1TTQA

Tryptophan synthase (e.c.4.2.1.20) in the presence of potassium at room temperature
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
256
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE
publication title Exchange of K+ or Cs+ for Na+ induces local and long-range changes in the three-dimensional structure of the tryptophan synthase alpha2beta2 complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Carbon-oxygen lyase
total genus 92
structure length 256
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1995-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ttqA00
3W2UA 1GVSA 3NQMA 2E6AA 3NA8A 3GKFA 3PSWA 1PCWA 1A53A 4IUOA 4NJHA 6TIMA 1OX4B 4FIQA 3N2XA 4K38A 2ZZ5A 5EYWA 3S5ZA 3ABOA 4O50A 5BMXA 2A7NA 4RJEA 1GTHA 2C18A 2HS6A 2OJPA 4UTTC 3W75A 3UD6A 3C8FA 1NF0A 4O11A 3MHFA 4WY0B 5E93A 3W23A 2X1RA 4DO6A 1ZCOA 4E38A 4IX0A 4N4PA 3NQ6A 4LY8A 1Q6RA 5EPDA 4O19A 2BSLA 2QUTA 2A85A 2ZZ7A 2VFDA 3UYCA 3RMJA 1SUXA 2CZFA 1ME8A 3PBWA 3QPZA 5K9XA 1XDMA 5D37A 3OVQA 3GIYA 3A9IA 1TV7A 5D2TA 3ABQA 5ABTA 4IMFA 1FDZA 3QW4B 4IPJA 4LU0A 2A7RA 1DV7A 3KVKA 3NEVA 1D3GA 3P7YA 5HWJA 4ZQRA 4YMZA 1I8JA 2F84A 4JR5A 5D09A 4O1BA 3BLEA 4DQWA 3R5EA 4HNTA 2W0UA 3TKFA 1ZNNA 3GKAA 2D73A 4JX6A 2YGYA 4I7UA 1AW2A 3N9SA 1PIIA 3OG3A 1NF7A 2RDTA 1JUEA 2DJXA 4YXGA 2PURA 2YCEA 2NXIA 4UTJA 1YADA 2TPSA 4NJGA 3S5YA 2EHHA 1YPFA 3SFKA 5GVJA 3WJYA 3TQVA 2WKJA 3LTPA 3NZRA 3PB0A 4PFMA 3BGGA 3B0PA 3LI1A 1TPDA 1S5TA 4R7JA 3DFPA 8TIMA 1TTQA 1V5XA 5TIMA 3LCFA 4CCDA 1KM5A 1KLZA 4JY9A 1XUZA 1RQHA 3W87A 1KM6A 3WK2A 2FDSA 1P4CA 1GT8A 1X1OA 1O4UA 2A2IA 2DZXA 3HPXA 2CLIA 5LNRA 3STEA 2VOMA 4LV9A 4MZ1A 2CLHA 4UMAA 1AL7A 3G1DA 1EX5A 1N55A 3EKZA 1A5SA 1TCDA 5FI8A 3K30A 5FEWA 1EP2A 4IXHA 1DORA 1F6KA 2E6DA 2ABBA 4JS3A 3CEPA 1L6WA 2V82A 4WOQA 1Q6QA 4ZZ9A 5G1YA 3RLUA 3USBA 1H62A 3W07A 1O95A 2ISSA 3KAOA 3TX9A 1T99A 3UWVA 3S5OA 2E5DA 4FF7A 2X30A 3G1VA 4LV4A 4UTHA 5CPOA 1VHNA 4UIOA 3G0SA 1JJKA 1LOQA 5D30A 3C0JA 3PAJA 2TMDA 4HHPA 3BLFA 5EMUA 4MY8A 4IXXA 3P62A 3SECA 4N2YA 3KFTA 4J9JA 2BZNA 1QO2A 3W88A 3A5VA 4TIMA 1K8XA 3A23A 1L6YA 3G1FA 3WFAA 1OFQA 1VS1A 1GVRA 1VYRA 3QMRA 2FB2A 1TPH1 2C0AA 3EWBX 2NWRA 1AG1O 1RPXA 5KMYA 1B3OA 3LHUA 4RZ5A 1JQXA 1HO4A 1OABA 3SI9A 4JIPA 1YLVA 2A5HA 2OX1A 4LVFA 1VH7A 4LTSA 2C3ZA 4BF9A 1N7KA 2O7SA 3TC7A 2GUUA 4ZQOA 2R8WA 4UNLA 2FJKA 3IVTA 4PC8A 3E12A 4NVTA 2RH9A 2QEZA 3TJXA 4WOZA 2NXHA 3CWNA 3DFTA 3M43A 1WBHA 5H91A 4Q32A 5AFDA 1R47A 1WV2A 4O52A 3R8RA 4ALDA 1H51A 4X9SA 3W70A 1Y0EA 4S2CA 5KSWA 2ZDRA 2YPIA 4ZQPA 1GYLA 5C55A 2RHGA 2Y7FA 4AEOA 1OFPA 3PSVA 4TX9A 1RV8A 1K8YA 1M7PA 1YPIA 5I3JA 1VC4A 1TV8A 4GUGA 4EVZA 4JTFA 2DZVA 2NUXA 4YWIA 5I3HA 4WD0A 3P81A 3BW3A 1YDNA 1LCOA 1YXCA 3RNDA 4Y90A 1T0OA 4O10A 4QITA 1TIMA 3DFSA 3STCA 4PH6A 3NL2A 4O8RA 3CIXA 2A1YA 4NZFA 4BFAA 1OYBA 3CLMA 4WQ6A 5C2XA 4L4LA 1FCQA 3W1NA 1EP3A 1RD5A 4GRSA 1LM1A 2YXGA 3BK0A 1JR1A 4XQ6A 5BNKA 3SZ8A 3LRMA 4AF0A 4MJZA 5AB3A 3QH2A 4LOCA 4Y6GA 5AYZA 3NPXA 4BK9A 1I2QA 3PULA 3TH6A 2QAPA 3GAKA 4Z1CA 3QQ1A 1UB3A 2W6RA 4M6PA 2QCGA 3VI2A 5AHEA 5CZJA 1EP1A 4OHQA 5AC8A 3T40A 5HWNA 1VCVA 1LOLA 2C6QA 3BARA 3TW7A 1RR2A 1P0KA 1QWGA 3B8DA 2QCCA 3LTYA 3EX3A 1ICPA 3BVJA 3IIXA 3MYOA 4N4QA 2JKAA 3DFOA 3W1AA 5A5WA 1M7OA 3PF3A 3G3DA 1JRBA 2AGKA 4JNMA 3L2IA 4WY0A 4JXCA 1F5ZA 1KV8A 1SZNA 5D32A 3C2FA 4H4IA 5FF2A 1BWLA 3NQ2A 3DHDA 3P61A 5DXYA 3DU0A 3W7CA 4JIQA 3DBPA 2P0OA 3C52A 2CLEA 4BWLC 5DBUA 4YLWA 1JQVA 1GVFA 1GG0A 4LS1A 3A22A 3NQGA 7TIMA 3HG4A 2GPTA 4DXVA 1ZAIA 5F2IA 1QMLA 4PTNA 1G67A 1TRIA 3W7KA 4WXYA 1KV5A 2DZTA 3E96A 4S2BA 2A6NA 1B57A 3W7GA 2B7NA 4CNNA 4IPIA 5I3GA 4IMGA 3WK0A 3WK3A 2X2GA 1W37A 3QEZA 1MXSA 4HNVA 3IRDA 2VENA 2C15A 2E6YA 3EX6A 3JS3A 4A21A 2I14A 3MMTA 4ICNA 2H6RA 5F4SA 3M41A 2QCLA 4JN6A 2NUWA 3G1SA 4Y96A 3KHJA 2QCEA 4R34A 1FCUA 2V2DA 2OT1A 5F2GA 2EGZA 5F4XA 1F74A 1Z48A 1LDCA 5DBTA 1KBIA 1TQJA 4HPXA 3V75A 4R53A 4ZQCA 4GUFA 3CPRA 3HF3A 1W5OA 4O0ZA 3W1RA 4I9AA 4YCOA 4Y8FA 2CU0A 3T78A 4JY8A 2BTMA 2YSWA 3FEMA 1Z44A 1LLWA 2G97A 4N02A 3N14A 2Y61A 4CQ8A 1X7FA 2WNZA 4K37A 5CPNA 3DFQA 4QQ3A 3UWWA 3CQ0A 4GUIA 3QFEA 3OHIA 1FXPA 5D2VA 3NG3A 1KFKA 2P10A 4S1FA 3R12A 2X1SA 4AAJA 5IBXC 4O12A 1JVNA 4LS2A 3O8AA 4X22A 1ONRA 1I2PA 4Z1DA 2RFGA 3LBCA 3BLIA 1FDYA 2ZRWA 2Y85A 2C19A 3I68A 4RV8A 3AO0A 4LT9A 3G24A 3S6DA 1JULA 2GVLA 1FWRA 2EPHA 3AJXA 1EUNA 4ADSA 1G7UA 4AHPA 4DF1A 2DU2A 2OCZA 3H53A 1PS9A 3HOJA 2CW6A 4XBSA 2EKCA 3PBVA 3LHTA 2Q8LA 1NFBA 2QDGA 3NPWA 1SR9A 3GXPA 3F4WA 4MYXA 4H3DA 2F7FA 4NNBA 4Q33A 1WYIA 3CB8A 3W1UA 3DZ1A 1OVDA 4O4VA 3L0KA 2DP3A 2OT0A 4R33A 1W0MA 3P8JA 3NO5A 4JTIA 3ZWSA 1W5PA 4AHOA 2AAMA 4GFSA 2PC4A 1FCBA 4OV9A 4AF0B 2P1FA 2RDWA 3LERA 1U83A 2HMCA 3I65A 1VGAA 5G2IA 3G8RA 3UZ5A 2CLOA 3LLFA 3GYEA 1SO3A 1J2WA 4NJJA 1XCFA 3ANYA 4GE8A 3UXAA 3KRSA 3LB0A 2WOQA 5HNRA 5I3FA 1WOAA 4KFNA 4E2DA 4OU1A 3O6YX 1UASA 1EEPA 3W7RA 4O1AA 3MP3A 3I6RA 2C14A 4HT3A 5BW6A 4CCCA 3MP4A 3HGSA 4MPQA 5D04C 4IMDA 4P61A 2GQAA 2Z6JA 3L68A 1ME7A 5FEXA 2CZ5A 4ADTA 1BEUA 2VEMA 1QPOA 3P74A 5SWUA 1YTDA 4JTJA 1BTMA 2V8ZA 1G69A 1QPNA 4FHAA 3TIMA 