB 3Q3FA 2ZJDA 3APDA 2G4DB 5C23A 3LDZE 3JSVB 1XD3B 3HK0A 4AUQC 2KN5A 2XK5B 2MQJA 3ECIA 4IG7B 1WGRA 4ZRIA 2MP2B 2KMAA 2BGFA 4PYZA 2FUHB 2KDEB 3ONSA 2JRHA 3KH0A 3V62A 5AZGA 3ZDMC 4N9F4 2FCSA 3BINA 4MGIE 1OEYJ 2GMIC 1WIAA 3L16A 2MBQA 1K8RB 1P1AA 4NAWB 1L7YA 4JIOU 2OOBB 3M63B 3DCGA 3SDLC 1Y8RC 4IC7B 3OLMD 2DX5B 1LFDA 4ANVA 3ZTCA 3PHWB 3PGEA 4EUTA 3RD2A 4ANXA 3A9JB 2CKHB 3N3KB 3A1QB 2G3QB 3UIPB 2MSED 1SE9A 2KMCA 3RULA 3P2BA 2ZPNA 2GBRA 2K6QA 4IW0A 5JHBA 1UBIA 2O6VB 2ZPYA 4W9EA 2KLCA 2DZIA 2KJRA 3AULA 4DHJD 3A4RA 3DBHI 1WYWB 4CYEA 4NJ7A 3IVFA 1TBEA 1LXDA 1YX6B 1WE6A 2M17A 2NBWB 3B1LX 4GB9A 3ZKJC 5DPTA 1GC7A 1Q1OA 1E8WA 2K8HA 1P0RA 4MH0E 4FN2A 5LXHA 4JLCA 3V6CB 4M8NA 1NI2A 2J0MA 2BKFA 4HXDA 2KD0A 3IFWB 2MA9B 4MDKE 2LGXA 2FNJB 5DCNA 2JXXA 3KUCB 2ZCBA 1WX7A 3V60A 2KWUB 2G45B 2A5UA 2KDFB 3UF8A 1L2NA 3PVLA 1V9JA 4GDLB 4HWIB 3UIOB 1WGHA 1E7VA 1MG8A 1J19A 1IPGA 1E7UA 4BBNF 4NJ6A 2RSUA 1JRUA 2L0FA 2DZMA 1WGYA 2REXA 3CMMB 4PS7A 1J8CA 4DHZB 2JWZA 1GUAB 1I42A 4TQ1A 3PT2B 4NPNA 3VTWA 1EUVB 4MM3A 2BPSA 3IG3A 3QA8A 3PRMB 4WWOA 1E8YA 2RGFA 3ZUNA 1WX8A 2NBVB 4KIKB 2LVOA 3C0RB 2Z0EB 4MJSA 1UELA 1V2YA 3RUIB 4GXBA 1YIWA 4HPMB 2LZ6A 3ALBA 4PS8A 3VUXA 1GG3A 3PS6A 2KDIA 3PZDA 5E6NA 2BYVE 2GBKA 4KV2A 4HVBA 3OAWA 5G55A 2O6VA 2KANA 3QX1A 4HJKA 2KNBA 4WWPA 1WRDB 4K1RB 3V6EB 4ZDVA 3APCA 3PPAA 5KHQA 3ENEA 2FCMA 4IM3A 3WALA 2MBEA 5D7GA 4BKSD 4ANWA 4DBGA 1J0GA 1KLVA 2GBNA 2ZNVC 1FXTB 2UYZB 4FJYA 4IWPA 4MSQB 2LI5A 3NS8A 2NBUA 1SIFA 4W9HA 3SHQA 1AARA 2Z0DB 4GDKA 5DPSA 3D32A 4G0NB 3TL5A 3DVGY 1P98A 3LJ3A 3UQBA 2LASA 2LWPA 5DPRA 4HLEA 5AZHA 4GDLA 4II3B 3VUYA 3VH3B 3VUWA 3QCAA 4W9LA 2KJHB 2DYOA 2K1FA 2KC2A 1WGGA 1G6JA 4LJOB 2ZZPB 4KDIC 3DOWA 4ANUA 2HE7A 1WMHA 2M4NA 3EFUA 3EHVA 3HHMA 3WANA 1WR1A 2C7NB 2JPHA 4BKGA 2DAJA 2EMSA 3DQVA 2M1MA 5CHFA 3ML8A 3ZW3A 1OEYA 3AXCA 1WX9A 3VTVA 3UQAA 1X1MA 4MGYE 2N7DA 3VTUA 4I6NB 5LLIA 2AYOB 2KTFA 2KFKA 2AEHA 2UWQA 1WZ3A 2LD9A 5D94A 1YJ1A 1WXVA 3JW0X 2MLBA 3RCZA 5L95C 3NOBA 3AU4A 3DVNV 4J6IA 3EC8A 1LQBA 2GOWA 3K9PB 2Y5BB 5TR5A 4II2B 2M8SA 3VHTC 4K7UA 3I3TB 3TIXA 1LM8B 2IO2B 4BFRA 5FR6A 1WM3A 2ASQA 3ZRCA 3ZTDA 1V80A 2CR5A 2KTRA 3A4SC 3PRZA 2D3GA 4AOFA 4B9KA 2MBOA 4K81A 4M0WB 3WAOA 4PYUA 2O2VA 5D6JB 3V61A 4OVUA 2EKEC 3QQ8B 3W1SA 4RM8A 3TBLD 1A5RA 3ZNZB 2LUEA 1WJUA 2BYEA 4MJSB 3PV1A 3L08A 2LGYA 5IAAC 3MHSD 3VAWA 3PHXB 4PS3A 2KC1A 2N9XA 4FHJA 1P9DU 4WWNA 3QHTA 3WA0A 2C7MB 2KWVB 1WFYA 2ZEQA 3B08A 2KXJA 1UZXB 2YLMA 2I1KA 3B0AA 1PQSA 3DVNU 3ZO5B 2BKRB 4AWJA 1UGMA 4FA6A 3AU5A 2N1VA 4KVGB 4FULA 3KYCD 3ZRFA 5G2NA 2K39A 2RR9A 4EZLA 1D3ZA 3APFA 3VQIA 5J17A 1Z5SB 4GDKB 2AL3A 2JRIB 4KSKC 1Q0WB 4JGHB 3DBSA 1EF5A 3UINB 4IWOA 3R3MA 5JZEB 3L17A 3QIJA 2KQ7A 1NDDA 4K7SA 2WX0A 2D07B 3RYTA 4OVVA 4KZCA 4FJZA 1R4MI 3ZDTA 2FAZA 3L0WB 4EEWA 2KLGA 2NPTA 2L76A 5CHWA 5L83A 2LVPA 4IWQA 1KM7A 3EECA 2ZCCA 2JZZA 1V5TA 3IBEA 3ML9A 5GMVA 2JY6A 3CSTA 4W9KA 3PRPB 5AEKB 1WMHB 3H6NA 4W9JA 2RD0A 1TZ1A 3RT3B 1QZEA 1XQQA 2KDBA 3M62B 2IYDB 1WJ6A 4JL9A 4WJNA 3M3JA 2KX0A 2ZVOA 1WXAA 3SU8X 2GBMA 2L05A 3QJZA 1YX5B 4MELA 2MCNB 2KFKB 2PE6B 4LCDE 3CSFA 4G11A 4DHJB 4KZ0A 5J18A 2PJHA 1YQBA 2K25A 2MRPA 4ZRJA 3R7RA 2WX1A 2KOXA 2MBHA 3QWZB 5JH5C 5E6OA 1EF1A 4MEMA 2VRRB 2G4SA 3L13A 2MW5A 3N30A 4NQKE 3R66C 2R2QA 2DENB 2KTRB 3RZFA 1ISNA 1E90A 2D2QA 2K8CA 1RAXA 2K8BA 4TUUA 1KOTA 2LXAA 2O2VB 2N4FA 1V49A 3H9DA 2L3ZA 2HJ8A 2FIFA 3IHPC 4F1SA 2N9PC 1M94A 3QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHW A;  4ASW C;  3PTF C;  3Q3J A;  1WM2 A;  3WAP A;  4TQ0 A;  4RM9 A;  5EDS A;  4IUM B;  1EO6 A;  4RMA A;  3KUZ A;  2LRW A;  2JZ3 B;  2N1W A;  2KQS A;  4I6P A;  4KSL C;  4HDQ A;  4DXA B;  1U4A A;  2CHX A;  4DWF A;  2KHW B;  1VD2 A;  2IBI B;  4E74 A;  3H7P A;  1WE7 A;  4DHZ E;  4GGQ A;  3TMP B;  4W9I A;  2C9W B;  4W9F A;  4NNJ B;  4ZRK A;  3VVW B;  1OTR B;  4AP4 C;  2I1J A;  5IA7 A;  2D10 A;  2AL6 A;  3QC8 B;  1V81 A;  2DZK A;  3ZIM A;  4CHK A;  1YD8 U;  2KX3 A;  2V4L A;  1V5O A;  4IM2 A;  3HM3 A;  3DBL I;  4B6W A;  2NCN A;  2O6V D;  2JT4 B;  3N32 A;  2KZR A;  3PLV A;  1E8X A;  2WYQ A;  2NPT B;  2LGD A;  3HM6 X;  5LXI B;  1ZGU B;  3VDZ A;  3DVG X;  4E71 A;  1WGD A;  1WZ0 A;  4W9D A;  2A4Z A;  4WAA A;  4G3X B;  4AJY B;  2HTH A;  2JVC A;  3OJ3 A;  3KW5 B;  4GSW A;  4F8C B;  1GC6 A;  3A33 B;  2WWZ A;  3NZU A;  3X23 A;  2DZJ A;  2IY0 B;  2C7H A;  5D2M B;  3U8Z A;  4ICV A;  4A20 A;  2IO3 B;  4X57 B;  2EMT A;  2YVC A;  1UD7 A;  5AZF A;  2L00 B;  3ZNH B;  3O65 B;  4HPL B;  3KVF B;  3L54 A;  1GJZ A;  3MJW A;  2DYM A;  4NY0 A;  3S2A A;  3U7D A;  4WJP A;  3ZNG C;  5J2R A;  2L8J A;  4BBN C;  1E5W A;  4GIV A;  1TTN A;  2CS4 A;  3HIZ A;  3NZS A;  3ZLZ A;  3H1U A;  1H4R A;  3DDC B;  5DPW A;  2IY1 B;  4XX5 A;  3NHE B;  2V3S A;  3W1Y A;  4LDT B;  1BT0 A;  4FHK A;  1RLF A;  1I35 A;  4W9G A;  3R7Q A;  3TJP A;  3NY5 A;  4IM0 A;  2B3A A;  4NQL B;  1H8C A;  2OJR A;  2N7E A;  4GU2 A;  2QHO A;  1CMX B;  4URK A;  3VXW A;  2BWE S;  1WI0 A;  4W9C A;  4B95 A;  2PE9 A;  4BKS A;  3PRE A;  2CHZ A;  1WY8 A;  3TCA A;  2K6D B;  3QAQ A;  4HDO A;  2NVU I;  4ICU A;  1IYF A;  4BKT A;  4KDL B;  1GNU A;  1KJT A;  4TV3 A;  4WQO B;  1IP9 A;  2LXC A;  4EOY A;  2BYF A;  3H7P B;  3A9K A;  4G50 A;  2BF8 B;  2C60 A;  2ZNV B;  2V1Y A;  3K9O B;  3KUD B;  1F9J A;  5KHO A;  1WJN A;  3JYU A;  1RFA A;  3JSV A;  1TGZ B;  2LRU A;  4EZJ A;  1C1Y B;  4DDG D;  2XK5 A;  2DAF A;  1S3S G;  4XZ4 A;  2MP2 A;  4TKN A;  4DDI D;  4GMV A;  3PLU A;  2FCN A;  4HCP B;  3GZN I;  2J0K A;  3VH4 B;  3M95 A;  1P3Q U;  1WH3 A;  3WIM A;  3MTN B;  3VFK A;  2NS5 A;  2AWT A;  3AI5 A;  2FID A;  2MBB B;  4M8M A;  2JF5 A;  2MWS B;  1V86 A;  4GOC A;  4F7Z A;  4NAW A;  1R4N I;  3CF6 E;  4AJW A;  1V6E A;  3ZVV A;  2XEW A;  5E6P A;  2KK8 A;  2ZVN A;  4EFO A;  2HD5 B;  4A3P A;  4LJP B;  4E3C A;  3A9J A;  5JHA A;  1XT9 B;  3UGB B;  3L10 B;  3A1Q A;  4ZYN A;  5HKH A;  4FBJ B;  2C5L C;  1OQY A;  1UH6 A;  4XC2 A;  1RRB A;  4FLH A;  2M0X A;  2RPQ A;  2FCQ A;  1Q5W B;  1WR6 E;  1WXS A;  3BY4 B;  3QAR A;  4BOS C;  2DHZ A;  1SGH A;  3PSE B;  1OGW A;  4WJQ A;  4BOZ B;  3OJ4 B;  4MGK E;  4WJO A;  2IO0 B;  2CU1 A;  1VCB A;  2IO1 B;  2KO3 A;  3GOE A;  4I6L B;  4MGZ E;  1UBQ A;  3T8M A;  3ZNI D;  3RZW C;  5CTR C;  2BWF A;  3JVZ X;  4HK2 A;  4CO7 A;  4YL8 A;  3T9L A;  2KKC A;  2WDT B;  4HCN B;  2PEA A;  1NBF C;  2D11 A;  1WXM A;  1ZW7 A;  2KWC A;  5CX3 A;  1C3T A;  2L0T A;  3DPD A;  5CHV C;  2N9E B;  2MX2 A;  2IZV B;  4GN1 A;  1Z2M A;  1E8Z A;  2XBB C;  3H7S A;  4EKU A;  2NR2 A;  2W9N A;  3DBR I;  2KFJ A;  3SD5 A;  2J7Q B;  2KJ6 A;  4P7I A;  2L7R A;  1HE8 A;  3U30 A;  3WAM A;  3X0W A;  4DK5 A;  4FJV B;  5BO4 B;  2PPH A;  2DYB A;  1T0Y A;  3W1S C;  2JUO A;  2J0J A;  2LVQ A;  2KVR A;  4A3O A;  2R2O A;  3KYD D;  4BVU C;  2LJ5 A;  3A9K B;  4KIK A;  4LDT D;  4EZK A;  4K7W A;  1WF9 A;  2GBJ A;  2Z59 B;  4MSM B;  4FAD A;  5C1Z A;  1ZKH A;  4JQW C;  1WJ4 A;  1S1Q B;  3Q3F A;  2ZJD A;  3APD A;  2G4D B;  5C23 A;  3LDZ E;  3JSV B;  1XD3 B;  3HK0 A;  4AUQ C;  2KN5 A;  2XK5 B;  2MQJ A;  3ECI A;  4IG7 B;  1WGR A;  4ZRI A;  2MP2 B;  2KMA A;  2BGF A;  4PYZ A;  2FUH B;  2KDE B;  3ONS A;  2JRH A;  3KH0 A;  3V62 A;  5AZG A;  3ZDM C;  4N9F 4;  2FCS A;  3BIN A;  4MGI E;  1OEY J;  2GMI C;  1WIA A;  3L16 A;  2MBQ A;  1K8R B;  1P1A A;  4NAW B;  1L7Y A;  4JIO U;  2OOB B;  3M63 B;  3DCG A;  3SDL C;  1Y8R C;  4IC7 B;  3OLM D;  2DX5 B;  1LFD A;  4ANV A;  3ZTC A;  3PHW B;  3PGE A;  4EUT A;  3RD2 A;  4ANX A;  3A9J B;  2CKH B;  3N3K B;  3A1Q B;  2G3Q B;  3UIP B;  2MSE D;  1SE9 A;  2KMC A;  3RUL A;  3P2B A;  2ZPN A;  2GBR A;  2K6Q A;  4IW0 A;  5JHB A;  1UBI A;  2O6V B;  2ZPY A;  4W9E A;  2KLC A;  2DZI A;  2KJR A;  3AUL A;  4DHJ D;  3A4R A;  3DBH I;  1WYW B;  4CYE A;  4NJ7 A;  3IVF A;  1TBE A;  1LXD A;  1YX6 B;  1WE6 A;  2M17 A;  2NBW B;  3B1L X;  4GB9 A;  3ZKJ C;  5DPT A;  1GC7 A;  1Q1O A;  1E8W A;  2K8H A;  1P0R A;  4MH0 E;  4FN2 A;  5LXH A;  4JLC A;  3V6C B;  4M8N A;  1NI2 A;  2J0M A;  2BKF A;  4HXD A;  2KD0 A;  3IFW B;  2MA9 B;  4MDK E;  2LGX A;  2FNJ B;  5DCN A;  2JXX A;  3KUC B;  2ZCB A;  1WX7 A;  3V60 A;  2KWU B;  2G45 B;  2A5U A;  2KDF B;  3UF8 A;  1L2N A;  3PVL A;  1V9J A;  4GDL B;  4HWI B;  3UIO B;  1WGH A;  1E7V A;  1MG8 A;  1J19 A;  1IPG A;  1E7U A;  4BBN F;  4NJ6 A;  2RSU A;  1JRU A;  2L0F A;  2DZM A;  1WGY A;  2REX A;  3CMM B;  4PS7 A;  1J8C A;  4DHZ B;  2JWZ A;  1GUA B;  1I42 A;  4TQ1 A;  3PT2 B;  4NPN A;  3VTW A;  1EUV B;  4MM3 A;  2BPS A;  3IG3 A;  3QA8 A;  3PRM B;  4WWO A;  1E8Y A;  2RGF A;  3ZUN A;  1WX8 A;  2NBV B;  4KIK B;  2LVO A;  3C0R B;  2Z0E B;  4MJS A;  1UEL A;  1V2Y A;  3RUI B;  4GXB A;  1YIW A;  4HPM B;  2LZ6 A;  3ALB A;  4PS8 A;  3VUX A;  1GG3 A;  3PS6 A;  2KDI A;  3PZD A;  5E6N A;  2BYV E;  2GBK A;  4KV2 A;  4HVB A;  3OAW A;  5G55 A;  2O6V A;  2KAN A;  3QX1 A;  4HJK A;  2KNB A;  4WWP A;  1WRD B;  4K1R B;  3V6E B;  4ZDV A;  3APC A;  3PPA A;  5KHQ A;  3ENE A;  2FCM A;  4IM3 A;  3WAL A;  2MBE A;  5D7G A;  4BKS D;  4ANW A;  4DBG A;  1J0G A;  1KLV A;  2GBN A;  2ZNV C;  1FXT B;  2UYZ B;  4FJY A;  4IWP A;  4MSQ B;  2LI5 A;  3NS8 A;  2NBU A;  1SIF A;  4W9H A;  3SHQ A;  1AAR A;  2Z0D B;  4GDK A;  5DPS A;  3D32 A;  4G0N B;  3TL5 A;  3DVG Y;  1P98 A;  3LJ3 A;  3UQB A;  2LAS A;  2LWP A;  5DPR A;  4HLE A;  5AZH A;  4GDL