1TU2A

The complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
b'ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
molecule tags Electron transport
source organism Nostoc sp.
publication title Structure of the complex between plastocyanin and cytochrome f from the cyanobacterium Nostoc sp. PCC 7119 as determined by paramagnetic NMR. The balance between electrostatic and hydrophobic interactions within the transient complex determines the relative orientation of the two proteins.
pubmed doi rcsb
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tu2A00
4K9JA 2XU9A 3FU9A 3WG7B 1NWPA 4A67A 1NIDA 3X1GA 3TA4D 3NJGA 2PCYA 2MRYA 2FT7A 3NSDA 2BZCA 3NYKA 2XLLA 1AZUA 3NJFA 4A66A 2JKWA 2PPEA 2VM3A 2EILB 4YSSA 4E9TA 4AX3A 1MG2C 3ABKB 2PPDA 2ZWNA 3IEAA 2Q9OA 1L9OA 4HCFA 3AG4B 4KNSA 5EHFA 1PMYA 3TBBA 3ZIYA 4BWUA 3NP3A 3TASA 3OM3B 1ZPUA 2VMJA 2YARA 3FSWA 1W6WA 2H5UA 3AG3B 3JT2A 3T6XA 1OE2A 2H47C 3FPXA 4BWTA 1GY1A 7PCYA 1NIEA 2PP7A 3ERXA 4E9WA 2ZXWB 5F7AA 1BXVA 4CSPA 2HXAA 2HX7A 2IDQA 4GY4A 5B1KA 2PP8A 1PZAA 1BQKA 2GC4C 5A7EA 1KCBA 3ABGA 1IUZA 2VSKB 1DZ0A 3PAUA 3QJRB 1NZRA 4HAKA 1T5KA 2AFNA 1XB8A 4E9VA 5B1JA 2VW4A 3C75A 1WS7A 4WTQA 4FA7B 2XVBA 5PCYA 1CURA 3CG8A 1GW0A 1J5CA 5B1AB 3H4HA 4RH4A 2GC7C 2I85A 3H4FA 1PNCA 3NJJA 5B7FA 1KDJA 2YAEA 1AZNA 4BXVA 1KV7A 3N2JA 2P80A 2VM4A 5TK4A 8PAZA 1OE1A 3GYRA 5I5IA 1SJMA 2LLNA 3DKHA 1AZCA 1BYPA 5D4JA 1ETJA 3FQ2A 1F56A 3AY2A 3AZUA 1AS8A 4HCIA 4YSOA 5I6NA 6PAZA 1WA2X 3AG2B 1RCYA 1PF3A 4N8UA 1GY2A 4G72B 1FFTB 5AZUA 4F7KA 1GYCA 1JZGA 3PPSA 2WO3B 2IWEA 4JHUA 4NERA 1JOIA 1NINA 5I6MA 3FQ1A 2VW6A 1HAWA 2YXWA 2YAMA 1GS8A 2UXGA 2W8CA 3ASOB 2X87A 1OCOB 3V9EA 2XX1A 2XX0A 4A68A 1SDDB 2HX8A 5B7MA 3SBPA 4YL4A 4Q8BA 4G7RB 1HAUA 2R7EB 3FYIB 2FQGA 1OOWA 2BHFA 1ILUA 1NTDA 3NSYA 5B3SB 4E9XA 5I5MA 1ADWA 3FU7A 3NJMA 4GP8B 2NRDA 2CCWA 1JXDA 2YAPA 3NP4A 5I26A 3QJSB 4A2HA 4YSQA 1KGYE 2AZUA 2EINB 1KYAA 2VW7A 1IC0A 4HZ1A 3NSFA 2BWIA 3OMNB 1ET5A 3NJHA 1KBVA 5D4HA 2XV0A 1R1CA 2TSAA 4E9QA 4KO7A 2XYBA 1AZRA 2PPAA 2XXGA 1SFHA 5E9NA 1JZJA 1MZYA 4DPBX 1JVLA 4E9YA 2BP0B 3QJUB 2FNWA 4NAJA 1ET7A 1E65A 4YVUA 2YAHA 4BXSV 3T71A 2I7SA 3EHBB 3KW7A 1ZDQA 1PZBA 2Q5BA 4M4RB 4AI7A 2YAQA 1BQRA 2H3XC 2J57A 3AG1B 1QLEB 3N55A 5FC9A 4EF3A 5AKRA 2OV0A 3HB3B 2UX6A 4A2DA 1OE3A 1SF3A 2BP0A 3CDZB 4A2GA 4QKTA 4HIPA 1JZEA 2QPEB 3SBQA 4BDVA 1J9RA 1NDTA 2A3TA 3UABA 3OMAB 1NICA 4P5RA 2YAFA 3ABMB 3SQRA 3EH3B 3NT0A 4KO6A 2OCCB 2QDVA 4DP4X 3S3CB 4BK5C 2AANA 2HRHA 2YAOA 3QJVB 1W8EA 4YSRA 4F2EA 1IBZA 2FT8A 2P80D 4UANA 1N70A 1RZPA 2IDTA 1TEFA 5D4IA 1JZHA 1MZZA 4YSUA 2PP9A 1ET8A 1GR7A 3FSVA 1WAEA 1PZCA 1NIFA 2CBPA 5F7BA 7PAZA 3FQYA 5AFAA 4BWWA 1BXUA 2E86A 3QQXA 3EH5B 2EIMB 1BEXA 1L9SA 5IY5B 3T6VA 1KBWA 1SDDA 2UX7A 4Q89A 2IH8A 4YSCA 4KO5A 4GXFA 1FA4A 1JXGA 2UXFA 3WI9A 2HRGA 1HFUA 1ASPA 2DWSA 3CZUB 4ZK8A 3D12B 1SNRA 2N0MA 3S3DB 3X1FA 4W9ZA 1AZBA 1YLBB 4AKOA 4UF7C 1CYWA 1JZIA 2RACA 2FJSA 3OQRA 1CC3A 2OJ1A 4DP2X 3UACA 2R7EA 3BQVA 1E5YA 1ZIBA 3V9CA 5B7EA 2BWDA 2XV2A 1A3ZA 2I7OA 3TU6A 2BZ7A 3H56A 1PLAA 4M3HA 1A4CA 4DP9X 2FQFA 1E67A 2IAAC 1AOZA 2BP8B 4NB7A 1ZDSA 1PY0A 4KOBA 4AKQA 1TKWA 1ID2A 2WO2B 4DP6X 3U25A 3TBCA 1E5ZA 4KOCA 4KNTA 1A4BA 3ZX1A 3T6WA 2B3IA 2QPDB 1AIZA 3BVDB 1NWOA 2FQDA 2VSMB 1GS7A 5ANHA 3FSZA 4F2FA 2IDSA 1KDIA 3DIVA 1IBYA 1A8ZA 3RYMA 3IBOA 2PCFA 6PCYA 1URIA 2DV6A 2Y1AA 4DPAX 1RKRA 3JTBA 4YSTA 1TU2A 3NJLA 3QJQB 1FWXA 4E9RA 1AS6A 3DTUB 1J9TA 1GS6X 2DYSB 2PLTA 2YXVA 1OCCB 2AVFA 1QHQA 1L9QA 1BAWA 3UGEA 2W88A 3KW8A 2J55A 1AG6A 1XMEB 4DP8X 1XB3A 3PLYA 1PNDA 1WA0X 1J9QA 1ZIAA 4HHWA 2HZHA 3PCYA 4P5SA 1JZFA 3X1NA 3T6ZA 1OV8A 5I6OA 1PLCA 2XV3A 1AR1B 1OCZB 1M57B 1SHWA 3UADA 2Y69B 4YVNA 3EF4A 4A2FA 1MDAA 2MTAA 3IN2A 4AKPA 4X4KA 3FYEB 4JKNA 1WS8A 4FAAB 2FQEA 1AAJA 4G70B 1EZLA 3FU8A 4E9SA 3X1EA 1DYZA 4DPCX 1M56B 2JFCA 2QT6A 1TEGA 5I6LA 1NIBA 3WKPA 2JXMA 3G5WA 4MFHA 1WA1X 1AG0A 9PCYA 3UAAA 1ASQA 3SBRA 3MBWB 4YSEA 2GI0A 3PAZA 2GSMB 2HLEB 1M9WA 2EIKB 4TXVB 4CSZA 2FT6A 3PXLA 3ABLB 2GHZA 2DWTA 2CJ3A 1AQ8A 1BYOA 5I6KA 4HCGA 3L45A 2XUWA 2ZOOA 4WKXA 1I53A 3FS9A 4DP7X 2YQBA 1SHXA 4PCYA 3OMIB 3PAVA 3UAEA 2GB2A 4YSDA 4W1TA 5I6PA 1W6LA 2XXFA 1NIAA 1X9RA 5B1BB 2UXVA 4HHGA 3AW5A 2IWKA 5LDUA 4G7SB 1J5DA 4G71B 3OD3A 2XWZA 1B3IA 4GP5B 1OF0A 1V55B 3NJIA 4UAHA 1ZV2A 2AZAA 1BXAA 3GDCA 2BW5A 4KNUA 