1TTQA

Tryptophan synthase (e.c.4.2.1.20) in the presence of potassium at room temperature
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
256
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Exchange of K+ or Cs+ for Na+ induces local and long-range changes in the three-dimensional structure of the tryptophan synthase alpha2beta2 complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Carbon-oxygen lyase
total genus 92
structure length 256
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1995-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ttqA00
3UPWA 1FXQA 3AJXA 5F4XA 3L9CA 3ABSA 1OFPA 1JVNA 1Q6RA 3GVGA 3HPSA 5G4EA 4CCEA 2X1RA 5HWJA 1YPFA 3Q2DA 4Q4KA 3P8JA 2CFFA 1B4KA 1KM3A 1F6PA 4NNAA 3LBMA 4UMBA 1CX9A 2Y70A 3THAA 4NQ1A 1SO6A 1UJPA 4M19A 2VFGA 1P4CA 2NX1A 5DBUA 3SSJA 5D2YA 3LV6A 4O52A 2UV8G 4DPQA 3BLEA 1W8SA 2NWSA 4NVTA 3G24A 1M7OA 1HG3A 4O8RA 1V7YA 2P1FA 4WXZA 3W87A 1VYRA 4IX2A 1H63A 4XKYB 1XBYA 1XI3A 3KRZA 3AO0A 4IJBA 2GJNA 1WQ5A 1OX6A 3I65A 1H7WA 1SU5A 3S0CA 3HMJG 4CQAA 3UQNA 1F05A 2ISSA 2ZRYA 1O4UA 1W5NA 5E93A 1H7RA 1L6YA 1TPEA 1LBFA 1KFKA 1TQJA 1LOQA 4DF1A 4BI5A 4MKNA 1MZHA 2X1UA 1OFOA 1HL2A 1OHLA 3QMSA 4NJGA 3EX4A 3GXPA 2B7OA 3GXNA 3FEMA 1GVFA 3HB9A 5CGQA 3EWBX 1DJNA 4Z1CA 1K8XA 4GUIA 1PVNA 2WSQA 5DELA 3TE9A 4U28A 4GNJA 2B7QA 1H50A 1KM5A 5KMYA 4Q33A 4EF9A 4CCDA 2J88A 4YCPA 1SW0A 5IBXA 5I3GA 3EXRA 3NQDA 2ZCGA 3LRLA 2VC6A 4AHQA 2Z0IA 1H51A 1FY6A 3FJ6A 1KTBA 5HUPA 1OFBA 1SW7A 4I9AA 3GR7A 3P7YA 3TW7A 1D3GA 4ZQOA 4NNCA 3O6CA 2ZFAA 3QYQA 1K03A 2A7NA 3CB8A 3DU0A 4JXCA 3EB2A 3R12A 3NDOA 4O1DA 2E5CA 4H3DA 1A5AA 4JY8A 1H7PA 4I7WA 4LNYA 1KBIA 2H6RA 4LY8A 5AYXA 3TX9A 3ZS4A 1K3UA 2GVLA 3MBFA 1VLIA 5HR7A 2BX7A 5F2GA 3N2XA 1TRIA 1F2JA 4J9JA 3O15A 4AB4A 3SW6A 2DORA 4MPQA 3FS2A 1KFLA 3NQ6A 4JNMA 5EKYA 4E2BA 5MHBA 2BLEA 3TQ0A 3MHUA 2VFHA 1R2SA 3TSDA 4EF8A 1AL7A 1TQXA 3NQ8A 3NL3A 3KVKA 1Q6QA 3O06A 1ME7A 1YTKA 4JTLA 2HMCA 4LRSA 2O7QA 3DXIA 2RFGA 1C9DA 2GVGA 3BG9A 1H5YA 4FNSA 3CQ0A 3LCLA 3U2OA 2VOMA 2WV8A 4MY9A 2E6AA 4JYFA 1XXXA 1M6JA 1LRTA 3BW4A 4K8HA 1EP1A 1WOBA 4NXSA 4A3UA 4DO4A 2XN2A 4KFPA 3TJLA 3W1XA 1LLZA 3LLFA 3GNDA 5CSSA 3HGSA 4NJJA 3C61A 4I7VA 1RVGA 3LHVA 4UC5A 1GVRA 1ME8A 3G8EA 5A8GA 1DVJA 2QAFA 4H6KA 3S42A 2BZNA 3GB6A 4UMAA 3THQA 3SY5A 1Z42A 1FQ0A 2NX3A 4LV9A 1ZHAA 3MBDA 5EA9A 3QRHA 3NL6A 2J9ZA 1XBXA 4O0KA 4MZ1A 4QAIA 1SSDA 2B0MA 4O19A 4DEFA 4LT9A 4RZ5A 4IPIA 1O5KA 3B03A 2BXVA 3FYPA 1SW3A 2V5BA 4WOZA 3B04A 1XBZA 3LHTA 3W1NA 2C18A 3KAOA 2PCQA 1XKYA 3S1XA 5F2IA 1OYAA 3HG2A 3GNNA 4S1FA 1DL3A 3SECA 4IXXA 5KZDA 2PURA 1A5CA 3GYEA 4ADSA 5LSMA 1ALDA 4O18A 2C16A 3TAKA 5LNSA 2F7FA 1VYPX 3VE9A 1W3NA 1JRBA 4FO4A 4JTTA 2PRLA 5TQLA 5HNRA 2QKFA 5EY5A 4YXGA 3GKFA 3A22A 5D03A 1YADA 2CLEA 4TO8A 1YDNA 5IM51 5D30A 1TPVA 4FXSA 3B0VC 3G1VA 4A22A 3C0JA 5I3JA 3GDRA 3OEXA 5LZLA 3SI9A 3DENA 2ISVA 3CLMA 3QH2A 4WOQA 3TR2A 1DBTA 2EHHA 3LGEA 4FEZA 1SZGA 1THFD 3KRUA 3W88A 3TK7A 3PY2A 1X1OA 4M6PA 2OT1A 5CZ0A 1OF6A 2Y85A 4GWEA 3O8AA 4FX7A 3ATZA 4XBSA 5K9CA 1KA9F 4TX9A 4OU1A 3IGSA 3W3OA 3ABOA 4DELA 1YDOA 3GX9A 1NVMA 5HR6A 1EX5A 1Q45A 3NQ2A 4OV9A 4WZHA 4XQ6A 5K9XA 3W73A 4FXRA 1LP6A 3DZ1A 3MMTA 1FCBA 5H2ZA 5CZJA 2ABBA 3MI3A 2Q8LA 3MI2A 4XBKA 1VLWA 6ALDA 4NJHA 4MOZA 3KFTA 4JTSA 3IIVA 1SO5A 5AHIA 1OVDA 3L65A 5F1UA 3SFKA 1ZCOA 4LRTA 3TFXA 3QZEA 1JULA 2YW3A 4UFMA 3P62A 4LOCA 3NVTA 3D0CA 1WYIA 3BARA 2XFWA 4LS0A 4YWIA 4BWLA 1ICQA 2I14A 2NZLA 4WQ6A 3C2RA 1KLZA 1PIIA 2Z6JA 5D2TA 3MI6A 4U4MA 1TV5A 2Z2UA 1IGSA 1Q6OA 4O53A 1UUOA 1TIMA 3HG4A 5HULA 3W1RA 3PC0A 2QCFA 3W07A 2J9XA 2DJXA 2NUXA 3UYCA 4IWWA 4OHQA 4A2SA 1JCLA 3LLDA 1IXOA 5CG7A 2ATMA 1FXPA 4E0CA 1XDMA 5J5RA 1T99A 2V8ZA 3NL2A 5SWUA 3N19B 3HOJA 1DJQA 3TDFA 1H60A 4LS2A 4K7VA 4IPJA 3L0GA 2JBMA 4MZYA 1EIXA 5TBOA 3DFQA 4JTUA 1GEQA 5BRBA 1ME9A 5D37A 3JS3A 4R34A 3C4UA 3EX3A 2E6FA 3A5FA 3DFTA 3W6YA 3G1FA 5HQEA 1CI1A 4WXYA 2ZYFA 3OVQA 3ATYA 3WJYA 4ZL1A 3TU9A 1L6WA 1QO5A 3PS7A 5GVJA 3G1AA 3EX6A 5AFDA 1FCVA 3G0XA 2YXGA 3ZWSA 4FNRA 4Z0SA 3G18A 1PL9A 1U83A 2CLKA 3WJZA 3WJXA 4E38A 1GQNA 1RZMA 3TAOA 1SO3A 1D3HA 3Q94A 5D32A 1YTEA 2HSAA 3R2GA 1U5JA 3WFAA 3FLUA 2NV2A 1R46A 1QNVA 3W2NA 1AW2A 1OK4A 3MWAA 3IV3A 3A21A 1LBLA 3O63A 3NOEA 5DLCA 1ICPA 1K8YA 3CEPA 3PUEA 1LZOA 4I7UA 3S5OA 3UZJA 3NPWA 1XCFA 4RK8A 3TUUA 2PRHA 4PH6A 2G97A 3L66A 1ZAJA 5TIMA 2YW4A 4K38A 5HWNA 3QEZA 3BV4A 3HG5A 4JTGA 1L2UA 4LC8A 4ZQMA 2H3BA 1QWGA 5L9FA 1W5OA 4O0ZA 4DF0A 4Y96A 2ATSA 1P5BA 3ANYA 4OWGA 5LNWA 3RU6A 2Y7GA 4Z1DA 1SFJA 1TJRA 1VPXA 3QF0A 3KXQA 2OCZA 3S9YA 4BF9A 2OMAA 3R89A 3NPXA 3C3NA 2DZXA 3M5XA 1EA0A 1X1ZA 2Z6IA 3LCFA 3L68A 2ZA2A 3EEGA 1V5XA 1A50A 1M5WA 1W3TA 4E2DA 2QCCA 3FYOA 2V0TA 1NFBA 3CIWA 3IGXA 4NX0A 3SIZA 4GFSA 1NF7A 2NXGA 4DBEA 1YLVA 2PC4A 5BW6A 3G1SA 4Z1BA 5AHMA 4UR8A 4O11A 2YFNA 3W7OA 3DGRA 3NYZA 1KM4A 2Y7DA 2YZRA 1WBHA 5EYWA 3USBA 3TXVA 5LNUA 4O4VA 4UNKA 3TQVA 1PCKA 1GYLA 3LXAA 5EPDA 1G6CA 3EX1A 2JGQA 1RR2A 4LVFA 2P10A 5LKYA 1EPXA 3VNDA 2DZVA 4UTTC 5EMUA 4WY0A 1YYAA 2OX1A 4LWWA 3W70A 3NG3A 3L21A 1F6KA 1JRCA 2E6DA 3KVLA 3N3MA 4JTJA 