3W3OA 3SIZA 2VFEA 3EX2A 4AWUA 3THAA 3M0ZA 2B4GA 4O1CA 3IIZA 1K8ZA 2J24A 3LV6A 1H7OA 2CZEA 3OVRA 4WZHA 1SSDA 1K7EA 4LVAA 1XBZA 2QCMA 3S42A 2CWNA 3LCXA 2ISVA 5FF4A 1ZJIA 4RX0A 4KKXA 2Y62A 1NEYA 2Q3OA 5AC6A 2Y7GA 1SO5A 3S0CA 1D3HA 4Z08A 2XN1A 1TRDA 3NQFA 3M7WA 2ZA1A 4KWVA 4MJMA 2ZRVA 4H6KA 3W73A 5E1QA 3LDVA 1QAPA 1M6JA 3EXRA 5D38A 1I2RA 4O15A 1P1XA 4QIUA 3KVLA 4XBKA 5KZDA 3LCIA 4QM1A 3I7SA 3HJZA 6ALDA 1AMKA 3MBFA 2YX0A 2Y88A 3NL6A 1X1ZA 2ATMA 1S5WA 3DKLA 2ZQ0A 1VZWA 3W1PA 2DORA 4N9DA 1T96A 3W7EA 4N9EA 4IQLA 4FXSA 4UTUA 3OEXA 1YDVA 4JDYA 1FWWA 4UFKA 4UFIA 5D2WA 5F2MA 4M6VA 3NPUA 5G4WA 3O05A 3G1XA 3T4CA 4MFEA 1IXPA 3IIOA 3TDFA 1VJIA 4A29A 4MIMA 5FF7A 4QAIA 3LRLA 1H7RA 3W7JA 1GVOA 5CKSA 1MZHA 5CPLA 1H61A 3CU2A 5G4EA 1KTNA 3GNDA 4N6FA 4FNSA 3HPZA 4RXFA 3KXQA 1ZAJA 3ZS4A 4BI6A 1SPQA 3GXNA 3E9AA 4AMAA 3D0CA 1VLWA 1H7XA 4A2RA 1HG3A 5HQEA 5K2ZA 2ISWA 2ZTKA 4O4WA 1TB3A 1T8XA 4AWTA 3NDOA 4PA8A 4IGHA 1A5CA 4A2SA 4GWEA 1KTCA 3OA3A 4DF2A 4KFOA 3EWWA 5HR7A 1JCXA 1UUOA 3ELFA 4ZVJA 1ZHAA 4UTMA 4XWUA 1FWSA 4PODA 4PEKA 3O6CA 3W7NA 4O54A 4ML9A 3C2OA 4MY9A 1YDOA 5G2HA 4NXKA 2JGYA 3BG5A 1LORA 5LNWA 3Q37A 2C16A 2NXGA 5AOUA 3PWAA 4JD4A 1K7XA 2UV8G 4LC8A 4MY1A 3OBKA 1OF6A 3CT7A 4HKPA 1RQBA 2DZUA 4JYEA 3FYPA 1B4EA 1ICQA 3QPYA 4A22A 4MOZA 3DGRA 2QCDB 2WNNA 2QDHA 4MKNA 3W7IA 4IMCA 3L65A 4PL2A 3EKLA 3M5ZA 3DFNA 3FYOA 4PCFA 1C9DA 4ORMA 3UQNA 3BW4A 3C56A 3TSDA 3MO7A 5J5DA 3W83A 3R2GA 3TUUA 4Z0SA 3P8IA 3F4NA 2G95A 1LBLA 1THFD 2NUYA 3DENA 1UUMA 4RZ4A 2H90A 2H3BA 1PE1A 1ZENA 3NOEA 4JEQA 4JYFA 4NUWA 5BMWA 2E1DA 4O53A 5KZMA 1YYAA 2ZFAA 4BI5A 3QSTA 4WY0F 1W31A 4K7YA 5CGQA 1XDLA 4Z0JA 3VCRA 3L5LA 4LUJA 2V9DA 3GX9A 4LWWA 1HUVA 1K3UA 3M47A 4TMBA 3TXZA 2ZRYA 5D2XA 3SR7A 3HG2A 3B06A 3UZJA 3EXTA 4N9BA 1XC4A 3C61A 1R2TA 5KZEA 3MI6A 3S1UA 3O15A 3HMJG 2C1HA 2PRMA 1GEQA 3W2JA 1OYCA 2B7QA 2O7QA 1NVMA 1DVJA 3FJ6A 4UTWC 4JDBA 2Y7EA 5I3IA 1Q45A 4JX5A 4EF8A 3LM7A 2NZLA 5D02A 1TTIA 1TREA 3M1ZA 1G4TA 4UTWA 5L9FA 1B4KA 1A5AA 4O57A 3RF9A 1LOSA 1JCYA 3G18A 1XL9A 3TROA 1I2NA 3W71A 1WOBA 4NNCA 1L2UA 4TR9A 1FDJA 4NQ1A 1DJNA 3ZFHA 4OQVA 2AQWA 1ME9A 3DI1A 2BWGA 3IV3A 1Q3NA 2Y70A 2H8XA 3TAKA 1GOXA 4WXZA 4C1LA 3W7DA 1A50A 3STFA 2E09A 4GUHA 1L6SA 3UY7A 5MHBA 3PB2A 2WO5A 2HSAA 3UWZA 4NNAA 1C8VA 1O5KA 3NAVA 1GG1A 3S8HA 1F05A 4P2VA 1SFLA 4UMBA 1ML1A 2J6XA 4UFLA 5HINA 2GOUA 1TTPA 2G5WA 1JUBA 5FEZA 1OFDA 3HG5A 4X3ZA 4FO4A 3E02A 5DCDA 1AW1A 1H63A 1O94A 4FXRA 1LYXA 1KM3A 3C3NA 3LGEA 2V2CA 3B03A 3GDMA 3HQ1A 3RFAA 3W1QA 3BG9A 1W1ZA 1DBTA 2Z2UA 3BV4A 3LXBA 4N6EA 4NU7A 2FPYA 2J88A 3IIPA 5KINA 1EIXA 5HJLA 1H5YA 3W76A 2ZZ4A 2R14A 1DOSA 3S1XA 5BRBA 1UBSA 2FLIA 4E0CA 1VYPX 1W3IA 1RQEA 5EKYA 1AL8A 1KFEA 4QJ1A 1JCJA 2VEKA 1F73A 3F1QA 2BX7A 4O18A 3FFSA 3SJ3A 1W8SA 1OK4A 3TJLA 3C2EA 4KFPA 1LLZA 1WDWA 3DKJA 5D05A 4AHQA 4EOUA 2WSQA 3QW3A 1OFBA 3PY2A 1XKYA 4NZJA 1BKSA 4DBEA 1TPC1 3O06A 4FB7A 2YYUA 5TBOA 3LV5A 1R2SA 1SZEA 3LXCA 2FQIA 3WJZA 3G8EA 3TR2A 4FNPA 4DPPA 3TU9A 1RZMA 5LNVA 2ZRXA 3QM3A 3I7RA 4DO5A 3GR8A 4LVBA 1LRTA 3L67A 4FNRA 1FXQA 2TRSA 5L6UA 3S1WA 3TW6A 1XBYA 2IQTA 1Z42A 1GPWA 5LNSA 1TPEA 1N8FA 3O07A 1G4SA 4XKYB 1I4NA 3IGSA 3KVJA 3GR7A 4BI7A 3NZ1A 3UWQA 2J9XA 3GB6A 3R89A 2Y89A 4QNEA 2PRLA 3NQAA 1R2RA 1VQTA 2ZTJA 3N34A 3QRHA 3EWZA 3GLCA 3ZWTA 4POCA 2FPVA 3TE9A 2EAWA 3I7QA 1J4EA 2E77A 2PRHA 2GJLA 3PUOA 1EUAA 1CW2A 4AB4A 4AWSA 3INPA 1WBJA 4Q4KA 1B9BA 2WQPA 5HR6A 1KM0A 1SW0A 3O16A 3G22A 1F76A 4RZ6A 4CQAA 3LHZA 1KFJA 1X8FA 1SFJA 1WAUA 4Z1AA 3QJAA 5C54A 4EWND 3TK7A 4JTHA 2YFNA 3DI0A 2YFOA 1ZAHA 5KTLA 4TMCA 1TTJA 1LP6A 5LNUA 3NXFA 2NV2A 5LGXA 3QSRA 3B0VC 3LI0A 1QPRA 1U5JA 3W6YA 4IWWA 4UR8A 2HTMA 4AVFA 1LTDA 4DEFA 3FKKA 3GVGA 3LBMA 2V30A 5EL1A 5F4WA 4TO8A 2NV1A 4JGDA 3JR2A 4FNTA 1GTEA 4N9CA 3PBUA 1LBMA 2NX1A 2ZZ1A 3L5AA 4CNOA 1ZY9A 1HO1A 3C4UA 5AC7A 1FWNA 3BGJA 1L9WA 3IVUA 3HG3A 4GC4A 3TFCA 3W7HA 1DJQA 3W84A 3EWYA 1TMHA 3G3MA 3CM4A 1VCGA 2W79A 3HO8A 3NQEA 5EBUA 1AW5A 5CZ0A 5T26A 4XTDA 3CWOX 3TV8A 2FTPA 4WUIA 3M5YA 4IJBA 2QCDA 1FWTA 4K8HA 4K39A 4LS0A 1NAL1 1TPVA 1TSIA 4CLMA 5HULA 1MSSA 2YDAA 3N2MA 3R13A 3FLUA 3TMQA 3LCGA 1ICSA 1H7WA 3NQ7A 3IVSA 1DHPA 4XUGA 3VKJA 3BW2A 2YW3A 2ZA2A 4DELA 5CZSA 3C6CA 1TYGA 3P60A 1C29A 1XBVA 4FNUA 3C2RA 3OVPA 1FCVA 4ADUA 3V1PA 2RKXA 3PG9A 5IM51 3VFLA 3MHUA 3MJYA 1G4PA 3RLVA 1FY6A 2LLEA 1LZOA 2C13A 4M6QA 1R30A 3TCEA 3H55A 4LRTA 5BOOA 3E0IA 4HN4A 1DKWA 1S5VA 1KFCA 3M44A 2FFCA 2OMAA 5CPMA 1H1ZA 3IEBA 3NGJA 3FJLA 1QOQA 1OX5A 1XFBA 1KW1A 3NQDA 3GDRA 3GDKA 3KRZA 1NSJA 3GNNA 3H54A 3B04A 4JTUA 1W3TA 3T7VA 1EWEA 3W7LA 4U4MA 3RK8A 1KM1A 1EWDA 4JICA 4MLJA 3DH7A 1MEHA 4DO4A 4QNWA 1FX6A 3P84A 2QR6A 1S3HA 1X6UA 2A0NA 3CTLA 2TYSA 3THQA 3MYPA 3M9YA 5DELA 3N19B 1LBFA 1IGSA 4GJ1A 3SGZA 4GUJA 2NX3A 2J27A 3HPSA 1TPUA 3U2OA 1D9EA 4L4MA 4ORIA 3TFXA 2A4AA 2BLEA 2GVJA 4HSOA 1BWKA 1KTBA 5AHMA 5G2WA 1OK6A 5C5YA 5K4XA 1W5MA 4ZQMA 4WX2A 2QCNA 2EF9A 4ONVA 2VEPA 5C6MA 3F03K 2NLIA 3EX4A 3W86A 4UTTA 3B4UA 4G1KA 4JTSA 3ATYA 1TPWA 3EB2A 2QUUA 1YXDA 1F6PA 2V2HA 3PUDA 1ZFJA 2QJHA 3PUEA 3IGUA 3DAQA 3LOTA 1IF2A 4K8EA 4GXMA 1SZGA 