2EIJB 3NJNA 1PCSA 2CALA 1UATA 3ASNB 1ASOA 2J56A 3MX0B 3QPKA 4ENZA 1L9RA 1AANA 1SF5A 1EHKB 2FWLB 1VLXA 2GIMA 1JERA 3NSCA 1OCRB 2IDUA 1A4AA 1X9UA 2DY2A 1AACA 2WSDA 2ZONA 3ZDWA 5TK2A 2IH9A 4JHVA 1BQ5A 3NJKA 1V10A 2IDFA 3WNIA 1L9TA 5PAZA 3T9WA 3CDZA 2VN3A 2BO0A 2BW4A 2CAKA 1AS7A 3FSAA 1GSKA 3IN0A 4L0PB 4YSAA 3EH4B 3QJTB 4DP0X 5I28A 3WIAA 3S8FB 2HX9A 1PLBA 3FU7B 3IE9A 1E30A 5I5JA 3FT0A 4YSPA 3X2QB 1N68A 1NPJA 4G7QB 1PAZA 1JXFA 4A2EA 2GBAA 4HALA 2BP8A 3GXUB 2TSBA 4KO9A 1A65A 4GP4B 1IKOP 1XB6A 4BDVB 3CVBA 4N4YB 3ZBMA 1MG3C 2UXTA 2CUAA 2J5WA 1ILSA 2X88A 1QNIA 3S3BB 3X1BA 2IWFA 2B08A 4PAZA 4QLWA 4AZUA 4DP5X 1CYXA 3WKQA 1RZQA 3HEIB 2QDWA 3CVCA 1L9PA 1J9SA 1V54B 5B1JC 2DYRB 3WNJA 1JVOA 4DP1X 1CUOA 1NPNA 1KCWA 2FTAA 4GYBA 3S8GB 2PPCA 2PPFA 1SFDA 3CVDA 3FPYA
chains in the Genus database with same CATH superfamily
3O8XD 1DLHB 4JO3H 1A6ZA 2CCLA 3BUQA 3OGCB 3H3PH 4JFDA 4NSKB 4C8XA 5HHOD 2ZUYA 3KDMA 4YDVB 3C5ZA 5H4YA 5AAPA 1RUQL 4L4VA 1KIRA 3KPSD 4D2NA 3JV4B 1HEJC 4YEFA 2XLLA 1AZUA 5J12B 3Q05A 3CVHB 2XZZA 4N6RA 2Y7SA 5HXMA 3P9LB 5KS9A 3T2NH 4PY8I 2WSKA 3LMJL 1BBJA 4OVUA 3KVDD 2BCKA 3TASA 5I8OL 2ZKMX 5E56A 3OAZH 5E4EC 1Z66A 1A6TB 3OKMA 4XWOC 3AG3B 5E6UB 1IZKA 3U4AA 5KZCD 3DMMB 4OD2B 3QH3B 4L1HA 4M7LH 1NBZB 4PSPA 4PJAB 2F74A 1QRNB 2VR6A 2XY1A 1UGKA 4LSDA 1I9IH 1IGJA 1JGIA 5F0MB 4UQ3A 2RA1A 1CI5A 2DD8L 4WW2F 1BW8A 3N04A 4JQVC 1PZAA 1IKNA 1JL8A 3VB9A 4L0YA 3WE6B 2DMGA 32C2A 1YN6B 5CGTA 4YDLB 2CNYA 3LIZA 3MC0A 1X6LA 4E9VA 3D06A 4G8EA 4U0QB 4RQQB 1TTBA 1WAAF 4PRHE 5F7YC 5L2KD 3A6OA 3PGFH 1AE6L 2RBLA 1ID5I 3ZDXE 2Q6WA 1YA5A 3GI9H 2HKFH 3QAZB 1YNTB 4Z7VE 3VGGA 5ABAA 2H0EA 2LTQB 3Q8FA 1HESA 1P5UC 2AK4D 2QKIA 5T5FA 3SQBB 3FN9A 5JLZA 5A3IC 1YPZB 1A6AA 4MCMA 3D0LA 3NK3A 1VB9A 2AGJL 5LAPA 2EVJA 4ZAKA 3ZKQD 3MUGA 4UT9L 2JJVA 3SKMA 1NOFA 4QHUB 4P9MH 3JUZA 4LEBA 4YSOA 3BPOC 4BFRA 3P0YL 3AG2B 1A3LL 2HSIA 4C57C 1CLOH 1GY2A 5DJ2B 2PO6B 4HGWB 3V5DA 2IV8A 1B90A 2ZOKB 2QTEA 2VDKB 3QA3B 5F7DB 12E8L 4M29A 3VMPA 3DPDA 2P7TA 1JZGA 4RISL 4YDKH 1AGDA 3MA9H 4UDUB 1FZOB 3OL2A 1I3GH 1DUYB 3POHA 3PGFL 4TL5A 3VD0A 2HG5B 5IB1B 3MCKB 3UTSB 4AEHL 1X7SA 4V1DE 1NGZA 1OGAA 1ZSDA 