1TU2A

The complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between plastocyanin and cytochrome f from the cyanobacterium Nostoc sp. PCC 7119 as determined by paramagnetic NMR. The balance between electrostatic and hydrophobic interactions within the transient complex determines the relative orientation of the two proteins.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords Plastocyanin
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tu2A00
1SFHA 3ERXA 2QDVA 4YSEA 1SHWA 1KBVA 1AG6A 4A68A 2BHFA 1IBZA 1PZAA 3QJQB 2DYSB 1M57B 2GC7C 1SF5A 3TU6A 2UX6A 1L9TA 2TSAA 2P80D 4BWUA 3HB3B 4K9JA 4YSQA 1AG0A 1PY0A 1W6WA 1OE3A 3EH4B 1SFDA 1J5CA 3X1EA 1E5ZA 2IDFA 2FTAA 1URIA 1NIBA 4BWTA 3NSFA 2YAEA 4YSOA 2GHZA 1CUOA 4BWWA 4FA7B 2IDQA 3X1BA 2IWFA 1KYAA 1IKOP 4YSTA 4P5RA 3NJKA 2BP8A 5PCYA 4BXVA 2CBPA 4MFHA 3PPSA 1E30A 1SF3A 2GB2A 2FT6A 2YXWA 1V54B 4G70B 2W8CA 1A3ZA 1JOIA 2PLTA 4KO5A 4KNTA 1GY2A 3ABKB 1WS7A 2XXGA 3V9CA 4TXVB 3MBWB 4JHVA 1AZNA 4WKXA 1NIAA 3CDZA 3WNIA 1ZIBA 1WS8A 2XUWA 4KNUA 5F7BA 1DYZA 2H3XC 5E9NA 1E67A 3T71A 3NJLA 3UAAA 3KW7A 4KO7A 4HCFA 1JERA 4AKQA 1JXGA 2UXVA 3OQRA 3QJRB 5TK2A 4DP0X 4GYBA 4G7RB 1ZDSA 3AG4B 3PAZA 1SNRA 2FQDA 1NDTA 2GSMB 2AVFA 1VLXA 2E86A 3WNJA 1ID2A 3H56A 3BVDB 3NJJA 4YVUA 2J55A 2IDSA 3FSVA 3DIVA 1WA2X 2VM4A 1ILUA 3FYEB 1AS6A 3G5WA 4DP4X 4GP8B 4UF7C 2WSDA 3ZBMA 3FS9A 3UABA 4HCGA 3S8GB 2IH8A 4HHGA 1FWXA 2CALA 3CG8A 3CDZB 4ZK8A 1NIDA 3H4FA 4A2HA 1TKWA 2BP0B 4YSUA 1RZPA 2CAKA 3FU7B 3PCYA 5EHFA 4YSDA 4DPBX 4FAAB 2FNWA 2PPDA 3V9EA 2B08A 4HHWA 4E9RA 1GW0A 2GBAA 2I7OA 1MG2C 3L45A 4YSPA 5B1KA 1PZCA 3KW8A 1V55B 3OD3A 3UGEA 5D4HA 4NB7A 2BP8B 3N2JA 2YAPA 4YSCA 2XYBA 2YAOA 4NAJA 5I6LA 3IN0A 1PNCA 3SBQA 1IUZA 3NP4A 1EZLA 9PCYA 4BXSV 4GXFA 4DP1X 2FQGA 1TEGA 1A4CA 1OE1A 2R7EB 1N68A 4E9TA 2XV0A 3PXLA 5I6OA 1X9UA 1PMYA 3T6WA 5B1AB 3ZIYA 1BQKA 3FSZA 2R7EA 2OCCB 3OM3B 3RYMA 5D4IA 2VN3A 1AZRA 2CUAA 1BXUA 2Y69B 4AX3A 5I6KA 4CSPA 5B7EA 3GDCA 1L9OA 1XB6A 2IWKA 1L9SA 4F2EA 3QJVB 1EHKB 3X2QB 5I5IA 3AG1B 5AFAA 4E9YA 4E9WA 1NWPA 1JZJA 2GIMA 2VSMB 1AIZA 1ET7A 3UADA 3UACA 3WKQA 1NPNA 1W8EA 4DPCX 2HX8A 2VM3A 1IC0A 5I5JA 5ANHA 2XVBA 3CVDA 5TK4A 1PLBA 2MTAA 4GP4B 3NYKA 1SDDA 4W9ZA 1E5YA 1AZCA 1PCSA 3S8FB 3BQVA 2XX1A 1BXVA 3ABGA 4JHUA 1OCRB 1TEFA 1OCZB 2ZOOA 2J56A 1KBWA 2DV6A 1NTDA 2BW5A 4KOCA 3AW5A 4F7KA 1ZPUA 5I6MA 2BO0A 1L9PA 2UX7A 2XV3A 4KOBA 4AI7A 1BYOA 4G7SB 2YAMA 1GYCA 4EF3A 2PPFA 3ASNB 2VW4A 1J5DA 1R1CA 1TU2A 2JXMA 1IBYA 3FU8A 2PCFA 3SBRA 3C75A 1ET8A 3ZDWA 4ENZA 2ZXWB 2FJSA 4PCYA 4YVNA 1ET5A 1M56B 3N55A 2FQEA 1HAUA 2ZWNA 1NPJA 1OCOB 3AY2A 4DP9X 3WG7B 2VSKB 2PP7A 3TBBA 4KO9A 4JKNA 2XU9A 4NERA 4E9QA 1A8ZA 1AQ8A 2FQFA 2Q9OA 4HIPA 4E9SA 2Q5BA 5I6NA 2HX9A 3CVBA 4RH4A 1AS7A 1B3IA 1M9WA 2NRDA 3NJMA 2MRYA 4YL4A 5B1BB 5IY5B 2LLNA 2Y1AA 1NICA 4P5SA 1ASQA 1SDDB 3ZX1A 1JXDA 1KV7A 1GS8A 1I53A 3D12B 4A66A 1WA0X 2YXVA 3PLYA 4BDVB 5LDUA 2BP0A 1AANA 4DP5X 2CJ3A 2VW6A 3OMAB 3TASA 4N8UA 4Q89A 3S3BB 2XV2A 3CVCA 3QJUB 2B3IA 3FU9A 4G72B 4E9XA 3T6VA 4YSAA 1OCCB 2JFCA 2DWSA 2H47C 1ADWA 3FSWA 2N0MA 2QDWA 4GY4A 1ZIAA 1GS6X 2YAHA 1N70A 2EINB 3ABMB 4BK5C 1WAEA 2PP9A 3NJGA 1JZIA 3WKPA 1KCWA 2BWDA 1BQRA 2IAAC 2YAQA 3FPXA 3U25A 2PP8A 1MZZA 4DP7X 2AZAA 2X87A 1SHXA 5D4JA 7PCYA 3NT0A 5PAZA 2I85A 3QQXA 8PAZA 2DYRB 5B1JC 1A4AA 1CYXA 2WO2B 2WO3B 3FQ1A 6PCYA 1AZUA 3NJIA 1L9QA 1RCYA 2IDTA 3EF4A 1FFTB 4HAKA 4F2FA 2X88A 4QLWA 1KCBA 1GR7A 2VW7A 1AZBA 2DY2A 3FPYA 3FYIB 1PF3A 2QPEB 3S3DB 3S3CB 2BW4A 3IN2A 4HALA 4A2FA 1A65A 2FT7A 5A7EA 1X9RA 5I26A 4N4YB 3EH5B 2JKWA 1KGYE 1YLBB 4WTQA 4A67A 3FQ2A 2QT6A 1V10A 3PAUA 2EIJB 2OJ1A 1QLEB 2A3TA 2EIKB 3DKHA 3JTBA 4YSSA 1A4BA 1HAWA 4AKOA 4Q8BA 1PLAA 2PCYA 2YARA 1NINA 3QPKA 3CZUB 2UXGA 1NZRA 3OMNB 3GXUB 1W6LA 4AKPA 1GS7A 2UXFA 1PZBA 5B7MA 5AKRA 1BAWA 1MG3C 2IWEA 3PAVA 4DP8X 1OOWA 5AZUA 1XB3A 1JXFA 1J9SA 4QKTA 2IDUA 5I6PA 2GC4C 1L9RA 2XX0A 3DTUB 1JZEA 3WI9A 4CSZA 2IH9A 1AR1B 4M3HA 2J5WA 3ASOB 1QNIA 3AG3B 1BXAA 2BZ7A 4HCIA 1JVLA 1XMEB 2XXFA 2HX7A 3AZUA 3QJTB 4W1TA 3WIAA 1J9RA 2EIMB 1XB8A 3X1GA 7PAZA 3FU7A 1UATA 1HFUA 2HRHA 3SBPA 2GI0A 1KDIA 3FT0A 1ZDQA 1NIEA 3EH3B 2XLLA 1QHQA 1OE2A 1AS8A 2DWTA 1CURA 5I5MA 1F56A 2PPAA 2HLEB 2HRGA 3EHBB 4M4RB 3T9WA 1AAJA 4E9VA 1PNDA 2P80A 1BQ5A 3IBOA 2BZCA 4UANA 5FC9A 1ETJA 1WA1X 2TSBA 2CCWA 2PPCA 3NP3A 1PAZA 1NIFA 1JZGA 5F7AA 1GSKA 1AOZA 2HXAA 3TA4D 3X1NA 2H5UA 1RKRA 6PAZA 1JZHA 1BEXA 2HZHA 4A2GA 2QPDB 2OV0A 3JT2A 4DP6X 4DP2X 1RZQA 3TBCA 4X4KA 2W88A 3ABLB 1J9QA 2RACA 1BYPA 1MZYA 2VMJA 1CC3A 3HEIB 5B7FA 1ASPA 3NJFA 2AFNA 4HZ1A 3T6XA 4G7QB 3GYRA 2UXTA 2ZONA 3H4HA 3SQRA 2I7SA 5B1JA 4GP5B 3T6ZA 2AANA 5I28A 3OMIB 1SJMA 1PLCA 2AZUA 1CYWA 1J9TA 3FSAA 3NSDA 4A2DA 3QJSB 1E65A 3X1FA 1OF0A 1OV8A 1FA4A 2EILB 1AACA 1KDJA 1ASOA 1ILSA 1GY1A 1DZ0A 3AG2B 3IEAA 3NJHA 2YQBA 3NSYA 4G71B 2BWIA 4YSRA 4AZUA 4L0PB 3IE9A 1JVOA 2J57A 4KO6A 1JZFA 1ZV2A 5B3SB 4BDVA 1T5KA 2XWZA 3MX0B 3NJNA 4DPAX 3UAEA 3NSCA 4UAHA 2YAFA 2FWLB 4A2EA 2FT8A 4KNSA 4PAZA 2PPEA 1MDAA 3FQYA 1NWOA
chains in the Genus database with same CATH superfamily