1JCNA 1IIGA 2VEMA 4ML9A 5CPOA 4QNEA 3STGA 1JJKA 3U6WA 1FDZA 3DAQA 4RZ4A 3N9RA 1BWLA 3KVMA 4AEOA 3CTLA 1KLYA 4LS1A 2EKCA 3L5MA 1VHCA 4PL2A 4AMAA 3WK0A 1H61A 2V81A 3M43A 3W1PA 3W9ZA 1ZAIA 3C52A 2P0OA 1XUUA 2DZWA 5KSWA 1G4EA 4JDBA 5FI8A 3OBKA 4M6VA 3QM3A 1I4NA 5F4SA 3EX2A 3KVJA 5EBUA 3F1QA 4CNNA 1RD5A 3CU2A 1I2RA 3PVFA 3QW3A 4G1KA 2WNQA 4N9EA 4WJEA 4JTKA 3BW2A 1T0OA 1FDYA 4R53A 1W5QA 4O1CA 8TIMA 5G5IA 2AAMA 2A7RA 3UWYA 4EOUA 2ZZ3A 4RJEA 4HNUA 1VHNA 4N02A 1MEHA 1OFEA 4WY0B 3KHJA 1OABA 3W74A 3TMQA 2TRSA 3MJYA 1QOPA 5HUOA 4YCOA 3SZ8A 3CHVA 1TRDA 3N34A 4O10A 1FUYA 2WSYA 3TIMA 3PG9A 1GJPA 4BK9A 1OX4A 3C2FA 3FKKA 3UD6A 4A2RA 2E5BA 2GQ8A 3OHIA 1XM3A 3QSRA 1FWRA 1SSGA 2A0NA 2FLIA 4LUIA 2A6NA 1BEUA 2YFOA 4N4QA 3FA5A 2TYSA 3LERA 2X1TA 4RX0A 2A2IA 3S1UA 3L0KA 3M7WA 3UNDA 4WD0A 3BLIA 1L6SA 1EUNA 2X16A 4IMCA 2YYUA 2EF9A 1ZAHA 5DY2A 1LRNA 1XDLA 5DCEA 1G67A 1JUBA 4ZQCA 5LNRA 5F2MA 1XL9A 3DFPA 2V30A 3C56A 4O57A 5LGZA 1TPH1 4JEQA 1OYBA 3GLCA 2GQAA 5FEZA 2RDTA 4DF2A 5HMSA 3LX9A 4A29A 4K8EA 3UY8A 2ZTJA 4KWWA 1SZNA 3PBUA 4H4IA 3M5YA 3LI0A 5D33A 3W1AA 4GUJA 4JTHA 1FX6A 2VKZG 2J9YA 3BG5A 2CLIA 1LYXA 2QJHA 5DN1A 1NSJA 3W7QA 2V2DA 3PB0A 1GT8A 3HGJA 1KFCA 2QJGA 3TROA 3IGUA 1A5BA 3NM3A 2EGZA 4N4PA 3IIOA 5D05A 1G7UA 1UCWA 3HGOA 3G1DA 4UTWA 5KTLA 1WBJA 1R2TA 3P82A 1GVOA 5LNVA 3OVPA 1HO1A 4MFDA 3F03K 1AMKA 1JQVA 2TPSA 3RFAA 1BTMA 1GTEA 4ZZ9A 3E0IA 3V1PA 5CPNA 3I6RA 3ELFA 4MUZA 1KFBA 4HNVA 4UTJA 3G3DA 4UNLA 1VQTA 4FNTA 1TPFA 4O28A 3M41A 1RQEA 4LVDA 4KKXA 1KBJA 3TW6A 1NAL1 4WX2A 2CLFA 1RV8A 3DI0A 4K6AA 2GJLA 3LHWA 5A5WA 2DZSA 4L4MA 1MO0A 2R8WA 4YL2A 3RK8A 3G1YA 4LC6A 3P84A 2NXIA 3WK1A 3OG3A 1H7NA 4O1BA 3G3MA 3B06A 3EKLA 4FX6M 2CLLA 5AHLA 5CPMA 1QMLA 3U8GA 4ALDA 5HJLA 1VCVA 3W84A 2ZZ4A 1TB3A 3C6CA 1KV8A 4BI7A 1WV2A 5C55A 1KV5A 2ZRZA 1I2OA 4GE8A 2Y7EA 1VRDA 2WNZA 3PSVA 2G96A 3C2EA 2A6LA 3NXFA 4R33A 2A4AA 1GG1A 3NA8A 3NQFA 2ZZ1A 3IVSA 4IMGA 4FNUA 3L5LA 5J5DA 3LOTA 1IIHA 4JICA 4UFLA 1I45A 3GDTA 3W7GA 3M6YA 2Y6ZA 3PULA 1F74A 2DZTA 5AOUA 1IF2A 4O54A 2X2GA 4O16A 3NAVA 5DXXA 4FNQA 3B8DA 4P2VA 4GRSA 3R13A 1KFJA 4JYDA 4MY8A 5FEWA 5AC7A 5DCBA 3M16A 1W0MA 3QPZA 3LCHA 4DO6A 3MO7A 3PBWA 4ZQPA 2OT0A 1TJPA 3HF3A 3H55A 5D04C 3NZRA 2NUYA 4HHPA 2XN1A 3M5ZA 3NNTA 3DFNA 4JS3A 3QC3A 5AYZA 1Z48A 3M44A 4GXMA 4NNBA 1IXPA 4RR4A 3OIXA 5AHFA 2ZDRA 2BWGA 2QCDA 3QMRA 3LCGA 4M7TA 1W5MA 2R94A 1HFBA 1LBMA 1XUZA 4X22A 2FPYA 2QCHA 3P8IA 4O17A 1YTDA 2B7PA 3HQ1A 1KTCA 2QCEA 2YYTA 4FIQA 1TMHA 4UTMA 3LI1A 1WXJA 4PFMA 2CZ5A 3W2KA 1FWTA 3LTPA 1VGAA 2ZRXA 5CKSA 1ZY9A 3W75A 5IBXC 3EWUA 2RDWA 1LORA 5K3VA 1H7XA 1C29A 4LVGA 2Y63A 1KW1A 1O94A 2O7SA 4AWUA 3BPWA 1I2NA 1FWNA 3SGUA 3FIGA 4Y9AA 2Y61A 1SQ7A 3BLFA 4PODA 4QIUA 3MP4A 1OG0A 2D73A 2QUTA 1B3OA 1N55A 5CPLA 3T44A 4JTIA 1TTIA 2H3DA 3S6DA 1WX0A 2B4GA 3N14A 2F84A 4UFIA 4PEKA 4PCFA 3GDMA 4OQVA 3GR8A 4NJKA 3NZ1A 1S5VA 4O14A 3H53A 1LCOA 1TPDA 4HPXA 3V75A 2WO5A 3E96A 3T40A 3UPBA 3M5VA 5I3IA 1GVSA 2FFCA 1IXQA 2VFIA 1PHWA 3W2MA 4JTFA 1C8VA 4D2JA 1HTIA 4POCA 5FEXA 3FKRA 4K39A 1FDJA 4KWVA 3P80A 3EKZA 1KM1A 3WK3A 3W1TA 3MHFA 1F5ZA 5FEPA 1VS1A 3UXAA 1FCQA 1F7BA 2R14A 3NQAA 5LHEA 2VEIA 1UUMA 3NQCA 4A21A 1KTNA 2Q3RA 1YXCA 1H1YA 4S2CA 2Q3OA 2GQ9A 1VCGA 3R5EA 2ZRVA 2V9DA 1WA3A 2HTMA 2QCMA 2GUUA 1EB3A 2E1DA 3PUDA 4RCXA 1WOAA 2H8XA 2EAWA 3DFOA 4HIBA 4N2YA 2R91A 2YR1A 1B4EA 4MJZA 6TIMA 2QUUA 1W5PA 3W1UA 5D02A 1H1ZA 2B7NA 3I7QA 4OT7A 3O16A 1X8FA 3F4WA 5D2XA 3G22A 5L6UA 3ZWTA 5FF3A 5I3KA 3C8FA 3TSBA 4QNWA 5AC8A 3SGZA 4JTEA 5I3FA 3GDLA 1RQBA 3KRSA 3P81A 1J4EA 1ONRA 1VZWA 2ZZ7A 4UIOA 4W9TA 1LTDA 3VCRA 3W22A 4JX5A 5C5YA 3K30A 4KFOA 3HIJA 3UWVA 1TPWA 5U7SA 1UASA 2G5WA 5EL1A 2A1YA 3W7DA 5FESA 1VCFA 2YDAA 1F73A 2KZHA 2A7PA 1PE1A 3TFCA 3NQGA 5FF4A 3W83A 5D2VA 1GOXA 1EWEA 2FJKA 3GK0A 3P5YA 4JYEA 2V5LA 4RZ6A 3L5AA 3HJZA 4WUIA 1JR1A 1W56A 3ABQA 4NXKA 3CEUA 4FX8A 4HKPA 2ALDA 1R2RA 1J5TA 5I3HA 3NEVA 1QCWA 1DKWA 1LOLA 3TC6A 1TYGA 4DQWA 2ZA3A 4ONVA 1LLWA 4K37A 4O1AA 2V82A 1TPUA 3W7KA 2V2HA 3UY7A 4O15A 3GIYA 4TMBA 3STFA 2QDHA 3CT7A 4UTLA 3O6YX 3STEA 1TPB1 3N2MA 4MLJA 1G69A 3PWAA 2E6YA 3SR7A 1AL8A 3L2IA 2FDSA 1SZEA 4NUWA 4RXFA 3PB2A 3C2VA 1TTPA 1G4SA 3PR2A 4XTIA 3CIXA 3DKJA 5KZEA 3QMTA 2QUVA 4LW7A 1T8XA 4IMFA 3EWXA 4UXDA 3S1VA 5AYYA 1DV7A 2X30A 1Q3NA 4OBTA 4LVBA 5CZTA 3UZ5A 1TTJA 5DCDA 3QJAA 3FJLA 5FF7A 4PA8A 2PE4A 4ADUA 3G1HA 4AWTA 3LHYA 2Y88A 1G4PA 4N6FA 4AWSA 4RLIA 4MY1A 5E1QA 1KM2A 4Z0JA 1AG1O 3M47A 3N9SA 3W2LA 1SZFA 3LRKA 3UWZA 3TQKA 3W7NA 4HSOA 1TSIA 2JKEA 3TNOA 3L0NA 5HINA 3E12A 3QFEA 2NWRA 3ZFHA 4YMZA 1W37A 2DZUA 3S5ZA 5C54A 1QO2A 1Z41A 2QDGA 4XWUA 2NV1A 4FB7A 3QSTA 1R30A 1BWKA 4C1LA 3GZ3A 4JIQA 5U4NA 3A23A 4BWLC 1GYNA 2I1OA 2NXHA 3UWUA 1PS9A 3PBYA 2Z1BA 3WJWA 2A85A 2C6QA 3TH6A 3PG8A 2LLEA 4PL1A 2CWNA 4XUGA 2CZFA 1JCYA 3UWQA 1QPOA 1YPIA 1O5XA 1P0KA 1ZNNA 3TCEA 4MIMA 5FF2A 1S3HA 3LXBA 3VE7A 3EXSA 1SFLA 3LHZA 4DPPA 1T96A 1OFDA 3KX6A 1TCDA 2QCLA 3LRMA 2W0UA 3HBLA 3W7LA 3WJSA 3W1MA 1KM6A 4HPJA 2GOUA 2YCEA 5FF0A 3EXTA 2ZZ6A 4JN6A 3E02A 5K4ZA 1QPNA 3M9YA 5ABTA 2HS6A 3BGJA 1F76A 3NPUA 1OF8A 