A;  4II3 B;  3VUY A;  3VH3 B;  3VUW A;  3QCA A;  4W9L A;  2KJH B;  2DYO A;  2K1F A;  2KC2 A;  1WGG A;  1G6J A;  4LJO B;  2ZZP B;  4KDI C;  3DOW A;  4ANU A;  2HE7 A;  1WMH A;  2M4N A;  3EFU A;  3EHV A;  3HHM A;  3WAN A;  1WR1 A;  2C7N B;  2JPH A;  4BKG A;  2DAJ A;  2EMS A;  3DQV A;  2M1M A;  5CHF A;  3ML8 A;  3ZW3 A;  1OEY A;  3AXC A;  1WX9 A;  3VTV A;  3UQA A;  1X1M A;  4MGY E;  2N7D A;  3VTU A;  4I6N B;  5LLI A;  2AYO B;  2KTF A;  2KFK A;  2AEH A;  2UWQ A;  1WZ3 A;  2LD9 A;  5D94 A;  1YJ1 A;  1WXV A;  3JW0 X;  2MLB A;  3RCZ A;  5L95 C;  3NOB A;  3AU4 A;  3DVN V;  4J6I A;  3EC8 A;  1LQB A;  2GOW A;  3K9P B;  2Y5B B;  5TR5 A;  4II2 B;  2M8S A;  3VHT C;  4K7U A;  3I3T B;  3TIX A;  1LM8 B;  2IO2 B;  4BFR A;  5FR6 A;  1WM3 A;  2ASQ A;  3ZRC A;  3ZTD A;  1V80 A;  2CR5 A;  2KTR A;  3A4S C;  3PRZ A;  2D3G A;  4AOF A;  4B9K A;  2MBO A;  4K81 A;  4M0W B;  3WAO A;  4PYU A;  2O2V A;  5D6J B;  3V61 A;  4OVU A;  2EKE C;  3QQ8 B;  3W1S A;  4RM8 A;  3TBL D;  1A5R A;  3ZNZ B;  2LUE A;  1WJU A;  2BYE A;  4MJS B;  3PV1 A;  3L08 A;  2LGY A;  5IAA C;  3MHS D;  3VAW A;  3PHX B;  4PS3 A;  2KC1 A;  2N9X A;  4FHJ A;  1P9D U;  4WWN A;  3QHT A;  3WA0 A;  2C7M B;  2KWV B;  1WFY A;  2ZEQ A;  3B08 A;  2KXJ A;  1UZX B;  2YLM A;  2I1K A;  3B0A A;  1PQS A;  3DVN U;  3ZO5 B;  2BKR B;  4AWJ A;  1UGM A;  4FA6 A;  3AU5 A;  2N1V A;  4KVG B;  4FUL A;  3KYC D;  3ZRF A;  5G2N A;  2K39 A;  2RR9 A;  4EZL A;  1D3Z A;  3APF A;  3VQI A;  5J17 A;  1Z5S B;  4GDK B;  2AL3 A;  2JRI B;  4KSK C;  1Q0W B;  4JGH B;  3DBS A;  1EF5 A;  3UIN B;  4IWO A;  3R3M A;  5JZE B;  3L17 A;  3QIJ A;  2KQ7 A;  1NDD A;  4K7S A;  2WX0 A;  2D07 B;  3RYT A;  4OVV A;  4KZC A;  4FJZ A;  1R4M I;  3ZDT A;  2FAZ A;  3L0W B;  4EEW A;  2KLG A;  2NPT A;  2L76 A;  5CHW A;  5L83 A;  2LVP A;  4IWQ A;  1KM7 A;  3EEC A;  2ZCC A;  2JZZ A;  1V5T A;  3IBE A;  3ML9 A;  5GMV A;  2JY6 A;  3CST A;  4W9K A;  3PRP B;  5AEK B;  1WMH B;  3H6N A;  4W9J A;  2RD0 A;  1TZ1 A;  3RT3 B;  1QZE A;  1XQQ A;  2KDB A;  3M62 B;  2IYD B;  1WJ6 A;  4JL9 A;  4WJN A;  3M3J A;  2KX0 A;  2ZVO A;  1WXA A;  3SU8 X;  2GBM A;  2L05 A;  3QJZ A;  1YX5 B;  4MEL A;  2MCN B;  2KFK B;  2PE6 B;  4LCD E;  3CSF A;  4G11 A;  4DHJ B;  4KZ0 A;  5J18 A;  2PJH A;  1YQB A;  2K25 A;  2MRP A;  4ZRJ A;  3R7R A;  2WX1 A;  2KOX A;  2MBH A;  3QWZ B;  5JH5 C;  5E6O A;  1EF1 A;  4MEM A;  2VRR B;  2G4S A;  3L13 A;  2MW5 A;  3N30 A;  4NQK E;  3R66 C;  2R2Q A;  2DEN B;  2KTR B;  3RZF A;  1ISN A;  1E90 A;  2D2Q A;  2K8C A;  1RAX A;  2K8B A;  4TUU A;  1KOT A;  2LXA A;  2O2V B;  2N4F A;  1V49 A;  3H9D A;  2L3Z A;  2HJ8 A;  2FIF A;  3IHP C;  4F1S A;  2N9P C;  1M94 A;  3QK0 A; 
#chains in the Genus database with same CATH topology
 2M56 B;  3AEF B;  1WM2 A;  1V1O A;  1QKZ A;  5C3J B;  3AEB B;  3B2F A;  2AX5 A;  2IBI B;  2IJ0 A;  1KLG D;  3TMP B;  3FC4 A;  4NNJ B;  3HRD D;  2WXH A;  2I1J A;  2AL6 A;  2DZK A;  1AN8 A;  3HM3 A;  3DBL I;  4B6W A;  4R3D A;  1R4M B;  1IUE A;  1HTQ A;  3HM6 X;  5LXI B;  2WXL A;  3VDZ A;  4E71 A;  1WZ0 A;  2HDE A;  4G3X B;  2BT6 A;  1GC6 A;  4NJC A;  3A33 B;  1Y56 A;  2WXJ A;  4K3B A;  3NZU A;  2IY0 B;  4JWU C;  2IO3 B;  2MH7 A;  3KWL A;  3O65 B;  3KVF B;  1K52 A;  2J52 A;  4WJP A;  1KTK A;  5J2R A;  1D5X C;  4BBN C;  1YQ4 B;  1E5W A;  1TKE A;  2PMV A;  1FO4 A;  1H4R A;  5DPW A;  4XX5 A;  3IAM 1;  4W9G A;  3R7Q A;  2INN E;  1TIF A;  1ZE3 D;  1KRH A;  1KLU D;  1D6E C;  2DLB A;  4XDD A;  4BKS A;  1T3Q A;  3PRE A;  3TCA A;  3VR8 B;  2K6D B;  4XYC A;  1ZPS A;  2NVU I;  1HXY D;  4WQO B;  1IP9 A;  3A9K A;  2PLP A;  5KHO A;  1WJN A;  1QOF A;  3JYU A;  2D3C A;  2LRU A;  1ZOY B;  1S3S G;  4DDI D;  4QAY A;  1E9M A;  1WH3 A;  3MTN B;  2NS5 A;  1JRP A;  2AWT A;  4ITK A;  3R2T A;  2FID A;  3RMK C;  4F7Z A;  4GOC A;  2PKO A;  3NS1 A;  5BYR A;  1QOA A;  2HD5 B;  4A3P A;  5JHA A;  1XT9 B;  3DHI C;  1HTO A;  5G5G A;  1RFK A;  2N9K A;  5HKH A;  3UI3 A;  1OQY A;  4RGN A;  1WR6 E;  1WXS A;  2KYW A;  3C19 A;  4WJQ A;  1JQ4 A;  1OGW A;  1UNS A;  4WJO A;  5G5H A;  2VH1 A;  3RZW C;  4HK2 A;  4AS1 A;  2WDT B;  1I4X A;  4PT5 A;  1C3T A;  4KX6 B;  5CHV C;  1SF0 A;  2MX2 A;  3N9Y C;  3DBR I;  3P4R B;  2ACZ B;  2KFJ A;  3AE3 B;  4RNA A;  2J7Q B;  2KJ6 A;  4P7I A;  3MHZ A;  3WAM A;  4RGO S;  3X0W A;  3IT6 B;  4KGS A;  1DOI A;  1ZDX A;  3W1S C;  2M0A A;  2WXR A;  4WWM A;  5HG2 A;  3TSS A;  1WJ4 A;  1S1Q B;  3Q3F A;  3SFE B;  4CQN A;  3LDZ E;  3HK0 A;  2KN5 A;  4LLG M;  1C77 A;  5BYQ A;  1I4H A;  4M00 A;  3ZNH B;  2MP2 B;  2KMA A;  2N9L A;  1TKY A;  2GMI C;  1BUI C;  1HA5 A;  3LYY A;  2MBQ A;  4NAW B;  1L7Y A;  2OOB B;  