5JXEC 1E2WA 4WIQA 1OAZH 1U9KA 4FS0A 5GRYA 3D0AA 2NY0B 1DJIA 5CJXC 4PGJA 3VFPA 1PZAA 1WPCA 1A0QL 2WWMD 5SWSA 5IIEA 2DYSB 4WQOA 3FW6A 5DJ6A 4U1SA 4X0KA 3IBEA 4KK5D 1A14L 1YZZA 5K9QI 1DQQB 2Y6TE 5DCCA 2DYPA 2WYTA 4G59C 3UBXG 4BSWA 3ROOB 5FOBA 3K80A 2IJ0C 4NM4L 3HE6B 4AJ0A 4D9QD 2XRAL 3FO1A 4B53A 3U7WH 3T5WA 3HBQA 4MGXA 3RVUC 1IKOP 4YSTA 1GJIA 3WIFB 3UTTA 4ZX3A 5ICYA 4BE5A 1MJUH 2R59A 4KI5D 4DPRA 4ERSL 3FF8A 3KZ8A 1SF3A 2FHFA 3GXMA 4GXVH 4L0ZA 4Y16C 3BSZH 3RIAK 3OLGA 3VE0A 4G3YL 1H5BB 4ZJ9A 3J2PA 4YDNA 5L6YH 1MCBA 4KK8D 3GLDA 2BNRD 2W92A 3WIHH 4OQTA 1WEJH 3GSOA 2YD4A 4AVJA 5CN3A 2F2HA 1HJCA 2W9LA 3OKLA 1EHNA 1MRDH 2CU9A 4D3CL 3WO4B 3K4AA 3PHOA 4ZMLA 1E3XA 2UXVA 3OQRA 5BRQA 4PRHE 2ZSVA 4N2NA 5A40E 1A14H 4DTGL 5DO2D 1UYWL 3G6JA 1BEYH 1PYWA 1G7HB 1QI3A 1UACH 1WYJA 5BO0D 3QXTA 1G7QA 1B2WH 4L8DA 3FFOA 4NRYB 1XEDA 2J55A 4JFWA 3ARTA 3QUKA 4V1DB 4XBGB 3SOTA 4NKDA 2AJUH 5EBMA 3FRPG 3ESVF 1U3ZA 5DA0B 1M05A 4PCKA 3ROLA 2WNWA 1MFBH 1N26A 4V1DA 4NHCH 5DUBB 4P4KC 4AYSA 5I6XB 4U6HA 4CN6A 3CSTA 1TKWA 1P7KB 2NX5E 4RMRA 4YZFE 3DSNB 4B9ZA 4JG1H 4FG4A 3RPIB 3D0VA 1UM4H 3CZSA 2R29L 4YDZA 5DJ8A 3LKNA 1Q94B 1U95B 1MI5E 3M17A 4HC1H 1NCUA 3C5XA 5G4MA 4UM9B 3MV8B 5J1AB 5I6LA 1S9KC 3GSXA 3CPUA 3JWOL 4N2IA 4NM8H 1LD9A 3QUML 4PLJC 3KPSA 4UQCA 1U0QA 3QPXH 4BXSV 4EJ1C 3DX6A 2OR9H 1T7YA 4NPJA 5ECJE 1K6QL 4D0CB 4DQOL 4XPBL 3G3LA 2WMPA 1RZIB 4MJHA 1IAIH 3UYPA 4ZMOA 4JO4L 3HMWH 4UDUB 5D1ZB 5E1GA 3NIGB 3WSQL 3MZGB 5TDNB 3P1VA 2AXGB 2VR6A 4DJMA 1IB5A 4OZHF 3BWSA 1Y18A 3S35L 4Z0BL 5B7EA 4KVCH 2AI0H 1VESA 1BM7A 2ADGA 1EHKB 4POUB 3DPBB 5C0BB 3G5ZA 2NY3B 5D93C 1SXCA 4ZTPH 2JKRM 4U1MA 4YDVA 3V0IA 4UDTB 1E0OB 1Z0MA 3KPPA 3N44B 3OV6A 1Z9NA 2I9LA 2B4CL 2EEXA 4WZ9A 5EOTB 5TDNA 3BCFA 4KFMA 3I02B 5BRZA 1HSBA 2BIOA 2G5BB 4MJIE 2XVBA 4FNLL 1ZHBA 3QDGE 4XPGH 5B22A 1P4LA 4X98A 2N3JA 4HPYH 3MOQA 3QHFL 3I3DA 1OW0C 3TH4T 4F15C 2E9JA 5C70A 2WXIA 1T22A 4YHYC 3PRZA 4LKCA 5GSRA 5D1ZD 1UVQB 3O4OB 3TO2A 3Q1EA 5FF6B 1IC5H 1OAQL 1OCRB 1WHOA 2YQ2A 3FTGA 1IFHH 1AQKL 1S8DA 3ZR5A 3UH8A 2J56A 1JMXA 1NTDA 4A6YA 2R2EB 3SKOB 5IM7A 1H8NA 4ZXBC 1P5UA 2ATKB 5AOIA 4KK8C 3REWA 3EJQA 4CC4A 3RTQD 3QXWA 1M6OA 2LW3A 3S37X 5I17B 3CDGA 2R2EA 4MMZA 4Z3HA 2F8XC 1QD0A 3BSZL 3FTGB 4F7CA 4ESKA 3KPOA 3PABB 3MA9H 3SGKC 1J5DA 3WLBB 1BJ1H 5E1IA 4F15B 1MFVA 2WN3A 2CCLA 2QVIA 4BH8B 4FXKB 3VWJB 1UUSA 4OFVA 4QT5B 5DQ9B 1PKQB 3T3MB 4K23H 4TUJA 3Q9PA 2FQEA 1HAUA 3KLDA 2GT9B 3QI9A 4BFNA 3DURB 1MHCB 1MPAL 4N1EA 1VADA 2VXQH 4XHJD 4UZUA 2VMDA 4OV6F 3O0LA 3GJFB 3VM7A 4F37K 2Q9OA 3G9AB 1IVTA 2F8OA 3KXFB 25C8H 4JRXB 1R3JA 5LBGA 1DQML 1YEWA 2JJWA 5G5DA 4A7QA 1I8LC 2EUVA 2I69A 1EZVX 2Y7QB 3PWNA 3MLZH 5BO1L 2MRYA 3AWGA 5I6XC 3MRLA 3Q44A 4PVLA 3LZLA 1RHFA 4HWBH 4X4XA 3VG9C 2VUYA 1OSZA 4L8SC 4M7KH 3UGXA 1EIBA 5I16A 1NBYA 4YX2H 1I8UA 1A1NB 1AANA 4BM7A 3OTTA 2YUZA 5CR8A 4JFPA 3BD5A 4AY0A 3VXSA 4Q9CA 4Y1AD 2IOIA 3QZPA 2B3IA 1KPVB 1S7XB 1R19A 2VXVH 2ZNWA 4PY7A 1E4XL 1Z9PA 3H3BC 4B9CA 5FCUH 4AQEB 2OP4L 1RZKC 4A7UA 1HJBC 2J5LB 1UWGH 4PJCB 2X4RB 1YY8A 3CSFA 1QPXA 1TMQA 3ZE1E 1MLBA 3HRPA 3T3PF 3WKPA 1E9QB 4OTXL 3ARDC 4XNUL 1GGTA 1A6ZB 1FRGL 4MBRA 1Z5YD 3UYRH 5PAZA 4G11A 3ARYA 2VDLH 1XXFC 1A4AA 5IQMA 1MCIA 3MLTA 3ZHKA 1S9XA 5EO9A 2F5AL 5GRJL 1NGWB 1NSNL 3I84A 3VXSB 1Z5LB 3D4CA 3MRKA 4YAQA 3IKCA 4FZ8H 2X88A 4X80L 4PJGB 4XR8C 1AZBA 1N64L 4IU2B 2B5IB 1C08A 3S98A 3T3MF 1XFPA 5E5UB 4HALA 2A2QT 3IXAB 5BS0D 5EIIB 3D0LB 2HFGH 1KV3A 1T20B 3VI3F 3IDUA 4Y1TA 1DBMH 2WBWB 3D3VD 4YAQB 1SXBA 1J8SA 4H44C 3PHOB 2Z35B 4N0UE 4MX7A 4GT7A 4ZFOA 5JNYB 4YIQB 2P8MA 3BZEB 4Z7VF 4RFNC 2AJVL 2EIKB 3MOAL 3GMMB 3QDHA 5FDWA 3QJFB 4N86A 2PCYA 3VWKA 1SBBA 1OP3H 5I0XA 1CLOH 2P28B 2VQUA 3EGDA 5FKAA 2UXFA 4MCYB 3B3BA 4UB0L 2YSSB 1R3LB 5HY9B 3EDJA 1J0YA 3H8NA 1I7UA 5JZ7C 3UTSE 3KPMB 1RPKA 5D7IA 1JDAA 1X5FA 3BUDA 3NZSA 3WDIA 4ZZKA 5ADPL 1XB3A 5FYJE 2IGTA 4N25A 4AEEA 1JJUA 3KJ4C 1XGQB 3F58L 1LNUB 3AJ7A 1U91B 4BQ9A 4Q97A 1KB5A 1ZSDA 4W6WB 4Z0XB 4A7SA 3DRQB 3QUZB 1UZ8A 3NA9H 3QAZC 3B9KD 4MB3A 4BFBD 3LQAL 3ZE1B 4NSKB 4UT7H 1U8KB 2EDMA 3MV7D 3SBWA 5CWSA 5AUMB 4LLDA 2FBJL 3S5LB 4LARL 2Z0BA 4EVNB 5BQDA 4W1TA 3C2AL 4KKZA 1G7QB 4L8DB 1L3NA 4DKDC 1MJJA 4XMKL 3LRSB 2EIMB 1OGSA 2G5UA 2GQHA 5CLZA 1TEYA 1EXUB 3BXNA 2GI0A 3TT1H 1DBAH 2G60H 3BKJL 4XMUA 1PLGL 3L1FA 1JZDC 4E9LA 5ISZD 3IJ7A 2JI1A 4M02A 4HHAA 4KRLB 4M6OH 3W37A 2WLHA 4M4RB 2ZOLB 2DQDL 3NIGE 2P80A 3IT8D 3NAAL 4FFWD 1F3JB 1CBVL 5CSBA 5SV4A 1FNEB 5E2VH 4DH2A 2ZUSA 4H4NA 2Q2EB 4F9PC 3OGCA 4HHAB 3MRRB 3BVTA 4ZW7A 5JORB 2E76C 1NFDF 2KC0A 2Z1KA 4WEBL 5GJTH 4ICXA 3RE0A 4PMEA 4YHLH 4J2QA 4ELMF 2V2TA 5DLLA 3OAZH 4ATTA 3FHQA 1RIHL 3QRGH 2NW3B 5TE4H 4QR7A 2J4WH 4BZYA 3IMTA 3N91A 5IVNA 1Q0XL 1I1YA 4P23B 5C0BA 2FLRT 3ECBA 5SWZA 2VH5H 5JHLH 1B0GA 2YJQA 2ZUYA 4HSCX 1I4FA 3SDAC 4FQPA 5CIPB 2JJVA 3WTSA 4WU7B 3OAYK 2X6CA 2J6EA 2AW2A 4UDUA 5JYLA 2G60L 1ITBB 1JNLH 4PJHF 2PTTB 3L4CA 4R26H 2ZONA 1A1OA 4MAYC 3L3IB 4OZ4A 1I3GH 1I1CA 3LYRA 1E28A 1OSEA 5BRPA 1SJMA 1JTPA 3GHPA 1UUNA 1VAHA 1X6LA 2ZOKA 1CYWA 1XR9A 3Q8AA 3VU1A 1FCGA 1G9HA 1JK8A 