3DKLA 3I7RA 2JK2A 3TA6A 3E9AA 3BVJA 3W1QA 4Q32A 2RKXA 4GUHA 4O12A 3PM6A 4O50A 4X2RA 4X3ZA 2QAPA 4TMCA 3INPA 3MP5A 1AW5A 3DI1A 4JR5A 5G2HA 3TJXA 4CQ8A 1N8FA 2VXNA 4PTNA 4UMCA 2QCGA 2YSWA 5F1VA 1ZFJA 2ZQ0A 3IRDA 1VC4A 3PSWA 1FCUA 4S2BA 5D38A 3W7EA 2J27A 5DBTA 3M1ZA 3NQ7A 4TIMA 4ZVJA 3NR0A 4IUOA 2CZEA 2ZRUA 3BW3A 1N7KA 4GJ1A 3TMLA 2X1SA 4EWND 2ABAA 1W31A 1GTHA 1MXSA 4MLRA 1FBAA 1SO4A 4Y90A 3HO8A 4AF0A 2WOQA 4QM1A 1I2PA 1YXYA 1LRQA 1ZENA 1X6UA 2BTMA 2OJPA 3VFLA 3W85A 2YX0A 3NO5A 2CLHA 4BFAA 2C0AA 1P1XA 4DBDA 1ICSA 1YXDA 3W7HA 4GBUA 1HUVA 2NUWA 2WNNA 2FB2A 2FIQA 1ZJIA 5AN7A 3NQEA 3GAKA 1OX4B 3CC1A 4PC8A 3EWYA 5K4XA 3NPVA 1OK6A 2PRMA 4K36A 3N73A 4CLMA 1GG0A 5K7JA 3MYOA 3LCIA 4IGHA 3P67A 4AHOA 1RQHA 2QEZA 3MHGA 3NGJA 5K2ZA 1OJXA 1EP2A 1SUXA 1MEIA 3KOFA 1TV8A 3F4NA 3E49A 1FWWA 2A21A 2C3ZA 2FQIA 4FNPA 4XTDA 1NEYA 4KFNA 3RF9A 4NU7A 3IIXA 4Z1AA 3Q37A 2WQPA 1OFAA 3M0ZA 2EPHA 3I68A 1PCWA 3UWWA 4MJMA 1ZALA 2CU0A 5DXYA 4AF0B 4JX6A 4LVAA 3IVUA 3YPIA 4GUFA 2E77A 5DY3A 3NQVA 4ZQRA 3IVTA 3CWNA 1B9BA 4HNTA 1NF0A 4UFKA 3RNDA 1QPQA 4JD4A 4M6QA 3LHUA 1TPC1 5AHNA 1A5SA 1S5WA 3NM1A 3O05A 3B4UA 3P60A 4BI6A 5G2WA 4EVZA 3HPZA 3HG3A 4L4LA 5CSRA 1GZGA 5D09A 4RV8A 4UUIA 2FTPA 5CZSA 3DHFA 1UBSA 3B0PA 4HN4A 2FPVA 3IEBA 3TC7A 5D2WA 1Y0EA 1JCMP 4HSNA 4AH7A 4QQ3A 2ZBTA 1TO3A 3FOKA 2VFEA 3HPXA 2QJIA 4CNPA 2NLIA 4Z08A 1SR9A 1K02A 3LB0A 3LBCA 1B57A 1X7FA 2VFDA 4ZMGA 5BNKA 4JDYA 3T78A 1DQWA 1R47A 1K7FA 4UTHA 4ZQNA 1JUEA 3EWZA 2C1HA 3T7VA 2ZTKA 1W54A 3OVRA 2YPIA 1GWJA 4NT0A 2Q8ZA 4HNNA 4CQ9A 4R7JA 4OE7A 3T55A 2G95A 3BO9A 1S5TA 1FWSA 2JGYA 1VJIA 3W7JA 1A53A 3S5YA 1TTQA 3I7SA 3LDVA 1O95A 1VH7A 2VFFA 3LV5A 5LGXA 1GVQA 5G2IA 3RLUA 4O13A 4UCGA 1PHQA 3SJ3A 1BKSA 3W2UA 2QR6A 2DU2A 3P5ZA 2WKJA 2Y62A 4BR1A 3TV8A 2W6RA 5C6MA 4M7SA 1EWDA 2WPBA 4EIVA 3FFSA 2FPTA 2CW6A 4OGZA 3W7IA 4XZ9A 1J2WA 5KITA 5F2LA 2ISWA 4IX0A 4AHPA 1E51A 4M5PA 4AAJA 2YGYA 1K8ZA 4X9SA 4O4WA 1ML1A 1WDWA 2XN0A 5E0KA 3ABRA 2RH9A 2H8ZA 1CW2A 2VEPA 1DORA 1G7VA 3BGGA 3LCXA 3W86A 2NX9A 5G4WA 1OFQA 3G0UA 3S1WA 3RMJA 4UR7A 3NQMA 3LCWA 4GC4A 5BOOA 3A24A 3UXDA 3TXZA 4YLWA 4UTTA 2E09A 4MYAA 1UB3A 4LV4A 4WY0F 3QQ1A 4CCCA 2QCNA 3OA3A 1SPQA 2W79A 5HWMA 2V2CA 4RXGA 2IQTA 2VELA 1EEPA 3G1XA 4LTSA 2ZZ2A 1EUAA 2VENA 4QSHA 1QAPA 3A5VA 4NZFA 4FIRA 3LM7A 4TR9A 2J24A 4JY9A 3GDKA 3VKJA 1JQXA 2QCDB 3RLVA 1W3IA 3BG3A 2HS8A 1L9WA 2GVJA 2J6XA 2RDUA 4QITA 4Y6GA 3P61A 3PAJA 4UTWC 5LHFA 3EWWA 2DZPA 3L67A 2RHGA 2A5HA 4AXKA 1AK5A 4CNOA 3VI2A 2TSYA 1D9EA 4UTUA 1LOSA 1GPWA 1G4TA 2GPTA 3G0SA 2E68A 2CLMA 3CM4A 3B0UX 1HO4A 2E5DA 2Y7FA 3LTYA 2DP3A 1QOQA 4LUJA 7TIMA 4IMDA 2JKPA 2ZA1A 4N9CA 3W23A 1K7EA 5AC6A 1KFEA 4UFJA 1QR7A 3NL5A 2Y89A 4Y8FA 1LM1A 2TMDA 1YDVA 1VYSX 3W7RA 3PUOA 1I2QA 3LTSA 1XFBA 4C1KA 2CLOA 1AW1A 1OFRA 2AQWA 2C19A 3IIPA 3CPRA 3DFSA 2WSRA 4IXHA 4JGDA 1MEWA 1Q6LA 4ORMA 1XBVA 3A9IA 4IQLA 3C2OA 5BMXA 2C15A 1DQXA 2VEKA 3LXCA 1Z44A 1M7PA 4JX4A 1OYCA 3S5NA 1MSSA 4OV4A 5H91A 4UTIA 1JUKA 3QPYA 1IXNA 4N9DA 3QW4B 3O1NA 2ZZ5A 4FHAA 3GXTA 4MFEA 4UTKA 3MUXA 3MP3A 1K7XA 4LU0A 4UFHA 2WJZA 5G1TA 2JKAA 2H90A 2OZ0A 2C14A 5KZMA 4HT3A 1LDCA 1VR6A 3H54A 5C2XA 4ADTA 3Q58A 1W1ZA 1RPXA 1KM0A 3P74A 1O60A 5BMWA 5T26A 3TSMA 4FF7A 3W76A 1H62A 2C13A 3R8RA 4JIPA 2QF7A 3MYPA 3W7PA 4MVAA 1QPRA 5G1YA 3G8RA 1TV7A 4B5NA 1OX5A 3WK2A 2BSLA 4DO5A 3W71A 4RKAA 1LROA 4IMEA 1WAUA 2FB3A 3IIZA 4DXVA 3PF3A 3PBVA 1JCXA 1TREA 5F4WA 1JCJA 3JRKA 5AHEA 3W7CA 3GAYA 1XC4A 4ICNA 4MYXA 1H7OA 1PV8A 4NX5A 1DHPA 4NJIA 3QQ0A 2I9EA 2ZRWA 3W72A 3BK0A 3JR2A 5K9DA 1I8JA 4MZ8A 2AGKA 3DH7A 3B05A 4TU1A 3T4CA 1DOSA 3W1LA 2CZDA 3DBPA 3CWOX 3TKFA 1QFEA 4AVFA 1P0NA 4XKYA 4N9BA 3GKAA 1QDSA 4QISA 4P61A 1ADOA 3O07A 4NZJA 3W7MA 4QJ1A 4ORIA 3MW7A 3STCA 3W2JA 1EP3A 4N6EA 5KINA 3DHDA 2DJLA 3HGRA 4K7YA 3ZR4A 5AB3A 3S8HA 3O6DA 4GUGA 4IOTA
chains in the Genus database with same CATH superfamily
4QRNA 3U4AA 3AJXA 2VRQA 4MWAC 3CASA 1OFPA 1FFQA 2B81A 2GWGA 2VJXA 2WK2A 2X1RA 5HWJA 2Z7KA 3Q2DA 3VKAA 3SAZA 4M24A 2F9RA 4UMBA 2YJQA 4XIMA 2BFGA 1CXFA 5EMYA 3THAA 5HDRA 1SO6A 4LUSB 2VR2A 7TAAA 4D1IA 1UD5A 4GXPA 4XISA 4MF4A 2ZUWA 4EACA 2CETA 1GQIA 1VJZA 3G24A 2OEJA 3KDNA 4WXZA 3NSMA 3KRZA 2GJNA 5FD0A 1H7WA 1E71M 4KS0A 4CQAA 1BYCA 1F05A 1RBOB 1VFFA 2ZRYA 4L6DA 1XD1A 1O4UA 3GHRA 1H7RA 4HPHA 2PZNA 4U33A 2BOGX 1LOQA 3GNPA 2PLJA 2VURA 3QOKA 1XLHA 4A3QA 2X1UA 4DJFA 5AKQA 4O1FA 1BHGA 3CZEA 4NJGA 1OIFA 2B7OA 3GXNA 3H6OA 4CN4A 1B5TA 5CGQA 4AUBA 3SSZA 2DSUA 1W6TA 2DZBA 2J8GA 5DELA 2PWDA 3TE9A 2YBVA 3E0LA 1UZHA 4O8AA 4L64A 4Z2HA 2D0HA 3OLDA 1XP3A 4YCPA 5I3GA 3EXRA 2I57A 3LRLA 1L8NA 2CKRA 4Q8UA 3SURA 2XISA 4CNUA 2VOTA 1UR3M 1EPVA 3FJ6A 2IPJA 2JIEA 1OFBA 4I9AA 3P7YA 1UKSA 1XRTA 3APGA 2HPMA 2NSXA 5HJYA 3G6MA 2V5DA 5LIUX 3NDOA 2DT0A 1A5AA 4JY8A 3VOJA 4LNYA 3TX9A 1CYGA 4PE8A 4AZ5A 3SFWA 3A4JA 1TRIA 2YL5A 3O15A 4FPSA 1HN1A 1KFLA 3GNOA 2BS9A 1AJ2A 2ADAA 4Q8NA 1Y5VA 3MHUA 1R2SA 1FHLA 2C91A 1OADA 3O06A 3KL0A 2O7QA 2VL4A 4U3CA 2RFGA 4E6MA 3W25A 2D23A 2WV8A 5GPRA 4MY9A 1LG1A 2E6AA 1OWQA 4IP5A 1LRTA 3BW4A 3FK4A 4NXSA 4DO4A 3VIPA 3TJLA 3GNDA 1WB0A 9CGTA 