3UMNA 1I1FB 5T3ZL 3IYLW 1R5IB 1A4KA 1LO0H 2W0LA 3CZJA 5TDNA 5DS8B 1M7IA 1TVHA 4PD4J 3U0TA 1NTDA 3LXBA 3RKPA 1JHLH 4POZD 4P2OD 5EBLB 1FYTA 4GUPB 4R26H 2HT2D 3PHQA 1P5UB 4M7JH 4YSQA 4Q52A 5I0YA 3AABA 2FGZA 2EINB 2P44B 1I8KB 4EVNA 1NC2A 3DHMA 2AK4A 4MD5B 3HPLB 1UM6H 4HZLA 3QFDB 1OARH 5HYIA 2EE3A 4WUUD 3DO7B 5AVXB 1OSPL 5ESVB 1KTRL 1T80A 2WNXA 4WY7H 3V5KB 1KWGA 2V17H 2HKHH 3TPUB 3L2NA 1FLRH 5C0AB 4S1SL 1KCRH 2PXYC 2F7OA 1I3RB 2G60H 2R4RH 4JFYA 5MEQB 2J1KA 1WUZA 4LDLB 2D7MA 5F7WC 4A55A 2QZQA 3EZ8A 4PJCE 1Z5LA 4PJ9C 4BQ8A 4NQTA 4DUXA 3BH9A 4N2MA 2C9QA 2E46A 2GTQA 5GRXG 5J56B 1CDIA 2R29A 2HFEA 1Y6NR 4KJWC 4XCEA 1IM9A 1QR1A 4OIIH 3KMDA 2YQGA 3TNMA 3CDZB 4JZOB 1MQKH 2V9QA 4Z7UB 1H15B 3RL2B 4D9QE 3G5YA 4HUUB 2B2XL 3BPLB 2WLYA 4F20A 2R2HA 5DEJA 4P5RA 1KCVL 3WY1A 5AUMA 4GG8A 1K8DB 3BP6A 4JM2A 3CC5B 3MUHL 2IXQA 3P3SA 2JKSA 2X10A 3FBKA 4Z18A 1QA9B 4KX9A 1BSIA 2VMCA 3U1SH 4YSUA 2OXGB 4O2EA 1XGPB 2VQ1B 1NBQA 1OVZA 3FRPB 1UJ3C 4HT1L 4YHZH 3CMGA 5D7JC 2ZE0A 3BXNB 5A3ID 2KERA 5I74B 3CFEB 1ZANH 1EVTC 4IIQB 3BFQG 4DN3H 4Q0XH 2D9QB 1UWGH 2OSLB 2CRMA 4YSCA 4GRLA 4WV1A 5F8RC 3VRIA 1NBYA 2CHZA 4IBWA 2DLHA 4P2RE 4PB9H 3RHWF 2Y1VA 4DFIA 1HILA 1ZTXH 3M1CA 2E7DA 1TJGL 4MQSB 3EBGA 4U0RC 4WU7A 3KWUA 2B14A 4M8QA 1AJ7H 2TRHA 4MDRA 3PF2A 4OZIF 1ZIBA 3ARZA 1YEJH 3QZNA 3QUML 1TZGH 1I85C 2O93L 4BIKA 4PMFA 2NCEA 2F5AH 3ZKMD 2FD6H 2WMPB 4RRPG 1MDTA 1RPKA 2HT3C 2QZ5A 1A3RL 1X5HA 5FO9A 1BD2E 2EEBA 1R9FA 5LB1A 4AKQA 2N1TE 1ID2A 3FMGL 1EBAA 3C60C 1SYVB 1E5ZA 4MJIB 5E0FA 1AQHA 4JN2A 5EV7A 2LGNA 3TFBA 5AG9A 25C8L 2NTFA 5HYSG 4L8BB 2A6KB 3PWNA 3FT3B 4F7MA 3HZYA 5GJTH 5JIMA 4G1MA 3T8VA 5DS2A 5SV3A 4NPYA 5TDOA 3U2JA 2HPOA 1MRFH 4LMQI 5F9OH 2B4CL 4LLVB 1DL7H 1S7XA 5KVEH 3ARVA 2A4CA 3D0VB 4AMKL 3W9DA 4ONFL 3ZKSD 2PLTA 4FNUA 4UUJA 2F6AA 4F2MB 3TO4C 5GS0L 5IROA 1KIPA 5LG6A 4Q4IA 4P06A 3RWHB 3VD9A 1WA0X 5FUOH 2BSSB 2F68X 2ZWZA 3NAAH 5DJZB 1U3HC 4QXVA 1Q9LA 5DRNA 1CICD 3N40F 2R56L 3EGDA 4MD0B 4TNWF 1MPAL 1G7QB 4NBZB 4OF7A 1WAAA 3LS4L 3WENA 4EI0A 1PD1A 4X4KA 3W38A 3HBGA 4OZIE 2FQEA 4YBLC 3VRJA 4IOSA 4Z7IA 4UOW1 5I8CA 4WWKC 2WHVA 2DQEL 1PLGH 1KULA 3QNZB 4RMSA 1DYZA 4HWBL 3KWWA 3MBED 