3M63 B;  1Y8R C;  3ZTC A;  3OG5 A;  2CKH B;  1KF6 B;  2KDM A;  2O6V B;  4W9E A;  2DZI A;  4DHJ D;  3GB1 A;  3Q8F A;  3DBH I;  4CYE A;  3IVF A;  1TBE A;  3B1L X;  4GB9 A;  3ZKJ C;  4FN2 A;  5LXH A;  4M8N A;  2VZK B;  4HXD A;  4MDK E;  2ONQ A;  1Q10 A;  4RFB A;  1WX7 A;  2KDF B;  3UF8 A;  5AUI A;  1L4D B;  1WGH A;  1PGX A;  1PGA A;  2RSU A;  1JRU A;  1F1H A;  1UWM A;  2REX A;  1J8C A;  4DHZ B;  1BXT A;  4A9A A;  3QA8 A;  3PRM B;  3URY A;  4ZRQ A;  1R7S A;  4KIK B;  3EUB 2;  2Z0E B;  4GXB A;  4EE2 A;  2BYV E;  2GBK A;  4KV2 A;  4RGM A;  5G55 A;  2O6V A;  2WU2 B;  1TS5 A;  4K1R B;  2WS3 B;  3ENE A;  4IM3 A;  2MJD A;  1KLV A;  3BYY B;  1UUP A;  4FJY A;  4MSQ B;  3U7Z A;  2NBU A;  2WXK A;  2MJ3 A;  5DPS A;  4OZB A;  3DVG Y;  3RPF C;  3LB8 C;  3LJ3 A;  3AB5 A;  2LAS A;  4HLE A;  4IOI E;  3QCA A;  4W9L A;  2KJH B;  5IKC M;  2KC2 A;  4IDI A;  1G6J A;  4LJO B;  2NMQ A;  2WP9 B;  4KDI C;  2D3A A;  1K51 A;  3HHM A;  1MVK A;  4LNK A;  2C7N B;  2OJW A;  3DQV A;  1QF6 A;  3ZXR A;  1UGJ A;  4LTU A;  3IXS A;  4LNO A;  1MPE A;  3VTU A;  1STE A;  2KTF A;  2KFK A;  2AEH A;  3JW0 X;  3Q3M C;  3DVN V;  1LQB A;  2Y5B B;  3U52 E;  2K3U A;  3U2S C;  2M8S A;  4K7U A;  3I3T B;  4BFR A;  5FR6 A;  1WM3 A;  2ASQ A;  3HVZ A;  2MBO A;  3WAO A;  4AQ7 A;  2JX5 A;  2VZK D;  2EKE C;  3W1S A;  2WDQ B;  4BAX A;  3L08 A;  5IAA C;  2KC1 A;  4FHJ A;  2YLM A;  1PQS A;  3ZO5 B;  4B0M A;  2BKR B;  2J53 A;  4AWJ A;  5H8Y E;  2N1V A;  1P7F A;  3KYC D;  2BB6 A;  2RR9 A;  1D3Z A;  3APF A;  1GOZ A;  2JRI B;  3RFZ B;  4A90 A;  1Q0W B;  3DBS A;  3BVM A;  1OQR A;  1EF5 A;  3OWE B;  4MT5 A;  3R3M A;  2D07 B;  4OVV A;  1JW9 D;  4KZC A;  4YSX B;  2FAZ A;  4XE0 A;  2NPT A;  5L83 A;  5CHW A;  4YSZ B;  1SJH D;  3IBE A;  3ML9 A;  2ICI A;  2RDG A;  4W9J A;  3H6N A;  2WU5 B;  3RT3 B;  1QZE A;  1T6B X;  1WJ6 A;  1ROE A;  2ZVO A;  3SU8 X;  2L05 A;  1TJE A;  1FM0 D;  2M19 A;  1ENF A;  4L23 A;  2MRP A;  3GS2 A;  2VH2 A;  4MEM A;  1V1P B;  3TEY A;  3CWI A;  3L13 A;  4C7Z A;  1VZ7 A;  1ISN A;  4TUU A;  2GB1 A;  2K8B A;  2N4F A;  1V49 A;  1A70 A;  3Q8A A;  3IHP C;  4KKJ A;  2N9P C;  3QK0 A;  5C2T B;  4ASW C;  3BK2 A;  1I4P A;  4HKQ A;  5IOI A;  3ZXV A;  2JZ3 B;  2N1W A;  2G1E A;  4DXA B;  1U4A A;  2CU3 A;  1FFV A;  2CHX A;  5IO9 A;  4DWF A;  1VD2 A;  1YJI A;  3LXF A;  4GGQ A;  3VVW B;  2AQ3 B;  1JAL A;  4AP4 C;  3FKY A;  1QLB B;  4YT0 B;  2V4L A;  4GLS C;  3FIL B;  3N32 A;  4XDC A;  1BML C;  3PLV A;  2LJI A;  1D4B A;  1QIL A;  3DVG X;  2A4Z A;  4WAA A;  2JVC A;  1MFW A;  1XEE A;  3X23 A;  5D2M B;  3NVZ A;  3W5V B;  1VLB A;  4LNF A;  2DBY A;  1JWB D;  2EMT A;  3AN1 A;  1UD7 A;  2K22 A;  2L00 B;  4S0R A;  4C4V A;  4HPL B;  1FD6 A;  4NY0 A;  3U7D A;  2L8J A;  4C00 A;  3HIZ A;  3NHE B;  3RNF C;  1YQ3 B;  4LDT B;  1BT0 A;  1RLF A;  1F0Z A;  2MEK A;  4NQL B;  2OJR A;  3HUI A;  1M4V A;  1PYW D;  1AWD A;  2QHO A;  1CMX B;  1L6V A;  2ZW0 A;  3VXW A;  3ABV B;  5AUK A;  2L1A A;  3CIR B;  2PE9 A;  3PZ7 A;  1ZP0 B;  1WY8 A;  5BMI A;  5TSS A;  1YN4 A;  4BKT A;  1GNU A;  1KJT A;  2LXC A;  1RWS A;  2Y5C A;  2KVZ A;  1L0Y B;  2V1Y A;  3EFC A;  2BW2 A;  2K9X A;  1C1Y B;  4DDG D;  2XK5 A;  2DAF A;  3WCQ A;  4GMV A;  4HCP B;  3WIM A;  4M02 A;  5EE1 A;  3AI5 A;  2BVC A;  2MBB B;  5FKA C;  1V86 A;  1LGR A;  2V3P A;  3NZ3 A;  1VZ8 A;  4MH8 A;  3L10 B;  2W55 A;  4FBJ B;  2C5L C;  1FNV A;  4FLH A;  2RPQ A;  3QAR A;  1FFU A;  1SGH A;  3PSE B;  3AED B;  3OJ4 B;  4RF1 A;  1SXT A;  4N58 A;  1VCB A;  5HFY A;  3I9V 1;  3ZNI D;  4CO7 A;  4YL8 A;  3T9L A;  2D11 A;  2IZV B;  2JYT A;  4GN1 A;  1Z2M A;  1EWC A;  5GXG B;  2D5G A;  1HQR D;  1TY2 A;  3P4P B;  5H92 C;  3TEW A;  4DK5 A;  4FJV B;  2PPH A;  2DYB A;  1T0Y A;  2JUO A;  2J0J A;  4UDU C;  2KVR A;  3A9K B;  4LDT D;  1GB1 A;  1WF9 A;  2GBJ A;  2H88 B;  3W9C B;  2KAJ A;  4JQW C;  1C78 A;  5C23 A;  2IGG A;  1L4Z B;  3MJ5 A;  2BGF A;  2FUH B;  3ONS A;  2JRH A;  4US8 A;  1OEY J;  4OZA A;  4WQM A;  4C56 C;  2FBW B;  4HEA 1;  3RNC C;  4KGR A;  4JIO U;  1QOB A;  4IC7 B;  2N0S B;  4H2A A;  3N3K B;  3UIP B;  1JRO A;  2KMC A;  2LUM A;  3P2B A;  2K6Q A;  2H89 B;  2ZPY A;  1WYW B;  1YX6 B;  1WE6 A;  1FXA A;  5DPT A;  1Q1O A;  1P0R A;  1MHX A;  4MH0 E;  3DHG C;  2LMC A;  2MJE A;  2J0M A;  2BKF A;  1HEZ E;  2KD0 A;  3IFW B;  2LGX A;  2ZCB A;  2G45 B;  3ZJV A;  2V3N A;  4HWI B;  2R61 A;  2QC8 A;  2YEP B;  1J19 A;  2AQ2 B;  4NJ6 A;  1RYJ A;  4PS7 A;  4OZC A;  2LHE A;  2JWZ A;  1I42 A;  3PT2 B;  4NPN A;  1ZDV A;  1EUV B;  4MM3 A;  2BPS A;  1PGB A;  1E8Y A;  4P1C C;  2FUG 1;  3C0R B;  1LO5 D;  4MJS A;  1YIW A;  2N7J A;  1MI0 A;  2LZ6 