2DZWA 3W7PA 4RCXA 2Y6ZA 1EPXA 3MP5A 2VFFA 5FF3A 2VC6A 4C1KA 3WJWA 4D2JA 3ABSA 2A21A 2YZRA 4O16A 4O1DA 3A5FA 3EX1A 3LHYA 1W3NA 2QCHA 4YCPA 3TXVA 4HSNA 3N3MA 2HS8A 5F1VA 1OFEA 1TJRA 1PVNA 4FIRA 1VR6A 2ZBTA 1XBXA 5G5IA 3HGJA 4OE7A 5F2LA 1QPQA 1TV5A 3S5NA 3FIGA 3FS2A 3PBYA 3Q94A 1DQWA 2CFFA 2ZRZA 4LVDA 4B5NA 2Z1BA 3QYQA 1DL3A 3KOFA 4AXKA 4IOTA 2VELA 1YTEA 2ZZ6A 1DQXA 3P5YA 1JCMP 2CLKA 2ZZ3A 4M7TA 1MO0A 4QSHA 2X1TA 2CLMA 5U4NA 4XKYA 1VPXA 1PHWA 1PL9A 4MFDA 4OGZA 3P5ZA 1GJPA 2Y7DA 3W74A 3TA6A 3DHFA 2PCQA 3PM6A 5F1UA 3RU6A 2H8ZA 1WX0A 1P0NA 1K03A 3NQ8A 4A3UA 3JRKA 2WSYA 4UXDA 3W2NA 5H2ZA 1TO3A 3GAYA 4MUZA 5U7SA 4HNUA 3U6WA 1LROA 2ZRUA 3M5XA 4LC6A 3B0UX 2R94A 3W1TA 1XXXA 1KA9F 2XN0A 4LVGA 5CSRA 4RLIA 1XM3A 1SW3A 4OBTA 1UJPA 5J5RA 2GJNA 3W9ZA 4UFHA 1TQXA 3PVFA 1H60A 3TMLA 3G0UA 3E49A 4LRSA 5DLCA 4RR4A 3HGRA 1RVGA 1GZGA 1SO6A 2VFGA 3TSBA 3OIXA 2CLLA 3NL3A 4WJEA 5HMSA 1IXNA 3GDLA 2YYTA 1QFEA 4X2RA 3B05A 1OFAA 4ZL1A 2GVGA 2V5LA 2Y63A 2ZYFA 3HIJA 3MUXA 4M7SA 2ZA3A 3MWAA 1LRQA 2E5CA 3M6YA 3STGA 1AK5A 3WJXA 3Q58A 2DZPA 1OYAA 4FX7A 4UTLA 1E51A 3S1VA 2ZCGA 3T44A 1WXJA 3ZR4A 1SW7A 5A8GA 3KVMA 5K3VA 3S9YA 2E68A 1H7NA 3L0GA 2JGQA 1PHQA 5AN7A 3CIWA 5LZLA 1F2JA 1LRNA 3HGOA 3LHVA 5AYXA 1ADOA 1P5BA 3W1MA 1TPB1 3C2VA 4GBUA 2FPTA 2ZZ2A 4YL2A 5I3KA 5LHEA 2FIQA 5DCEA 5LHFA 1KFBA 5DY2A 1TJPA 4DBDA 2GQ8A 1CX9A 1ALDA 2E5BA 4JTKA 3NQVA 5HUOA 3W85A 3TNOA 2V81A 1YXYA 2I9EA 1I2OA 4NX5A 4UTIA 4MYAA 4FEZA 3FOKA 1GVQA 3LRKA 2DZSA 3G1AA 1KM2A 3DXIA 3TC6A 3TAOA 1QDSA 4MZ8A 3EEGA 1OJXA 4OV4A 5LKYA 5K7JA 3NQCA 5CG7A 5HWMA 3QMSA 1FQ0A 3MI3A 3EXSA 4EF9A 4K7VA 4GNJA 4K6AA 2VKZG 2G96A 4KWWA 3L5MA 1OHLA 2YW4A 3HB9A 1VRDA 4IX2A 3TSMA 5D2YA 2KZHA 5AYYA 1FUYA 3W2KA 2DJLA 4LUIA 3ATZA 4OT7A 2WV8A 3FA5A 4UCGA 3LCHA 1OF8A 3W72A 2ALDA 5LSMA 1FBAA 1GWJA 3M5VA 1XI3A 3MHGA 4M19A 1G4EA 4CQ9A 1K7FA 2VXNA 4W9TA 4O28A 2V0TA 3HBLA 2Z6IA 3NVTA 4ZMGA 3TQKA 3W7QA 4U28A 4DPQA 3NYZA 2QUVA 1SU5A 2ABAA 4LW7A 2B7OA 4FNQA 4TU1A 3LCLA 1M5WA 5AHNA 5DXXA 3QZEA 1W5QA 3T55A 2CLFA 3KRUA 1YTKA 3PR2A 2OZ0A 4LNYA 2PE4A 1IXQA 3VE7A 2YR1A 1KM4A 2BXVA 3N73A 3WJSA 1TPFA 1PCKA 3KX6A 5G1TA 3GXTA 2QJGA 1W5NA 1VHCA 3BG3A 4CCEA 1WQ5A 2B7PA 1OX4A 4JTLA 5K9CA 4UFMA 2QJIA 4NT0A 1JCNA 2JBMA 2RDUA 2XFWA 3A24A 4ZQNA 2A6LA 1EB3A 1MEWA 3GZ3A 4JTTA 1W56A 3FKRA 1OFRA 1IIHA 1GYNA 1MEIA 4UFJA 5TQLA 4UMCA 1JRCA 5E0KA 3SSJA 1F7BA 3UPBA 2NWSA 1HFBA 1R46A 5CZTA 1SZFA 4HIBA 3MI2A 4UC5A 4RKAA 5DCBA 5CSSA 4AH7A 1QO5A 4BWLA 2QKFA 1QR7A 3PC0A 1J5TA 2I1OA 3IGXA 1OG0A 1ZALA 3MW7A 1OFOA 3W22A 5DY3A 1Q6LA 1XUUA 5K9DA 2JK2A 1G6CA 1JCLA 3PG8A 3P82A 1W54A 3UWUA 3W2LA 3PS7A 4EIVA 4HPJA 3UNDA 5AHLA 4JYDA 3Q2DA 1Z41A 4FX6M 2JKEA 4NJKA 3YPIA 3L66A 1V7YA 3G0XA 1SSGA 3EWUA 4UUIA 1KBJA 4PL1A 2E6FA 1JUKA 4MLRA 1GQNA 4IMEA 2X16A 3WK1A 3VE9A 3QQ0A 4JX4A 3ABRA 1KFLA 1H7PA 1EA0A 4HNNA 1VYSX 2VFIA 1SO4A 4XTIA 2H3DA 5FF0A 5K4ZA 2X1UA 4MZYA 2A7PA 5DN1A 2J9ZA 3CEUA 3G1YA 4JTGA 4BR1A 3UY8A 1HL2A 5EY5A 1CI1A 5KITA 3LHWA 3L21A 1SQ7A 2XN2A 4QISA 5EA9A 1H50A 3SY5A 1A5BA 2ATSA 3LTSA 5AHFA 4OWGA 5D33A 4RXGA 3CC1A 2Z0IA 3LLDA 4NJIA 2QF7A 3O6DA 4JTEA 3GDTA 1IIGA 2VFHA 1H1YA 3NPVA 5HUPA 3SGUA 2WNQA 1VCFA 3QC3A 2J9YA 3UWYA 2QCFA 5IBXA 3EWXA 3W7MA 3QF0A 4M5PA 3BPWA 3W1LA 5FESA 4O14A 1G7VA 3W1XA 4UR7A 3IIVA 4O17A 4CNPA 4E2BA 1IXOA 2R91A 3BO9A 3NM1A 2V5BA 3QMTA 3A21A 4NXSA 1WA3A 1UCWA 3U8GA 4UTKA 3UXDA 3GK0A 4O13A 3TQ0A 1QNVA 3G1HA 3LCWA 3L9CA 1K02A 3NL5A 4NX0A 1I45A 2GQ9A 4K36A 2FB3A 2NX9A 1OX6A 3SW6A 1QCWA 2Q3RA 4Y9AA 5D03A 3N9RA 4DF0A 5LGZA 1KLYA 3O63A 1VLIA 2Q8ZA 1Q6OA 3LXAA 1O5XA 3L0NA 4O0KA 3LX9A 3VNDA 3NNTA 3W7OA 5AHIA 3O1NA 2TSYA 2B0MA 3M16A 1O60A 5FEPA 4FX8A 2WJZA 4MVAA 4Z1BA 3P67A 2VEIA 2WSRA 3W2MA 2JKPA 3UPWA 4I7VA 1HTIA 4UNKA 2WPBA 2CZDA 3CHVA 3NR0A 1QOPA 2QAFA 4XZ9A 3P80A 4RK8A 4I7WA 3NM3A 1PV8A 3MBDA
chains in the Genus database with same CATH superfamily
3GBEA 1HL9A 3LNPA 3W24A 4G7FA 4AUBA 1KKRA 4IL2A 4RW3A 3PSWA 4GYKA 3WMCA 2Z1WA 1UZHA 2QVHA 6TIMA 2WHJA 5ABHA 2X7VA 4K38A 4ZTXA 1ADDA 1ZP3A 5JBEA 2POTA 4O50A 2W63A 1Q6CA 2OJPA 1JGMA 3MHFA 4DJDD 6A3HA 3VINA 3HURA 1Z3NA 3GNPA 5EPDA 4FOJA 1RA5A 3SQLA 4W7VA 1Q7ZA 2WLYA 5A8NA 3G77A 2DQXA 3CB3A 1XF0A 3FW6A 4N0RA 3QPZA 3FJ4A 1XJBA 5A94A 1TV7A 5D2TA 1FWAC 3VKBA 5ABTA 2OX4A 3TWBA 1R3TA 2OEMA 1LF1A 3P7YA 2XIMA 4DWSD 4YMZA 1R3SA 5DEZA 1CDGA 2Z1SA 4GIRA 5HXMA 4PB5A 1JFXA 4GQQA 3DN5A 2W0UA 2WKLA 3FVMA 3TKFA 1ZNNA 1QU4A 4LQ1A 2XIIA 1QATA 3GKAA 1JPHA 4JX6A 4V1YA 4ATWA 5EBAA 3KW3A 3BJSA 1JUEA 1UR8A 2DJXA 4YXGA 1G0CA 1W6TA 1Z6KA 2PURA 4V28A 3S5YA 1YPFA 3UJ2A 3WJYA 4DJFD 4MB1A 1LL7A 2WKJA 3LTPA 2YB1A 3BGGA 3B0PA 3AXKA 3DFPA 2QYGA 2PAJA 2PDYA 4CCDA 1KM5A 1KLZA 3LQLA 3TW9A 3DEQA 2GGEA 3RIKA 3W87A 2EG6A 1IEVA 1P4CA 3I6EA 3GXMA 1I9CB 1D3CA 2A2IA 1XINA 5JIWA 3K13A 5LNRA 3STEA 4MZ1A 3F4CA 2I56A 4UMAA 2ZXBA 3LLXA 1A5SA 5FI8A 4H8UA 3K30A 3XISA 5FEWA 1B3XA 3TCSA 4IXHA 4JS3A 1L6WA 4WOQA 2VEFA 4HTYA 1HJXA 1Q6QA 3N2OA 1KBLA 1RSCA 4GIEA 3ZVHB 2J77A 1O5RA 1GK8A 2R9RA 3V3WA 3USBA 1H62A 3W07A 1O95A 4US5D 1E1CA 4XO7A 3GUWA 3Q4DA 2XH4A 2X30A 4AEEA 1RAKA 