4U10A 4NJJA 2YA1A 1RVGA 3LHVA 4ZFCA 1GVRA 3G8EA 1DVJA 4H6KA 3S42A 2YA2A 2HBVA 3URBA 3THQA 3SY5A 4QS5A 3VIIA 3H2AA 3VOHA 3NL6A 2J9ZA 1XBXA 1SFTA 4UTFA 2ZX6A 3D6NA 1M41A 4LT9A 4IPIA 2WLZA 2P0IA 3FYPA 1J0YA 1SW3A 1U1HA 1ENUA 4LAUA 3OJGA 2NQ5A 1PWMA 3BMXA 1TV4A 3RPDA 2VC5A 1BXBA 1RVKA 3HG2A 3GNNA 4S1FA 1DL3A 2VUNA 2FFIA 6CGTA 3GYEA 1X39A 5LNSA 1W3NA 1JRBA 1P0EA 5D8ZA 4F66A 2PRLA 3QR1A 2QKFA 3ARWA 4EPDC 3GKFA 3A22A 1NOWA 2F2HA 2YDSA 3AZSA 1TPVA 2FHFA 4FXSA 3VNMA 3UNTA 4HOWA 3U7BA 5LZLA 5A69A 3V35A 5IFPA 1PDZA 1HVXA 3IS4A 1WKFA 4WOQA 1PKLA 1MUWA 1QHOA 2EHHA 3UETA 5CC3A 1SZGA 3IUDA 2OZ3A 3PY2A 2OT1A 3B0XA 3OLEA 1OF6A 1UOKA 4TV6A 3L4YA 4XBSA 2C1GA 1QW9A 3SRHA 3OYXA 4TX9A 1XGDA 1QJWA 5AYBA 4IQJA 3ABOA 4KRTA 4ZBCA 1UH4A 1EX5A 2WCGA 5DRIA 4J7RA 1NWRA 1LT7A 3WQ5A 3P3BA 5H2ZA 2Q8LA 2ABBA 3FNDA 1GOKA 4L1XA 3LPFA 2WJDA 3KTXA 3L2MA 4ATWA 5EMKA 2ZWYA 4RE4A 4PUKA 3V5FA 5HK4A 3SFKA 2OYMA 1ZCOA 3WD0A 4IIFA 3MKVA 4LRTA 3TFXA 4PRTA 2UBPC 3WLPA 4P8XA 2PDLA 4LB4A 5A1AA 3P62A 1XGZA 3NVTA 4ZOCA 1WYIA 3UEQA 4YWIA 1ICQA 4WQ6A 2QIIA 3FVDA 3C2RA 2PDWA 1KLZA 1PIIA 4Z2GA 2Z6JA 1KCXA 3MI6A 3A3XA 1S3TC 1TV5A 4L80A 1FKWA 5I0DA 3LNPA 4DNMA 2OYLA 3HG4A 5HULA 3W1RA 2XGBA 3WMBA 3W07A 1V51A 1JD7A 4HZ8A 1RSCA 5CG7A 3AISA 2VWTA 1DWGM 1IQ8A 2WMIB 3DBNA 4IPJA 2GDUA 3QFWA 4HN8A 4W7VA 4R27A 3JS3A 7ODCA 1HKMA 1SJAA 3EX3A 4FLQA 5GJNA 1OGGA 1M7XA 4GH3A 4DO7A 2DUXA 3AU2A 3UZZA 2FVMA 2G8ZA 2IKHA 2EPNA 4KGJA 4IQEA 4DUXA 3ZWSA 4LYQA 3G18A 2REQA 4GQGA 4XSMA 4WJXA 3SADA 2Z1VA 4GZJA 4OIFA 3FGCB 5DRCA 3CV6A 3OG2A 5D32A 3WLRA 4HU4A 2Q71A 3RO8A 3IJIA 1T6MA 1OK4A 3MWAA 5HPOA 1U5HA 3WDIA 4Q8PA 5I3DA 3W27A 1KXHA 3CEPA 4I7UA 3NPWA 3TUUA 1E72M 4PUEA 3R0DA 4PH6A 4KWUA 3CLWA 4K38A 4A3HA 5HWNA 3QEZA 4U2ZA 4GYJA 4D6DA 1VB9A 3CUZA 4DF0A 2ATSA 1UR4A 2YXOA 2DFAA 1SFJA 3KXQA 3S9YA 1CDGA 3NPXA 3C3NA 1F4AA 2E9MA 2X1IA 2FGLA 3EEGA 1V5XA 1UR2A 3AXMA 2Q8XA 3DOPA 4E2DA 5BYWA 2PFHA 1NFBA 1S5NA 3CIWA 2DSKA 2IW0A 4NX0A 4GFSA 2NXGA 3B4YA 3OOQA 3PPHA 4S3BA 2YFNA 4CGTA 3R4IA 4GKLA 2Y7DA 1WUEA 5EYWA 5LNUA 3VX0A 4O4VA 2NVDA 1DPMA 1BGAA 3SUVA 1G6CA 4TQTA 3H24A 5LKYA 1XG3A 3MV01 2CNCA 2VD9A 3B9DA 2GYIA 3KCJA 5EMUA 2XFYA 1JXJA 1F07A 4J35A 4XD6A 3CQKA 4LGXA 1A3HA 2QYGA 3W70A 1V4YA 4M80A 1F6KA 1XCWA 3QOMA 3EDDA 1W3JA 1JCNA 5C9RA 1GUVA 4F2UA 5CPOA 4QNEA 5KEZA 4H9UA 2ASHA 3ARRA 3CQJA 2VR5A 1BWLA 3N9RA 3T0BA 3CTLA 3L5MA 1B31A 2ZICA 3M43A 1ZAIA 2WHKA 2P0OA 1EL3A 1RJQA 4M6VA 3OBKA 1I4NA 3F1QA 5HNTA 1RD5A 3PVFA 3E0FA 3NZGA 4WJEA 4HZMA 4JTKA 3GH5A 4R53A 7REQA 3GSMA 5LIYX 2AAMA 2A7RA 4V27A 5RUBA 4RJEA 4HNUA 4FSAA 2D69A 4Z42C 2R1KA 1NDYA 4F48A 4YCOA 1VD6A 2PDJA 1MFVA 3CHVA 3OODA 4H7VA 4B9ZA 1FUYA 1E9ZB 2G37A 3GVVA 4R9OA 4H8NA 3PG9A 2Y5SA 1RBLA 5I2UA 2O4MA 3WX7A 2CERA 4IP7A 3UD6A 4ZE4A 2NVAA 5XINA 2E5BA 3GTFA 3QSRA 4PSRA 5XIMA 4FR6A 2A0NA 2YFOA 3FA5A 4KEUA 2ZUUA 3THCA 3AU6A 4CN1A 1ITUA 3LPPA 3AOFA 2X16A 2YYUA 1UW9A 4D6IA 1EHNA 5A8PA 1G67A 3C3UA 5F2MA 3DFPA 1JAEA 2I16A 1UIOA 3AIQA 3WYZA 3K4AA 3CYJA 3UFYA 4HBKA 2ZTJA 2PDYA 3LLXA 4JFVA 2J47A 4CVUA 3W1AA 4JN8A 4GUJA 4JTHA 7ENLA 4DZHA 4H19A 3O3RA 3KWSA 1NSJA 3SCVA 2Z2AA 3WUFA 1T5AA 4TVCA 3W7QA 1BLIA 1C8QA 2FVKA 1PXGA 3M0LA 3TROA 5E9XA 3NM3A 4B90A 1EKOA 1R2TA 5CPSA 1QI5A 4WJ8A 1JQVA 1XSIA 1UMYA 1BTMA 3U57A 4GH1A 4H6RA 3V1PA 5ABFB 2E7FA 2ZX7A 3CMGA 4ZXLA 2QJMA 4IPPA 1LJYA 1TPFA 5CBJA 4DIAA 4I9MA 3LSBA 1EC9A 3COTA 4LVDA 1KBJA 3TW6A 1NAL1 2VC9A 2DY3A 3WBEA 3NDZA 3KOXA 1KKRA 1Z3NA 2WM1A 3BANA 2ZADA 3GBDA 3VIHA 3QY8A 5C0QA 2PDFA 2DZSA 4L4MA 3IJLA 3N4AA 4YL2A 3F2DA 3OA5A 5FCZA 4W8LA 3RK8A 1V6XA 4I9TA 2NXIA 1S2AA 5A6BD 2R82A 2D2HA 4DLFA 4JPGA 5AHLA 3AFBA 3ARVA 3GUWA 3VZXA 2OQLA 2RDXA 3P14A 3DX5A 1WV2A 3GHTA 2VWSA 4WRHA 1O1HA 3C2EA 2A6LA 1UWAA 2HXUA 1JF5A 4WKFA 3L5LA 5J5DA 2JQXA 3VIKA 3GDTA 3UZXA 3M6YA 1IR2A 5BROA 3PULA 3LUTA 3URQA 2FGBA 2TODA 3LENA 3WZ0E 3CL6A 2X2GA 1J0JA 3EWDA 3CUFA 1KBLA 2Z26A 3R13A 4PMYA 4N0RA 3QPZA 3MO7A 4ZQPA 1V77A 3H55A 1ADDA 4QG8A 3NZRA 2ZKMX 2V3GA 1Q6FA 1CB7B 4NNBA 3M44A 3OGSA 4ZEPA 3OIXA 2ZDRA 2BWGA 1K8CA 1UD3A 1KBKA 3WH8A 1W5MA 3F4VA 3PTDA 4H7CA 3RCYA 1E1CA 3LBOA 4F40A 1YTDA 2B7PA 3QY7A 1E0XA 4GZIA 1YE4A 1CXLA 4A3YA 1WXJA 3VX1A 4US6A 1WDSA 5M3WA 3ICJA 1PUDA 1ZY9A 2RDWA 5FOOA 1VF8A 5K3VA 1YMYA 4LVGA 3OZPA 2G3NA 1V03A 4HNOA 3FIGA 2BG5A 3BH4A 1EOKA 4ZB0A 3BLFA 2HJPA 3O6AA 1B3OA 4JBRA 1W1TA 4JTIA 4WF7A 1J93A 3OB8A 3KTCA 1O68A 1WKDA 3N14A 1C3FA 1TZ7A 1Q6GA 3DECA 4PCFA 3GC2A 1S5VA 2OGJA 2Z2BA 1U33A 4IGNA 5IHSA 1LCOA 5JBFA 4KRUA 1RP9A 4KPLA 2WO5A 3E96A 3M5VA 1MNSA 2Z1WA 2OTDA 2VFIA 1DJGA 3FSUA 4RE3A 5CLWA 1FWBC 1QT1A 1HTIA 3BGAA 3TCSA 1WDDA 5HQLA 4JCMA 4PMVA 3O9NA 3GIQA 2DH3A 3W1TA 3MHFA 4JHZA 5CH9A 1F7BA 3U0HA 2Z25A 1UA7A 2V67A 2Q3RA 2ONEA 2PWEA 3QQWA 3MT1A 4H9ZA 1VCGA 3R5EA 4JHMA 4CQBA 4PSPA 1JZ6A 2V9DA 1RJRA 4BQ2A 1HKKA 2QCMA 4C5ZA 4XD4A 2E1DA 4C6QA 3L4TA 4Z2JA 4Z1YA 3DFOA 4HIBA 2VEFA 3MB9A 4PMDA 4MJZA 3W1UA 3C2YA 2B7NA 3GH4A 3ITGA 4DM1A 3F4WA 3MMUA 1S2WA 4FLSA 5I3KA 3N04A 3TSBA 5AC8A 3L4VA 3ME3A 3S2CA 1AUSL 3BAJA 3VNJA 3EDKA 3WUEA 1U1JA 3AXHA 1ONXA 1ZBWA 1UJQA 4MGGA 