3H55A 4TUOA 2AS5M 2JH2A 4N28A 3NCMA 2YK1L 1XGQB 1VEOA 2BSRA 3MLVH 5DZOA 1MH5B 1UM5H 3GUFA 5LQBL 3RX9A 4IKNA 4HH9A 4Z7QE 1R46A 2QEJA 5TQ0H 2WANA 2GSMB 3SE9L 3HG3A 5FAAA 1ZT1B 1FL6B 1DDTA 1JTPA 2Z93B 4AQEB 1IEAB 5I73C 3FL7A 4OKDA 3IF1B 4ORGA 5JQIB 2DIAA 2Y06L 4GAGL 2BIHA 5CP3H 1JS4A 3HRZA 3ISWA 2VAAB 1I3UA 1OAKL 1XF1A 5T1LB 5D7IE 3BGFC 4Y1SA 1X3DA 2W91A 3WNMA 4NKOB 2Y5EA 5EDSA 5HDLA 1A4JB 1KXTB 1OD9A 2GB2A 4YSDA 2E7LA 4K71C 4WFGE 5DHYA 5KN5B 5I30L 3T0EE 5E8OA 1L0XA 3PAYA 2IIJA 3T3PE 1U8NA 2IWKA 1QSED 4G42B 5F7HA 2NY4C 2ICES 5GSVB 1B3IA 3TBTA 3ULVC 2P8PB 1SXAA 2GFBB 1IM9D 1BFTA 1BXAA 4KXAA 2BW5A 3U9UA 3V6BR 2K6WA 4AYSA 1IT9L 5JW5B 1MI5E 1UATA 3ASNB 1ASOA 1FGNL 2DKMA 3V6OE 4XVTH 4N9GA 2OZNA 3X11A 1N7ML 4N6RB 5D8JL 2DW5A 3FN3A 1ZLVK 4UNVA 2GJ6B 3MCKA 2RCSH 2XIIA 3OB0K 3TCLB 4PRPA 5IMLA 1MXGA 1IAKA 2Y5TA 3TH2T 4TLTA 3KDMB 4K0OA 4PJ8D 2VN5A 2I26N 4KHTL 5FYLD 4OB5H 3RTQA 3WJLC 2YN5A 2WB7A 2ZSWB 5PAZA 3V10A 2DTML 1A2YB 2BO0A 2R0KH 2PO6A 4HGWA 2MJWA 4EMZA 5A2AA 3ZKXC 5F3BA 3OR6A 2N0KA 5DZJA 4JFTA 2W0PA 1XF3B 4JDZB 4WFED 4UDUA 3ARBB 2WBXA 3ARPA 5DD5L 4TTDD 3HRZC 1PAZA 1CTMA 1SHMA 2D4DA 4Y1AD 4HG4K 1NEPA 5C0RL 2V2TA 3J27A 1J5IA 1BVLA 1DDHA 3V0VB 4YIQA 5DO8A 5KBMA 4HF5H 3TOPA 4XMVA 5I23A 1QLFA 1YMMB 1OSZA 1QSEA 2HJFA 4FQ2H 1SJHB 1KYDA 1E2VA 4JKKA 3ULSB 1FYHB 3BEVA 1IBFA 1U58B 5D93B 5H2BB 1ZHBB 4AZUA 3I02A 2NW2B 5EZPA 4XN7A 4DT2A 5I1GH 3GLZA 1VCBC 3K5SA 3IETB 5CZXD 1E43A 4XVUD 3WKQA 4L4TD 1NCAH 3ZDZB 4CKVX 4JFHE 3V4PL 1EGJA 1QYGH 1QZNA 5B1JC 5C2BH 2DYRB 3RIFF 1UZ6E 3ECQA 5I1IH 2X1XR 1E6JH 2F8IA 3DI3B 4HDIA 1XGYL 4Z7QB 3S8GB 5DA4A 4IBZA 4UNTA 5FCSH 3KEHA 3DWTA 4N0UB 1JWSA 1TQUA 4HIHA 4P5TC 1NKGA 3R0MA 2MHAA 3BKYL 5D70L 5E94A 1CG9B 4ALAH 5C0DB 3V4VB 1U36A 2CO6A 4KXCA 3X17A 1YPZA 2BY0A 2NQ3A 4HUXB 2HT4C 5B1CA 3S9DB 3WKYA 2Z4QB 3HZMB 1AYRA 3ORJA 4DOHB 4AQ1B 3BHBB 2WXIA 4X9FA 1DE4A 2Z65C 2Z9TA 4OT1H 5CKGA 4H8VA 3FAXA 1TITA 3JWOH 4PMEA 1EK3A 1H9VA 2NCMA 2VN6A 4H2CA 5KS9B 1AY1L 2WCSA 5C0CD 4KNSA 4F8NA 1GYVA 3CU1A 3GSRB 3ZIYA 1WZ1H 5DEFB 3SDAB 1WGOA 3GMRB 5C2UB 2Y9RT 2L0DA 3QNFA 3O6KL 4NX0A 1J8KA 5HHNA 1OE2A 2Y72A 3CVHH 4YHIA 3EOBA 4OJFL 3REVA 