4UTHA 2D69A 2GGGA 4KCTA 1HP4A 3FHAA 2HBXA 5D30A 4J4KA 5MKGA 3PAJA 2TMDA 4HHPA 3BLFA 3WH6A 4IXXA 4XZMX 3SECA 2MNRA 3BMWA 4N2YA 4XSLA 4TIMA 3A23A 1TELA 1OFQA 1VS1A 1UPMB 2PWGA 5KEZA 5C71A 5AYIA 3PZQA 2XVNA 3W4RA 2J79A 5KMYA 3WQPA 2CBVA 3NGFA 5EMJA 4PR4A 4Z2GA 3VD3A 1XPYA 1JQXA 1OABA 4GXWA 3GH7A 1YLVA 1PWLA 2A5HA 1HX0A 4LAMA 2PZ0A 4LVFA 4LTSA 4A3HA 3TC7A 3IVTA 4PC8A 3GVRA 1GOIA 3ARQA 3OP2A 1NWSA 2QEZA 3EKGA 4WOZA 2NXHA 4XIAA 3KEHA 2F2HA 4GD0A 2VVSA 1WV2A 4Q4MA 3OZOA 4ALDA 1H51A 3UZXA 2R1NA 1Y0EA 3QLDA 5KSWA 2ZDRA 4M51A 1KRBC 5C55A 3KL3A 2Q09A 5C8BB 2RHGA 4HNLA 3VKCA 2ZUVA 7TAAA 1LQAA 5I3JA 3TN6A 1VC4A 4ES4A 4GUGA 4F0SA 3V16A 3VPLA 4LF2A 2C8NA 2DZVA 2PTXA 1JCTA 4WD0A 1JYWA 3NIYA 1LCOA 3RNDA 4Y90A 4DHGA 4QITA 1TIMA 3DFSA 4MADA 3BQ6A 3NL2A 1AJZA 3LM3A 3NSMA 1U1UA 4R7OA 2PODA 1DJZA 3CLMA 5C2XA 1BRLB 4L4LA 1FCQA 3WENA 2YXGA 4MDOA 4MWAD 2VYOA 4LUTA 4MNKA 3GHTA 4MJZA 4H7CA 3V1HA 4F4RA 3PULA 1F4HA 3TH6A 2PDGA 1UKPA 1A5LC 3CPGA 3QKEA 2QCGA 5AHEA 5CZJA 1EP1A 1WE5A 4BKNA 2WNWA 1NQKA 4ZB0A 4H9YA 2C6QA 1DXIA 1P0KA 3ITCA 1WO2A 1QWGA 3B8DA 2X09A 4AZIA 2X1IA 4CU8A 3MYOA 4N4QA 1XYFA 3G3DA 3H12A 1RBAA 3T42A 2IMRA 2AGKA 2VGFA 3NSNA 3L4YA 2ACSA 1X7IA 1F5ZA 1KV8A 4JXCA 3REQB 3C2FA 3CK5A 2WHMA 1BWLA 3P61A 5DXYA 3E1F1 3C52A 2CLEA 2VUYA 2PB1A 4YLWA 5DBUA 4LS1A 3NQGA 4DXVA 1ZAIA 1D7FA 4PTNA 4KRUA 5TNVA 3EOUA 3BTNA 1V6XA 3ES8A 3FSTA 3TVAA 5JMUA 3DG3A 2DZTA 1B57A 1OT2A 1QI5A 4F9JA 1LWHA 4DO7A 3W82A 1P48A 1E1CB 2VEGA 4XZNX 5HJYA 1KR0A 4LSBA 1K9EA 3AHZA 1OQFA 3IRDA 1NJJA 2C15A 2VURA 4J27A 4BQ4A 2E6YA 5MKGB 3EYPA 1GONA 2FHBA 2I14A 3MMTA 2NQLA 1KRMA 3NEHA 1NDWA 3VMOA 3G6MA 4NAFA 4Y96A 2QCEA 2CKSA 2VTFA 2AQOA 5F4XA 2UY2A 5IHRA 2PDUA 4HPXA 3VGGA 4ZQCA 5DMMA 1DE6A 4IMAA 5M1TA 3HF3A 4QDMA 1EF3A 3CQHA 4YCOA 2CU0A 3EMCA 4JY8A 3GWQA 4N02A 2Y61A 3QOMA 4CQ8A 2VOTA 1Q2RA 1K6WA 4XD6A 3PP7A 3PWGA 4AAJA 1V6TA 4O12A 1JVNA 3O8AA 1AQFA 2WHLA 4LAKA 1GKRA 2QMJA 3MC5A 2RFGA 3NZPA 1FDYA 2KX9A 2ZRWA 4FI4A 3UT0A 5C9ZA 3I68A 1TV4A 4RL3A 5CGMA 3AO0A 4REQA 3THCA 1K6AA 5A6SA 3G24A 3S6DA 1R5YA 1FWRA 3UR7A 1XDJA 4Y9OA 3B8TA 5IOBA 4ADSA 1BGGA 1WKEA 3H53A 1PYFA 3TN3A 1TV3A 2ZXDA 3HOJA 2CW6A 1RCQA 2Q8LA 2D20A 3NPWA 1SR9A 1R86A 4MYXA 4DLFA 3KBNA 4NNBA 3GC2A 1JXKA 3VOJA 3W1UA 3V5FA 3EWDA 4R33A 1QTWA 3P8JA 1W5PA 3MMWA 2AAMA 1SYTA 4LANA 3GO2A 4LUTB 3MUZ1 3LERA 3UR8A 1U83A 3B8VA 1W1PA 2CPUA 3LLFA 1KGUA 3WQ4A 1XCFA 1T7LA 3QYSA 3ANYA 1OGBA 4CKQA 5EMKA 4F9DA 2XVGA 3KL0A 3NFUA 4KF1A 2WZHA 4TTGA 1EEPA 3TNBA 1GNXA 1RJQA 4JL1A 1NFPA 3ZLGA 3M0IA 1EHNA 2EG8A 2ZC1A 4TVDA 1HVXA 2C14A 5BW6A 3HGSA 4MPQA 5D04C 4IMDA 4GQBA 2Z6JA 3LEPA 1Y8BA 5SWUA 4JBRA 2V8ZA 4G8TA 3RR4A 2H9AB 4FHAA 2VFEA 4J7RA 4AWUA 3WH8A 3NUKA 3EBVA 3OGVA 2ZUMA 1H7OA 3HN3A 1W91A 1E1EA 2V3GA 1TX2A 4IJCA 1XBZA 4PSPA 2QCMA 3NOYA 2CWNA 3LCXA 3ME3A 5A6BD 1FWHC 5FF4A 1ZJIA 5E5CA 1X8CA 4K1GA 1D3HA 4P8VA 2XN1A 3SCVA 3CNYA 3F2DA 3VK5A 3N15A 3PZTA 1HN1A 3EXRA 1M6JA 3KCOA 1PKMA 1NIUA 2HDJA 3BAXA 3I7SA 4EK7A 3SUSA 3WIJA 1AMKA 3MBFA 1A4MA 1FWFC 3WG6A 1S5WA 2ZQ0A 1VZWA 3U5YA 3A4AA 4FXSA 1XIJA 3UETA 5A8PA 5F7UA 1YDVA 1FWWA 1O5QA 5F2MA 5D2WA 5G4WA 3O05A 3WBYA 3ZZ1A 3MDUA 1EL3A 5GNXA 1GHRA 2WLZA 3A13A 4S3JA 2OO6A 4MIMA 1LL4A 4NAFB 4I90A 1KXHA 1V6YA 3W7JA 1QASA 5FJJA 3N6JA 3A4WA 1KTNA 1C3FA 2CHRA 3BSGA 3GNDA 5AECA 1A80A 1ONWA 1E0TA 1ZAJA 1OGSA 1H11A 1SPQA 4RNFA 3ARYA 3E9AA 4KERA 1VLWA 1H7XA 3ID7A 2F2KA 5KETA 3VOIA 1TB3A 1HXJA 4F0KA 1K9DA 3EEZA 3KS5A 1JD7A 4QP0A 3MV11 1E6QM 1WZMA 4JFUA 4HVXA 4JFVA 1DWFM 2EJAA 1X6NA 1UUOA 4UTMA 1KGWA 4CN4A 4PEKA 1YE4A 4QJ3B 2GGIA 4W87A 1JPIA 1WKYA 4MY9A 1J11A 3QZAA 1E0UA 1G1YA 1GKQA 4F2BA 1EC8A 1LT8A 2GJXB 1XD1A 2Y4SA 2YDQA 3H21A 5LNWA 3ARSA 3PWAA 4Q4QA 1HKWA 4JD4A 2UV8G 4ROPA 4LC8A 1OF6A 2O92A 4JHMA 3GQYA 4A22A 4MOZA 5G1MA 3PHAA 3DGRA 2QCDB 4MKNA 1KCXA 3EKLA 3USZA 1FKXA 4ORMA 3UQNA 3C56A 4J3ZA 2PU0A 3BAYA 3H2EA 3R2GA 1L0PA 5FD0A 2G95A 1LBLA 2YA1A 4LYQA 2FZ9A 2C79A 2NUYA 4WSHA 2PUZA 5DMNA 1QW9A 5CBBA 2E1DA 1VB9A 3WUGA 4WY0F 1W31A 2OELA 3JVAA 1XDLA 5CGQA 4Z0JA 5HMEA 4IQEA 4PN2A 3L5LA 4LUJA 4NRSA 1VPYA 1ZJBA 3M47A 2DH3A 2DUAA 2WZEA 3BCFA 3TXZA 4M3PA 3B06A 3EXTA 3C61A 1KXQA 3MI6A 3O15A 3HMJG 3WNOA 2B7QA 2O7QA 3C3UA 1IE7C 1UWQA 1HJQA 2DIEA 4IFRA 2BGSA 3SRFA 3T2OA 2Y8UA 3LM7A 4GO8A 5T8GA 1PEZA 3AUOA 2ZDSA 3K5XA 1JEZA 3M1ZA 1G4TA 1AJ0A 5L9FA 4TX8A 1A5AA 3OW1A 1RJPA 1XLCA 4H9MA 1QHOA 1FWDC 3MV01 4IP5A 1W3HA 1JCYA 1QNRA 2OPJA 1ZZMA 3G18A 1XL9A 3TROA 3A4JA 1WOBA 2PU1A 1L2UA 2DIJA 2XGIA 1POKA 3BOLA 3ZFHA 1BG9A 2BWGA 1E9LA 1E40A 4QE1A 4WXZA 4C1LA 3S47A 1PJ9A 1A50A 5CJNA 1VIWA 3GXFA 1L6SA 3UY7A 3PB2A 2ZUTA 5AKQA 3PTMA 2HSAA 4Y8EA 3NAVA 1SFLA 4I9JA 4ROQA 1ML1A 2OSYA 5M03A 1TTPA 1JUBA 4V15A 5FEZA 2J7CA 1L2QA 2IUZA 1WZKA 4X3ZA 1UR2A 3TYUA 3E02A 1AW1A 1O94A 1KM3A 3LGEA 2C71A 3HQ1A 3BV4A 4NZ3A 2BXYA 2BVDA 3G6LA 5KINA 1JDDA 1TKKA 4PMZA 2R14A 1UR1A 2GYIA 3R58A 3S1XA 5BRBA 3WDHA 4C6EA 1XICA 1UBSA 1S1RA 1W3IA 1AL8A 1KFEA 3WO8A 1V8EA 4P7NA 5I79A 1F73A 3F1QA 4HHLA 1WP6A 1OK4A 5CH9A 1H0IA 3C2EA 5D05A 2RJGA 4AHQA 2WSQA 3PY2A 4DBEA 3O06A 1QHPA 3LV5A 5JBDA 1R2SA 