1SJDA 2DW7A 9XIAA 4R9XA 2HNEA 3K30A 2A79A 5A6MA 1TPWA 3GM8A 5EL1A 1E6NA 3K4WA 4W86A 4DYJA 2YDAA 3ARTA 3ZJ8A 1A5LC 2VR4A 1TE1A 2KZHA 1V79A 2PLMA 5FF4A 1Q6DA 3W83A 1GOXA 3RRAA 3ARUA 3H22A 2VX5A 2IKJA 4JYEA 3AS2A 4RZ6A 1W56A 4NRRA 1TWDA 4Y8EA 4NXKA 2ALDA 4AY8A 3AMCA 3RX4A 1R0MA 1LOLA 1D8WA 2V82A 3PN8A 3KS5A 4O15A 2L5HA 4TMBA 3ARYA 4RPPA 5FJRA 2ZUMA 1TPB1 4MLJA 1G69A 1UUQA 3SR7A 2GWNA 2JE8A 3VUSA 3L2IA 1P48A 1G5AA 1PX8A 4NUWA 1XLBA 1XX1A 3MKCA 1VENA 5DO8A 1R3VA 3QMTA 2PDXA 1QI0A 4IMFA 1A5MC 4UCFA 2Z28A 3M46A 1DV7A 4OBTA 5CZTA 4F2BA 1TTJA 5DCDA 1ISVA 4PTVA 4UR9A 1N82A 4QROA 3ONBA 3G1HA 5MKGB 2DUAA 2Y88A 1RCOB 3PWGA 1Y5XA 4AWSA 1YRRA 3TYAA 2E9LA 4RLIA 4JTAA 4MY1A 5E1QA 1B3XA 2PDKA 3M47A 1SZFA 3TQKA 3E0VA 1TSIA 2VQTA 4IL2A 3DFHA 5GNZA 3NDYA 3T42A 3R7MA 4JOMA 4LYPA 3BURA 3D5HA 5C54A 1GW1A 3R6IA 1GQJA 3P0WA 3QSTA 4C1LA 4JIQA 3WDPP 1V3LA 5TNVA 5U4NA 4BWLC 3VDGA 2IQ0A 3VDHA 2LLEA 1H2JA 4XUGA 1JCYA 3T8LA 4U5IA 1TA3A 1QPOA 3VPLA 2V38A 4H8VA 3TCEA 4YVXA 4MIMA 5FF2A 4CVWA 2OOFA 5LA1A 1CBGA 3AS1A 5CZKA 3ZSTA 4JNYA 3FX4A 3AHYA 4AG0A 3AYSA 2V63A 3JU2A 1OFDA 3LRMA 3HBLA 3WJSA 3W1MA 1NTHA 1KM6A 2GOUA 1C92A 5FF0A 3UJEA 1XGEA 2XWEA 3PZGA 5ABTA 3CO8A 3BGJA 3BSGA 1X1NA 3NPUA 2EQDA 1BYAA 4LUTA 4QE5A 3W1QA 3O7UA 4Q32A 3EGJA 5AZ0A 4EE9A 3PM6A 1VBGA 5HMEA 3BLOA 1GW9A 3H4GA 3MSYA 3AYVA 4U31A 2VXNA 5A2CA 5JVLA 4W87A 1AFSA 3PSWA 3T2OA 1Q5MA 4DYEA 3W7EA 2J27A 3SBFA 4JQ3A 1C90A 4JKMA 1FWEC 4KGLA 3NR0A 4DJFD 2CZEA 1E1EA 2P76A 4BKNA 2J8FA 2X1SA 4LANA 4EWND 4OTKA 1W31A 3T09A 3QLLA 1PTAA 2OR2A 2XPKA 4QM1A 1YXYA 1ZENA 4B5WA 2BTMA 3AHZA 5D8WA 2HVOA 1A3WA 4PMJA 4BFAA 2CCRA 2C0AA 2GDQA 1YXDA 1HXJA 1YE6A 2DT3A 4B5UA 2WNNA 3S2NA 5AN7A 3GAKA 3FY1A 4C6JA 3CC1A 4PC8A 3NOYA 4D6GA 1OK6A 2PRMA 2GSHA 3E74A 1GG0A 1P43A 5K7JA 3ZOAA 1DTNA 4AHOA 1RQHA 4FLOA 2XTKA 1EP2A 1SUXA 4DJED 2ZXBA 3UP8A 2E8YA 2PWFA 3VIOA 1EXBA 2YCLB 3KS6A 4DVOA 1PKMA 1GPFA 1MYRA 5JIPA 1TJ2A 1K70A 3H4XA 3VO0A 1E56A 3UWWA 3UW6A 3TTEA 2CU0A 1DXFA 1TKKA 4Y9NA 1JPHA 3QV8A 3IVUA 4GQQA 3YPIA 1NF0A 4UFKA 2PUZA 2ZE3A 3WNMA 5AHNA 3V7PA 2X0SA 4NRSA 5D09A 3N17A 4UUIA 4HGXA 1E43A 4HN4A 1UBSA 3AXKA 5D2WA 4AH7A 2ZBTA 3OBEA 2BOEX 2VFEA 5ABGA 4B16A 2NLIA 1L0PA 4I9JA 3LB0A 3HN3A 1M01A 2P8CA 4UTHA 4D6FA 3HURA 2POTA 2ZTKA 2NT0A 3A9BA 1GWJA 1PAMA 4NT0A 2X7VA 4HNNA 1K77A 3W7JA 5I77A 1A53A 2ZVRA 1TWWA 1C9WA 2HK0A 3SCRA 4NF7A 1VH7A 3EB3A 2FH6A 3APYA 3GVQA 4QHRA 3RLUA 3ZR5A 1BRLB 3EPNA 1CB2A 1BKSA 2QR6A 4UZSA 2Y62A 3TV8A 1DWFM 4H7ZA 3FHAA 2WPBA 3VOGA 1BF2A 2OLAA 4EIVA 4NZ3A 4OVXA 4KCTA 5F2LA 4IX0A 3TN4A 3TYDA 1XYAA 4AHPA 4M5PA 1XW8A 1JIBA 1AODA 3WDQA 1RCXB 1ML1A 5BU9A 1XH0A 5E0KA 1UIPA 2RH9A 4HZ7A 1W9BM 1CW2A 4U3AA 3LCXA 3TN5A 3S1WA 3BCFA 4CCZA 5AECA 4XZHA 3SQLA 1TX2A 3VILA 2GJXB 3VOIA 2E09A 3VIMA 4MYAA 1VFHA 3NO3A 2OQHA 2VGGA 1EO5A 1XS2A 2CHNA 4GX9A 1IEIA 4I3GA 3N11A 4GIYA 2V2CA 4RXGA 4PRRA 1NDWA 1V02E 4PULA 2VELA 4LTSA 5FJPA 2MANA 4PUNA 1KXQA 2PD5A 2ZZ2A 3TEVA 4FR1A 3GC5A 4DWDA 4NZFA 3TYBA 1FHUA 5J8LA 3LM7A 4TR9A 3W82A 3PAOA 2J24A 5HXMA 4JY9A 2DPEA 5AC4A 2CESA 1W3IA 1AQFA 1JFXA 3ABXA 4QITA 3GRIA 1UA3A 3N6QA 4C5YA 2WZMA 1Z9AA 2ZWZA 1JI1A 1AK5A 2J7DA 4CNOA 3TZFA 4I5UA 4CQCA 2J7CA 1LOSA 1GPWA 1G4TA 3G0SA 3SY1A 2E68A 1P7TA 3U5YA 2XVLA 2QF8A 2GGJA 3LU2A 2E5DA 1DJYA 2QULA 2WKLA 4LUJA 1K9TA 2WZIA 5CJMA 1B3WA 5LIXX 3F2CA 4MPKA 1M53A 4FOJA 1X96A 4PCTA 4Y8FA 5I7GA 1M65A 1EA9C 5CBIA 4QJ5B 3LTSA 1XFBA 1AW1A 1JL8A 2XVPA 4O1EA 1IWBA 1TUFA 4JEJA 1XBVA 5AZ1A 2VEGA 1RUSA 2HE5A 3VD5A 1RJPA 3WBXA 2CZVA 1Z44A 5A2BA 4R5EA 3CNYA 4IMAA 1UZDA 4YNGA 3EMCA 1O12A 3REQA 1H09A 1OCNA 4MFEA 1ZLPA 1P7TB 1FWAC 4LCSA 3DFYA 1UWIA 3IRSA 4LU0A 2JKAA 1ELSA 1PWLA 4IJRA 1AQ0A 1UWSA 3VYLA 3NQBA 4HT3A 1SVDA 5TD4A 5REQA 1HZYA 5BMWA 4HYVA 3ARXA 2WM0A 3W76A 1MNZA 4Q8QA 2PDNA 3HPFA 3RGTA 1Q8JA 2E67A 3MYPA 3L7RA 2FZNA 3S46A 2Q09A 1OX5A 2DIJA 2PWGA 3KBNA 1HJSA 4NAEA 1QI3A 2FB3A 5A8NA 4XV0A 3ALFA 5F4WA 1JCJA 5AHEA 3W7CA 4NZ4A 3GAYA 4MKSA 4WSKA 3WBYA 5C7HA 1R85A 2I9EA 3W72A 1Q2RA 3NWRA 2AGKA 1ZUAX 4HTBA 4ZOBA 2YA0A 3DG6A 1Y7VA 2CZDA 3DBPA 3TKFA 1QFEA 4AVFA 1P0NA 4N9BA 4K1WA 5JQ9A 3GKAA 1XRVA 4NI3A 1ADOA 4G7EA 4NZJA 4QJ1A 3L4UA 3MW7A 1UD8A 4DWSD 1J12A 1HX0A 2DJLA 4HNCA 1F6YA 4K7YA 1JPMA 2PP1A 2PCEA 4IOTA 2C79A 2NVCA 3VMOA 1FXQA 3E0WA 2PDGA 4MB3A 1E3ZA 1JVNA 4JNZA 1Q6RA 1WE5A 3WBAA 3L4ZA 2WB5A 2J77A 3P8JA 1S46A 2CFFA 3CHCA 4DWSB 5AC5A 3XINA 5HQMA 5CPTA 1QASA 1HVQA 3VGHA 2Y70A 3CHEA 3DYMA 4M19A 2VFGA 4HQVA 2NX1A 1IWAA 5D2YA 3LV6A 2UV8G 4DPQA 3BLEA 3UPMA 2INEA 2IMRA 1EIBA 3AZTA 1QK0A 4GISA 5I07A 4OOZA 1AD1A 4XKMA 1CGYA 1AZ2A 3ORWA 4O8RA 3QY6A 4XUYA 2G41A 2QNEA 1VYRA 3M07A 3W87A 4IX2A 1XBYA 4A8NA 4LX4A 1NFGA 1XI3A 2O9OA 3K8MA 4IJBA 4GI4A 2VRJA 1SR0A 1MDLA 5DMMA 3ZXWA 2WMFA 3K8LA 3QGKC 3LMZA 3WMCA 1BTCA 1H41A 1JZ3A 1I6NA 1LBFA 4HSHA 3W01A 4BI5A 4MKNA 4J3SA 4YTTA 4HA0A 4W89A 1A0EA 3AIEA 4V2XA 3R94A 1HL2A 3PJXA 1OHLA 2YB1A 1EQPA 3FEMA 9RUBA 3TOPA 4JKLA 4BQ5A 3HB9A 4QFUA 1QOXA 3BLKA 1E73M 1K8XA 4IUGA 4GUIA 2WSQA 1OCQA 3A6OA 3WF3A 1ODUA 2BVTA 3ENLA 5I24A 1H50A 4Q33A 2NQJA 1TUXA 1XYFA 2XGZA 1QI4A 