A;  4HPM B;  3PS6 A;  2KDI A;  4HVB A;  1DGJ A;  4HJK A;  2LGI A;  3PPA A;  1C79 A;  5EE3 A;  4BKS D;  3Q8E A;  2V9H A;  2ZNV C;  2QEJ C;  4IWP A;  2LI5 A;  1ZUD 2;  4RGT A;  4W9H A;  2JU6 X;  4G0N B;  1P98 A;  3UQB A;  1YNT E;  5AZH A;  1GAQ B;  1YN3 A;  3C8Y A;  2DYO A;  3N1Z C;  3AE5 B;  1WGG A;  1SE2 A;  3BII D;  1V8C A;  1T5X D;  2KT7 A;  4ANU A;  1E6E B;  3EFU A;  3EHV A;  2X8X X;  2JXT A;  2DAJ A;  2EMS A;  3AXC A;  1WX9 A;  2N7D A;  1TT5 B;  2KMM A;  1TY0 A;  2UWQ A;  4TMA B;  1YJ1 A;  3RCZ A;  5L95 C;  3NOB A;  5TR5 A;  2BQQ A;  3TIX A;  2JWU A;  3ZRC A;  2KTR A;  3PRZ A;  1L0V B;  4K81 A;  2K0P A;  3H8H A;  2O2V A;  2BS3 B;  4OVU A;  1R4N B;  5FK9 C;  3QQ8 B;  4RM8 A;  3TBL D;  2LUE A;  1MJD A;  2BYE A;  4D2K A;  3AE6 B;  3MHS D;  2LFI A;  3VRA B;  1QT9 A;  4WWN A;  3QHT A;  2KWV B;  3B08 A;  5I4D A;  2KXJ A;  3P4S B;  2EEL A;  4FA6 A;  5G2N A;  3B9J A;  5J17 A;  2AL3 A;  4KSK C;  3SFD B;  4JGH B;  3BVG A;  3L17 A;  2KQ7 A;  1NDD A;  4K7S A;  2WX0 A;  4N59 A;  3RYT A;  2GLS A;  4KKI A;  1WRI A;  4EEW A;  2KLG A;  2L76 A;  2QSD A;  3RNB C;  1KM7 A;  3EEC A;  2JZZ A;  5GMV A;  1NVI D;  3BWU D;  2JY6 A;  3PRP B;  4N6E B;  3M3J A;  2KX0 A;  1WXA A;  1YX5 B;  4MEL A;  2OED A;  2MCN B;  2KFK B;  2PE6 B;  1EWY C;  4LCD E;  3CSF A;  4HKZ E;  2BYT A;  4KZ0 A;  4BZA A;  2K25 A;  2ZW1 A;  2KOX A;  3SR6 A;  3N30 A;  2R2Q A;  2WXO A;  2DEN B;  4J3O D;  2K8C A;  1RAX A;  1KOT A;  1C4C A;  2IPK D;  5EE9 A;  2FIF A;  4L2Y A;  4F1S A;  1E10 A;  2WDV B;  1M94 A;  5BYS A;  1E0Z A;  2V0G A;  3DWG C;  3WAP A;  1EO6 A;  4RMA A;  2LRW A;  2KQS A;  4I6P A;  1E7P B;  4KSL C;  4HDQ A;  4RF0 A;  1IGC A;  1C4A A;  1HZ5 A;  1JWM D;  4E74 A;  3H7P A;  1J7A A;  1ACC A;  2C9W B;  4W9I A;  2RPV A;  1XLP A;  4ZRK A;  4XWW A;  4ZHP A;  2DWQ A;  3ZIM A;  1V5O A;  4IM2 A;  1D5Z C;  2O6V D;  2JT4 B;  2KZR A;  2NPT B;  2LGD A;  3R2I A;  1ZGU B;  4W9D A;  1FPY A;  1YMH E;  2JZP A;  5T8I A;  3VRB B;  2WWZ A;  3NUH B;  2QDF A;  2DZJ A;  1KFY B;  2JYE A;  4A20 A;  4X57 B;  2YVC A;  5AZF A;  1N5W A;  3L54 A;  1GJZ A;  3MJW A;  1MHH E;  4O1N A;  4Q2J A;  4HRS A;  4GIV A;  4C7Y A;  2CS4 A;  3H1U A;  3DDC B;  2IY1 B;  3W1Y A;  1F77 A;  4FHK A;  4RCO A;  2L83 A;  3DWM A;  1I35 A;  2IDY A;  3BZD B;  1NEN B;  3TJP A;  1SJE D;  4JWS C;  1PDX A;  3AMZ A;  2L52 A;  4IM0 A;  2B3A A;  4DXG A;  2N7E A;  4GU2 A;  1CJE A;  1WI0 A;  2BWE S;  4B95 A;  5IN7 A;  2CHZ A;  3QAQ A;  1IYF A;  1SE3 A;  4KDL B;  2JQR B;  4TV3 A;  4EOY A;  2BYF A;  1ET9 A;  4ACF A;  5HHD G;  3AH7 A;  5IP4 D;  1F2R C;  3I63 C;  2WXG A;  1YOV B;  2KN4 A;  1RFA A;  3JSV A;  1TGZ B;  4EZJ A;  4OVZ A;  1NYQ A;  4JX1 C;  3AE4 B;  4TKN A;  3GZN I;  2J0K A;  3VH4 B;  2RMM A;  3M95 A;  3RNE C;  2IND C;  1EM7 A;  3CF6 E;  4AJW A;  3I57 A;  3ZVV A;  2ZVN A;  4IKG A;  4LJP B;  3A9J A;  3UGB B;  1NEK B;  3A1Q A;  1TS2 A;  3HVD A;  1TS3 A;  4ZYN A;  4XC2 A;  1MG4 A;  1RRB A;  3PZ8 A;  2FCQ A;  4BOS C;  3BY4 B;  2DHZ A;  4C4V B;  4MGK E;  3E9S A;  2CU1 A;  2IGH A;  2IO1 B;  3GOE A;  4ZHO A;  4MGZ E;  1UBQ A;  4A55 A;  3T8M A;  5CTR C;  3JVZ X;  1DYQ A;  2KKC A;  1VZ6 A;  5CX3 A;  1ZW7 A;  2K5P A;  2L0T A;  1L5P A;  2N9E B;  3ZJT A;  2XBB C;  4EKU A;  3H7S A;  2NR2 A;  4WUR A;  1JWA D;  2L7R A;  2I2Y A;  3DHH C;  4A3O A;  2R2O A;  3KYD D;  4EZK A;  2YEP F;  4K7W A;  3AM9 A;  2Z59 B;  4MSM B;  4FAD A;  5C1Z A;  2ZJD A;  2EKI A;  2G4D B;  3APD A;  4AUQ C;  1XD3 B;  3RN9 C;  2XK5 B;  3ECI A;  1WGR A;  4PYZ A;  3NVV A;  3V62 A;  4WIP A;  3BIN A;  4MGI E;  5D3I B;  3L16 A;  1P1A A;  3KWV A;  4REZ A;  2WLB A;  3SDL C;  3OLM D;  3TEZ A;  3PHW B;  1TS4 A;  4EUT A;  4ANX A;  1N60 A;  1SE9 A;  3RUL A;  2ZPN A;  2GBR A;  4IW0 A;  5JHB A;  2KJR A;  3Q14 C;  3A4R A;  4NJ7 A;  1LXD A;  2M17 A;  1E8W A;  1VJK A;  3AEE B;  1TZO A;  4PK1 A;  4JLC A;  3V6C B;  1IGD A;  5E6J A;  1JML A;  2BTE A;  2MA9 B;  3EA6 A;  2FNJ B;  2JXX A;  3KUC B;  3V60 A;  4M01 A;  5HI1 A;  2A5U A;  3EGR A;  2L32 A;  3ZYY X;  4C80 A;  2W54 A;  4GDL B;  1E7V A;  1MG8 A;  1FRD A;  4BBN F;  1XXG A;  1WGY A;  2DZM A;  3DBL B;  4TQ1 A;  3VTW A;  1FCC C;  3ZQ4 A;  2RGF A;  1WX8 A;  2NBV B;  4ZYS A;  2LVO A;  1UEL A;  1VRA B;  1V2Y A;  1F2R I;  3ALB A;  4S17 A;  2KAC A;  1GG3 A;  3VUX A;  3PZD A;  5E6N A;  4ARI A;  3OAW A;  3QX1 A;  3V6E B;  2KNB A;  3AEG B;  2WXI A;  1ESF A;  3APC A;  2KQ4 X;  5KHQ A;  4ARC A;  2PTL A;  3WAL A;  1NI3 A;  2MBE A;  5D7G A;  4ANW A;  2GBN A;  1FXT B;  3W5U B;  3FAH A;  2UYZ B;  1EU3 A;  1SIF A;  2D3B A;  2IGD A;  3BVZ A;  1AAR A;  1SEB D;  3SHQ A;  3AV8 A;  4GDK A;  5DPR A;  1WYG