4KMTH 2X89D 4MCZA 4HIJA 2RHEA 3RVVC 2HRPH 2PMZA 4RIRA 4PJ8B 1OAUL 3U9WA 3EJZD 4HUNB 1ZLUH 3QJHA 4UQ3A 2PYED 1YEIH 4UV4L 4C8XA 1NBZB 5EEXA 4O51A 3ILQD 4OT1L 4UILH 2ZICA 1NCGA 2NY6C 5DZVA 2XYCA 4ONFH 1BAFH 2V2XA 2MQCA 5CEZL 1ZVHA 4YEFA 2YUXA 2EDQA 4OV5B 1XD1A 2X3BA 1RV6X 5ESQB 5AB0A 4XCYB 1TVHB 3QG6A 2C1PA 2A9ML 4AJVA 5H35B 3D3VE 3QG6B 1NCAH 3F65A 1W8NA 2AF2A 3MFGB 4UI2A 4XMVA 3V52L 1R3IH 3STZB 4XVUD 1KACB 1SF5A 3CHQA 3PDDA 3DVNA 2P26A 2I5YL 4ZAKD 4BFJA 4LPWA 1VZIA 4A6YH 5CINL 1Q72H 4M00A 3MV9B 1IIKA 2RJMA 3RWEB 1QFPA 2VDPH 2OYPA 3TF4A 4X8GA 1F02I 3GRGA 3MLPA 2EACA 1X5MA 2XTSA 3BP5B 4QRFA 4F33B 2EUZA 4Q6YA 1ETA1 2CRYA 3UBGA 5GXBB 5ABDE 4LHUD 4UQ2B 4Z7IA 3U4BL 3RDTC 3V8CA 2FO4A 5B3JE 3AS3A 1VEPA 4PY8J 4PHXA 5C9JA 1A3ZA 2EDOA 4J3OC 2C7UB 3RVWC 2XXGA 2O5XL 4IBTA 5DQDL 3U7AA 5JW3L 3PFUA 3EUDA 4ZPVB 1PU0A 2I9TA 1NIAA 1ZHKA 1FFNA 3TGXA 3P11L 4GG6E 1ZIBA 1WS8A 1QSEA 4GEJA 3BGAA 4M7JL 4OJEH 4WUUB 2X4TA 2NTFB 3NAAH 1JXGA 5E99L 1KTKE 3NFPB 5DK0B 1H6UA 4XAKE 5SWZE 2V5SA 4ALAC 4PJ9C 2FQDA 4TSCH 1F8TL 3KL3A 3WELA 1YNKL 5E2VL 3IJ8A 2H0EA 3FCBA 2XVLA 2A6JB 2F53B 4L4VE 5E03A 2F8VA 1IE5A 1J1PL 1U8NB 1ID2A 3JV5A 5AW4B 4OQ1A 4JPWL 4QJ3B 1LEIA 1ES0A 1BIHA 3CN1A 2YMOA 4O02L 3W0WB 1ILUA 5HYJD 3FYEB 4G6KH 1W72A 3US9A 1CU4L 4ACTA 1DQLL 3TBTA 1MHPL 2PXYD 3U0TB 4Y2DA 5DRZB 12E8L 2ZX8A 4R4NC 5IFHL 3PFQA 3DI2B 1FGVH 2NYKA 3ZE0B 1WZ1H 4JHAL 1TQWA 2GW5A 1PL3A 4JZJB 3DYOA 3KPRE 2OQJB 5D2NC 1BF5A 1ZHKB 5JUEL 1V7NH 2WXPA 5IV2A 3ZDZB 4F93B 4UWQB 1QRNB 3QCVL 2B1AL 3VFSB 3VFMB 3QUYD 4KI1A 4GIPD 4W4OC 4X0NA 1T2JA 4RAUA 1ZANH 5GS0C 4M7LH 5KTEL 1SMAA 1O9ZA 1CD8A 5FLUA 2XJKA 4M7JH 4M1DH 5JIQA 4W9CC 1EZSA 2HWZL 3OD3A 5KSUB 3BVNA 2GAZB 3IMRA 1AO7E 5HDQL 4LSPL 3V7MA 3JUZA 3U30C 2A9AA 3SGJC 3NABL 5T3ZE 2JJTA 4RA0C 4LCWE 3EJRA 1VPOL 2WUCH 1S5IH 2PXYB 4K3DH 1FI8C 2DQGH 4RZCB 5JOEA 3NCBB 4OZIF 1QWUA 1WEJL 3MLVL 5C07A 1BQKA 1ECYA 2A9DA 2V37A 3TN0A 5C6PB 4V2BA 5CU9A 3B37A 3OM3B 4F9PA 5KVGL 1AZRA 1Y6NR 5DC9B 1U2CA 1NLDH 5KVEE 3CZKA 5GPRA 1N3NA 1HWWA 2ATPA 1IARB 3L5WA 4N2GA 4KZDL 1YYLH 1G7JA 3HPJB 4PLJD 1NWPA 2CK2A 3MA7B 2IEPA 5I18H 3VDCA 5J3HC 4FNLH 5DJZB 4L18A 2LHAA 4KX9A 4L23A 3NQKA 3PXHA 1LEGB 4GSUA 3REVB 1HOCB 1DVUA 3L3DA 1BCIA 1SVBA 3I2CL 3QXAA 5F9JB 3S5LA 1UACL 2NOYA 2BHZA 5HDOA 1J5OH 5ES4B 1RZ7L 3FB6B 4KUCD 3V4PB 3L3OB 4O2FA 1B6DA 3TIEA 5I74B 4I48B 4I88A 3K8KA 4HIIB 2R0ZH 3CIQA 3KBHE 4X9HA 4JFOB 2WWOA 3Q13A 4UTAH 2V2TB 3TNMB 3OKOA 3KR3L 2QQKL 4FFYA 1MWAL 4KOCA 4GI6A 4Z5RB 3GSUA 4I3SL 2K0RA 1URZA 4GKSA 1L9PA 4J3UA 4JM0A 2OMWB 5D7LE 1INEL 4AI7A 1BYOA 4FNRA 2OTUB 5ISZB 3HG2A 3BP6A 2NUPB 3JWOH 3LH8A 3ESPA 4W9JC 4G8AC 1YNTF 4MCMA 5B38A 5I1GH 1ZLWK 3ROLB 1ZLVK 3FU8A 4FTVA 5C0AA 5CD5D 4HC1L 4H8VA 2E7MA 2WXNA 5EN2A 5T5FA 1OPGH 2GTWB 3SKJL 1BQHB 3CUPA 4N2CA 1T1WA 2Y2TA 3HE7B 5GGSA 2EXWD 3NFSL 5ETUB 1X5KA 2MPAL 3QARA 2VXQL 1NCIA 1QLFB 4G8FB 2PP7A 2CUHA 4R5XA 25C8L 4JKNA 2OSLB 2BVYA 1OKEA 1YMME 2FD6H 2FX7L 4QTFA 4U1KB 5B38G 2GCYB 1QSFA 3BOVA 5K9KB 1X4XA 3JWDH 4NQQA 2HX9A 3OKKA 5HYJE 4NQSA 5CD3B 1ZLDA 4JCMA 1NKGA 4CC1A 4IU3A 2R4SL 2OJZH 3GZKA 4KZEH 1KY7A 5E2UH 3FH5A 1KIQB 5IZ7A 1J8RA 3UOAB 1WA0X 2J6EH 3CCHA 1M53A 5DR5L 4JUTA 4K3JL 3HI5H 2CSPA 3N9GH 1MNUL 3DO7A 2EDBA 4LOUD 4RGMB 2G75A 4OGYL 4Y0GA 4A04A 3U2IA 3INUL 4AW7A 3THML 4X6FB 1UH3A 5DVLA 3RVTD 4X9IA 5HI4D 2QDWA 5EUOA 4GY4A 2D31A 1KXHA 1VFAB 4JZNB 3UJJL 3NK3A 3WFHA 4L37B 5F2FA 5T33H 1WFTA 5L8KB 4HS8H 3ETBF 2Q7AA 4MA1C 4FZEH 2DZEA 4PJEA 1IC5L 4TOYL 2R69L 2ADIA 5GRZA 4CVZA 4AYMC 1HT6A 1CLZL 3X3GH 4YXLH 1TTUA 3PL6D 2ARJB 4H5SB 3NBNA 5DUMH 2GSIB 3A4FA 1NGZA 4GKLA 3HNTL 5KSVB 2EDLA 3MLVH 3MUHL 1OF2B 1CLCA 3GDBA 3SJVE 4LNRA 1BFSA 1AQDB 2VAAA 4P59L 3HUJB 3UZQA 1NGZB 4RBPH 4AC2A 1K8DB 2UY6B 4PP2A 4UAOC 3V4PH 5DLML 3K6OA 3KPRB 1HINH 2HVKA 2D3VA 1MWAA 3IJYB 3KWTA 3FCTA 1KB5L 2BVPB 4J28A 1VHPA 3RIKA 1SPDA 4GQPH 5E56A 4NN5B 4CU6A 2OJEA 1UM5H 2BNQD 5CEZD 3MRQB 3WGUB 1FDLH 4HWZB 4OZHA 3APDA 3K2IA 2BNUA 5FM5M 1THAA 1CDUA 1YLBB 4OAWA 1CJYA 2VSCA 3N04A 3EDFA 5FUZL 3VD2A 4M7ZB 3H9SE 1T1YB 3KPOB 3PABA 2A3TA 2EDEA 2XWBA 4U3SA 4Q8BA 2GY5A 2NDFA 3V0GA 2ZPKL 2ZWYA 2V5TA 3SDDD 5BXFB 2EDYA 4HWZA 4WI8A 5C7ZA 4LCVA 1NZRA 1KN4L 5FYLD 5FK9A 1OSZB 2WIIA 4JFXA 5DJCB 3D39D 4GG8A 1NC4B 2XZCH 2ILLA 3PAVA 4XVTL 3Q8EA 1DUYB 1I85C 3ARED 4HUUB 4OF6A 5F3BA 4OTXH 3ZYJA 1P2CA 1CG9B 4GW4B 2Z91A 1NCWL 4R7LA 4CMMA 2J5WA 1OTUD 2HLAB 2LAGB 4ODUB 3PV6A 3O3AB 1FVCA 1I8IB 1SUHA 1P2CB 1QNIA 1U8LA 1ZGLP 1ZGLA 1J1XL 1P7QD 1SYVA 1KJVB 1HHKB 1DUYA 1S7XA 1RJYA 1QBAA 4POZC 1NMAH 2P42B 3DX8A 1U41A 1F6LL 4ZQTA 2A6JA 2IALA 1Z6JT 1FL6B 4LLYB 1ZDQA 3EH3B 1QO3A 4Z7WB 3B34A 5CN1A 3ZKQD 2L7UA 3DRTB 1CURA 3GS4A 2PPAA 3WJJC 3AGVA 4NUJA 2IXQB 1T21A 5FYKE 5IHBA 5DQJB 3FUDA 1JYNA 5EU6E 1BFOB 2CCVA 1C12B 2ZPKH 3QCTH 4WWID 5DDHA 5GGTH 3PGCB 4S1RH 1ZTXL 4M93C 4PJAA 4WUKH 3BJ91 2YEZB 1FGNH 2VTFA 3PJSA 4FDWA 4F92B 4AM0B 4GB9A 4NZDA 1MHHB 1ITCA 5DJAB 1CLOL 2X4RA 1MVYA 2QPDB 4NJ9L 4QGTA 4QRUB 5HI4C 1SQ2N 2XWXA 4G5ZH 1MFEH 4LLUB 3WFDL 2AJVH 4Y5YA 3CMOL 3GS0A 4K2UH 4MMYB 1N0LB 3EGXB 2HVJA 2JK5B 3NESA 