1W1YA 4NYYA 4AHQA 2Z0IA 2INFA 1S2UA 4HCLA 1KTBA 2ODOA 1EDQA 7CGTA 4D6HA 3GR7A 3CUXA 4CD7A 3O6CA 3WLLA 2ZFAA 4JTQA 1K03A 1RA0A 1Q63A 1DWIM 3DU0A 1JPKA 4JXCA 4UOJA 4O1DA 3URAA 4H3DA 1KBIA 2H6RA 4IIDA 5HR7A 5LXXA 3UG4A 3UVAA 4J3WA 1AH4A 3MSGA 4DBUA 5F2GA 1ZBKA 1F2JA 1K6AA 4J9JA 3PZVA 1IWPA 4PFHA 3SW6A 1B3ZA 2DORA 4MPQA 4JNMA 1PZ1A 5XIAA 2BLEA 2OB3A 1TMLA 1ITCA 2I17A 3NL3A 2VZOA 2J25A 4QG9A 3BQ5A 3DYOA 1YTKA 4GQ0A 3SUTA 3WD2A 3QTGA 3AALA 1I0DA 2HPIA 1H5YA 4FNSA 4H2CA 3LCLA 3U2OA 4PTDA 1EGVA 4JYFA 1L8PA 1E55A 4DXXA 4WDWA 1EP1A 1WOBA 3ITTA 1EDTA 4A3UA 4KFPA 4H04A 1U1UA 4B2DA 4FAMA 3FJ4A 2YZ5A 3GTNA 1U5VA 4YVPA 4I7VA 2Q6ZA 3ITXA 1ME8A 4RUBA 3V1HA 1RLCL 1I0BA 2BZNA 3GB6A 4QDMA 1FQ0A 1NOFA 5BWFA 5EA9A 3RLGA 1VPQA 3K4DA 3QRHA 3AHVA 2YL8A 1DJZA 1XIEA 2B0MA 2DVXA 4PR4A 3WO8A 2PD9A 1OSEA 4DEFA 1Q7MA 3VINA 1JAKA 1O5KA 1IZCA 1EZ2A 3B03A 3MY9A 4NI8A 4NIRA 3B04A 5IFTA 1BYBA 3W1NA 2C18A 1OZMA 3KAOA 2XH4A 3PUGA 2OFJA 3UG5A 3S1XA 1GOOA 1FWCC 4IXXA 5KZDA 2PURA 1Z7AA 8RUCA 4ADSA 5LSMA 1F3WA 3TAKA 2F7FA 1AJZA 2UZ9A 4UQ9A 5EY5A 1YADA 1XIDA 4TO8A 4Q22A 4A8LA 8CGTA 5D30A 3BOXA 4FP1A 3N12A 2UY4A 3N15A 2HK1A 2XWDA 2ISVA 4EXBA 2OWCA 5CJ5A 1DBTA 1THFD 4MNKA 2PWVA 1RY0A 3GH7A 3TK7A 1M1BA 3ID7A 3O8AA 1CECA 4FX7A 2PBGA 1KA9F 4A6GA 2WVTA 3SGGA 3W3OA 4L7ZA 2YL6A 1YDOA 3GX9A 1NVMA 3N18A 1MXGA 4FXRA 3TYUA 3DZ1A 4J4KA 3ANUA 2IPFA 1VLWA 3TA9A 3WQEA 1LWIA 2IS7A 4NJHA 2C1IA 2W66A 4OJYA 1IEXA 3IIVA 1SO5A 5AHIA 1RD6A 1US3A 2PDQA 3VNYA 4F79A 1JULA 3LPGA 2Z24A 3UT0A 1YW1A 2OGYA 4LOCA 4CEXC 4QJ4B 1KNWA 3BARA 2GVYA 3EPOA 4BWLA 2NZLA 5D2TA 1O7AA 2JEPA 2E0PA 3H2EA 1UUOA 3RRXA 1TIMA 1E0VA 2QCFA 2NUXA 2DJXA 2ZIDA 3WQ8A 5M03A 1AQMA 2QXWA 3MA8A 4LH8A 1JCLA 3ITLA 2XM2A 2ATMA 4E0CA 5M1TA 3KBMA 4MWAD 2GDVA 1UD4A 3NL2A 3HOJA 2CHRA 2FHCA 4M0XA 1K6WA 3TDFA 4LS2A 4K7VA 4MZYA 5CXPA 3UF9A 3C86A 3DFQA 5BRPA 4JTUA 1XWYA 5D37A 3W24A 2E6FA 3DFTA 4IIHA 1Y5WA 2VZSA 3MMDA 3POCA 4WXYA 3WJYA 1L6WA 1MZRA 2BXZA 1NWSA 2J7FA 3W28A 4KW2A 5IOBA 1HQTA 1CT5A 3AHXA 3WJZA 1SYTA 3WJXA 2WHMA 4Q4MA 4E38A 3TAOA 1XLKA 1UR1A 1UP2A 1D3HA 1W9UA 3IAQA 3K8KA 2QV5A 3EMQA 1MQRA 1XG4A 3GY1A 3R2GA 5FACA 2BB0A 3VZZA 1OZQA 1U22A 4GYKA 2YCIX 1XYZA 4GJJA 2Z1SA 3KBVA 1QNVA 3W2NA 1ZS2A 4OUIA 1W32A 3A21A 1LBLA 4LF1A 4PBGA 5I5RA 2ZX8A 1IE7C 5EMLA 1N8IA 1WZLA 2P88A 1LZOA 2WVVA 4RK8A 1ISYA 2G97A 4IG2A 2NQ9A 3RM9A 3BV4A 2VO5A 3LSCA 3DG3A 3MC5A 3SCQA 3VM5A 2C7FA 2H3BA 2OOGA 3UCCA 1VFLA 1QWGA 2QPUA 5JBDA 1W5OA 2H9AB 3F5JA 2A3EA 1P5BA 4C1NA 3VDBA 2PLKA 5E0FA 1S2CA 2OMAA 4OBRA 4PMUA 3M5XA 4JIIX 1X1ZA 4UB9A 3LCFA 5BXTA 1A50A 3B97A 3FYOA 4YN5A 2V0TA 3IGXA 3FXGA 3D3FA 2W91A 1HT6A 3G1SA 4UR8A 1TJ1A 4JHOA 3APTA 2HQAA 3IUIA 1UD2A 3USBA 1WBHA 4UNKA 4EP8C 3TQVA 1GYLA 5EPDA 4QX4A 3EX1A 1UWTA 2JGQA 2WXDM 4NP7A 1EPXA 1BAGA 2JEQA 5CG0A 3MCMA 5CGTA 2DZVA 4UTTC 1JF6A 1YNYA 1RHCA 3WLIA 2WVVB 5T8GA 1J10A 2YDQA 2AOSA 3A4XA 1JYVA 2OX1A 3EKGA 4LWWA 2FDMA 3NG3A 1JRCA 2X2YA 2Y8KA 3N3MA 4JTJA 3B8IA 5E5CA 1AMYA 2PGRA 4QR6A 1JJKA 3U6WA 3SUUA 1NQKA 3JW7A 3KVMA 4KT2A 5C9ZA 4LS1A 3LPOA 4PL2A 4XZNX 1KRAC 1XDJA 2FJUB 1HJXA 3CQIA 3W9ZA 5KSWA 4ERGA 4JDBA 5FI8A 3WD1A 1FWIC 3BMVA 3CUHA 2HV5A 1SMAA 5F4SA 3AAMA 4CNNA 3LNMA 3CU2A 1YBQA 5DMYA 1V7AA 3QW3A 1RPKA 1AD4A 2XH2A 3VOCA 3E3HA 6REQB 3N6JA 4OUEA 3T05A 4ENLA 1T0OA 1XFCA 1FDYA 1JYWA 3E1F1 1KGUA 5G5IA 3BAKA 3GXFA 3W38A 1VFOA 4N02A 1OFEA 3KHJA 3LZ5A 1OABA 4RW5A 2TRSA 3VU2A 5HUOA 1HNYA 3SZ8A 4XD3A 1TRDA 3EDJA 4O10A 5LA0A 4GY7A 1JZ4A 3FA4A 1M9HA 1M68A 4BK9A 2PTYA 1XYLA 2OZ8A 1OX4A 1AVAA 1B0IA 4A2RA 1O6IA 3I3EA 5A94A 5HBFA 2FLIA 4N4QA 2TYSA 4F2TA 3LYEA 3FN9A 1VFMA 1A47A 4FXJA 2QW5A 3M7WA 2ZXAA 3DUGA 4WD0A 5HANA 3ITCA 3HV8A 4J1OA 3MCOA 4IMCA 5DY2A 3NFUA 1LG2A 1LRNA 5DCEA 4PB3A 3UU0A 5LNRA 4ZE5A 1XL9A 3RN6A 1SFSA 5IHRA 2V30A 3UA3A 3C56A 4O57A 2VQUA 2ESCA 1TCMA 3CHFA 1OYBA 3GLCA 2GQAA 1BYDA 3PZNA 4DF2A 4DZ5A 1H1NA 5HMSA 4A29A 4IL0A 1R87A 4IF2A 3UY8A 2WKGA 4KWWA 3TTOA 1SZNA 4H4IA 3WMLA 3B8UA 4L4OA 3UJRA 1FX6A 2QJHA 5DN1A 3CH0A 4LBUA 3UJFA 1QW8A 2J7EA 3VGFA 3TYZA 2FGZA 3EA2A 2V2DA 1KQYA 1GT8A 3KEHA 3IGUA 4PGLA 2EGZA 1UYQA 4FALA 3IIOA 1UCWA 3H70A 4LFYA 1WBJA 3GBEA 5LNVA 5A8QA 3BOFA 1V0NA 3PFRA 4MFDA 1AMKA 1XLEA 3FSTA 4BEUA 1GTEA 5LIKX 5IRPA 3I6RA 1KFBA 4GCAA 1VQTA 2BGSA 4FNTA 3NXLA 3M41A 2TAAA 1PB0A 3U48A 4H83A 1M03A 1XYCA 3DCPA 4WX2A 2B31A 2CLFA 3DI0A 5A5WA 2DW6A 3WLNA 1FOBA 3IJ7A 1MXDA 3VDAA 4JTRA 1JYXA 2R1MA 4IT1A 3WK1A 3TYCA 4FX6M 4B9YA 1E40A 3U8GA 2PZ0A 1MW1A 2E4TA 1LL6A 3W84A 1QNPA 1KV8A 3RMEA 1DQUA 5KZ6A 5C55A 5D9MA 4HNLA 1Q6CA 1VRDA 4E4UA 2WNZA 2XFRA 3RXZA 1U30A 4X60A 3PSVA 2G96A 4G5DA 1FKXA 4R33A 2A4AA 1GG1A 3NA8A 2FTWA 1B1YA 2ZZ1A 1A5KC 2ACQA 3M64A 1IIHA 1QNOA 4E5TA 4JICA 1I45A 2DSVA 3AXIA 3E5BA 4BF5A 4WSHA 3VKDA 2O92A 4MADA 3TTYA 1DJIA 4XD5A 5A6KA 1XLAA 3MVIA 1F74A 1WP6A 1XIMA 1Z69A 5AOUA 3NAVA 5DXXA 2O56A 3B8DA 1EJVC 4P2VA 1ZL1A 3PBGA 3OBAA 2R1PA 5FJOA 3DERA 1KFJA 1V6UA 5FEWA 5DCBA 3TJIA 3BTNA 3M16A 1QK2A 1KO0A 3BOLA 1E5NA 3LQLA 1TJPA 4C65A 1US0A 3N3TA 5AYZA 2ZX9A 3ZVHB 1Z48A 4GXMA 4MTVA 3NCOA 1OG6A 4WK9A 2Z00A 2BDQA 2QCDA 