A;  2BS2 B;  1J7C A;  3RNA C;  2J42 A;  4GDL A;  4II3 B;  3VUY A;  3Q69 A;  2K1F A;  3Q2A C;  1AYF A;  1FNU A;  3Q8C A;  1XF5 L;  3DOW A;  1I4G A;  4YXD B;  4WH4 A;  2HE7 A;  1WMH A;  1WR1 A;  2JPH A;  4BKG A;  3PO0 A;  3ML8 A;  1XLQ A;  3AEC B;  1IBX A;  3BK1 A;  3KQ4 A;  2LD9 A;  5D94 A;  2MLB A;  2B76 B;  2PVO D;  3AU4 A;  4II2 B;  3VHT C;  2IO2 B;  4K3C A;  3TEX A;  1V80 A;  2CR5 A;  3A4S C;  3IT4 B;  4MM3 B;  5D6J B;  2Y3A A;  3V61 A;  1A5R A;  1WJU A;  4MJS B;  1QOG A;  1N62 A;  2LGY A;  3VAW A;  4PS3 A;  3ZJU A;  4NAM A;  1P9D U;  3NG0 A;  1UZX B;  1SBB B;  2I1K A;  2WGS A;  4LK0 M;  1UGM A;  3AU5 A;  4YTN B;  4KVG B;  4FUL A;  3ZRF A;  2E6X A;  4OHJ A;  3GE8 C;  3VQI A;  2ON8 A;  2DNF A;  1ZXH A;  3SEB A;  3Q6B A;  1L6U A;  5JZE B;  3QIJ A;  3O13 A;  1TYG B;  2W82 A;  4JE3 B;  2CJO A;  1R4M I;  4FJZ A;  3L0W B;  3DBR B;  2LVP A;  3RNG C;  2ZCC A;  1N63 A;  1V5T A;  2G9H D;  3CST A;  3N1Y C;  3MC0 B;  2J4X A;  1TZ1 A;  2WQY B;  1N5X A;  4JL9 A;  2IYD B;  4WJN A;  1GPX A;  4XWT A;  3QJZ A;  2WXN A;  1OFF A;  4G11 A;  4DHJ B;  3BYT B;  3KLS X;  3R7R A;  4P1B C;  2WX1 A;  5JH5 C;  2MBH A;  3QWZ B;  5E6O A;  2G4S A;  2MW5 A;  1ZXI A;  2BBC A;  3R66 C;  2KTR B;  3RZF A;  1E90 A;  2D2Q A;  4YTP B;  2LXA A;  2O2V B;  1JCK B;  2PVG C;  3H9D A;  2L3Z A;  2HJ8 A;  5JXV A;  2CHW A;  3PTF C;  3Q3J A;  4TQ0 A;  4RM9 A;  5EDS A;  4IUM B;  3KUZ A;  1T0S C;  4TSS A;  5MPO A;  1B1Z A;  3DBH B;  2KHW B;  3T3N A;  1WE7 A;  2BS4 B;  4DHZ E;  1DOY A;  1D5M C;  1ET6 A;  4W9F A;  1OTR B;  1CK1 A;  3P1M A;  5IA7 A;  1NYR A;  2D10 A;  3QC8 B;  1V81 A;  4CHK A;  1YD8 U;  2KX3 A;  4HPP A;  4P6V F;  2NCN A;  1PUT A;  1E8X A;  2WYQ A;  3TUO A;  1TKG A;  1WGD A;  1RM6 C;  4USA A;  1C76 A;  2HTH A;  3OJ3 A;  3KW5 B;  4GSW A;  3V05 A;  4F8C B;  2C7H A;  3U8Z A;  4B0E A;  3AE2 B;  3W2D A;  4ICV A;  4HJG E;  4A8X C;  2DYM A;  3S2A A;  3MC8 A;  3ZNG C;  1L0X B;  1TTN A;  3NZS A;  3ZLZ A;  3ZGZ A;  4US9 A;  2V3S A;  1XLN A;  4WAF A;  2QIE B;  2HJ1 A;  3NY5 A;  1H8C A;  4OW0 A;  4URK A;  4W9C A;  1T0R C;  4HDO A;  3RI7 C;  4ICU A;  3U4E G;  2WXP A;  3H7P B;  4G50 A;  2BF8 B;  2WNM A;  2C60 A;  1FXI A;  2JSV X;  2ZNV B;  3K9O B;  3KUD B;  2INC C;  1FMA D;  1F9J A;  1WSP A;  1VR9 A;  4XZ4 A;  2MP2 A;  3PLU A;  2FCN A;  3J9C A;  1P3Q U;  2W3S A;  3VFK A;  1XLO A;  2CJN A;  4M8M A;  2JF5 A;  2MWS B;  2QCZ A;  4NAW A;  1CQV A;  1R4N I;  4ZOH C;  1FNW A;  2MHJ A;  1V6E A;  2XEW A;  5E6P A;  2KK8 A;  4EFO A;  4E3C A;  2KWD A;  1UH6 A;  2M0X A;  1Q5W B;  1AW7 A;  4BOZ B;  3NVY A;  5FR3 A;  2LEK A;  2IO0 B;  1UF0 A;  2AQ1 B;  4NZL B;  2KO3 A;  2LHD A;  4I6L B;  3NRZ A;  1KH0 A;  2BWF A;  2GRI A;  1UWX A;  2TSS A;  4HCN B;  2PEA A;  1NBF C;  1WXM A;  2KWC A;  3DPD A;  5EE0 A;  4DQO C;  3NVW A;  1E8Z A;  2W9N A;  1T0Q C;  1WXQ A;  2UU7 A;  3SD5 A;  1HE8 A;  3U30 A;  1V97 A;  3AE7 B;  3AE8 B;  5BO4 B;  2RDH A;  2LVQ A;  2W3R A;  4LNI A;  4BVU C;  2LJ5 A;  4KIK A;  2BB5 A;  1ZKH A;  3V3X A;  1DOX A;  3R8B A;  3JSV B;  2QMT A;  2MQJ A;  4IG7 B;  4AJY B;  4ZRI A;  4L1B A;  2KDE B;  3KH0 A;  2V4I B;  5AZG A;  3ZDM C;  4N9F 4;  2FCS A;  2PW9 A;  5D3D A;  1HZ6 A;  3GZN B;  1FRR A;  1WIA A;  2SEB D;  4FXC A;  3MP9 A;  1K8R B;  5BMH A;  3I5J C;  3DCG A;  1WGK A;  5LNK 1;  2DX5 B;  1LFD A;  4ANV A;  3PGE A;  3RD2 A;  3A9J B;  3A1Q B;  2G3Q B;  1PFD A;  2MSE D;  1SB3 C;  1GB4 A;  1UBI A;  1YJJ A;  2KLC A;  3AUL A;  2PIA A;  1K50 A;  1XCQ L;  1XCT L;  1J7B A;  2NBW B;  3VR9 B;  1GC7 A;  2K8H A;  2INP E;  4P16 A;  1NI2 A;  3P4Q B;  1FCL A;  4DXF A;  1N6Z A;  3MC9 A;  5DCN A;  1JWS D;  3P63 A;  2WDR B;  2KWU B;  1L2N A;  3N1X C;  1QQR A;  3PVL A;  1V9J A;  3ETR A;  3UIO B;  1E7U A;  1IPG A;  3B2G A;  2L0F A;  3CMM B;  1GUA B;  4A6Q A;  2XN9 C;  3IG3 A;  4WWO A;  3ZUN A;  3Q3N C;  3RUI B;  2I38 A;  2WXF A;  2NTT A;  4PS8 A;  2WXQ A;  2HTM E;  2KAN A;  1N61 A;  4WWP A;  1WRD B;  1I7H A;  2RDB C;  4ZDV A;  3L4P A;  1EU4 A;  2FCM A;  4DBG A;  1J0G A;  2QJL A;  4YSY B;  2X38 A;  3NS8 A;  2Z0D B;  3D32 A;  3TL5 A;  1I4Q A;  2LWP A;  4MAC A;  3P42 A;  3VUW A;  4JPS A;  3VH3 B;  3AE1 B;  1K53 A;  2GI9 A;  1XO3 A;  2Q5W D;  2SAK A;  2ZZP B;  3AEA B;  1VDV A;  2M4N A;  3WAN A;  1OQQ A;  2M1M A;  5CHF A;  3ZW3 A;  4HRO A;  1OEY A;  4YWG G;  3UQA A;  1X1M A;  4MGY E;  4I6N B;  5LLI A;  2AYO B;  1WZ3 A;  3N20 C;  5BMG A;  1WXV A;  4RH6 A;  4J6I A;  3EC8 A;  2GOW A;  3K9P B;  2WXM A;  1JWU D;  1V1P A;  1LM8 B;  2OHF A;  4LNN A;  3ZTD A;  4B9K A;  4AOF A;  2D3G A;  4M0W B;  4PYU A;  1C4P A;  3ZNZ B;  3PV1 A;  3AE9 B;  3IAS 1;  3PHX B;  2N9X A;  4YTM B;  3WA0 A;  2C7M B;  1WFY A;  1WWT A;  2ZEQ A;  3NJT A;  3B0A A;  3DVN U;  1CZP A;  1B9R A;  1SSN A;  2K39 A;  3Q3O C;  4EZL A;  1Z5S B;  4GDK B;  2WHI A;  3UIN B;  4IWO A;  1C9F A;  3E56 A;  3FIL A;  2LGS A;  4XGA B;  2QIL A;  3ZDT A;  3Q8B A;  4IWQ A;  2NTS A;  2E3T A;  2Z8L A;  4W9K A;  4M0W A;  5AEK B;  1WMH B;  1FEH A;  1SIJ A;  2FE8 A;  1F52 A;  2RD0 A;  1XQQ A;  2KDB A;  3M62 B;  3MFG A;  1IBX B;  2GBM A;  1P7E A;  1FIQ A;  1YN5 A;  4ZRP A;  1SE4 A;  3T3O A;  5J18 A;  2PJH A;  1YQB A;  4KGT A;  4ZRJ A;  2XNA C;  1EF1 A;  2VRR B;  1I4R A;  3GP7 A;  4NQK E;  2Y5P A;  3GE3 C;  3VTV A; 