4C7FA 4DPPA 3TU9A 2A79A 4A3QA 3I3BA 5LNVA 2AKMA 3I7RA 3R0DA 1BFNA 1TE1A 2TRSA 4WDXA 3TW6A 1BVWA 1Z42A 1GPWA 1XLMA 1N8FA 2YCLA 5FIPA 4BI7A 1KC7A 3R43A 2Y89A 2PRLA 5HNNA 1R2RA 3TP4A 2ZTJA 1XLFA 1GCYA 3U0HA 3IPWA 1M65A 1SZRA 3GLCA 3ZWTA 4GX8A 2Z28A 3GTHA 2NW0A 2PRHA 1M41A 4AB4A 3VZYA 3N3TA 5E6ZA 4RE2A 3C2YA 5HR6A 1UH3A 4B90A 3ZR5A 1SW0A 3H7UA 2CESA 2OWXA 3G22A 1VEPA 3SFWA 1SFJA 2XSXA 5C54A 1RD6A 3V5OA 5LIKX 4JTHA 1WXYA 1QI2A 5AYBA 2NSOA 2YFOA 1ZAHA 1BD0A 3ISIX 2Q8XA 1LUCA 1UP2A 2DZAA 3KWSA 4TMCA 1TTJA 3MCNA 5LNUA 2NV2A 3EDDA 4HYRA 3LI0A 4QS6A 1U5JA 3QKZA 3W6YA 4IWWA 3GSMA 3WQDA 2E67A 4Q3MA 3FKKA 3VKDA 3SN0A 2XVLA 5DFAA 3KDOA 3UG4A 5I06A 4FNTA 3TN4A 1GJWA 1W9XA 2DT3A 3GYCA 5CAKA 4HHMA 4PYSA 3BOXA 4LAOA 1W1B1 1UWTA 3AI0A 4AIBA 3E0FA 2FVMA 3BGJA 1L9WA 1P0DA 3HG3A 2OEJA 3W84A 1OD0A 2VZVA 1KXVA 3SCOA 1VCGA 3AIBA 4JZ5A 5EBUA 2D3NA 5T26A 4QX4A 1MNSA 3AZTA 4K39A 1IEXA 4LS0A 1NAL1 4ATLA 1TSIA 1NM9A 2YDAA 3N2MA 2CC0A 3LCGA 1ICSA 1B54A 4XUGA 2OTDA 2NVDA 1ESWA 2ZA2A 1V93A 1HGWA 3N2CA 2WJEA 1US0A 1UKSA 3C2RA 3OVPA 4YU1A 2HWGA 4ML4A 4AC7C 2OWWA 5FJOA 3RLVA 2FVKA 2VDGA 3WEMA 5MF5A 3R10A 4HN4A 1Y5VA 2PWVA 1KFCA 3MPGA 1KFWA 2PDLA 2ZVIA 4AU0A 3QY6A 3TTEA 4P8WA 3NGJA 3DERA 3FJLA 1XFBA 1KRAC 2ZX6A 4LYPA 3WYZA 3GNNA 3KOZA 2EO7A 5A8MA 1YW1A 4BQ5A 1IT8A 1EWEA 1J2BA 4ZB2A 3RK8A 1XH1A 1QW8A 1EWDA 4JICA 1FWIC 3WLPA 1MEHA 1JDFA 2J78A 1K4GA 2QR6A 3ANUA 3PNUA 4IF2A 1S3HA 1X6UA 2A0NA 1C92A 4S3DA 2YBVA 4OECA 2AQVA 3MYPA 1YRRA 4XZBA 4U2ZA 1GOMA 4GJ1A 3ZMRA 2NX3A 4C65A 2J27A 1MYRA 2XM2A 4YHEA 2BLEA 1P7TB 1C7TA 1BWKA 5E6YA 3EA3A 1W5MA 1A5MC 2QCNA 4XAFA 2NLIA 3E3HA 3EX4A 2YCLB 1JZ5A 3MVTA 3W86A 1VJSA 2V2HA 1J18A 2HXUA 3DAQA 3LOTA 1IF2A 3W7PA 4OUIA 4QSFA 1FKWA 4UZSA 3VNZA 5B7YA 4MKVA 1Q6GA 5BRQA 4GK8A 2VC6A 1JZ3A 4C1KA 3AMLA 2P3EA 3WJWA 1W3KA 4KS0A 4O16A 3EX1A 1EJSC 1W3NA 4X61A 2QCHA 1S2WA 3HV9A 4NYUA 4OBRA 3W25A 4ZFMA 2HJPA 1C91A 2VQTA 2XSAA 1GVEA 3AS3A 4EPBC 5A2AA 4B4HA 5G5IA 2Y0FA 3HGJA 1KKOA 1QPQA 2BS9A 2HV5A 3BLPX 4L6HA 3ES7A 3TC3A 4LVDA 3QHOA 1UR9A 3V18A 1AQ0A 1JZ2A 1YTEA 1GVIA 3MMDA 1VBJA 3EMZA 1JYNA 3UGRA 2XWEA 2RAGA 4FPSA 5U4NA 4XKYA 1VPXA 4V27A 1B5TA 4MFDA 2PDPA 4W5ZA 1IT7A 3UVIA 5CCZA 3W74A 3OVGA 3C0SA 2EKGA 3MSDA 1YKWA 2G0WA 5BXRA 1CGTA 4M24A 4Q8VA 3OB8A 1K03A 1NWRA 1N8WA 3HU7A 1DXFA 2JQXA 5FL1A 1NFGA 1CPUA 1TO3A 3S2LA 3AIQA 2R94A 1JF5A 4I8DA 4Z17A 1XM3A 1UH4A 1SW3A 2JF7A 4OBTA 4Z1YA 3IJDA 5I23A 5J5RA 1JNEA 4HQVA 1RBLA 1H60A 4LYRA 3WF4A 3MQTA 4RR4A 4AW7A 3HGRA 3TSBA 2CLLA 3E74A 3IJLA 4ZB5A 4WJEA 5M17A 1IXNA 3AIVA 1OFAA 4QHRA 2GVGA 4ZL1A 2E40A 4Q8UA 3STGA 1AK5A 2UY3A 3Q58A 4HCDA 1E55A 3WH5A 4B5SA 3WUEA 1MFUA 3VVGA 3AHXA 1LL6A 4JQ3A 3AHYA 2ZCGA 3T44A 1W3LA 1MDLA 4PUWA 3S9ZA 3KVMA 2Z24A 1UBPC 3FJNA 1TX0A 4WK9A 2JGQA 4CD5A 1BVNP 1U1HA 4MMWA 1LRNA 1HIZA 4GBUA 1NTHA 4UBPC 4GNVA 1J6OA 2FIQA 1K70A 1KFBA 4FR6A 1MZRA 1PB0A 2WMIA 1TJPA 4DBDA 4PMUA 1UD6A 5BROA 1MXGA 1WKDA 5LIWX 2E5BA 3LPFA 3W85A 1YXYA 1I2OA 4NX5A 4UTIA 1CZ1A 4ZO6A 4GO9A 2DZSA 1KM2A 4MZ8A 4JCMA 2J8GA 4X2PA 4OV4A 5LKYA 3NXLA 3E0LA 3NQCA 2RGMA 3FA3A 3ZJ6A 3EXSA 3IANA 4K7VA 1FH7A 2DSUA 2YL9A 3O2LA 3L5MA 4HNCA 1VRDA 1ZBCA 2FJUB 3TSMA 1QRQA 2XJ7A 3AIWA 2KZHA 2DSKA 4HJFA 1IT0A 5HPCA 1FWBC 2YCKX 4IP7A 4Q8WA 3MUCA 1V4YA 3FA5A 3LCHA 1XI3A 3MHGA 5TAOA 3EA1A 3TYZA 1G4EA 3GZAA 3B0YA 2VXNA 5FSDC 3HQNA 4H8NA 2Z6IA 3NVTA 3SY8A 4DPQA 2BGQA 3LK6A 1UR4A 2ABAA 4PFHA 4CEUC 3LCLA 1M5WA 1W5QA 3CJPA 4Z2HA 4KBXA 4EXQA 1IXQA 4J3UA 3VE7A 1BG4A 2QDDA 3RX3A 3M4HA 5G1TA 8RUCA 3AIEA 2IW0A 1VHCA 4UOJA 5CSUA 4NRRA 2B7PA 4JTLA 4AG0A 5K9CA 3C0LA 2QJIA 4PB4A 4NAEA 4L5ZA 4RE3A 1MEWA 4JTTA 3VOGA 4D6IA 1ADSA 3FEQA 1PZ3A 1W56A 1PPIA 1MEIA 4AX7A 5JH2A 4UMCA 3VGEA 5E0KA 1DTNA 1W1YA 5IDIA 1UWIA 1DWAM 1SZFA 4Q4RA 5DCBA 4J35A 1QUMA 3ARXA 4HMNA 2QKFA 5ECUA 1OFOA 5DY3A 1QW7A 4GC3A 3QV7A 5REQA 1CWYA 1WDRA 4YYFA 1KBKA 1TR1A 2ESCA 3P93A 5GPRA 2CZVA 4XB3A 4FX6M 4NJKA 1W9VA 3YPIA 3GXDA 1SMAA 1V7YA 4R5EA 4UUIA 2E6FA 2Z29A 3VIIA 1JUKA 2WCGA 3WNPA 2VD8A 3KBMA 1P6WA 3BH4A 3QQ0A 1KFLA 1EA0A 4HNNA 5B7ZA 1I75A 2VFIA 5FF0A 1S3TC 2XGZA 2A7PA 3AYVA 5HNUA 4IIHA 4RV3A 1DJIA 3CEUA 1HJUA 4BR1A 5KITA 2G4FA 3KCJA 1R3YA 3DYMA 3NSXA 4XVDA 4QISA 3L4UA 5EA9A 1H50A 2XDFA 4U3AA 3T08A 1A5BA 3AMKA 4ZGYA 5AHFA 4OWGA 5D33A 1X6LA 4XUYA 2NQHA 2Z0IA 4JTEA 2F38A 1XCWA 3H26A 5A6MA 1NP0A 2WNQA 1XP3A 1QJWA 2Z4GA 4INFA 2J13A 2QCFA 5IBXA 4QJ5B 2R1LA 3VU2A 3QFWA 5FESA 1LQ0A 2OLSA 3V0SA 4O17A 2O9TA 1TA3A 3CUGA 3JZUA 3A21A 1ZJAA 1UCWA 4MTVA 1UP3A 1F9CA 3M07A 3HPAA 3VZZA 3LCWA 4H9VA 4V33A 2XFYA 4B9YA 4K36A 4RNHA 2FB3A 2G37A 4PMXA 1OX6A 1MWOA 1QCWA 2QVNA 2PSNA 3O6AA 3T8LA 2ODOA 4WKFA 4DF0A 4WHBA 3GIQA 1UD3A 2Q8ZA 5CSYA 1Q6OA 1M7XA 1PWMA 5E09A 3L0NA 4K1WA 4C6JA 3NNTA 4AZ6A 3SUUA 2WJZA 4Z1BA 1MVYA 3AWOA 3P67A 2WSRA 3LQGA 1HTIA 2J47A 4UNKA 5AY7A 1L8NA 4JN8A 2E8YA 4S23A 3M0KA 2PDBA 4RK8A 4QJ1A 3CH9A 4QS5A 4I7WA 4B5VA 2G3MA 5I5RA 3W2UA 3NQMA 4E8CA 2WANA 2E6AA 3GKFA 1PCWA 2UY5A 3CMGA 1FHVA 4IUOA 3B8SA 4FIQA 3CZ8A 3S5ZA 2Z2BA 4HK6A 2REQB 3W37A 2A7NA 2C18A 3UD6A 4DI9A 3VDBA 4O11A 4WY0B 1ZQ5A 2X1RA 2HE5A 