3QI9C 5EU7C 3CVIL 2HG0A 2YD0A 5JMRA 4O02H 5ETUA 3MNWB 3AS3A 2IO5A 5HDWA 1DJXA 3PHOB 1EPFA 3CFCL 5IHWA 5LN8A 4BKSC 2IDQA 2C3GA 1TZHA 5DMGC 5C6TL 3BXNA 1ONQA 2WXNA 4DHLA 3B9KC 4GQZA 5L6YL 1TPXC 3KCPB 5B3NA 3EO0B 1IFRA 4YMPA 5E2TH 5HVFB 4Y8AA 4PTTA 1OTSD 3LKQA 4XCCL 5IK3A 2X41A 2PW1B 1Q9WB 3V0DA 5HGHB 4L1LA 1Q9WA 5IB3B 4KZEH 5CP7A 5JXED 1AOHA 1MCFA 3FUEA 3RGBA 1WZ1L 5GRUL 3VWKD 4LVHB 1KIRB 1F4XL 4YZFE 2YPLE 4ODBD 1SLUA 1UH3A 1TJXA 3L1OH 3OG4B 2NNRA 1XQ4A 2GY7B 4ANXA 2J44A 4N2FA 1XSIA 2E9IA 3TWCH 5TF0A 3VFNA 4HCIA 1JFQL 3CSBA 1ODUA 4JQXC 5DVNA 5GGRB 2YMXH 3D5OF 3NCCB 4KKLC 5AZUA 1U2HA 4RMVA 3T0EB 4FE9A 5A6MA 5B22A 2UYLB 2CZNA 4WSJA 3WEXA 5LXVA 4B6ZA 4HGMA 3CHXA 1E6JL 2E7BA 2IWEA 3UJJH 1YZZA 1NINA 2CGYA 4JFXB 4N8VG 5T5FH 2EO9A 2Y5QA 1OK8A 4OJEH 4XMLL 4JKMA 5EO1A 3QUXC 1NCAL 4PJEA 1RJYB 3OWRA 3S88H 4TSCH 1NCJA 5E8NB 4GKNB 3EG9A 3F00A 1NOAA 5JDSA 2HX8A 3FB6B 3DBXA 4QTHB 2DQTL 3Q2CA 1H5BB 5T3XH 5J7CC 4PJCB 1Q0XL 3VTAA 3KHOA 1QTYT 3QCVH 3B8SA 3NSYA 4K7FA 3SE8H 1MRCH 3RQ3A 4N0UA 3BEVB 3STZA 4MB5A 5E6SB 5EU6E 4FNQA 1T0NA 4GP8B 1JF6A 2P3YA 1G4RA 4FFZH 4E42B 3L3DA 4XN9A 4L3FA 2V6HA 2NY1B 2F61A 5KSVB 4O2FA 1M1XA 1TMCB 5FGCE 3NSFA 3VWKA 1D5RA 3HE7D 2WYZA 2P4AB 1CJYA 3WFBH 4BH7B 5FECB 1XXDC 1XD1A 3U30B 1C5CH 3DVNB 1AKJA 2YPLD 4NNPH 4DGYH 1EAPA 3PV6B 3F3HA 3DX4A 2IV9A 2NXYD 2DICA 2YGVA 1XEUA 3KLKA 1SN5A 1DVSA 1NAML 3A24A 4OCWL 4JPIA 1JZJA 4JR9L 1IAIH 1NLBH 3PNRB 4A6YA 2BP0B 4G82A 1KV3A 3PS6A 2N59A 5JXAL 3B4NA 4EN3C 4Y4HA 2VDML 1T1ZA 4BXSV 2LU3A 3UP6A 1I1YA 4LOUD 3RA7H 5D1XC 4DETA 5I1JL 2HUEA 3OLEA 1MHPH 4XRCB 4LLWA 3HB3B 3O3EB 1A64A 4JPIB 5F1IB 3W3BA 1A9BA 2CQVA 2MOQA 4ZPVB 3WN6A 4EZKA 4MA8L 2K7PA 3D2UA 2OTUB 1JZEA 2PYEA 3RWCA 3EJTA 5JA8B 1HU8A 4TPRL 1KXVC 1NDTA 4MASA 1Y6MR 5BCAA 4WJG3 3CN4A 1N0LA 3RKDC 5B39G 5KAQG 3FH7A 5D6CA 3BD3A 3WO3B 4I9XA 4KDTC 3QIWC 1QHPA 4KAQH 2GJZA 4MX7A 1Q8MA 4RMRA 5T5NG 3ULVF 1VIWA 1Q0YH 1IC5H 5BV7L 5I1AB 3UH8A 1G84A 1A6UL 2ZCHH 1GC1H 5C0ND 1CT8A 1K2DB 2VDMB 2XC8A 4BWWA 4XPAL 5GSVA 2VL5B 4PGBB 4GBXD 2N4IA 4QHLB 4ADIA 1RP9A 2K3TA 2ZNWA 5F9JA 4Y19A 1HS6A 4HU2A 3KLAB 1MJJB 1ZPLA 2BM3A 3ELAT 3MLVL 4HWBA 1CGXA 3LS5H 