#chains in the Genus database with same CATH homology
 2CHW A;  4ASW C;  3PTF C;  3Q3J A;  1WM2 A;  3WAP A;  4TQ0 A;  4RM9 A;  5EDS A;  4IUM B;  1EO6 A;  4RMA A;  3KUZ A;  2LRW A;  2JZ3 B;  2N1W A;  2KQS A;  4I6P A;  4KSL C;  4HDQ A;  4DXA B;  1U4A A;  2CHX A;  4DWF A;  2KHW B;  1VD2 A;  2IBI B;  4E74 A;  3H7P A;  1WE7 A;  4DHZ E;  4GGQ A;  3TMP B;  4W9I A;  2C9W B;  4W9F A;  4NNJ B;  4ZRK A;  3VVW B;  1OTR B;  4AP4 C;  2I1J A;  5IA7 A;  2D10 A;  2AL6 A;  3QC8 B;  1V81 A;  2DZK A;  3ZIM A;  4CHK A;  1YD8 U;  2KX3 A;  2V4L A;  1V5O A;  4IM2 A;  3HM3 A;  3DBL I;  4B6W A;  2NCN A;  2O6V D;  2JT4 B;  3N32 A;  2KZR A;  3PLV A;  1E8X A;  2WYQ A;  2NPT B;  2LGD A;  3HM6 X;  5LXI B;  1ZGU B;  3VDZ A;  3DVG X;  4E71 A;  1WGD A;  1WZ0 A;  4W9D A;  2A4Z A;  4WAA A;  4G3X B;  4AJY B;  2HTH A;  2JVC A;  3OJ3 A;  3KW5 B;  4GSW A;  4F8C B;  1GC6 A;  3A33 B;  2WWZ A;  3NZU A;  3X23 A;  2DZJ A;  2IY0 B;  2C7H A;  5D2M B;  3U8Z A;  4ICV A;  4A20 A;  2IO3 B;  4X57 B;  2EMT A;  2YVC A;  1UD7 A;  5AZF A;  2L00 B;  3ZNH B;  3O65 B;  4HPL B;  3KVF B;  3L54 A;  1GJZ A;  3MJW A;  2DYM A;  4NY0 A;  3S2A A;  3U7D A;  4WJP A;  3ZNG C;  5J2R A;  2L8J A;  4BBN C;  1E5W A;  4GIV A;  1TTN A;  2CS4 A;  3HIZ A;  3NZS A;  3ZLZ A;  3H1U A;  1H4R A;  3DDC B;  5DPW A;  2IY1 B;  4XX5 A;  3NHE B;  2V3S A;  3W1Y A;  4LDT B;  1BT0 A;  4FHK A;  1RLF A;  1I35 A;  4W9G A;  3R7Q A;  3TJP A;  3NY5 A;  4IM0 A;  2B3A A;  4NQL B;  1H8C A;  2OJR A;  2N7E A;  4GU2 A;  2QHO A;  1CMX B;  4URK A;  3VXW A;  2BWE S;  1WI0 A;  4W9C A;  4B95 A;  2PE9 A;  4BKS A;  3PRE A;  2CHZ A;  1WY8 A;  3TCA A;  2K6D B;  3QAQ A;  4HDO A;  2NVU I;  4ICU A;  1IYF A;  4BKT A;  4KDL B;  1GNU A;  1KJT A;  4TV3 A;  4WQO B;  1IP9 A;  2LXC A;  4EOY A;  2BYF A;  3H7P B;  3A9K A;  4G50 A;  2BF8 B;  2C60 A;  2ZNV B;  2V1Y A;  3K9O B;  3KUD B;  1F9J A;  5KHO A;  1WJN A;  3JYU A;  1RFA A;  3JSV A;  1TGZ B;  2LRU A;  4EZJ A;  1C1Y B;  4DDG D;  2XK5 A;  2DAF A;  1S3S G;  4XZ4 A;  2MP2 A;  4TKN A;  4DDI D;  4GMV A;  3PLU A;  2FCN A;  4HCP B;  3GZN I;  2J0K A;  3VH4 B;  3M95 A;  1P3Q U;  1WH3 A;  3WIM A;  3MTN B;  3VFK A;  2NS5 A;  2AWT A;  3AI5 A;  2FID A;  2MBB B;  4M8M A;  2JF5 A;  2MWS B;  1V86 A;  4GOC A;  4F7Z A;  4NAW A;  1R4N I;  3CF6 E;  4AJW A;  1V6E A;  3ZVV A;  2XEW A;  5E6P A;  2KK8 A;  2ZVN A;  4EFO A;  2HD5 B;  4A3P A;  4LJP B;  4E3C A;  3A9J A;  5JHA A;  1XT9 B;  3UGB B;  3L10 B;  3A1Q A;  4ZYN A;  5HKH A;  4FBJ B;  2C5L C;  1OQY A;  1UH6 A;  4XC2 A;  1RRB A;  4FLH A;  2M0X A;  2RPQ A;  2FCQ A;  1Q5W B;  1WR6 E;  1WXS A;  3BY4 B;  3QAR A;  4BOS C;  2DHZ A;  1SGH A;  3PSE B;  1OGW A;  4WJQ A;  4BOZ B;  3OJ4 B;  4MGK E;  4WJO A;  2IO0 B;  2CU1 A;  1VCB A;  2IO1 B;  2KO3 A;  3GOE A;  4I6L B;  4MGZ E;  1UBQ A;  3T8M A;  3ZNI D;  3RZW C;  5CTR C;  2BWF A;  3JVZ X;  4HK2 A;  4CO7 A;  4YL8 A;  3T9L A;  2KKC A;  2WDT B;  4HCN B;  2PEA A;  1NBF C;  2D11 A;  1WXM A;  1ZW7 A;  2KWC A;  5CX3 A;  1C3T A;  2L0T A;  3DPD A;  5CHV C;  2N9E B;  2MX2 A;  2IZV B;  4GN1 A;  1Z2M A;  1E8Z A;  2XBB C;  3H7S A;  4EKU A;  2NR2 A;  2W9N A;  3DBR I;  2KFJ A;  3SD5 A;  2J7Q B;  2KJ6 A;  4P7I A;  2L7R A;  1HE8 A;  3U30 A;  3WAM A;  3X0W A;  4DK5 A;  4FJV B;  5BO4 B;  2PPH A;  2DYB A;  1T0Y A;  3W1S C;  2JUO A;  2J0J A;  2LVQ A;  2KVR A;  4A3O A;  2R2O A;  3KYD D;  4BVU C;  2LJ5 A;  3A9K B;  4KIK A;  4LDT D;  4EZK A;  4K7W A;  1WF9 A;  2GBJ A;  2Z59 B;  4MSM B;  4FAD A;  5C1Z A;  1ZKH A;  4JQW C;  1WJ4 A;  1S1Q B;  3Q3F A;  2ZJD A;  3APD A;  2G4D B;  5C23 A;  3LDZ E;  3JSV B;  1XD3 B;  3HK0 A;  4AUQ C;  2KN5 A;  2XK5 B;  2MQJ A;  3ECI A;  4IG7 B;  1WGR A;  4ZRI A;  2MP2 B;  2KMA A;  2BGF A;  4PYZ A;  2FUH B;  2KDE B;  3ONS A;  2JRH A;  3KH0 A;  3V62 A;  5AZG A;  3ZDM C;  4N9F 4;  2FCS A;  3BIN A;  4MGI E;  1OEY J;  2GMI C;  1WIA A;  3L16 A;  2MBQ A;  1K8R B;  1P1A A;  4NAW B;  1L7Y A;  4JIO U;  2OOB B;  3M63 B;  3DCG A;  3SDL C;  1Y8R C;  4IC7 B;  3OLM D;  2DX5 B;  1LFD