3QPXL 2DWEA 4KJWC 3DV6A 4WEUD 1M7XA 4YIQA 4XVSH 4FCHA 4JHBA 4LCYA 4WHTB 3GMNB 2O72A 2BSDA 4OUUB 1YA5A 4QTHA 2I7SA 1LK3H 2K3TA 4L3CB 2N01B 3ARDB 1EDHA 3DA0A 1AH1A 4ZOAA 1QWHA 5ICYB 3VFWB 2F54B 2UV3A 4U6YB 1QPPA 4IU2A 2ROYA 4PD4J 3LIZA 4HCRA 3HPJA 3AB0B 2VITB 1IM3B 2K4AA 4NFBA 1WT5C 3OMZA 2V9RA 1E65A 3D9AL 4LCYB 4OVUA 1BQLL 1D2OA 3KWXA 5HGHB 2YK1L 1FA4A 1QQDB 1ZGLM 3E3QC 3RL2B 5T5NF 1BWWA 3BQUA 4OZHE 1DR9A 3HNTH 4FQQB 4UILL 4Z77A 2Q0ZX 3MJGX 4BGDA 1TQCB 4MMXB 1CD1B 1H5BC 2J25A 3G9VA 3QYMA 2ADYA 1UA6L 1ZV2A 3G6JF 2FYYA 4LHUG 4N87A 2LU5A 4ZS7H 3V6BR 3TT3H 5KAQF 1FO0B 3ORJA 1T5KA 4KJYB 1FZKB 3K3QA 3NJNA 1SJEA 5GJSH 2R29A 3SD2A 4F58L 2BXYA 2ZYHA 3L3GB 1JCVA 1NWOA 2V7NB 2ARWA 4DK3A 3VCLA 3LN5B 3PIQB 3NTCL 3ERXA 2Y2YA 3MRCA 1RZJL 1R3IL 2ITCA 2H4EA 4IS6B 2R0KL 3M17B 3EYQC 4GSDH 2EDXA 4YLCA 1X9QA 1FHNA 1VKXA 5D2LF 5J06A 2IADB 2XWTB 4LGRB 4Y7MA 2HKHH 5BNXD 2WLZA 2P80D 1OM3L 1LEGA 3T0BA 5SX5H 3HLAB 5AQ0A 3QUGA 3EH4B 3L1OL 3QZWB 4FHJA 4H1LH 4IDLA 3O45A 3OLEA 8FABA 2WLMA 5KVDE 1JPST 1FVEA 3RGVA 2NR6A 4X50A 1LDPH 1H15A 3MI6A 1I7ZB 4JM2B 5BVPL 1DJZA 1MXGA 3U1PA 5F7DB 2CJUL 3P54A 4H8UA 2IDQA 2R23B 3WYRA 2QPSA 3LTVA 4IIZA 1Q8MA 2OK0L 3FFCD 3S36H 4GUPA 5A6LA 1CXIA 3BH8B 4IOSA 3CLEH 2GB2A 1TJIL 1OSPH 5IW1B 1D5RA 1JOIA 2MMXA 3O6LH 4GW1A 1A9BA 1VGKB 4WHYH 5L0QB 1IGFH 4HIXH 3MBWB 3G5YA 1WD8A 2D9CA 1TKWB 1N0XL 4JFUA 4N0CC 3MLUH 2DQCL 3U2JA 3DJTA 3QQNA 5EN2B 3TL5A 4NCDA 2E59A 5HYIA 1YAIA 2EUXA 2VUKA 3QUMA 3BFWA 4QY8B 1XF3B 1DHKA 1AZVA 1JGVH 4PVMA 3RGVB 2NZ1A 4AKQA 3Q2WA 1BBJA 2BC4B 1XL6A 3FOMB 1OAXH 2X89A 4G6FB 1A4JA 3ATFA 1MREH 4NGHL 1ZHNA 4G43A 2NY5L 3NJJA 2BIHA 4YVUA 4OCRL 1YECH 3EJYC 2IDSA 2SEBA 4LRNL 4X6CB 3LB6D 4MLIA 4IIQA 1DEDA 2BNQB 2G3MA 3ZBMA 1KXVA 5MP6L 1T1XA 2JKTM 5IB1A 1UOLA 4BD4A 3S8GB 3VFOB 3COOA 1DEEB 1NCDH 2CALA 4HD5A 2BOBB 3CDZB 3U9PL 1MKFA 1ESOA 1CDGA 1XMWA 4LGSB 1AKJB 3JXAA 4HYTB 2CK0H 3OSVA 2KPNA 1QSVA 2YPKB 4NHUA 3VI4E 2QR0A 2I7OA 1MG2C 5DQ9A 3WS6A 1XSJA 5I1IL 1CFVL 2VDRH 4PWFA 2AHIA 5AWNL 4J5VA 5B1KA 5SX4H 2R1WA 3D39B 2VDML 5D4HA 4YHNB 3U36A 4HIHA 2FGZA 5CLXA 5TFSH 2R83A 1LO5A 4FLOA 4TRPH 1HSAA 1L9NA 1LP9F 4JREC 3LKPA 3P0YL 5DI8A 1AXTH 1MI5A 1FL5A 2XT1B 3HS0A 3T6QC 1M71B 5ANMB 5LBSL 4IM8A 4WWKC 2R7EB 3EJTA 5AEAA 1DCLA 2AEPH 2RCSH 3FBKA 3RWGA 4NPYB 5C08E 3N3EA 1A22B 5T3XH 4PS8A 1IM9D 3PL6B 4PJ9B 1EEZA 2CGZA 1L6ZA 2X2JA 3CFDA 4WSGA 1BG9A 4F9LA 3UZQB 4N8VA 3UTQB 5FOJA 4F33A 4HT1L 4RDQG 2X7LB 4Z7UA 1DLFH 2C26A 1XF5B 12E8H 1XGPB 2ADJB 2CGYA 1KZYA 1QUNA 2R56H 5DJ0A 4B5ZA 3NCJH 4OJYA 2NW2A 2JI2A 4OCNC 3L3HA 4LESA 4P2RD 3GNML 3CH1A 5DK0A 2CM5A 3BEVA 2NY1C 1DJXA 1OO2A 3GLEA 3HS0B 4DESA 4LSRL 1NMBH 3MRHB 2ZKYA 3LJ3A 3EYVA 2A9CA 3A6CL 1PQZB 4LEEA 1KPRB 2DKUA 4XGZA 2I9TB 5IHUH 3L3OC 1P6FA 5IBTL 2QV4A 4Y9BA 5EF2A 2CLRB 3KR3H 3LV3A 2BS9A 1OCZB 2XPYA 1PJ9A 5IFHH 1ND0B 1HQ4B 3NG5A 4OM0L 3SDYH 1FL6A 1MCWM 3BVUA 4J1UB 3O6KH 1DVFB 1JG9A 4TVPE 1G7MB 4GINA 4L48A 4Y16B 1TTGA 1HILB 3RWJB 3RTQC 3ZK0A 3CHOA 3FQRA 4BINA 3ZO9A 4YZWA 3ASNB 3BPNB 3VO0A 2XG4B 1OANA 3BP4A 1RQ5A 4R7NB 4RX4A 5CZKA 5C0GA 4XPHH 2GUYA 3EYSH 3WNNA 4OCMC 4AV5A 1QEXA 1CLYH 5D7KD 4C56A 3C75A 1CFMA 4R96B 4R7NA 1RSFA 1U4EA 4YDJA 2UZYB 5EEWA 1JHLL 1EZUA 3ILPB 1CFQB 2AK4A 4GO6B 1OCOB 1F6AB 5CGMA 1E7VA 2Z7WA 5F1NA 4H8WH 1CXEA 2XZQH 5ADOH 4KRPD 3WMPA 3C60D 4GH7B 3JWDL 3LNGA 3PP4H 4HIPA 2B39A 5DZJA 3PP3H 4OIFA 2VZVA 2R39A 1J48A 3HBPA 2VLKD 4DKFL 5FGBA 3VRJB 4AIXA 3LEVL 2CDGA 1EEYB 2H0JA 3UC2A 4G6ML 5HGGS 2ERJC 1DP0A 3GD1C 3QEUA 4L5FH 4X7DC 4XXWC 1W0VA 3L81A 3RPBA 3VGGA 4BSWB 4PGZA 2AK1H 1K5NB 1R46A 1I53A 4GPVA 5IV2B 1Q9KA 2CO6A 2GPZA 2PKDA 1J1OH 1TCRA 2X0UA 4NUGL 5LB1A 4XMTA 2WXHA 1E6JH 2AVGA 3HVNA 1MFCL 3P69A 4NUQA 4IW4C 3CLFH 1TDQA 4AC4A 3PGDB 5IJBC 5DFVC 4JRYE 4HJTA 2R15A 1AXIB 2NYZA 3U46A 3Q8FA 1C9SA 5EIIA 1KCLA 1D5MB 4I3SH 4MQXD 3UBHA 2JSFA 3S96B 3X3FH 3VXSE 3PU7A 3Q05A 1E4WH 1EO7A 1CPUA 3K1DA 2XY2A 2CBQA 1Y1DA 4B9FA 5HSFA 1UJ3A 2PWDA 2IAAC 1HYSC 5IK3A 3DO4A 4AXWB 2JIXB 4BCYA 1QLFA 4B50A 3LRSA 4K07A 5C08D 3BKYL 3IRZA 4DTGH 1PZUB 4Y4KC 1Q1JL 4JFFD 2JJSC 5C2BH 1SHXA 2W0FB 5IFJA 4PJXF 3B9AA 2F5BL 2OSWA 4MQTB 4Q6IB 2FJHB 2FD6L 1NCAL 2FX7H 4D3CH 1F4XL 1A7PL 5KSBF 2WNKA 4NQDE 1EJ8A 3NZHH 4F20A 2GTZB 4XNQB 3WN5C 4CN1A 4M8UA 1GZHA 4A7GF 1A2YA 1RJLA 3AGWA 4U7KA 2XVKA 2MCPL 5LGJA 3ENEA 2WV3A 2EIEA 4NUGH 1RU9L 3BT2H 2DDQH 3RUGB 3UYPB 4QLWA 3O6ML 3MNWB 3ULUL 1X5HA 4KZEL 1OD9A 5E2UL 1TZOA 1P4IL 3S3DB 3EW3B 4Z23A 2H2PD 1FNEA 4UTBA 4K3JH 4TVPH 1T03H 4BFOA 3KLSA 3ZQXA 5CEXA 1INQA 1MRCH 3FCSA 4U7MA 1ZHLA 4U4BA 3AWEA 3M6DA 5J1AA 2PCFB 2Z31D 5BS0A 3F7KA 1YNLH 4R2GD 1YN6B 1QSFB 5IHHA 1A4BA 4AKOA 3K4ZA 35C8H 2W0FA 3OAYH 1ZA3A 4LU5H 4AOFA 1RK7A 3HLAA 5IGXH 3T0EE 5SX4I 4G8FA 1PZBA 4YK4C 5MEPA 1PD6A 1JWUB 4LSUL 3VH8A 2Y4SA 5ETUA 4GMTL 5FHAH 3KXFE 4DW2H 4M3KB 2E47A 1TSRA 1ZS8A 2XTLA 3MJ9A 1I8KA 2DQHL 1F4XH 1U8IA 3O6FC 1AO7D 4RNRB 4X6DB 4F7TB 1EERB 3F5WB 4G7VL 4URTB 3MRNA 4FULA 3Q1SH 2ZX5A 3BAXA 3BUYA 5C92A 5ESQA 1RU9H 3BT2L 1OM9A 3B7SA 3H9YA 3O0RL 4NKOB 3TCXA 4K5LA 3VFNA 1IGTA 2D03L 2A73A 1XCTB 5ALBH 