4PI0A 4AMXA 4ESKA 2ZOTA 3US1A 3VGBA 2IH8A 5JTWA 1VKXB 3I84A 3QUYA 3T8XB 3H9HA 1UA6H 4ODWB 2X2YA 3QVAA 4P5MA 3MNMA 2R69A 3CZUB 3TBVB 1REIA 2P5WA 4Z0BL 2OQJA 4CU8A 3WOVA 4YDJA 3P4LA 2AW2A 3C6LD 2PKDA 1FORL 1KGJA 2GFBA 1DO5A 1OO2A 3D39D 3LS4H 4FZ8L 1J1PH 1QUNB 3LNFA 4W6XB 3K81A 4N0FA 3FTZA 5FYLE 4LEXH 5F0LB 4RMTA 2AK1L 5LN4A 1PZ5A 1Z5HA 1A3ZA 4XBGB 2UZYB 5A43C 3T1FA 2APXA 3H0TB 2CXGA 1LO2L 4XXWA 2YGNA 4YGAB 1B2YA 3NZ8B 1T04A 5E8EB 5KVFH 4GPVA 5FA3B 1PY0A 1OW0A 2VDQL 5IOPB 4ZD3H 3H42L 2R2BB 4OFQA 1GCYA 3EOAA 4PGEA 4JFFE 3TIDA 1J1OH 4LLQA 2ADJA 2B4CH 2YFNA 3BVDB 3F5WA 4LCCA 3J8F7 5MI0C 2ZP8A 3TVMC 5AOLA 4M4RA 3D3VA 5GJTL 4PJXE 4MRBA 1C08B 5JDJA 3UZEA 2BSBA 1URIA 2DV6A 3WS3A 3JTBA 4ZBJA 5FDWA 4YC2C 3PGCA 3IDIB 5D4QA 3NFSL 1FLTX 4PJAE 3FT9A 4Y5VC 1A66A 3EO1B 1ZXQA 1EX0A 4E0RA 4H88H 2WLIA 4LEOB 1A6WH 2BIQA 2YLHA 5E6ZA 3IGAB 4MAUL 3V0IA 3HI1A 1PZSA 4DEPC 4XMWA 2A38A 5HI4D 1MNNA 4X6CB 1WFOA 2Y0SA 4QO1B 5AW3B 1K6QH 2AEIT 5HI4C 3VM5A 5A2CA 4F8OA 1YEJL 1WTGT 4Y9GA 2VITA 1ETZA 1JNHB 3HPJB 4L8SB 1P1ZA 4R5TA 1HEZA 4MD4A 3PWUB 5L7XL 1FH2A 3BKCL 4JY5L 1NFIA 4F15B 3V4PA 1EGJL 5I1CL 1UT9A 4MB4A 3V4VA 5T1JA 1EDHA 4N0CC 3A6CL 3SOTA 3BPCB 1RH8A 3FN0H 1FAKT 3FRUB 3G6JA 3FHEA 2XTJC 2BH0A 2OR9L 3G5WA 4HCRH 4X8XA 2ZAGA 2VWEC 1YVLA 2GSIB 2GI0A 1N8OE 5IFAL 3Q3GB 4CVXA 1UKTA 2HFFA 3THML 3C2AL 4I1PA 3ABLB 5DRXA 5T5NF 4UQAA 4XXDA 2CU9A 1VGKA 1BAFH 3JUYA 4M5TA 4UTAL 3OXRA 2EYRA 1T5WA 1RFDL 4JFZL 4ZFFB 5EO0B 5JPNC 1E5CA 4GKZA 3O3DA 4JFOA 5BPPA 5GRJH 2LHAA 3IKCB 1SHXA 1JF1B 1EJ6A 3H42H 1HQRA 1I7RA 4G6JH 5HHVH 4PU2A 5IB2B 5CCJA 3MBEC 3NFPB 3QULA 4MAYA 1CYGA 1A0QH 2OI9C 1H0DB 3NACH 3AW5A 2WV3A 4JJ5B 2D7TL 2H26B 3BT2H 1MQKL 3PWPE 4G71B 4ZMOA 3LQAH 5SWZB 1T3FA 4RX4D 1U8HB 3QFJE 3N44F 4NCDA 3E2HC 2HFGH 5D7JB 2CDFB 3K6IA 1XCQB 4KRPC 2G0KA 4LDCA 4AMWA 3B5TA 2DQFA 1B6UA 3ULAB 5KVGH 1BEYH 3MBEA 4MAYC 4ZUSA 2ADFL 3T1FB 4X2UA 2V9RA 2UZYA 3AS2A 3FZUC 4ONHB 4FTVD 4B97A 4PJXB 4H26A 2WSDA 2ZONA 4K94C 4NO2B 1CLVA 2IH9A 2XFGB 3N42B 3DLQR 3NZ8A 4WK4B 3N1FC 2AF2A 2E6JA 5IHHA 1QFWM 1F11B 4J4PA 3CDZA 3W2DH 2L3BA 1ETB1 2OZ4A 1R4XA 4ENED 3G6JE 4XB7A 4YSAA 4DP0X 1JGEA 3UPAA 2DQUL 5B8CA 