3QMRA 1HP4A 3JUGA 4M7TA 1PEZA 1HFBA 1LBMA 4XZMX 4IFKB 3N2BA 3MSDA 4HK6A 1KTCA 5CC5A 1JDCA 4AZ7A 2CZ5A 4UQDA 4IIBA 1FWTA 3RAOA 4Q7IA 1X7IA 1HL9A 5CKSA 3W75A 2GK1A 4BHYA 1E0TA 1KW1A 1PDYA 1E1FA 4ZTXA 2O9PA 3BPWA 2WWDA 1PPIA 3SGUA 5CC7A 4Y9AA 1FHDA 3GNRA 2Y61A 4PODA 4J3VA 4QIUA 4RZBA 1N55A 1TTIA 2OXNA 4CU7A 2H3DA 1DJXA 1ZRQA 2B4GA 2F84A 2PP3A 3WELA 4DB7A 3GDMA 4NJKA 1A80A 4L1WA 3H53A 4XB3A 2BHYA 3LMYA 4NASA 1FP8A 3T40A 4AZCA 1GVSA 3AMGA 4LCRA 4AVOA 5HNUA 4C6LA 2V68A 4JTFA 1C8VA 2XIQA 5FEXA 4KWVA 4DX3A 2RUSA 1VEOA 1KM1A 3WK3A 2AAAA 5FEPA 1VS1A 4B5XA 2G0WA 3ARPA 2ZXDA 4KRZA 5CLTA 1S1RA 3NQCA 4A21A 4IQDA 1KTNA 2Q3OA 5HPCA 4FZIA 1WKEA 4KMQA 4GINA 1WA3A 3C0SA 1WOAA 2H8XA 2YR1A 3HTWA 4GY1A 4LAMA 1W5PA 4AQLA 1UKQA 4MKVA 2XG9A 3CBWA 5L6UA 3ZWTA 2J66A 3C8FA 2OELA 1BQCA 4F4RA 3SGZA 3RILA 4MB1A 3H23A 2D2JA 3CUJA 1J4EA 1ONRA 3H21A 4W9TA 1XLGA 1LTDA 3CL7A 3W37A 3MCNA 1K4HA 1EO7A 2GGIA 5C5YA 3SRFA 3UWVA 3EOLA 3K13A 1HKVA 5FESA 3BUVA 1T8QA 3RLHA 1F73A 3DHPA 1EWEA 2FJKA 3P5YA 1LQAA 1W2PA 5HNNA 4WUIA 3WEOA 1ODZA 3ABQA 4FX8A 3QXBA 4HKPA 4LEQA 4X63A 3AIWA 5D9PA 3HM7A 3KW3A 1DP0A 1HP5A 3NEVA 1QCWA 1DKWA 5HOSA 2Q01A 1W1B1 2QIWA 3SRDA 4DQWA 2ZA3A 4ONVA 4O1AA 3SN4A 2V2HA 3ZVIA 3V5OA 4O0QA 4F3HA 1KXTA 2QDHA 3CT7A 4QEEA 3O6YX 3W29A 4PMXA 3PWAA 3KZPA 3AXXA 3DGBA 1ZU8A 1TTPA 2I56A 3CWHA 3CIXA 1JNDA 3AHTA 4LYRA 1EH9A 3OYZA 3PZ9A 4PUWA 4GD0A 5CCZA 3S1VA 4I6KA 3EMZA 4UQEA 4JFWA 2J6VA 4LUSA 3QJAA 4M56A 2EG6A 3F4DA 1VEPA 1OC6A 3L12A 4AWTA 4REQB 4QLJA 1GQLA 3T4WA 1G4PA 4N6FA 4L1GA 4JL1A 3U3HA 4Z0JA 1AG1O 3N9SA 3W2LA 3RM8A 3W7NA 1B90A 3FEQA 3TN3A 3WNPA 3TNOA 3TTSA 1EJTC 2JALA 3ZFHA 5CAHA 3BLPX 4QP0A 3Q67A 1W37A 7A3HA 2DZUA 2OKOA 4F8XA 1Z41A 2PGWA 2QDGA 3GFZA 2NV1A 3W26A 4FB7A 1VRXA 2AMXA 3C0LA 3GZ3A 2SFPA 5J04A 3A23A 1YPXA 1GYNA 2I1OA 1XSKA 3WL1A 1NELA 3UWUA 3G5EA 4PMQA 3SRKA 3PG8A 1CZ1A 2OWXA 2CZFA 4YTUA 1YPIA 2FKPA 1RA5A 4FXFA 1GJUA 1QBBA 4GQRA 3LXBA 1E0WA 1SFLA 2YB4A 2ZUNA 2BVDA 4MHBA 4CUCA 3BE7A 4HPJA 4AY7A 5K4ZA 3PPCA 5MF5A 2HS6A 3GG8A 1HIZA 1ZP3A 2FZ9A 4WDTA 1OF8A 3I7RA 1YNPA 7XIMA 4FMVA 5IDZA 1D7KA 2RKXA 3ITVA 1VEMA 1BFNA 3WQGA 3QZ6A 2R9RA 4X9YA 3MP5A 3N9KA 1DXIA 1CWYA 4JR5A 3TJXA 4CQ8A 3U2EA 2G3MA 2OWWA 1B30A 4AY1A 2C8NA 2QCGA 1ZFJA 2P8BA 4ERIA 1GZJA 3UXKA 1XV8A 3THDA 3MUCA 5DBTA 3W81A 1AH3A 1XPYA 3GTXA 2PBOA 3LY0A 4A3RA 1N7KA 4GCXA 3TMLA 4JKKA 2ABAA 1UR0A 1GTHA 4Y90A 4AZIA 5H6HA 4AF0A 2WOQA 1IHIA 1LRQA 4UWMA 2HCVA 3EA3A 2EXOA 3BMWA 5TAOA 3P2VA 4NL1A 2YX0A 2CLHA 4P7QA 2GGHA 3OVGA 1SM9A 2NUWA 1GOMA 4V1YA 3EWYA 4Q4RA 3CHDA 1HKWA 1UWQA 3HU7A 1CPUA 2EKGA 3ZQ9A 3P67A 2QEZA 2Y5JA 2ZX5A 5K2ZA 2DVTA 1TV8A 4HPNA 2PTZA 3GZAA 3MO4A 1FWWA 2A21A 3VGDA 4Y9MA 2AKZA 3UYIA 1NEYA 4F0RA 4KFNA 1YQ2A 3RF9A 4AZHA 3WENA 1TMQA 3UGRA 1H0IA 3IIXA 3Q37A 2WQPA 3LA4A 3M0ZA 1F3TA 4TTUA 4QGCA 3IACA 3R0KA 2V6AA 4XZBA 2F6KA 1ZTVA 4AF0B 3RIKA 4JX6A 2XSBA 2WZEA 4GUFA 3NQVA 4JFSA 4C6EA 1QPQA 3AROA 4JD4A 4M6QA 1Q4NX 1RP8A 1GHRA 3B4UA 5EMMA 3WH6A 1VP5A 4EWJA 5CSRA 1GZGA 4LCQA 5CZSA 2FTPA 3DHFA 2PEVA 2PC8A 2Y8UA 3S6OA 1Y0EA 4HSNA 1IEVA 1DYSA 1GK8A 1BQGA 1K4GA 3UG8A 2PGEA 4DBWA 5GNXA 1OT1A 1SR9A 5BCAA 4Z2KA 2FZBA 1LQ0A 5BNKA 1DQWA 1K7FA 3AS3A 2V3EA 3EWZA 3D47A 3BAXA 3OVRA 3BLLA 3CH9A 2YPIA 5IDIA 1VBUA 3HFTA 4OE7A 1V08A 2JGYA 1VJIA 3QR0A 3SCOA 5I78A 4Q6XA 2YBTA 1GNXA 3MJMA 3I7SA 3LDVA 1O95A 4O13A 4WGXA 4UCGA 1PHQA 1W3HA 2DU2A 2WKJA 2W6RA 3R1ZA 4PUUA 2OSYA 2CXEA 3GWQA 3FFSA 3ES7A 3W7IA 1TV3A 4XZ9A 1J2WA 3R10A 5KITA 1E51A 3DESA 3AMDA 1N8WA 3CZLA 1UHVA 4C90A 3ABRA 2GQ3A 3WQDA 3VCCA 1W91A 2H8ZA 4R3UA 1DORA 3BGGA 3WH7A 2NX9A 5G4WA 4TX8A 1QHZA 3ZLFA 3NQMA 2VT0A 4GC4A 5BOOA 3A24A 3TXZA 1OCBA 4DHGA 4UTTA 2WMIA 4GC3A 3QQ1A 4ES4A 3QV9A 3UJSA 3KP1A 1EJXC 2W79A 2WWCA 5HWMA 3AQUA 2IQTA 1L6GA 1EEPA 3G1XA 4DJEC 2PODA 1V3MA 4IJCA 2VENA 2EPKX 4QSHA 2G3FA 2VMFA 3A5VA 2WYSA 3EZ4A 2RGLA 1Z32X 3GDKA 1BVNP 3VKJA 2VM8A 4GOAA 3BG3A 4HU8A 5I09A 1LLOA 4C7GA 4J40A 4Y6GA 3FGCA 3PAJA 3QV7A 4UTWC 5LHFA 1EZWA 3EWWA 2DZPA 3CZ8A 2WJFA 3M0HA 3QHNA 5FAJA 3CV2A 3SCSA 4ZA0A 1V3JA 3VI2A 1D9EA 3H7VA 5H8PA 4MUPA 2C0HA 4ILSA 4Q4SA 3WQPA 3TW9A 2UY5A 3R11A 1HO4A 2ISDA 3SM0A 2Y1HA 1S1PA 4JZ5A 1US2A 3T2PA 2PMQA 3WUBA 2JKPA 2ZA1A 2XHYA 1IZJA 5CEWA 1RH9A 2GFTA 2QDEA 1PIGA 3RCMA 1QR7A 3ERPA 2VI0A 3WQCA 1LM1A 2TMDA 3NTYA 1JZ5A 1ZSXA 1VYSX 4CEUC 3W7RA 3PUOA 3V18A 4C6IA 3RG6A 1PX3A 3DC8A 4C1KA 1OFRA 2AQWA 2WSRA 1MEWA 1Q6LA 1MFUA 3C2OA 3VNIA 3RPTA 1DWAM 1UQZA 3S2LA 3LXCA 3S5NA 1MSSA 4LAOA 4UTIA 4INFA 1CXIA 2PLCA 2AGTA 5BRQA 3QPYA 2WC7A 1BKHA 3UCDA 1IXNA 3E6EA 4HZ6A 4PRWA 4UTKA 2PU1A 2OODA 4M51A 1BVWA 3M0KA 1K7XA 3S3GA 3TWBA 3IPWA 5HATA 4UFHA 4UOZA 4GLEA 3IJ8A 3AWOA 1LDCA 2WBKA 1UP3A 4ADTA 3Q58A 3RO6A 1W1ZA 1RPXA 1KM0A 3P74A 3SJNA 2GL5A 3R8RA 3MUZ1 3AIVA 2DEPA 4W8BA 2QF7A 3W7PA 5JH1A 1JG9A 3UERA 2QVHA 4H01A 3G8RA 4B5NA 3WK2A 2BSLA 4DO5A 3W71A 3ZYZA 1TJ0A 4US5D 4EPKA 4IMEA 3FDKA 5C71A 3PF3A 3R8GA 3LK6A 3VGBA 4MYXA 1PKYA 4NX5A 1DHPA 8A3HA 2P50A 3JR2A 4MB4A 4WVXA 4MZ8A 3B05A 4TU1A 3W1LA 3CWOX 3B8SA 4XKYA 5KETA 1QDSA 3O07A 4E2OA 1EC8A 3W2JA 5KINA 4H9MA 