1BA9A 1NFIB 4MJ5B 4G8GA 4ZXBA 1WG3A 4J6IA 2YPVA 4P2QD 4JFQB 2XLLA 4RGNE 5K1VA 3QNYB 4MJ5A 3QJHB 4UQ3B 5FWRA 2BJML 2B59A 4ZW6A 1CFBA 4Q14A 4XP1L 4PWJA 4ZPTA 1L6PA 4JE4B 3C6LD 1M1XA 4OKVB 4FG6D 3CFBB 3ZKMC 4X9YA 1LO2H 1T0NA 3CX2A 2YJLA 1PAZA 3OR7B 2GJ6E 4LXFA 2CMRL 1TVHA 4NC0B 1KGCD 3DARA 4XE0A 3FQWA 4HD9A 3E8UH 4YO0B 3V5DB 3ESMA 2CA3A 5D6DA 3UBXI 1MW1A 3CMOH 4K2UL 4K7FA 4U2YA 1DQKA 4DP2X 3W82A 2P5EB 4NZJA 1T0NB 3ZL1A 4Y2DD 3WNLA 1AY1H 3T65A 1E6JL 1A6TB 5IB1B 3FCUB 2QVKA 5GRUL 5FA4B 3RJDA 32C2B 4WW1A 2OMVA 1IM9A 3DGGA 5T1KA 5JW5A 3GMOA 3K4DA 1FH2A 4F37F 3MRFB 3FT3B 1KJ2A 1LGVA 2DLHA 3GYRA 4F2MB 2OLDA 5C0BE 4NENB 3N44F 4X6BB 2ZJSL 4FRWA 3NDYE 1PZSA 3OMIB 3HMXA 1W0WA 5C8JA 4CW1A 5GISH 1HL8A 2ED9A 3MV7A 4D2NA 2R2HA 5ISZE 4A2DA 2PNDA 4J39A 4TSAL 5I19H 1OF0A 3MRIB 4XHJC 3QSKB 5TE6L 1DZ0A 3K46A 3UBXB 1AYRA 2WKGA 1WFNA 1EA9C 2RFXA 4YR6B 3OR6B 2EE0A 1BVNP 3MJ7A 1G5GA 2DKSA 2FBOJ 1E9OA 4LFHG 3OB0H 3VXTA 5I17A 3SOBH 3DX8B 3RY5A 1A6ZA 1MELA 3PXJA 3GXPA 1GA2A 3CNKA 4HFWB 2MOGA 3Q48A 4QCIB 5CZXD 1E9OB 1YMMD 4E5XB 4MNGB 5IG7B 1PZ2A 2OQJA 3K6FA 5FYKL 2DICA 2EYTB 3PG2A 4NEHB 1OT1A 2AXHA 4G2AA 2JE8A 1JHKL 4C56B 4E68A 2XBTA 2NT1A 5A2FA 3UP1A 3DYMA 2KQMA 1SFHA 1QMUA 1CB4A 1IBZA 5B8CA 2CQVA 4MZIA 3PWVA 3UAJD 3C5SB 3TU6A 3L17A 5KZCD 5FECB 2AJZA 4FFZL 5GISL 1A6UL 2IIJA 3CWGA 4XN1A 2XWDA 1W6WA 4AQAB 3H2WA 4J3SA 5EPMA 4KUCF 3TPKA 4XT1C 2OMUB 1YO4A 3BO8A 3BZFA 3GJFH 3NFPA 3RVWD 5I19L 5F0JB 2YAEA 1NFDB 1GHFH 1REIA 4OSUL 4ZFOB 3BZEA 2AS5M 3GXFA 4LVNC 3NIFE 3QEQA 4HKZA 4TPRH 2XJLA 2D7MA 4UIKH 4AE0A 5TQ2L 4HLZH 3NFSH 4P2QA 5DQJA 1KYAA 3U0WL 5BZZA 1N8ZA 1N4XH 2J2ZB 4OFQA 3TF7C 4P2AA 4ZBJA 4TMPA 1TIUA 2AJSH 2QSTA 1DLHA 2VZOA 2RD0A 3DK0A 4JFPB 2BPBA 1H0DA 3FFDA 2YXWA 2FWOB 1E50A 1KEMH 1BX2A 2BVQA 2CKNA 3CSPA 1IFHL 3U7YH 1JWSA 3PWVB 4FQXC 3DX7B 2EIBA 4Y8AA 3SJVD 3MLTB 2P1YA 3GIVA 3EG9A 1GPOH 1SYSA 2XXMB 2JB6B 2E56A 3FTYA 4M6NH 4X4ME 5DEJA 4Y5YB 5DYFA 1E67A 3WO3B 3CZLA 5IBLD 3LN5A 5AZEH 1PEZA 2Z92A 1EUTA 1JWSB 5D7SL 4J3OF 1TVDA 5HI3D 1HHJA 2P48B 4G7RB 1T20A 1D6EB 5K9OB 2FNBA 5B4MD 3OLIA 1Q9KB 4GSRA 4BZ2L 2QSQA 2BHYA 3UAJA 2XN9A 1J5IA 3H56A 1Q9OA 2W94A 3T0XA 3O9WA 2VLRD 4L1HA 4PRPA 3IGFA 2X42A 3PNWA 1TTRA 3R19A 4LLDB 5CBAB 2EECA 4PJBF 2C3XA 2L7EA 2HKFH 1BLIA 4RQQB 2DWEB 3IFOA 1OT2A 2GI7A 4OF0A 3EGSB 5E9DE 4YDIH 1E5BA 2WTRA 4FQIH 4TOYH 4EDWL 4YSUA 2ZSWB 2YD1A 5K33A 2UWEB 1LEKA 3ALPA 3K74B 2E7HA 2RA1A 3MLRH 2NW3A 5J5EA 3VFRB 4K71C 4XMWA 2F61A 2CJTA 3D25B 4PJ7E 3OKOB 1U8PB 1IRAY 3QFJE 1G6RH 1HHJB 2P4AB 4H8WC 3VD1A 4Q9RH 3CLWA 1A2YB 1RJLB 3AT0A 1V55B 4JUSA 5IVXB 1T89A 4P9HL 3WEXB 4EIZC 1RSYA 3I6KB 4FYSA 1HHIA 1FE8H 1RZKL 3TEYA 4NNPL 1MCFA 1PDKB 2APFA 3LOWA 5C09A 1FAIL 3O6LL 1HKFA 3SY0B 4YHLL 5E9DB 3TEZA 4W9EC 3U1QA 1EK3A 1IAOB 4AXWA 2FYYB 2XNAA 3S36L 4N3UA 3BZ5A 1X9UA 2C4XA 4GFTB 3MLUL 5DJYB 5L88H 4L4VD 5IHZA 3VFTA 2F58H 3DUHA 4P2CG 4S1SL 5CMAA 3TFKD 2B0SH 2OMTB 5GIRB 1BMWA 1KNOB 4BJLA 3L2LA 3DOIA 1FLRH 4Q4EA 4FLRA 2GTZA 4GAFB 4AUYA 4EVNA 1PX8A 3V0JA 1YRKA 2J4WL 5J6HA 3AG1B 1UT1A 3MRCB 4KRPC 2IQAB 4Q74A 2OZ4A 3T8VA 2F18A 2Z64C 4L8BB 4ZTOL 3UCQA 3BN3B 3P0GB 5MP6H 1ET7A 4KJWD 4AYDC 4O00A 2JKXA 4DPCX 1XIWD 4PJFA 4YK4B 5F3HA 2XHNA 2FR4A 3SJVB 3BH8A 4PBXA 4YC2C 2VT0A 3P77A 4NO0B 4MA1B 1A47A 3RURA 4CVWA 5EO1B 3WL9B 4ZW3A 4RFEB 4UNIA 4N6QA 3EZJB 1XX9C 4OBSA 1PCSA 1D6VH 2NY4B 3O2DL 3HE6C 3QAQA 4HISA 2GSIA 3UDWC 3MFFA 3POCA 2V4LA 3TV3L 1F4HA 1N8OE 4G3YH 3L5XH 3TH2T 1U8OA 1DVXA 2FEEI 5AAWA 3WGVB 1KELH 2I9LB 1IL1B 4NCC1 4K9EH 1G87A 3C2SA 3VSUA 1JPGB 1KGIA 1A4JB 1UWXH 3WFHB 4WCYL 1ZS2A 3GBMH 3IJYA 4FMVA 3UMTA 2VXTL 1ZCRA 4PYGA 1IKNC 1MCCA 2WZAA 2EABA 4UT9A 5KW9L 3I3BA 2WWNA 2DI9A 5JMOC 1N2RB 4KDTC 2XN9D 5IMKA 1AKJD 1OF2A 1SBSL 3AAZA 4K8RH 3HE7C 5CINH 1KTDB 4F8LA 3W11D 1ZLVH 1W0WB 4NHUB 1M7DB 2MH4A 3TTYA 2WW8A 4AUUA 3VI3E 1NC2D 1E3FA 3TBBA 4XI5D 1MAJA 2BVTA 1JGUL 3RZCC 1ML0A 2DMKA 3ES6B 4XCEA 3HPLB 4A6YL 1VF5C 5DYOB 5KG9B 1AS7A 1B3IA 1KCUL 3BGFC 3G6JE 1TMCB 3P4MA 2KHAA 3VD0A 2NY6D 6FABH 4N2OA 1I1RA 2R8SL 3E9TA 5T3ZL 3D69B 1KV7A 3O8XD 4NQCB 3D12B 5K93A 4HK0A 4NLAA 2GJZB 2HJFA 5LCVA 4NAMA 3SKOA 3SYQA 3M1BA 1A1NA 2VW6A 4FC3E 1OAKL 4R90L 4JZOA 4CAGA 2W9EL 5DEFB 1NKRA 3LVTA 3S3BB 4MS8D 2CE6A 3U9UB 2NY0C 2CR0A 4Y2DB 2GEQA 4QRPE 3MCKB 4G1EB 3MRIA 3BSGA 3UIZA 4ABQA 5B8CB 4Y2LA 1PQZA 5LXGL 1K2DB 1U4FA 1LK2B 2EP6A 4JEGB 4HS6B 4ACPA 4MNQB 4N2MA 4N8VB 4OM0H 3SDYL 3UTQA 5CJOL 5GS2D 2GKIA 2WLIB 3BW9B 3MXWL 4XCEB 2YAHA 4X6BA 4WUUE 1MQKH 1O7DC 5I1DA 3RFZC 1KBPA 2PW1A 2OMNA 3U25A 3FPXA 3CXHJ 4Z0BH 1MHCA 2IG2H 1MHPH 2X4TB 4NIYE 3T3PB 2VC2L 1YEGL 1PGRB 3BDXA 1I3GL 5D4JA 4NFDA 1QSEB 1F00I 3DK2A 4JHAH 5L88L 5EDXA 2RFXB 3O2DA 4YR6A 4RMQA 4KI5C 2DN7A 1T04A 5D5ME 5KSAC 4NUJB 3DPDA 4KMTL 2IDTA 1FYTB 4KX8A 2X70B 4GRWE 3VVVA 4P46C 1HK6A 1FFOB 1USZA 2B9BA 5EORH 4FQ1H 2NXYC 3NA4A 5GGVL 1F6AA 4TVPL 4C4KT 3IDMB 2BW4A 4N5ED 5LO7A 5I15H 4NNYB 1RJYB 4LT7A 4OLVH 1ORSA 3C8KA 5FKPB 2NSMA 3EH5B 1T66D 1X9LA 4PRBA 3SDXF 3LXUX 1ETZB 3RGBA 2WQSA 1V10A 2XTJB 3GSNB 1HQRA 3P0VL 4WY7H 1ZKAA 1WIUA 2C7FA 3IFNH 5D1XA 2VXSL 