1ZCOA 3CUZA 4E38A 1AZ2A 3W6MA 1VBRA 2J7GA 2QMKA 4MB4A 2QUTA 1RCXB 1E9IA 1CIUA 3RN6A 1OD8A 3GY1A 4IGNA 3TYBA 3FY1A 3UYCA 2XH7A 4QG9A 1SUXA 2CZFA 3KTXA 5K9XA 3AHVA 4HOZA 4MKSA 1XHGA 3A9IA 4ICMA 4FXJA 1JXJA 3CHEA 1FDZA 3QW4B 4LU0A 3VGBA 1ZBVA 4X0VA 5HWJA 4ZQRA 3R94A 3V36A 3H2OA 1JPMA 4RW5A 5D09A 4O1BA 2QPUA 3R5EA 3U2EA 3OQEA 3RG6A 4P7RA 3CLWA 3BDKA 1BF2A 3URAA 3A4XA 4AWEA 2YGYA 3NDYA 2QPSA 2Q02A 3DG6A 1PIIA 3MKCA 1G5AA 3HFTA 2EHHA 5GVJA 4RDYA 5JVLA 1R87A 5D9OA 1Y7VA 4P8UA 4R7JA 1FHLA 8TIMA 1ENUA 1MW2A 2JIEA 2QV5A 2OEKA 1R3QA 3B40A 1RQHA 4R3UA 1F4AA 1KM6A 2FDSA 1X1OA 1O4UA 3RILA 3QQWA 3HPXA 4H9UA 4WF7A 4GABA 4LV9A 3BL3A 2ZICA 5M2FX 4W88A 1AL7A 1DEDA 2CETA 4Q7IA 1TCDA 5DF0A 1EP2A 3GW0A 5LA2A 3UERA 1GOWA 1UR0A 4ZZ9A 2GJPA 4XIMA 3RLUA 2R6OA 2ISSA 3KAOA 3S2CA 3UWVA 1B3WA 4HP5A 2E4TA 5CPOA 1VHNA 1EGZA 3CBWA 1YNQA 3SCWA 1LOQA 4I6VA 1ZSXA 3C0JA 1CB2A 2Z1KA 5EMUA 4MY8A 3P62A 3K1GA 5XIAA 2BZNA 4JIIX 6PTDA 2J7DA 2V63A 1IGWA 4B16A 1L6YA 3G1FA 2ZUUA 3E2RA 1FVPA 1VYRA 2EXOA 4DRSA 3W02A 4RDZA 2C0AA 3GG7A 3EWBX 2NWRA 1AG1O 1RPXA 3BANA 3HZ3A 4FP1A 1PTAA 1B3OA 1OZMA 3NQBA 4XSMA 3RPDA 5C9WA 3MJMA 2HVMA 3SGGA 3LMZA 2DPEA 4QDWA 1EQPA 2WVVA 2GUUA 4HJWA 4UNLA 3DYOA 3E12A 1GQLA 1VBGA 4NVTA 1UA3A 3TQPA 3TJXA 4F0LA 3K4WA 3IS4A 3CPUA 3CWNA 3DFTA 2YA0A 3M43A 4Q32A 2ZC8A 2AOSA 3FK4A 1AD1A 2YPIA 3LYEA 1R9YA 1GYLA 1DPMA 2GL5A 2PF0A 3H2AA 4TX9A 1RV8A 1QNPA 3SQMA 4MF4A 4TTUA 1EGMA 4KWOA 3PPHA 3N2TA 4B92A 3P81A 1A3WA 3BW3A 1YDNA 4E5TA 4H8VA 4KRZA 1T0OA 4PH6A 1WPCA 1EYWA 3H7VA 4AISA 1TWZA 1D8CA 2A1YA 3DG7A 4BFAA 1OYBA 1HP5A 1S2TA 4AQLA 1QI4A 1GOOA 3W1NA 1EP3A 1RD5A 2J75A 2OFJA 4GRSA 3WMBA 1BXCA 1QBAA 5BNKA 4LOCA 3NPXA 1DJHA 2DEPA 1I2QA 2IQ0A 3ITOA 3JUGA 4J3WA 3GAKA 2VZTA 3QQ1A 1S1PA 1RHCA 4M6PA 3CZLA 3T07A 4LH8A 2VHLA 1GEHA 4OHQA 4IISA 5LXXA 3M0HA 3WELA 5AC8A 4E2OA 5HWNA 3UESA 3LGDA 3BVJA 2D0HA 3IIXA 2JKAA 4PMQA 2PDHA 3KBJA 2PTDA 3WZ0E 4XZIA 1DWHM 3MO4A 4JNMA 2QDEA 2X0YA 3M0VA 3MMUA 5DANA 3BOFA 1BSLA 4JIQA 3FAWA 3OO2A 3PZMA 4JTDA 4EXAA 1EYEA 1JQVA 2ONEA 3VO0A 3HG4A 2GPTA 1ZP4A 2DGAA 3EMQA 5F2IA 1QMLA 1G67A 1XGZA 4DWSB 3EB3A 4F66A 4S2BA 3E96A 4E4FA 5BRPA 2B7NA 4CNNA 4ZOCA 3F5KA 1E9ZB 5CGTA 2X2GA 1W37A 3QEZA 4HNVA 2VCCA 2VENA 3VAVA 4S3FA 3EX6A 7REQB 4ICNA 2FTYA 4ZO8A 1PZ2A 1W3JA 3RPMA 3S9IA 4JN6A 1NARA 5XINA 3G1SA 3KHJA 1M53A 3B8WA 4ZO7A 4W7WA 1Z48A 3BURA 4DNMA 5AVNA 4R53A 2W62A 2XH0A 5EFFA 3KZSA 2FHFA 4HPHA 3SADA 1GPFA 4O0ZA 3W1RA 1XX1A 2IPWA 4I9AA 4GMEA 2BDQA 1LLWA 2G97A 3WEZA 4LPCA 2J7HA 4L6DA 2Z25A 5IDZA 1N82A 2WVVB 5CPNA 4JOMA 4QQ3A 1FXPA 5D2VA 3T8QA 3MSRA 4E8GA 2P10A 2GWNA 2GSEA 1IV8A 3IUIA 2X1SA 5IBXC 2UWFA 2CHNA 2WKGA 1I2PA 3ZQ9A 1B1YA 4HZ7A 1JIBA 3R0KA 4KQNA 1ZU8A 3QGKC 1PSCA 4CU6A 4RV8A 1XLKA 3ITLA 3RRXA 1MNZA 4EPDC 3CV6A 4IT1A 1JAKA 1EUNA 2VT0A 5BOFA 1G7UA 1TG7A 1V6WA 4PCSA 2DU2A 1CB7B 4XAGA 1MQPA 4ZE5A 4E3TA 3PBVA 4NKCA 3GXPA 3IJ7A 1Q7QA 1X39A 4QEEA 1I0DA 1TZ9A 3QC0A 4HZ8A 4WGXA 2BHZA 3D6NA 4HU3A 2OT0A 3OZMA 1W0MA 2PDMA 1H0GA 5BXPA 1UC5A 2PC4A 1FCBA 2BOFX 1NDYA 3WNLA 3DCPA 2WSKA 4Q4OA 5G2IA 3UZ5A 3CZKA 4KCUA 1J2WA 2J62A 4MHBA 1RBOB 4IUGA 1EXPA 1R3WA 3FXYA 5HNRA 4KFNA 5LA1A 3AS1A 4OKDA 3TYEA 1Q4WA 4O1AA 4CCZA 1MQRA 3MP3A 3O7UA 4W85A 3I6RA 2HK1A 4HT3A 1PUDA 1YHTA 1EBGA 1ME7A 3PZIA 4H1ZA 1RK6A 2DSWA 3FDGA 3CMFA 4JTJA 1TZ7A 1QPNA 3TIMA 1HNYA 3THAA 3SN1A 4PMNA 1K8ZA 4WJXA 1BGAA 3LV6A 4L56A 1M1BA 2P8BA 4B5XA 4F40A 3SIMA 5DT7A 2JE8A 4EAYA 2ISVA 1EF2A 5FL0A 2Y62A 4ZR8A 1NEYA 1PTGA 3S0CA 4MWAB 4H7VA 2SFPA 6ENLA 3H6OA 4WSJA 4MJMA 1S38A 1CXHA 4H6KA 3W73A 3LDVA 5D38A 4F0MA 4QIUA 2R82A 5IXEA 5KZDA 1M01A 1WZAA 4QM1A 1Q63A 3VABA 2E0PA 2Y88A 5DMLA 3CAWA 3DKLA 3LMYA 1W1IE 5BXSA 4N9DA 4N9EA 2OXNA 3WQCA 4JDYA 1E56A 3NPUA 4MFEA 4A3RA 3FX4A 3F5JA 4Q8PA 4PMVA 3LRLA 3UPMA 6REQA 1GVOA 1POJA 4C6BA 1UD5A 5G4EA 4N6FA 4M81A 3HPZA 1XC6A 2VDIA 4R9OA 3OTRA 1AODA 1A3HA 1XIDA 2PGRA 4BI6A 2B81A 4GPNA 4A2RA 1HG3A 4G5DA 1SFTA 5HOSA 5K2ZA 1OIMA 4CNTA 4PA8A 2NQJA 3LPGA 3RCYA 3LD5A 3OA3A 1RXOB 4PMJA 3ELFA 4ZVJA 1ZHAA 5CAHA 3GFZA 4XWUA 1FWSA 3VYLA 3O6CA 3LZ3A 4AIOA 3C2OA 5D4YA 4YTRA 5H1WA 4NXKA 5E0CA 1LORA 1B30A 3GVVA 2PWFA 5FJPA 1K7XA 3KOWA 3OBKA 4MY1A 4HMEA 4JYEA 1M03A 4H83A 1MW1A 1PKNA 3QV8A 3W7IA 3PPFA 1C9DA 2QUNA 3BW4A 4PUDA 4UOZA 3TSDA 1Q6DA 2QXWA 2QLYA 4AZCA 4WKHA 1AFSA 1QHZA 3F4NA 3VMNA 1ONXA 1THFD 1XCXA 5GJMA 2H3BA 4CUCA 3UGVA 5KZMA 2ZFAA 2I16A 3VD4A 4H9XA 4W93A 3GX9A 4IL0A 4LWWA 1HUVA 3TYCA 1K3UA 3SR7A 1IQ8A 3HG2A 7ODCA 3AZRA 1JGIA 4HYVA 4PBGA 2WZMA 4MNLA 4MNJA 3W01A 1NVMA 2W67A 3FJ6A 1IR1A 4UTWC 5I3IA 1NOFA 4ZEPA 4QLKA 3CHFA 4GJIA 4EF8A 3QV6A 4DNHA 2NZLA 1TTIA 1TREA 4LGXA 4LY4A 1ITXA 2D22A 3CH0A 4GFIA 1ZLPA 4R88A 1EQCA 1B4KA 4YS1A 3CUHA 3VOFA 2Z27A 1WB0A 4X60A 4KH2A 4ZSTA 4WSKA 4DLMA 5IHSA 1I2NA 3W71A 1TMLA 1FDJA 1DJNA 4OQVA 2AQWA 3DI1A 3PWIA 2H8XA 2XWDA 4JN7A 3TAKA 1GOXA 1ISYA 3ORWA 4MGGA 3CL8A 3STFA 5HA7A 3S2MA 1VFUA 1V0KA 2OR2A 3LA4A 4PUKA 3DGBA 2WO5A 3P3BA 1V6VA 4HTBA 4DYJA 4NNAA 1O5KA 1HZYA 4IFKB 3S8HA 1F05A 4UMBA 3WY1A 1BQCA 1ZTVA 2J6XA 2GOUA 3NWRA 2G5WA 3TYAA 3W28A 3GDBA 4K3ZA 3WMLA 