A;  4ANV A;  3ZTC A;  3PHW B;  3PGE A;  4EUT A;  3RD2 A;  4ANX A;  3A9J B;  2CKH B;  3N3K B;  3A1Q B;  2G3Q B;  3UIP B;  2MSE D;  1SE9 A;  2KMC A;  3RUL A;  3P2B A;  2ZPN A;  2GBR A;  2K6Q A;  4IW0 A;  5JHB A;  1UBI A;  2O6V B;  2ZPY A;  4W9E A;  2KLC A;  2DZI A;  2KJR A;  3AUL A;  4DHJ D;  3A4R A;  3DBH I;  1WYW B;  4CYE A;  4NJ7 A;  3IVF A;  1TBE A;  1LXD A;  1YX6 B;  1WE6 A;  2M17 A;  2NBW B;  3B1L X;  4GB9 A;  3ZKJ C;  5DPT A;  1GC7 A;  1Q1O A;  1E8W A;  2K8H A;  1P0R A;  4MH0 E;  4FN2 A;  5LXH A;  4JLC A;  3V6C B;  4M8N A;  1NI2 A;  2J0M A;  2BKF A;  4HXD A;  2KD0 A;  3IFW B;  2MA9 B;  4MDK E;  2LGX A;  2FNJ B;  5DCN A;  2JXX A;  3KUC B;  2ZCB A;  1WX7 A;  3V60 A;  2KWU B;  2G45 B;  2A5U A;  2KDF B;  3UF8 A;  1L2N A;  3PVL A;  1V9J A;  4GDL B;  4HWI B;  3UIO B;  1WGH A;  1E7V A;  1MG8 A;  1J19 A;  1IPG A;  1E7U A;  4BBN F;  4NJ6 A;  2RSU A;  1JRU A;  2L0F A;  2DZM A;  1WGY A;  2REX A;  3CMM B;  4PS7 A;  1J8C A;  4DHZ B;  2JWZ A;  1GUA B;  1I42 A;  4TQ1 A;  3PT2 B;  4NPN A;  3VTW A;  1EUV B;  4MM3 A;  2BPS A;  3IG3 A;  3QA8 A;  3PRM B;  4WWO A;  1E8Y A;  2RGF A;  3ZUN A;  1WX8 A;  2NBV B;  4KIK B;  2LVO A;  3C0R B;  2Z0E B;  4MJS A;  1UEL A;  1V2Y A;  3RUI B;  4GXB A;  1YIW A;  4HPM B;  2LZ6 A;  3ALB A;  4PS8 A;  3VUX A;  1GG3 A;  3PS6 A;  2KDI A;  3PZD A;  5E6N A;  2BYV E;  2GBK A;  4KV2 A;  4HVB A;  3OAW A;  5G55 A;  2O6V A;  2KAN A;  3QX1 A;  4HJK A;  2KNB A;  4WWP A;  1WRD B;  4K1R B;  3V6E B;  4ZDV A;  3APC A;  3PPA A;  5KHQ A;  3ENE A;  2FCM A;  4IM3 A;  3WAL A;  2MBE A;  5D7G A;  4BKS D;  4ANW A;  4DBG A;  1J0G A;  1KLV A;  2GBN A;  2ZNV C;  1FXT B;  2UYZ B;  4FJY A;  4IWP A;  4MSQ B;  2LI5 A;  3NS8 A;  2NBU A;  1SIF A;  4W9H A;  3SHQ A;  1AAR A;  2Z0D B;  4GDK A;  5DPS A;  3D32 A;  4G0N B;  3TL5 A;  3DVG Y;  1P98 A;  3LJ3 A;  3UQB A;  2LAS A;  2LWP A;  5DPR A;  4HLE A;  5AZH A;  4GDL A;  4II3 B;  3VUY A;  3VH3 B;  3VUW A;  3QCA A;  4W9L A;  2KJH B;  2DYO A;  2K1F A;  2KC2 A;  1WGG A;  1G6J A;  4LJO B;  2ZZP B;  4KDI C;  3DOW A;  4ANU A;  2HE7 A;  1WMH A;  2M4N A;  3EFU A;  3EHV A;  3HHM A;  3WAN A;  1WR1 A;  2C7N B;  2JPH A;  4BKG A;  2DAJ A;  2EMS A;  3DQV A;  2M1M A;  5CHF A;  3ML8 A;  3ZW3 A;  1OEY A;  3AXC A;  1WX9 A;  3VTV A;  3UQA A;  1X1M A;  4MGY E;  2N7D A;  3VTU A;  4I6N B;  5LLI A;  2AYO B;  2KTF A;  2KFK A;  2AEH A;  2UWQ A;  1WZ3 A;  2LD9 A;  5D94 A;  1YJ1 A;  1WXV A;  3JW0 X;  2MLB A;  3RCZ A;  5L95 C;  3NOB A;  3AU4 A;  3DVN V;  4J6I A;  3EC8 A;  1LQB A;  2GOW A;  3K9P B;  2Y5B B;  5TR5 A;  4II2 B;  2M8S A;  3VHT C;  4K7U A;  3I3T B;  3TIX A;  1LM8 B;  2IO2 B;  4BFR A;  5FR6 A;  1WM3 A;  2ASQ A;  3ZRC A;  3ZTD A;  1V80 A;  2CR5 A;  2KTR A;  3A4S C;  3PRZ A;  2D3G A;  4AOF A;  4B9K A;  2MBO A;  4K81 A;  4M0W B;  3WAO A;  4PYU A;  2O2V A;  5D6J B;  3V61 A;  4OVU A;  2EKE C;  3QQ8 B;  3W1S A;  4RM8 A;  3TBL D;  1A5R A;  3ZNZ B;  2LUE A;  1WJU A;  2BYE A;  4MJS B;  3PV1 A;  3L08 A;  2LGY A;  5IAA C;  3MHS D;  3VAW A;  3PHX B;  4PS3 A;  2KC1 A;  2N9X A;  4FHJ A;  1P9D U;  4WWN A;  3QHT A;  3WA0 A;  2C7M B;  2KWV B;  1WFY A;  2ZEQ A;  3B08 A;  2KXJ A;  1UZX B;  2YLM A;  2I1K A;  3B0A A;  1PQS A;  3DVN U;  3ZO5 B;  2BKR B;  4AWJ A;  1UGM A;  4FA6 A;  3AU5 A;  2N1V A;  4KVG B;  4FUL A;  3KYC D;  3ZRF A;  5G2N A;  2K39 A;  2RR9 A;  4EZL A;  1D3Z A;  3APF A;  3VQI A;  5J17 A;  1Z5S B;  4GDK B;  2AL3 A;  2JRI B;  4KSK C;  1Q0W B;  4JGH B;  3DBS A;  1EF5 A;  3UIN B;  4IWO A;  3R3M A;  5JZE B;  3L17 A;  3QIJ A;  2KQ7 A;  1NDD A;  4K7S A;  2WX0 A;  2D07 B;  3RYT A;  4OVV A;  4KZC A;  4FJZ A;  1R4M I;  3ZDT A;  2FAZ A;  3L0W B;  4EEW A;  2KLG A;  2NPT A;  2L76 A;  5CHW A;  5L83 A;  2LVP A;  4IWQ A;  1KM7 A;  3EEC A;  2ZCC A;  2JZZ A;  1V5T A;  3IBE A;  3ML9 A;  5GMV A;  2JY6 A;  3CST A;  4W9K A;  3PRP B;  5AEK B;  1WMH B;  3H6N A;  4W9J A;  2RD0 A;  1TZ1 A;  3RT3 B;  1QZE A;  1XQQ A;  2KDB A;  3M62 B;  2IYD B;  1WJ6 A;  4JL9 A;  4WJN A;  3M3J A;  2KX0 A;  2ZVO A;  1WXA A;  3SU8 X;  2GBM A;  2L05 A;  3QJZ A;  1YX5 B;  4MEL A;  2MCN B;  2KFK B;  2PE6 B;  4LCD E;  3CSF A;  4G11 A;  4DHJ B;  4KZ0 A;  5J18 A;  2PJH A;  1YQB A;  2K25 A;  2MRP A;  4ZRJ A;  3R7R A;  2WX1 A;  2KOX A;  2MBH A;  3QWZ B;  5JH5 C;  5E6O A;  1EF1 A;  4MEM A;  2VRR B;  2G4S A;  3L13 A;  2MW5 A;  3N30 A;  4NQK E;  3R66 C;  2R2Q A;  2DEN B;  2KTR B;  3RZF A;  1ISN A;  1E90 A;  2D2Q A;  2K8C A;  1RAX A;  2K8B A;  4TUU A;  1KOT A;  2LXA A;  2O2V B;  2N4F A;  1V49 A;  3H9D A;  2L3Z A;  2HJ8 A;  2FIF A;  3IHP C;  4F1S A;  2N9P C;  1M94 A;  3QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...