1RJZA 1TQTA 4NWTH 5H4ZA 5H94A 4PI2A 1MFBL 2HMIC 3MLXH 4EOWL 4TUKH 1R47A 1CK0L 5AOJA 2YSSA 3QXVA 2A38A 3MOBH 4J1UA 3FQUA 1W0VB 1JPSH 3VFPB 4X6DE 1UCTA 4JG1L 1MFMA 4WFFE 3F7YA 4MRBA 2XX0A 1AR1B 2MOVA 3TFKC 4HEPA 4MX7B 4IOIB 5C2BL 1SOKA 1NUNB 1SGKA 2EXWC 2O6FA 4ODVL 4P3CL 2FJHA 1ONQA 4LO9A 2BZ7A 4U1GC 2QMKA 1SXNA 5BZWB 3FTXA 3WIAA 3U6RA 4POZD 3ROOA 4JL1A 1LXMA 5AVZB 3KCPB 3GSVA 4AMKL 3KYOA 1IJ9A 3WHE0 3AM8C 1UJ3B 2RBLA 2VSDA 3CU7A 5IOPB 3GI9L 4IBYA 1IKFL 1NCNA 3ZZQA 3P3RA 3FT2B 4Y16D 4I8DA 3MA7A 2R1YB 3T9WA 3EHBB 4D0DA 2FIRT 3FN0L 3FTVA 1G7JB 2FJUB 4P99A 2X2HA 3F12B 4L4VB 3PGFL 3U46B 2PWHA 3TO4B 4F7EA 1N6QL 4V11A 3TYGH 5I0WA 4YNYA 1QLRB 4Z7NB 4Z7WF 4GFXA 4R7VA 3VI4F 1AOZA 1JGEB 2VLMD 4LSTL 3P2BA 4Z5RA 3KPTA 3HKZA 1ZVNA 4MAUL 1X5XA 4G6JL 4LPTA 4OM1L 3ZE0F 5C0CD 5LAXA 3TWYA 4BEIA 4NYLA 4GUPB 4I48A 5HGBB 1AXSA 4XPGL 5EEUA 1UEMA 1M7IA 3V4PA 4J6RH 1OK0A 5IQ7L 2HT2D 2M26A 1JRHL 3ECBB 2FJGB 1AIFB 3FB5A 3WBDA 5GGRA 3CQQA 4Z7NF 1X5JA 3DO3A 1UZ8B 3AITA 5J3HD 4NC1C 3LHPL 4FP8L 4WDIA 5HDQH 3CVHH 1UC6A 1ASPA 3CXDH 5CJQH 5J89A 3HC4L 1HCZA 2VJXA 4DKTA 4WWKA 3J8F7 1L7TL 1YJDC 3BIKB 5GGQH 1WZ1L 1BD2D 4NKMB 1T3FB 1S5IL 2NSQA 3RIFF 3IJSA 5C3IA 4HLZG 4FI6A 3TYFB 4FA6A 3WNMA 2X6BA 4RDBA 3QCVH 3FSAA 2WQUA 1ICTA 3DMMA 1SMDA 4XZ4A 4Q6KA 4NQSB 1ILSA 1Z5HA 2B59B 3QHZL 3AXLA 5FV1L 4KHTH 3A6BL 4YSRA 2FLMA 4HJ0C 4WGVB 2H0PA 3U83A 2OSLA 4DSYA 1OAZL 1E43A 5EFIA 3N85L 1KXTB 2BVUA 5J1SC 2LU3A 5IVZA 4QRRD 4QIRA 4OW6A 5FYKH 1VSCA 2AERT 2A73B 1NMBL 4ONGH 2YAFA 5JLZA 2CRZA 4JG0L 4U6HB 1OP5H 3V5DA 1JHKH 5FYJU 4OJCA 3BDYL 3STLB 3GRBA 1NBQA 1IT9H 1I7TA 1WBYA 3HI5L 5M94B 4G6FD 3QBTB 4JG9A 4RNRA 4X6DA 5EUOB 4MJIB 2J1WA 2EVGA 4DGUA 3MLWH 3FRPA 1CGTA 2A6IB 3FL7A 3GSRB 5KYXA 1JPGA 2V3FA 1LMKA 1N19A 5AYTA 2N56A 3MNVA 5EF1A 4BFKA 1YEHH 2BOBA 4L0YA 2IBZX 4LP8A 5EZIH 4OGQC 1T1XB 4M29A 4BWTA 3NMEA 4N1CA 2UY7B 3OAZK 4JM2C 1IC4L 3FMGH 5CS7A 3TJPA 4D0BA 1JPSL 2VDKL 2BNRE 5BV7H 4N2HA 1S3KH 4RDQF 3G5XB 1KB5H 4XVJL 3SZKC 3WHE1 2BP8A 4CADA 4F3FB 3WIIH 1GYUA 1JV5B 2Y25A 3MRJB 4KX7A 1IZKA 1NGPH 3DIFB 1U36A 2Q1EA 3B1UA 3L1EA 3CFJA 1QBML 1J8HD 4L3FA 3HCVA 5IEKB 2DQUL 2FAUA 4PIRF 2BCMA 5TF1H 3SYOA 4NQEA 1AZNA 5J0BA 2AXJA 5DI8B 4JZNA 2ZG3A 1R9FA 4QHMA 1DQDH 3D48R 3ARBD 4XMLH 2OTPA 2P8LA 4DNLA 5H35A 4N28A 1N7MH 5GRVK 1JE6A 1DN0B 5DHXB 3BEVB 4JQVA 4PJCE 5C0CA 5CP7B 3TONA 3HCVB 1M42A 4DKEL 3U0PA 1KGXA 3A22A 3TJHC 4BE6A 4DP0X 2FCBA 3CFKA 5JTWA 4Z7WA 1NSNH 5E6IA 2W1NA 3QUXA 3C60A 3FU3A 3IDYB 5KYYA 4I85A 4W6XB 4PS7A 3VMNA 2ZX7A 3N1GC 4OCWH 3C6SA 2XIBA 5BRZD 1QAWA 4X2UA 4LCUB 4ZG1A 3B2UC 1XAKA 3DV4A 1MCPL 1HE7A 5E4IA 3QFDB 4ZFFB 2IH3B 1I8LA 4ODUA 4LDEB 3BGFB 4IKJA 3GBNH 1OQOA 4GT0A 1A6AB 5FGSA 4UQEA 3VX0A 4ODSL 4FJ6A 4XXCC 3PL6A 3C8DA 3ZZ1A 4RRPM 1WCQA 2IH8A 3L7EA 4FQLL 3ZUNC 4QWWC 1U33A 3PNRB 3KDMA 4LASL 1JNHB 1KPUA 2WZPA 1J1XH 3RGVD 5LDSA 4IGBC 1KUMA 3RKDD 2A6KB 3CVHL 4F8NA 1UD8A 3LPPA 1DANU 4B7IA 1FJ1B 3B2PA 4FAAB 4OLWL 1KJMA 3BUIA 3MUUA 1RZJC 2R69H 1CDBA 4RVBA 4ZYKB 1L7TH 2QPUA 4DQAA 5LG6A 3NH7H 5I74C 3EYUL 5FO9B 1T1YA 2BOLA 2NY3C 2YBRA 1S46A 3LIZL 5D93B 1CZ8H 4P3WA 3U0TA 1IGIL 2G2NA 1OCWL 1WC7B 5L0QC 3HAEG 3AM8A 3L3JA 1Q9LA 1IVLA 3P40A 4FKHA 1TEGA 2LT9A 4FCAA 4XMPL 1UWEH 1FYTD 4QRUA 5DO8A 5D2LA 1BFVL 3GMLB 4YE0A 3D2UD 3QZLA 5JOPD 1MY7A 4JDTH 4MB1A 4PLKD 3GXTA 3VFVA 4X9BA 5I6OA 5K9OA 4X6CE 3DDGA 3QZWG 5ICXA 3ZIYA 1MRCL 4R84A 4ADGA 4WKZA 2IO5A 1DBBH 2B77A 3SPIA 3T2QA 4OCSL 2ZX9A 4CNIA 2G4GA 3O8XA 4MHHG 3AUWB 1T7ZA 2FEJA 1L9SA 2JB6A 1EHXA 1GC1C 35C8L 3OKNB 1W72H 3FB7A 5A43C 1IEHA 3DX7A 3ZTCC 5KVDL 2AEIT 5LN8A 2F54A 1KB5B 1SEQH 3HZMB 4LL9A 3ET9F 4Z3FA 1QBLH 2EC8A 2H2SD 1JYVA 2E5EA 2BVQB 4G9FE 3WY4A 3TM6A 1UZ6E 2PO6C 1A6VL 3VFMA 3MA9L 5FCSH 5FUCE 4MAYB 5EH1A 4MCYA 5HY9A 1RUAH 3WIFA 2I24N 1V5JA 4P2RA 4MSWB 2XA8H 1GZPA 3II2A 4I13B 1N3NB 2H2PC 2AV1B 4ZFOL 1XF2B 4IBWA 2AJ3A 5F44A 3ZMEA 1UA6H 3PV7A 1J86A 2C9SA 2ZG1A 4KVPA 4ZS7L 3WEXA 4LKXB 1TZAA 2X4QA 4YWGH 1DUZA 1ZSDB 4Z0XA 5TE7L 3VMOA 3ECWA 3L9RA 3SE8L 2ENYA 5HHPB 3WAKA 3FO0H 2D3JA 2A74B 2CO2A 2QQLL 4XNXH 5JPMA 1F4YL 4WFHD 4XN7A 5AW9B 1T1ZA 2VLKB 3I9GL 1FZKA 4UMGA 3KLHC 4PTTA 1VEOA 4J3BA 4KPHL 2Z7ZA 1OZTG 4F7EB 2XWRA 3RUGA 1CD1A 4Y2OB 3U4KA 1EAJA 1D7CA 5J8OA 3F85A 5FXCH 2H8PA 5LWYH 1HL5A 2APBA 1S6NA 3MOAH 4CL7A 2L7JA 4GRWH 4KQ4H 4FTVB 5C0AB 5CJXA 4OLYL 1NDGB 1S7SB 4P57B 3LVEA 1IBBA 3VRLF 5HHOA 2H8PB 1DQDL 3HR6A 2JCCF 3OKYA 5EU5B 4Q6IA 3FQTB 4ENZA 4P23A 4X6EA 1KTRL 1EEUA 1AXSB 3MV8D 4UV7L 3PREA 1JGUH 3HNVL 3KBFA 2X44D 5KUKA 2IGLA 4BQCA 1FH5H 2K9FB 3FUKA 1ZT7B 3Q3GB 3ZTDC 1NC4D 2IBBA 3ULUD 4Y1AE 1EHLH 3LKQA 5FYJH 3P3UA 4RH4A 1GAFL 3LRGA 4JN1H 4FFTA 5ID0B 1B6UA 3INOA 1Q94A 4JW3A 3FQNB 3KNBB 1QTYT 1SJEB 4RWYL 2EDTA 4JM2A 1YG9A 3QCTL 3O41B 1JXDA 1D5ZA 4NKMA 2UWEA 3PLYA 3MNZB 4DP5X 2DH2A 3BQUD 5ID1A 2KERA 4N8UA 2MKLC 3WHXA 2QMJA 4JMNA 4LSPH 3CLEL 5LGJB 1LO0H 5BUGA 3VMPA 4DO6A 2FB4H 3EFFA 2F7IA 3ETBJ 2NX5A 4XCFL 4E9XA 5CJOH 1G7LB 2E8YA 4JS7A 4PRIA 4JANA 2NXZB 2IV9A 5L9DL 1K5WA 2CBMA 4R6UA 1JFQH 2WQRA 3B9KA 1G43A 1BOYA 1N70A 4B9KC 4ATWA 2C3VB 2F19L 3L3KB 