1X1NA 5DCDA 1KB3A 1LYXA 3UR5A 3B03A 1Q6FA 3GDMA 1Z7AA 1D7KA 3BG9A 4DVOA 1DBTA 3LXBA 4PULA 3K8KA 1PKYA 3TTQA 3W76A 1DOSA 1XPGA 2YDSA 1DE5A 3A64A 1F8MA 1WKFA 1B3VA 1R8LA 1C7SA 3MUY1 1GORA 4DBWA 2PDNA 4DXXA 4L9ZA 5EKYA 3UZYA 6REQB 4GA8A 1EZ2A 1OGGA 1JCJA 1MUCA 1UD4A 2VEKA 4XD5A 4C60A 2OZ3A 3FFSA 3I4KA 4AZHA 1E3ZA 1W8SA 4MDPA 3Q67A 3VDHA 1LLZA 3DKJA 1OFBA 1VRXA 1XKYA 1BKSA 1TPC1 4UCFA 1PYMA 5A95A 2VZSA 2YYUA 4FB7A 3A9BA 2PGFA 4KGJA 9RUBA 2FQIA 4U33A 3G8EA 1W1A1 4QJ4B 1RZMA 1Q85A 2QGYA 3UWEA 2ZRXA 4DO5A 3POHA 1P0EA 3RUBL 3L67A 4FNRA 3VIOA 4J3SA 1W9UA 3L4VA 3M0MA 4DXKA 1TPEA 3O07A 2WXDM 3KVJA 1B2YA 4JQAA 1JF6A 3NZ1A 2VX4A 5GJNA 2WC4A 4RNIA 1VBUA 2XM1A 1VQTA 3N34A 1XIBA 4A05A 2YOCA 3W38A 1Y5XA 3Q65A 3R1ZA 2EAWA 1VBHA 3I7QA 3LG3A 3OGRA 2VGGA 1H2JA 3VD5A 1UWUA 4IHCA 2GJLA 3PUOA 1DHKA 2G3IA 1EUAA 2HZGA 2VDHA 3SRHA 2YDRA 2OQHA 4AWSA 4Q4SA 3N6QA 3W00A 1T40A 3IUDA 5JBFA 1KM0A 1E6RA 4PMRA 4FOUA 4AZCB 4CD7A 4CVUA 4TX6A 2VM8A 1KFJA 3LHZA 1X8FA 1E4LA 3OQ8A 4Z1AA 4AD2A 2HK0A 4TV5A 4EWND 4WDUA 3DI0A 5KTLA 4H9TA 4QR6A 3RR1A 2WCSA 1L8PA 1JYXA 3RXZA 4J2PA 4NASA 1S2CA 2XVKA 3WSUA 4EACA 3VNLA 3SCPA 3GVGA 2PDCA 1TWIA 2V30A 5EL1A 5C0QA 5F4WA 3AYSA 4TO8A 1XIEA 2C7FA 2NV1A 3WUFA 6XIMA 4RZBA 3BAIA 2NX1A 2ZZ1A 3T0CA 2P5NA 1IZCA 1FWNA 1R3RA 4XBJA 3QR3A 3W7HA 4M29A 3VXGA 3AICA 3TYDA 3CM4A 1W9PA 2W79A 3TOPA 1E0WA 4L1XA 4C1NA 1SR0A 3CWOX 1XSJA 2E9BA 4IJBA 1FWTA 1VFTA 2FH6A 2Q6ZA 3R11A 1JAEA 5HULA 1MSSA 2EPLX 3VNIA 1H7WA 3NQ7A 3A6OA 3DHPA 1XLAA 1P1MA 3BW2A 1Z89A 5JUVA 4CGTA 2XPKA 4F2UA 2HCVA 1R85A 3PK7A 3TJIA 1FCVA 4D9PA 3BQ5A 1MXDA 2E3ZA 2QGHA 8CGTA 2G3NA 4IICA 4O1FA 3MY9A 5AZ1A 1JFHA 4B3KA 3A3WA 4LRTA 1CGUA 4URIA 1S5VA 5AC4A 2PDFA 5BOEA 4YHGA 2FFCA 2ZE0A 1BXBA 2PDKA 5C70A 1OX5A 4LCRA 2ZX9A 1NSJA 1UW9A 3B04A 4JTUA 5GNZA 3GHSA 4GZIA 3EZ4A 3U5UA 3UJEA 3W7LA 4DO4A 1FX6A 5EFDA 3P84A 1V77A 3EGJA 3GHRA 3KUMA 3CHDA 4OJYA 1V79A 2HPIA 1VKFA 1EJVC 3FGCB 3IV8A 1E4MM 3T2QA 1RALA 2ACUA 3N19B 1IGSA 3SGZA 4U5IA 4MWAE 5FJRA 2W27A 4ORIA 5EU9A 3SSZA 4HSOA 1VPQA 1KTBA 3PJWA 4E4PA 5K4XA 4U3CA 2EF9A 5FAGA 2VEPA 5C6MA 3F03K 5HBFA 1I1WA 3VIPA 4D1JA 3WBEA 3KL5A 1U30A 4UTTA 4DJEA 4ZBCA 2I5IA 3R79A 3SN4A 1TPWA 2OOGA 3EB2A 2QUUA 4P7QA 1YXDA 2QJHA 3PUEA 1US3A 2ZUNA 4AVOA 3VNKA 3TZNA 2Y6ZA 4LUSA 1TCMA 3MP5A 2VFFA 1RLCL 2QV4A 4D2JA 2VRJA 3B9AA 2PP0A 3G2GA 2G3FA 4YCPA 3TXVA 3N3MA 3DDMA 2E7FA 4DJDA 1H3GA 2HS8A 4JCLA 5F1VA 4W86A 1XH2A 4LXFA 2Y8KA 1UWAA 1XBXA 2J8FA 3UBPC 4OE7A 5F2LA 1TV5A 1KCKA 3FIGA 3FS2A 2V3EA 5CPTA 2D24A 4B5NA 4GKTA 3BJTA 4Q6JA 3KOFA 5D8WA 2VELA 3L2MA 1DQXA 2O56A 4TVUA 2A3CA 1RY8A 4D6JA 3P5YA 2OSXA 4FZIA 3RCMA 4FLOA 1MO0A 1U5VA 2YL6A 1PHWA 4OGZA 1CYGA 3S46A 1P0BA 1GJPA 4F3HA 2Y7DA 1EIBA 3PZUA 3TA6A 3DHFA 1E72M 2HROA 2POZA 4JTQA 4RE0A 4UXDA 3W2NA 5H2ZA 4MUZA 5U7SA 4B2DA 3N4FA 4WIWA 4HNUA 3M5XA 4GNKB 3W1TA 4LVGA 1UQYA 1GHSA 2FGLA 5G4HC 3SY1A 4IG2A 1F3XA 4CN1A 2QUMA 2CERA 2GJNA 1TQXA 3PVFA 3B9DA 4NP7A 4AMCA 3WN6A 3WL0A 4LRSA 5DLCA 1OIFA 1RVGA 2VFGA 1YE6A 2VR5A 4UOQA 1Q4NX 3T6CA 2YYTA 1QFEA 1B90A 4XG1A 4M7SA 2V5LA 2Y63A 2UBPC 2ZYFA 1S2VA 1V6UA 3VGHA 2E5CA 3M6YA 3WJXA 3AXXA 1E51A 1JI1A 1SW7A 4N7QA 5A8GA 1DJYA 3PUGA 3S9YA 1QNQA 5AN7A 5LIUX 4XISA 1KXTA 1OC5A 3LHVA 4LJ3A 1ADOA 3C2VA 3UYIA 3WMSA 3S3GA 1E1FA 5T91A 2Y24A 5LHEA 2DT2A 5DCEA 1PAMA 3BE7A 1CX9A 4EANA 5EB8A 4H2HA 3TNOA 1BPLB 1CENA 4AD1A 1J10A 1YBQA 3LRKA 1T5AA 2PCEA 1XRSA 1CXEA 1I1XA 3EEGA 1CLXA 3W81A 1C93A 3WCZA 1KR1A 5CG7A 5HWMA 4F0RA 3MTWA 1FQ0A 4EF9A 3P0WA 2R24A 1VFFA 1IYXA 2G96A 4KWWA 1OHLA 5FAJA 2BY3A 3N1AA 5AYYA 3W2KA 4LUIA 1H49A 1AH4A 3RM9A 2WV8A 4LUSB 4B5WA 3VA8A 4RDVA 4M19A 4CQ9A 4JEJA 3ICJA 5EGRA 4AIEA 4XAZA 3HBLA 2NVAA 3SRKA 3W7QA 1R9ZA 1MW3A 2QUVA 4PRWA 1XGEA 1SU5A 2V3DA 4FNQA 4TU1A 1DIOA 3T55A 3VDAA 2CLFA 4KESA 2UZ9A 1YTKA 4H7ZA 4JNZA 2OZ0A 4GBDA 1XH0A 4LNYA 5CC3A 1KM4A 1NU5A 2JIWA 1TPFA 4B4FA 4FLRA 2QJGA 4KGLA 4AZGA 3BSMA 1WQ5A 2L5HA 2JBMA 2GSHA 1EHAA 2WSPA 4R85A 3A24A 4JL2A 1B31A 2ISFA 2A6LA 3GZ3A 4DUVA 4GH1A 3FKRA 4D6GA 2J7EA 1GOQA 4UFJA 1UQZA 3N13A 4ACZA 4OVXA 1PKLA 6TAAA 3UPBA 1FWGC 1HFBA 3TWAA 3GE7A 4H6RA 1IEWA 3E2SA 3ALFA 4UC5A 3SCQA 3NYDA 4RKAA 5DRIA 4AH7A 3A12A 4D8AA 4BWLA 1S46A 3T09A 3PC0A 1EDGA 2I1OA 4AD5A 3C8NA 3ECQA 1Q6LA 3R0UA 3NDZA 2VC9A 1XUUA 4HA4A 1XR2A 3RRAA 1JCLA 1ODUA 2XFFA 3CIVA 1NOWA 1OCJA 3UWUA 3PS7A 4HPJA 3S83A 3UNDA 3T81A 4JYDA 3AROA 1BXNA 4GGHA 3K46A 1EJ7L 4TV6A 4H19A 4EXBA 1OBAA 3M0JA 1J93A 1SSGA 1A47A 3EWUA 3WQWA 3WLKX 2GOKA 1EX1A 1KGXA 4MLRA 1JPDX 1GUVA 4KCVA 1DP0A 5A1AA 3GG0A 4Q8NA 3AS0A 5KZ6A 2GJRA 3TTSA 3VE9A 4J1OA 2CEQA 1ISXA 3VUSA 1H7PA 4YTSA 2RUSA 1TUFA 4HGXA 2H3DA 2ALRA 2X1UA 3FDKA 5DN1A 1C8XA 3QLLA 4ENLA 2PLCA 2YLAA 5EY5A 1CI1A 1B3YA 3LNMA 4A3YA 2XN2A 2PDXA 3SY5A 4IPLA 1HL8A 4ECLA 2NQ9A 1J01A 3LLDA 1S39A 1HGYA 1IIGA 4H04A 3BWWA 1IZJA 2YXXA 2ZX8A 2J9YA 3W7MA 4C90A 1TZZA 3CQKA 1E4NA 3GVQA 2PBGA 1G7VA 3W1XA 3SB0A 3IIVA 3SDOA 4CNPA 1CXLA 3BO9A 1WA3A 2D23A 3U8GA 2CLPA 4O13A 2OLHA 3DUGA 1DJGA 2DVUA 4BCEA 1DWGM 3BLOA 2O4MA 4GQRA 5D03A 3N9RA 3O63A 5J04A 2WB5A 1W32A 5I0DA 1MRQA 4E6MA 3ONCA 