3DHDA 3HGRA 3O6DA 4GUGA 2PB1A 2VGFA 1PJ9A 3GU9A 3MDUA 5F4XA 3L9CA 3BAYA 6PTDA 4PCPA 4C6PA 1ECEA 3MDWA 1VJSA 1YPFA 3EA1A 1B4KA 1KM3A 1F6PA 1PZ2A 4Z17A 2DDXA 3LBMA 1EF3A 1CX9A 1FA2A 5C9XA 4KH2A 1UJPA 2E1WA 1P4CA 3CUGA 5DBUA 3SSJA 3M7SA 2FMNA 1W8SA 2NWSA 1A0CA 2PP0A 4NVTA 4EPBC 4Q6JA 1WAWA 1M7OA 1HG3A 2P1FA 2GJPA 1M04A 4XKYB 3AO0A 4YHEA 1JDAA 3PTKA 4H2HA 3I65A 3S0CA 4AEEA 3HMJG 3UQNA 2ISSA 1DIKA 5DMLA 4GVGA 1S2TA 1S39A 1L6YA 4U5KA 3ZZ1A 1KFKA 1TQJA 5A6LA 2FVLA 4AC7C 1MZHA 2VC7A 1P0DA 1PZ3A 1OFOA 1DTUA 3VD7A 3KRBA 4PZVA 3GO2A 3QMSA 2D3NA 1W9DM 3EX4A 3T0AA 1HF6A 5C2CA 3S83A 1GVFA 5G1MA 1SJCA 4HHHA 4Z1CA 3S4TA 3WLKX 1K9EA 4QLLA 2UY2A 2V5CA 4GNJA 4D72A 5CJNA 2OO0A 1FH9A 2B7QA 1I1XA 1KM5A 1WXYA 4CCDA 3HFYA 2J88A 5ABFA 1U2YA 1SW0A 3VD3A 3NQDA 1OIMA 2ZCGA 3MANA 4W7UA 4WCJA 1G01A 4DM2A 1H51A 3VMNA 1E4MM 4H9VA 1SW7A 1D3GA 4ZQOA 4OFCA 2ZVIA 3QYQA 3M6DA 4ZO9A 2A7NA 3EB2A 1GQKA 1H7PA 3KTSA 3CZKA 5AYXA 1XSJA 4S3JA 3VD4A 3A12A 3MUAA 5BU6A 1XIIA 3D46A 3FS2A 3NQ6A 5EKYA 3NO1A 3BJFA 5MHBA 5C70A 2NW0A 2QJJA 3KVKA 4AZBA 4DWSC 3AIRA 4LRSA 1C9DA 2GVGA 3VC6A 2P53A 3TP4A 4OOUA 1V8EA 3EDEA 4GACA 1JD9A 3VFCA 3DN5A 3WD4A 3W1XA 1LLZA 1MW2A 3UZYA 5CSSA 1Q8AA 3PNZA 5CAKA 5B80A 3C61A 4LAKA 4UC5A 5A8GA 2JIWA 3IWPA 5M17A 2QAFA 3F5LA 1TG7A 5E0CA 3S1GA 4AIUA 2BOFX 3BSMA 4LV9A 1T7LA 1W2VA 1QATA 3CIVA 1X97A 2XIOA 4O0KA 3VXGA 1GGOA 1SSDA 4WKHA 1QNSA 1TVLA 4O19A 1J2BA 4B91A 2A3AA 3VCNA 4HU0A 1UWRA 2BXVA 4C6CA 1R86A 4WOZA 1R3WA 1UZ1A 2PCQA 1XKYA 1MDRA 1O66A 4GY0A 1OYAA 3TR9A 1A3XA 4CU8A 3SECA 4O18A 2C16A 1JPIA 4FO4A 4JTTA 1TFVA 5HNRA 5TQLA 1TZZA 1J0HA 3RM4A 2CLEA 1V3IA 1XF0A 1YDNA 2ACRA 4KETA 5IM51 1XHGA 2GSEA 4RE0A 4FS9A 2AKMA 2EPLX 3GDRA 1YKWA 3OEXA 3CLMA 1SMDA 3KOZA 3NZQA 3LGEA 1R8LA 4IGSA 4FEZA 1Q4WA 1HKJA 3WQWA 3ZJ7A 3GD6A 3KRUA 4C6NA 3W88A 1ISZA 1X1OA 3KL3A 3S6TA 5A95A 5CZ0A 2Y85A 4ZSUA 1XLJA 5K9CA 3LGDA 2DT1A 4DELA 2IQDA 1KWGA 3NQ2A 3SN1A 2I9UA 4XQ6A 3W73A 1LP6A 3UXIA 4CNTA 1FCBA 2OVLA 4W88A 4Q8WA 5CZJA 2AL2B 1TVNA 3MI2A 4XBKA 4MOZA 2PDCA 4GYFA 1WDQA 4LJ3A 2G50A 2BV9A 2FTYA 2XYLA 2XIMA 4YTQA 1ONEA 4ACZA 4UFMA 3D0CA 1PBGA 2XFWA 4LS0A 1J6PA 4V28A 1DIEA 3IK4A 4U4MA 1D3CA 1Q6OA 1VBHA 3QVQA 3PC0A 3VIFA 4AD2A 2J9XA 3G1RA 4IWWA 3IGHX 3LLDA 2WHLA 1IXOA 5T9BG 1FXPA 5J5RA 1LWHA 4IIEA 1F3EA 1T99A 5SWUA 3N19B 4PB5A 3HA1A 4Q8VA 3VK5A 3L0GA 2JBMA 1EIXA 1EJUC 4NZCA 4Q8MA 1A5UA 2IXUA 1E9YB 4FI4A 5BRBA 1HW6A 4B3ZA 1ME9A 2ZE0A 3C4UA 3BAWA 3GFYA 3ZJ6A 3A5FA 3H2FA 1GONA 1AJ0A 3W6YA 4AIEA 4Z2LA 2IKIA 2QHAA 3GUGA 2ZYFA 4CKQA 4OECA 4ZL1A 4WSJA 1QO5A 4DUWA 4P7RA 3R43A 2EEXA 1UKOA 2QJNA 3G1AA 3EX6A 4QAWA 1V0LA 1GVIA 1FCVA 3G0XA 3GQYA 2YXGA 4ACZB 4GI8A 4Z0SA 5FSEC 3TTQA 1UD6A 1IR1A 5ENLA 1GQNA 4CU6A 4DAIA 1XLDA 1SO3A 4MDPA 3Q94A 3T08A 2ZUVA 3TJ4A 4KEMA 2HSAA 1GYMA 1MW0A 4HMDA 3FLUA 5A6TC 2NV2A 4UQAA 3KLLA 3GXIA 3IV3A 3SIMA 3O63A 3NOEA 5DLCA 1ICPA 1JGMA 2HE8A 4GNVA 4XVDA 4LY4A 3L66A 5MKGA 5TIMA 3WSUA 2WPGA 3NSXA 3NZPA 4TVUA 4GG9A 2GZXA 3GVWA 3U2ZA 4JTGA 1L2UA 2HBXA 1G9HA 4IGMA 4LC8A 4ZQMA 4IH3A 1G94A 4NAFB 3RHGA 3AUOA 1PIFA 4O0ZA 1I60A 2JF7A 1V0KA 4OWGA 5LNWA 3RU6A 4ICMA 2Y7GA 4Z1DA 3QF0A 2OCZA 4BF9A 1UH3A 1IEQA 3R89A 2NLYA 3EOEA 4J2MA 1BSLA 1EA0A 1IV8A 2Z6IA 2ISFA 3L68A 4CD6A 4RE2A 1VFTA 2QCCA 1NQ6A 4GBDA 2QGYA 1NF7A 1H11A 4DBEA 1YLVA 3AI0A 1W8GA 2PC4A 4PUJA 5BW6A 4Z1BA 3CAWA 3ONCA 4EANA 3W7OA 3MZNA 4I8YA 4BA0A 4A35A 2OLHA 1PCKA 3LXAA 4LVFA 1RR2A 4WIWA 3VNDA 3QTPA 4OZOA 2XJ7A 1YYAA 1G1YA 1V3KA 2MNRA 3AICA 5I06A 3L21A 2OYKA 3KVLA 3FYYA 5FL0A 4IIGA 1IIGA 3S5SA 4NZ1A 3BCJA 1FDZA 1LUCB 4AEOA 4RDWA 4X0NA 4Q4PA 1VHCA 1XIGA 6TAAA 4DZAA 4Q4OA 1IYXA 1H61A 3WK0A 2V81A 5BOFA 4C7FA 1FWJC 1FP9A 2GUYA 1XUUA 2DZWA 3C52A 1G4EA 2V69A 3ZSSA 1JCTA 3QV6A 3QM3A 4HK5A 3W6MA 1CGUA 4Q4QA 4ZGYA 1I2RA 1UC4A 1E70M 2OQYA 1NJJA 2NSOA 3S9IA 3K46A 4G1KA 2WNQA 4HMCA 3CXOA 1FH8A 4N9EA 2ZDSA 4J3ZA 3BW2A 1K9DA 3QPEA 1CGXA 8TIMA 3QGVA 3UWYA 3WL0A 2ZZ3A 2J4GA 1MEHA 3O0KA 4KWOA 3W74A 3WLHA 4M81A 4J3UA 3MJYA 1DEDA 1QOPA 4YU1A 1TR9A 3N34A 1ESWA 2VRKA 2WSYA 4E3TA 5E09A 3IANA 2XIJA 3P6LA 1EJWC 3FKKA 2P3EA 2GQ8A 4LQ1A 1JDDA 3WLOA 1XM3A 1SSGA 2A6NA 1BEUA 5F7UA 4GI9A 3ZR6A 5D4YA 3UNDA 2PU0A 1DIOA 3BLIA 3H2NA 2YCLA 2PS2A 2EF9A 2EPMX 2W4XA 1DJHA 2DIEA 1XLCA 4ZQCA 4RL3A 3GE7A 2PTXA 4GVHA 5LGZA 1DJWA 4PMRA 4C60A 4X61A 3ZT5A 1XINA 5FEZA 3II1A 1EBHA 4MNJA 1P0BA 4L4PA 4DJEA 3OZYA 1K1DA 3LX9A 4K8EA 3IJ6A 4ZOAA 3T8QA 2HNHA 2HROA 3BZGA 3M5YA 2PAJA 2BVYA 2XZ7A 1EC7A 2CLIA 2FZDA 3HGJA 1KFCA 2POZA 5I00A 3Q45A 1R3YA 4LAZA 1LF1A 1A5BA 2AQOA 2I5QA 4JFTA 1O5RA 1G7UA 4UTWA 3G1DA 1DWJM 3P82A 3OVPA 1HO1A 3LZ3A 2WZHA 3RFAA 1X38A 2F2KA 4YYCA 3E0IA 4WLCA 1XJBA 4HNVA 4UTJA 3GDBA 4UNLA 4DI9A 3I6EA 2BBFA 1POKA 1BXNA 4C6FA 4KKXA 4NHVA 4F9JA 5JXQA 4LB3A 1E6QM 1QXLA 3OLGA 1GHSA 4TOQA 1RV8A 4K6AA 2P3ZA 3LHWA 2C71A 1YEYA 3U7VA 3BXWA 3A47A 2R8WA 1ZP4A 1XLMA 2QPXA 3G1YA 4LC6A 1R9ZA 1BRLA 1TE6A 3PZTA 5EMJA 3T0TA 1V3HA 3G3MA 3B06A 2CWXA 4KEZA 2CLLA 5A6AA 5CPMA 2WVSA 3FJNA 1W3LA 2JFEX 2ZZ4A 4BI7A 4RPQA 4E2VA 1KV5A 2ZRZA 1I2OA 2CBIA 4GE8A 3VNKA 2Y7EA 1NP0A 3NXFA 2QDDA 1R7AA