5EC1A 1A02N 5AVRB 1YEGH 3O3UN 3KPSE 3P4LA 3OR7A 3PDOB 4FYTA 3WXVH 4JFYA 4C56D 5A6MA 4G9FA 3B56A 1AR2A 1MAML 3MSPA 1RPUA 1V7MH 3AFLA 8PAZA 1GTFA 3VNZA 2EQDA 2WO2B 4OCXH 4NRZA 1DJYA 3GFUA 3OKKB 4G9FB 2UYLB 5GZND 1E9PA 4PJ8A 1L9QA 1P4LB 1G9NC 1U8IB 5FHBL 4WWNA 1D2PA 2HMID 4LSVH 5I1JH 5E99H 2VLJB 2R8SH 3ZHDA 1TXKA 3I2CH 4N0UB 2H1LM 1RXLA 5A3IC 1AR1D 3OC5A 1NMCB 2VDMH 2EEBA 1I82A 3PL6C 4N8VG 4YHPA 4Y19A 3SGJA 3T77B 4ELMA 4TS6A 2FECL 4ORZC 1S8DB 1T66C 3RWCA 4JRFA 4C59B 4N4YB 4MJIA 5B3JF 1KGYE 5DGRA 4AIOA 3CFMA 4ELKB 3HVDA 3P9WB 1X5IA 4I77H 4AE1A 1T80A 2JELH 5D1ZA 3BPOC 1UZ6F 3QPKA 5DK2A 1BAFL 4MYPA 4UINL 2QR0B 1JNNH 1WAAE 1LLAA 3TS8A 5B7MA 4I18C 5BS0E 4HPOL 3AREC 2PW1B 2OR7A 2GSGB 1F4YH 2V33A 3T04D 1P6WA 4Y5VB 2RCSL 3VFGH 4CSZA 3W57A 1IJNA 2OPCA 4UDTA 4CC0A 1ZANL 4JVWA 1HKLH 3RTLA 3FC8A 4JY5H 4DVRL 5BOZG 1SDYA 3ES6A 1AXTL 1HNFA 2KLRA 4LNRB 4Z7UB 5IW3A 4IRSA 1JPFA 2XXFA 2Z0UA 1VADB 4OJFH 1LEIB 4B0MM 1KJ2L 2Y7SA 1C8PA 1A7BA 3KBPA 1CVSC 3DURA 1QHPA 2CR3A 4IBQA 3UEQA 4QKXB 5IEHB 1A0QH 3FN9A 2XKNB 1HFUA 3OC8A 5AW1B 5IP4A 3G04A 2P44B 2W07A 3QPQC 3QZNA 4PJBA 4HK0B 2XN2A 5EBGA 2MHAA 1F2XK 3L4WA 5CCHE 1UASA 3QR0A 2FO8A 1EGJH 4MWFA 5FAAA 2C3GA 1J7VR 1YECL 3FK3A 1KPRA 2EH8L 1G1OA 1Z3GL 1ZGLB 3MBXL 2VLJE 4TLUA 1T83C 4R26L 3ZIMA 2HLAA 3QE5A 4G6AD 1A21A 3QQDB 2OTWA 4JN1L 4JFEB 4NC2B 1P1VA 1BEXA 1BREA 2OXHB 1S7UB 2YMTA 3DX1A 5JDSA 4AT6B 4J6RL 4DP6X 3EYSL 3HI1A 3L13A 3NIFF 2DQTH 1HH6A 5GGVH 2X9YA 1XSKA 1VZHA 3P3SA 2ENPA 4JPVH 3GBDA 3NDZE 2Y5EA 3GRWH 4KH9A 1W2KT 1CC3A 1WJ3A 5FYLH 2GBVA 3MJ6A 3UYOD 1QFHA 3HEIB 2MHAB 4HZ1A 5KS9E 5KBDA 1FYHB 2XZQL 4FFVD 1SRDA 1H9VA 1CLYL 3BDBA 2ZXEB 1KBKA 2NQCA 3QEGL 5F1NB 4LHUA 3IDMA 4J4PD 3KCPA 4MD4A 4QYOA 5FUCC 3EXJA 3RNQB 1HWHB 2H32B 4Y5XC 2YPVL 5I1EL 2AZUA 1FSKC 2CG9X 4KVNL 5DMIL 3BVXA 2DQEH 3FB7B 3T2OA 2VDMB 1BFTA 5E8NA 1YAZA 3IKCB 3QJSB 2YD9A 1TITA 2C34A 3CK0H 3SGDI 1G1YA 1T21B 5KZCB 1GY1A 3NJHA 5I1IH 5KVMC 4NLHA 3WTVA 1DFXA 1NEPA 3KGRA 1YEJH 3DX0A 3HHRB 4H0LC 4J3VA 4TM9A 3W0WA 3CQFA 3IE9A 3ZZLA 3HZKA 3W81A 3HOGA 1XCWA 3BWUF 4YS4A 5AVQB 2QJDA 4BDVA 4PTTB 3MGTB 4LF3B 2VO5A 2XWZA 3CTTA 4NNXB 4HUVA 3KYAA 5DJAA 1BYNA 2QVFB 5DD3L 5EEZA 1UYWH 3QJFA 3N1FC 5JA8B 2YD0A 3B7TA 2D73A 3X3FL 2P8MB 1OY3B 3GI9H 4HKJA 1U6AH 3AADB 1IKFH 2X6UA 5HGHA 1AG6A 2E75C 1N12A 3FQXA 4MXVF 2E4TA 4PGBB 3FN0H 1XIWA 1IO4C 3T2LA 1QLEL 1K8IA 4HFUH 1QFOA 2Q8BL 1KBGL 1RZFL 2GC7C 2JCCA 2VQ1B 3M7OA 3D50A 5CSGA 4ZNEE 3QWOA 1WRFA 5I1EH 4K94L 4QTHB 3O6FD 2CKBH 2OW7A 5DJZA 4EIBA 4YFDB 4UINH 5DEGA 3RL1A 4N8CL 1H3TA 2VDKH 1IAIL 4JO3H 4H88H 4YSOA 1FIGL 3N40F 1CUOA 1RIUL 2BSED 4JM4L 3RVXC 4DKAA 4BWWA 5DO2C 1ZK5A 4XO5A 4QEGA 3NOIA 3VW3H 1RERA 1G84A 5IJVB 1WFIA 2WC7A 1QFWL 2LVEA 2R0LH 4P05A 4R2GC 4ZX5A 3SQOL 1BZOA 2YUWA 5GGRY 2IAND 2FT6A 5FX3A 2NXZD 5J13B 3GJEB 4ERSH 3VXQA 3OZKA 1WBZB 3QNFA 3W9EA 4F1ZA 1DQJA 2FBRA 2W81C 2Z34A 4I3RH 3V9CA 1OLLA 4U7SA 4WKXA 2ZSWA 2EYRB 4JM2D 4PCSA 4ZAKB 1TSHA 3GO1H 4N20A 1RFDH 3WKYA 5HHOB 2CIIB 3OXSA 2J5LC 1V7NL 5F7DA 3KW7A 1M05B 3GZOA 4K7PL 3K81A 4P4RA 2K4WA 3OL2A 2CHWA 3AC0A 5IK3B 2AJXL 2QLYA 4AQOA 4HWEL 1ZDSA 4H2AA 2E6JA 1NDTA 3FHAA 1RZIA 2GSMB 3MNZA 1IT9L 4KJQC 3VVWA 3RWHB 3WFDH 2FYVA 4DEPB 1KOAA 2NDGA 1BDYA 2B2XH 4AITA 2O4EA 3WS3B 2YGOA 2DBJA 4PJAE 4PWEA 3LSOA 4N0CD 2OZ4H 4OD3H 1R33A 2LAAA 2CBTA 3RIAF 3O9WD 5AVTB 4QRQA 3K91A 2BNQA 3V4VL 1ADQL 1T2XA 2VDQB 1P6AB 4KDWA 5GHWH 5H37G 1ED3B 3NPSB 1Z9OA 1MQKL 4HJJL 4HCGA 4OD1H 4RFEA 3DUSB 2W65B 3H4FA 1NMCC 1BVZA 1V3KA 1MFUA 1WT5A 4JFYB 4YLBA 4EN3C 4K7FB 4KTEL 2NY4D 1TQVA 1YDPB 1KB9J 5D6DC 2B08A 2CHNA 2ZAHA 4R97B 5I76A 3WFEL 4NKOA 2XZCL 3WN6A 1PZDA 3AQZA 1BZQK 3IGAB 3L9YA 3RWFA 3S37L 1NEUA 5T3XE 4GLRH 1WBYB 4ZMWA 1NBCA 2SEBB 4TSBL 4N5UA 4HOMA 1YEDB 1UXSA 4AL8L 4WW2C 1CFTA 4EZLA 3M07A 1RMFH 5C9KA 1DVYA 1XTLA 3HI6L 4LCCA 4Y5YC 1HL9A 4HXBL 3OZ9L 3FUNA 3X17A 3JVGC 5GRWA 3E6FA 4XO8A 2WB1A 4X7FC 4LVNB 2Q6WA 3OZLA 5CKAA 1PZ3A 1KF9B 2FECI 2HFTA 3P4OB 4MVBD 4XTRC 5GRUH 2E9WA 1NPUA 3HAEB 4YGVA 4PJ6A 4WW1B 1GGCH 3UBXA 2BCKA 3HFMH 5EBLA 4E41A 8CGTA 3RWIB 3IDYC 3C87A 3IM1A 5F7HA 4LLMB 1DVSA 3MLYL 1JPFB 2AC0A 3IDNA 3QFDA 3TN0D 4ZFFA 2DD8H 3BN9D 4UT6A 3FOLA 4H7VA 1OB1B 5AFAA 3RHWK 3RWIA 3UAFA 2K9UA 2GIMA 2WOBA 4UAOB 3ZYZA 4ZW8A 3L1OH 1BZ9B 4JY6A 4MXQD 1OD7A 4LPUA 3WDJA 3BESR 1OTTD 3KH3A 9CGTA 4AGOA 1F58L 2B4CH 4WW2B 4GIOA 4AG4H 2A6KA 2XA8L 3D69A 1GJUA 1SEBA 4OGZA 1IM9B 1GVIA 3DGGB 4AUJA 3BD3A 1CE6B 5KYUB 4JGMA 3LXBA 1VACA 1GMEA 2EDFA 2ICEC 4OKVA 4X5XA 5KAQG 1FRGH 4CVXA 5IT2H 3HC3H 2E0PA 1HINL 4P04A 4PG2A 2EDRA 3B9DA 3DXAA 3R8QA 1C7SA 2L0DA 2IH3A 2BIIA 2AQNA 4P5MA 1QRKA 1LQBC 1GTNA 4LAQL 4PJBB 1D5XB 3VYOA 3PQYD 3MUZ1 3AW5A 2WVVA 5KBLA 2ZYRA 3MRJA 1QX1A 1N0XH 3UYRL 3WN5A 1QUNB 1UWEL 1I85A 5EEVA 3FONA 1NEZB 3C60B 3V0WL 5F3FA 2BVPA 4FQ2H 1E5UI 1GXEA 5L4FA 3PAYA 2WANA 2Y1ZA 5D2NA 4K3GA 1BQUA 3QVAA 4P2OB 3LQAC 4XOBA 1R1CA 3LIUA 4QNPF 3QRLA 4IRSC 2K8QA 4CMMB 4FFVC 3EYUH 3KVPA 2DYPD 4WI3A 1VFUA 5JIPA 1ET8A 1QACA 4QOKE 3MV9A 2H1XA 1N9PA 5KBPA 3M7FB 3QA3B 4OD2A 4QRRE 1T0MA 4WFGE 5C3TA 1AFVL 4MNHB 