3O1NA 2B0MA 3AYTA 4RPQA 1F8IA 4FX8A 4MVAA 4YIWA 4AIUA 3IUHA 3G5EA 2DIKA 3W2MA 4FMVA 1EO5A 3CHVA 1TJ2A 1I60A 1QOPA 3U9IA 4NI3A 2QAFA 3G1RA 1J9YA 2V6AA 4XZ9A 4EE9A 2PI6A 5ABFA 1TWSA 3EPNA 1PV8A 3ZSSA 4MUPA 4WJ8A 1GVSA 4IQDA 3ZT5A 3UJFA 2QW5A 4J3TA 3F7JA 2WCAA 4NJHA 3N2XA 3ABOA 2YKKA 4RJEA 1GTHA 3W75A 2HS6A 2DT0A 4UTTC 4DJEC 1BHGA 1NF0A 3W23A 1UHVA 5E93A 1D2KA 4DO6A 3SCSA 1RA0A 4N4PA 1U2YA 3NQ6A 4LY8A 1Q6RA 2VR4A 3WLIA 2OGJA 4ACZB 2C0HA 4O19A 1AD4A 1K9FA 3WFLA 1XKJA 5HATA 1GYMA 4CQCA 1XYLA 3RMJA 5CPSA 3PTDA 2X2YA 3PBWA 1XDMA 2OZTA 4Q22A 4M0XA 5D37A 3OVQA 3GIYA 2Z1VA 4Z2IA 3ABQA 4R27A 1TWWA 2PFHA 2HVNA 4IMFA 4IPJA 2A7RA 1DV7A 3KVKA 4C5YA 1D3GA 2P3ZA 2YCJA 3U57A 1OB0A 3MWCA 1I8JA 4PSRA 4AZBA 2F84A 2QF8A 2QJNA 3KCLA 4Z42C 3WH9A 4ERIA 2VO5A 1AW2A 2CWXA 5HANA 1R7OA 1NF7A 2RDTA 4CU7A 4UTJA 1FOBA 1YADA 4WVXA 4NJGA 4PTDA 3CAVA 4MB3A 4D8LA 2X8RA 3TQVA 1VENA 1XV8A 3PB0A 4PFMA 6XIAA 3BMVA 3BZJA 1TPDA 1TTQA 1EDTA 3PJTA 4MAZA 1RP8A 5TIMA 4BEQA 5GJPA 1XQKA 4LALA 1XUZA 7A3HA 4AZ5A 3ZSTA 1UOKA 1OY0A 4W4QA 1WUEA 3ABZA 2CLIA 1XG3A 2VOMA 3CL7A 1ZUAX 3B8IA 2GDUA 1EX5A 1N55A 3EKZA 3KHDA 3VUPA 2INEA 3APYA 4M56A 1F6KA 3GU9A 7ENLA 1V02E 1ONEA 2PTZA 4IFOA 3W6LA 4A8LA 5G1YA 4REQB 3TX9A 1T99A 1XG4A 2DY3A 3S5OA 2W4XA 2E5DA 3L12A 1EA9C 1CEOA 4LV4A 1ZBKA 4FA3A 1TJ1A 3UJSA 5IRPA 4L1GA 2AMXA 1TWDA 3KFTA 3LGGA 3CO8A 3B9EA 4Z2LA 1K8XA 5I00A 1GVRA 4I5XA 3QMRA 2PC8A 2FB2A 1TPH1 4C6NA 4ZOAA 4JQ4A 3LHUA 5CC5A 4RZ5A 5CZKA 4FXFA 3CYJA 2PGWA 3PJUA 3UU0A 5HJXA 3C86A 4KPLA 4JIPA 3GC5A 2HE8A 1IHIA 1IWBA 3RO6A 1VH7A 2X05A 2C3ZA 1Q6EA 1N7KA 2R8WA 1DIKA 3U2ZA 2E25A 1RCOB 4LFYA 4NF7A 4ZSUA 4HSHA 3LPOA 4ZQPA 2BVYA 3TN5A 3PSVA 3SO7A 1J0IA 1M7PA 5C9RA 5B80A 2EPNA 1YPIA 4LB3A 2BMBA 3N6HA 4I3GA 3E5PA 4JTFA 2NUXA 2WJFA 4YWIA 5I3HA 1QT1A 2HRWA 3T1GA 4ZE4A 2ZX5A 1YXCA 4WRHA 4O10A 3STCA 3WQOA 1FHDA 2OQLA 1DJWA 1LLOA 5LIYX 2YBTA 4WQ6A 4D6FA 1LM1A 5CJ5A 2YIHA 3KS6A 3VOHA 1JR1A 4XQ6A 1XWYA 4GZJA 3HMCA 3WF0A 2P88A 3DHUA 4AF0A 5AB3A 1BTCA 3QH2A 4Y6GA 5AYZA 3M6DA 1ZPTA 3CV7A 4BK9A 3I4EA 4J40A 1NY1A 4Z1CA 2GDQA 4AY8A 1XIGA 2W6RA 2ZWZA 3DIPA 4G2DA 3VI2A 1LWJA 1J6PA 3IK4A 4HA1A 3GFXA 4Y9PA 3UA4A 2XG9A 3T40A 4K8GA 1LOLA 3TW7A 1RR2A 3SUWA 4GY0A 4JHOA 1N2VA 3LTYA 3EX3A 2ZE3A 3WLQA 3ZT7A 3ABXA 2FGBA 1FFQA 5BWAA 3OLDA 5A5WA 3PF3A 3QZ6A 1V51A 1I6NA 5H8PA 3L2IA 4FR1A 5ABEA 1SZNA 5D32A 4DAFA 1SJBA 2X0SA 3NQ2A 3DHDA 2WM0A 3DU0A 1F07A 3RAOA 3DBPA 2P0OA 2Y5JA 4BWLC 1GVFA 3A22A 1Z32X 5CQ1A 3WD3A 7TIMA 1UP0A 1TRIA 3PTKA 5HK4A 3T0BA 2R1PA 2J7FA 1UJQA 1TUXA 2A6NA 4IZGA 4GZ7A 4IMGA 3E38A 4IPNB 2EPMX 3KM8A 3BAKA 1MXSA 4ZTYA 3W27A 4DAIA 3WUBA 5BWFA 3CV1A 4W5UA 3EB4A 5J8LA 3JS3A 2VJXA 4A21A 1E4IA 5HQMA 2H6RA 3CYVA 1J96A 1DYSA 5C2CA 1XLLA 4UNIA 5ECVA 2NUWA 4UQ9A 1ZBWA 4HNOA 3VC5A 1FCUA 2OT1A 2Z26A 1QBBA 4PTWA 3KTSA 1KBIA 4GUFA 3CPRA 3CL6A 3CZEA 3RU8X 2OYMA 1S2AA 3R7MA 3FEMA 3WLSA 3N14A 3CZGA 3HTWA 2DVXA 4DZHA 2WNZA 5CLWA 3GD6A 3UWWA 3CQ0A 4GUIA 3QFEA 2PDIA 3SRDA 3OHIA 2PWEA 1XYZA 3NG3A 4DX3A 1U33A 4G1NA 1KFKA 4UR9A 3R12A 3THDA 5EMMA 2W66A 1W1VA 4X22A 1XQLA 1ONRA 5IFTA 2HVOA 3LBCA 1EOMA 3BLIA 1J8VA 2C19A 1X38A 2EG7A 2QQ6A 3ZJ7A 3PPCA 1XLBA 1ZRQA 1A49A 3JW7A 1JULA 2BBFA 2GVLA 1OEPA 1T41A 3PZNA 2WW5A 3AU6A 1GQKA 1W2PA 5C2GA 4DF1A 5FOOA 2DW7A 1JPKA 2OCZA 1PS9A 1YQ2A 2VGBA 5I6SA 4XBSA 1REQA 5H8UA 2EKCA 3LSCA 1CXFA 1NFBA 4X63A 3F4WA 1EDQA 1EJRC 4H3DA 3SURA 3HFYA 1UIPA 4BQ3A 4Q33A 3CB8A 3DZ1A 1OVDA 1XYBA 3UW6A 2Y2WA 1K8CA 4LF1A 4JIHA 1VFMA 4JTIA 3NO5A 3ZWSA 4AHOA 1KBBA 4GFSA 4OV9A 4AF0B 3WLHA 3I65A 1VGAA 4DJED 4B5TA 3G8RA 2CLOA 3GYEA 1RH9A 1SO3A 2PTYA 3TTYA 3RLGA 3GW3A 4NJJA 3T05A 2FGZA 3OHMB 4MJ4A 3H4XA 5DT5A 3IRSA 4DUWA 3RJYA 1JL8A 4GE8A 2AMGA 4FLQA 2WOQA 4W89A 5I3FA 2YL5A 1WOAA 4OU1A 2DW6A 4HA0A 3ARVA 1HJVA 4QLLA 3V4BA 2GGJA 1GVYA 3APTA 1VJZA 4R7WA 1WDQA 4QCFA 4B5UA 4P61A 3BZGA 5FEXA 2CZ5A 1FP9A 1BEUA 1FHUA 4YJ5A 1QPOA 3P74A 1YTDA 1BTMA 1ITQA 2WZTA 3JU2A 3W3OA 3SIZA 2B4GA 4I8YA 4Q8QA 3IIZA 3MU7A 4XD3A 1O6IA 2CZEA 4WZHA 1SSDA 3MCMA 4PGLA 3B9NA 3OGSA 3OZYA 2EPKX 5LA0A 2FZNA 2Q3OA 5AC6A 2Y7GA 3DOPA 1AH3A 1BRLA 1TRDA 3BJFA 3NURA 2F61A 3M7WA 4GXPA 4KWVA 3SEPA 3TZFA 2V5JA 2ZRVA 4NILA 2CCRA 3PFMA 1OCQA 1P1XA 2PWDA 3KVLA 4ZXOA 1B3ZA 3LCIA 1E6SM 4LB4A 3VDGA 4RUBA 1H5VA 3GXIA 4BF5A 1V0NA 2XINA 2ATMA 3NL6A 4GQGA 1E6PA 1DIEA 1T96A 2FVLA 1NOUA 3OEXA 3TLLA 4ASTA 1UH2A 4B2DD 3RX2A 3S6TA 2YLLA 3II1A 2BFGA 3G1XA 3VZXA 3T4CA 3WL1A 1NELA 9CGTA 4FOKA 4S3GA 4QAIA 5C7HA 2FZBA 1QVBA 1H7RA 1U1JA 4UTFA 5CPLA 3UZZA 2WBGA 1TE6A 3LENA 3WDIA 4RXFA 3KXQA 2YCIX 3R25A 3REQA 3GXNA 1LUCB 1E73M 4AMAA 2Q71A 3H70A 2DUXA 2VI0A 4I9MA 2VL4A 2ZTKA 4O4WA 1T8XA 4AWTA 2ZIDA 4DYKA 1HT6A 2Z1XA 5CBJA 3U7VA 3ENLA 3VD7A 4GWEA 1KTCA 3AS2A 4DF2A 3TTOA 3B9OA 1JCXA 4JPGA 3VIGA 1XYMA 5A3HA 3W7NA 4O54A 4ACYA 3BG5A 3L4TA 1ITCA 2V38A 4JTRA 1W17A 2C16A 2NXGA 3UZWA 1AQMA 4WDTA 4WCJA 3CT7A 4HKPA 3DBNA 1RQBA 4G9PA 3FYPA 1B4EA 3ZXWA 3VIFA 4D8ZA 3VDCA 4KT2A 4GI6A 1REQB 2WNNA 4IMCA 4PL2A 3DFNA 3FYOA 4PCFA 2V3FA 3LZ5A 1Q8JA 1EEXA 3MO7A 3NJ3A 2QPXA 4US6A 1RUSA 3UVAA 3VNYA 4Z0SA 3IAQA 1UUMA