4HFWA 4QCIA 1WWWX 1QSFD 1H3PL 4K3EH 4M5YH 4XZUA 2ALAA 1VRSA 4KKAC 4Y4FB 1L0PA 1ZWIB 2O5YL 4PYHA 3VSTA 2HLFC 1KB3A 2X05A 4UOJA 1Y0LB 5KVDH 2A4CA 4HGWB 5K59E 1CGSL 3ILQC 5EO9B 5G4NA 2J71A 2X4SB 1M9WA 2FSEB 3CD4A 4KQ3H 5IB2A 2WUBL 3BPCA 3FTWA 1ID5I 1BF8A 5HDBF 3VFSA 3ARZA 3GTVA 1S7UA 2GFBA 5JDSB 3KDMB 2VZTA 4TNGA 5JPMB 2HKHL 3DLQR 4QO1B 1OM3H 2A74C 2VABA 5TJWK 2ICCA 4NZUL 1XAUA 4UBDC 3SE8H 2BSRA 2Y36L 2AV1A 1QFUL 5A2IH 2DQDH 2AXFB 3LRHA 3PWLA 4ZO8A 1LWJA 3N85H 3LZFH 3NCXA 4P2RB 4Y9CA 5HHXL 3HC2A 4XMXA 3V7AG 3WLWD 4FG2A 4UTBL 3BKJH 5IUCA 1Y0LA 1MDTA 2QZQA 4UT7L 3H42L 2MOQA 1RAMA 4BK5C 3VGAB 1J8HE 4ZS6C 1VDGA 2WXKA 4Y7OC 2OMZA 3SOBL 1NOFA 2GYSA 4QXTB 1JYWA 2XOTA 3QIWC 2IADA 2XWTA 3QDME 4P2QB 4WGKA 1WQVT 2AGJH 2ATPB 2D3NA 3QQXA 1H3UA 4WTWA 4YDIL 2YFNA 4JDZA 1CYXA 4YE4H 4NSKA 4WI5A 4JMXA 5E5RB 5EMYA 2ZP9A 4A55A 5HPMA 2MCAA 2EIZB 4XODA 5BCAA 4XP5L 1DL7H 4TSAH 2BH0A 3GNMH 5HHME 3UXFA 1FFTB 4ADIA 1F45A 3LS4L 1KLFA 3HG1E 2YMXH 1GR7A 1N6VA 1U8PA 3BP6B 3LH9A 2HT3C 1N67A 3NN8A 3IAQA 3EKCA 3MRDB 2CO7A 4GQQA 5FYLE 4YHMH 2F08A 1B9ZA 3O41A 4JFHE 4I3GA 1OGTB 4KROD 5DJ6B 3ZMNA 3DHPA 3LPWA 3A6OA 1IC4H 5I75C 1ACYL 3T4AB 1A7OL 2LABA 1JGLH 5JIIA 2V9QA 1F3JA 4O9HL 4CRPA 3PGDA 1IX2A 2OX5B 3UG3A 3AQYA 3I9AA 2X53A 1KFGA 3BKML 3VA6A 5IB5A 5EBMB 3FSOA 1Q0XH 3KBEA 3EF7A 1ZT7A 3FU0A 3Q3GA 2H0FA 1HAWA 3O6KL 3O4LB 1KYOJ 4GLRI 1P1ZA 4NP4H 1SHMA 5IW6B 3O9WB 3U0WH 5T1JA 3GXUB 2DJMA 1MHEA 4L5FE 5AKRA 2ZKHL 1XGUA 2PO6A 4XNMA 1BJ8A 4NI6A 1G9MH 3LZNA 5FGCB 1WUNT 5EFIB 5AZUA 5DUBA 2BC4A 1U8HB 1JGEA 2AMUA 4NXSA 2IF7A 2YRPA 4WUKL 4PLNC 3QIUB 4CGUB 1DVTA 4QRAA 5BS0B 3ASOB 5DVNA 2GJRA 3NZ8A 3D1MC 1JFQL 5FYKD 2IOMA 4LIQE 3LD8B 4NZFA 2EICA 1BXAA 1I9JL 3STLA 5AKSA 3HC0B 4ZD3L 4IKNA 4M7KL 3IXTA 4A1RA 5D1QA 3P77B 4NO0A 1VENA 4RAVA 1MFDH 1B3JA 3ZDYE 1UATA 4QXGL 4R7DB 4DZBA 4XMKH 1U2YA 3VFOA 3BEWA 3WNOA 2YWZA 4DK5A 3AU1B 3BSHA 1F56A 2NNAA 3O2DH 5MENA 3AY4C 3IBOA 4PRIB 2OL3H 3PHQB 4P4KD 1UB6A 4ZTOH 4HF5H 2ZUTA 2KLTA 3RWCB 1AD9B 1FHGA 4KDTA 2QHRH 1UWGL 5D7EA 3TYFA 1RVFH 3MRNB 3N41F 2ZQKA 2Z8RA 3CDYA 4RBPK 1BIIA 1NUDA 4IYKA 1I7TB 5DHEA 3KWVA 2LV4A 1DBJH 3DO7B 5CJBA 4XB7A 3BHBB 2JKLA 2R56L 1XQ4A 1YDPA 5I76B 1MNNA 1IBDA 2YK1H 4BFRA 1XF3A 4FXTA 3CFIC 1UENA 5E8PB 4NC1E 3IF1A 2CUIA 1HXKA 4FFYH 3ABLB 2E7DA 3V0HA 1LJMA 4WFFD 2RACA 4ELDA 4XPTH 3R7RA 1Q72L 1WSST 2YWYA 4ZPTB 1G6RL 1LE5A 4QJ5B 4OZGA 1G1CA 1KSRA 2ICWJ 5KUMA 4UM9A 3QDMA 3VXUD 2W95A 4ES8A 3LEYL 1EVUA 3SYAA 5GZOD 1KGWA 2YC1B 2D0GA 3I02A 4MDRA 5B1JA 4BSVB 5DXWA 1SBSH 4ZTEA 5AW3B 4WCYH 3F00A 4PRNA 4O58L 1M2VB 3UDWA 3AVEA 3V5KB 1N5AB 2ZP8A 3GSWA 2XETA 5C0FB 2OYLA 5CBEB 2BSTB 2VKWA 1L0QA 1NH6A 3HG4A 1D7DA 2DBLL 5E1QA 2K3HA 3DHMA 1FNAA 1AKPA 3IEAA 2ZWKA 1IAIM 3MBEA 4Q9RL 2BWIA 3O6MH 4ECNA 3MXVL 4GW5B 5DS8B 2AGJL 4M6AA 1CR9H 3NEOA 4KO6A 3ZYIA 2CK0L 4JDVB 1D5BA 5DJDA 3TA3D 1PTZA 4PB9L 3CZFA 1CE6A 1FZOB 1IEAB 3VXUB 2ZUXA 3MX0B 2ATKA 2APWA 4DO4A 3NSCA 3SDAD 3UC0H 4AZ8A 3SDCA 4A63A 3KYNA 2XI9A 3K6IA 4JFHD 4MJ2A 1U8LB 2PPEA 4LP5A 1MDAA 1VFOA 2BVOB 1JI1A 4FNSA 3HFFA 4R4FH 2VOTA 4CC4C 2F54D 1P7HL 4HS6A 2WP3T 4FF9A 2EO7A 3N42F 1TJGH 4GBXA 2R0WH 2FVNA 2W38A 4G6MH 1H19A 3GB7A 5MERB 3CAFA 4UQAA 4XVUC 3SGDH 3TA3C 1S9WB 2UX6A 3U9UA 4HIXL 3BH9B 3NFNB 3NABH 1NCCL 4V1DD 2EH7H 5IKCA 3WU1A 1XD0A 3EYFB 4M6ML 4QT5A 5J4MA 4HJEA 3QEGH 5D1QE 3W39A 3JBG7 4AV0A 1BLNA 3CSGA 4KKLC 4U05A 2VE6B 1MFCH 2YEZA 4ZUVA 2KI6A 4KTYA 4NO0D 4NQTA 4Y1SA 4K5OA 3QEQB 4HKZB 2OXGA 2Y7QA 1NGQH 4ETYA 4Q6IC 4BUQA 1J5CA 5TDOA 1R3JB 3FUJA 2D2OA 5EWIL 3PPSA 1HEHC 1OHZA 4OGAC 1FIEA 1TZIA 3ARVA 3QRGL 3FUIA 4TLKA 5T5NG 3KPSD 3X14B 2K45A 2EEDA 2E8ZA 3DOHA 3QI9B 5EU3B 2WM0A 1SXSA 4RAHA 4Y4HB 4KK9D 5ENWB 1SY6H 3K72A 3RI5K 5IHUL 4PN6A 5H94B 1SYSB 3UTSB 3TZVA 3ZKXB 3FFCE 3CFQA 5BW7A 1ZT1B 3ZZSA 4PJXA 5ENWA 3DX9A 3BYYA 4PB0H 2R2CA 3HHSA 4ALAH 4ZMPA 1JERA 3IMVA 5F3BB 4PV9A 5EU6A 4DEWA 5I15L 2HKAA 4QAMB 4DGYH 2O93L 2H32A 4FABL 4EI5C 3HZMA 3AQDA 4HEME 1CDHA 1MWAH 4XBEL 5BPPA 3HG3A 4YFLF 4DWHA 1ND0A 4PM1A 4ETQA 4YDLB 4PJGA 4URKA 4WO4A 3V4VH 1INEH 2XQYK 3LDBB 1R34A 1QOKA 4Z7WE 2NSXA 5DHMC 3QI9C 5GZOA 5L9DH 4HKJB 5DRZA 1UD4A 1QP1A 4M62L 2QQKH 2MKWA 4HMDA 3L16A 5KJRH 5F88A 3EJJX 3JTSA 1DQQA 1T7WA 1CL7H 1UKTA 3MRMA 5EO0B 3QDGD 1SLVA 2XN9B 3WAJA 3F04A 3EGDB 4NDMA 1Q9WB 4HHWA 1S7RA 2GBAA 2A74A 1MLBB 4QRTA 1LO3L 4B9PA 5C0RL 4IS6A 5E08H 2BP5M 4JFSA 1CXHA 3PJSB 5E8OB 4X8XA 4HOWA 3VXOB 1IQWL 4MA7H 5HPMB 3N41B 4JN2B 4M1DL 1UG9A 3KLHD 4XH2A 1OT4A 3IN0A 5DHYB 3SBQA 3TLRA 1HH9A 4UQBA 1S7RB 4AYEC 4U6YA 2R1YA 4TV3A 1NCHA 2R4SH 1FVEB 5C97A 5IQ9B 3LXCA 5CGTA 3BX7C 1M3JA 1XEUA 1QFWH 4K3DL 4X6EB 2KMWA 5E23A 3GMQB 2DQGL 2EYSA 1FFPB 3SQOH 5F88B 4FQHA 3QWOB 2NNRA 1P5VA 1Z9SB 3EO0B 5F7YC 5IQ9A 1I9RH 3KEHA 4YPGB 4R8WL 3VXRA 2LU7A 4NM8L 1U42A 1ZEAL 5DFAA 5BZWA 5DVOA 3FB5B 2I25N 1SY6A 3QJVB 1RLWA 3X2QB 2PWGA 3EOAB 1BJMA 1I1YB 4NRYA 2EYRA 3UP6A 5ILTH 5CFHA 1DE4A 5IB4A 4XP1H 3RWDB 1JF5A 3UADA 3WKQA 3BZDA 3ML9A 3GJEA 2BRQA 4ZUUB 5SWSD 2VNCA 4PW3A 3P4NB 3D09A 2CMRH 3CVDA 4G80B 4OFPA 5JORA 2MCMA 4I7ZC 2AJXH 4QRSB 3VFRA 2Y3NA