3QO0B 4P2RD 2YD2A 4PUBH 5I5JA 1WF5A 1DBJH 1X4XA 1FQ9C 4MTMA 5DI8A 3MRNB 1U95B 1K8DA 3DHJA 4WTWA 4MMXC 5C0JB 3MLSL 3KD4A 4N2BA 1DVUA 4HALA 1FV1A 3FUHA 5GGQH 4K8RD 4KO9A 4WFFD 1FIGH 1Q1JH 5D7IF 1H15A 1NFDE 1WAPA 4HIEB 3RL2A 1DJGA 2CH8A 3SO5A 4EVNB 3MRRB 3B1TA 3IFPA 4NRXB 1R24B 4ORGB 3IU3B 3VI4F 5DJ0A 5DT1L 2D3NA 4P2YA 1THCA 2IWFA 3HG1D 2DB8A 4QKXB 3CUPA 4Y2DD 2ADFH 2WWKT 2NZ9D 1CYXA 4WFEE 1LEKA 4KKBD 1KJMA 5TTRA 4I0PB 1MHPL 4G59C 3D0AA 2BNQA 3UJIH 2W9DL 5I1JH 3MA9L 3RA7L 4XMPL 2LFEA 4KFMA 2ZUVA 1ZD6A 4QRQA 4KJYB 1F3RB 3X3FL 3QHZH 1LWJA 4M3HA 5IW1B 3Q5OA 4FTVA 5JXAH 1AGEB 3SE4A 2XU9A 2R23B 5I9QC 3VB8A 5F1IA 3DX9A 3QRGL 1NLBL 3VYOA 2D7OA 3HBPA 1OT1A 1QBML 3MLPA 5AENA 5I75B 3POCA 3NSDA 2FT7A 5SWQB 4LARH 4Q4EA 1U8CB 2UWEF 1VPOH 1N4XL 1IEHA 4QGTA 4GKOA 1I3VA 3LB6D 3FTXA 2NXYB 2PPDA 3IXTA 3JYCA 5ISZD 4BSVA 5BZDA 4BWUA 3MRQA 3GSNL 3KPNA 2X2HA 4JQIA 3GHBH 3P11H 1YECL 2H9GB 4CW1B 4K7PX 1UKQA 3GSXA 2B1AH 2CHNA 2UUDH 5D2NC 3QUZA 5KYWA 1IBBA 3C6SB 3HI1B 1B88A 1A6PA 3LAFA 5HDBF 2ZOLA 2VERN 5J11B 1KTCA 1JV5B 5IVZB 3LNHA 4K5MA 3K4AA 2CPUA 4PFEA 1F4WL 4GKZB 4JFOB 3FT4B 4FFVD 1T1XA 1G5AA 2HX7A 3UEZA 3VG0L 2IANB 3RZWA 1NGZB 3RGVD 5ICZA 4R3SA 1DVFD 4DGUA 4MMZA 4WHYG 2J8HA 5KAQF 2ITEA 2ZWLT 5E99L 4W93A 3KEDA 4ZUTA 2JK5B 2HFFB 5DK2B 4ILDA 5DFAA 1MLCB 2KZ1B 2XVBA 5AKTA 3VA2C 3GSQB 4JQIH 2ORBH 5IWLA 4FABH 4OCXH 5B1AB 1X5AA 4H5SB 2FUTA 3H4HA 3GMMB 2GC7C 1ZCRA 3SE4C 1NOLA 3MGTB 4HW6A 2F58H 5GGSB 3IK2A 2BY1A 4J3OF 4XO5A 2YAEA 2R2BA 1NCGA 5DR5H 4JDVB 4BSWB 2F74B 1E6OH 4FS0A 2YD4A 2DQDL 1LHZA 3GYRA 3FU6A 4Z78B 4CL7A 3VGAC 5FWQA 4L2LA 5MENE 1BYPA 3GXIA 3FQ2A 4RIRA 2CMRH 2F54E 2H7WA 1TIUA 3CLEL 2XFXA 3NFSH 1OM3L 4PJFA 1CL7I 5FGCB 1SM3H 1T6BX 5A1AA 2DYPD 1NEZG 1DO6A 2MH4A 3QIUC 2KBGA 1QI4A 4O58H 1FNGA 4L4VB 4M7KL 2JSFA 2F54D 1E27A 3VXQA 1J1XL 3OAZK 2Y4SA 4K7FB 4KRLB 5GRWA 3WD5H 4A2LA 4BQCA 1DHKA 3VD1A 4V2CB 2B0SL 5JXEC 1K8IA 2V5RA 2YXWA 2EDOA 5FM8A 4ZMNA 3KXFA 1D9KA 3QPXH 3ENEA 5F7EL 1NMCC 3UJTL 5ES4B 4KHXL 3BCFA 2UY7B 2G3XA 1CFBA 3PWPA 5AOMA 5HDBB 3INUH 5E7FA 1NBZA 3FUDA 1S9KC 1F2QA 4WHYH 1UXWB 2CDEA 5DUPL 2IH1B 4FCAA 4L37B 3TYFA 4G5AA 4KKBC 1FNSH 2K8MA 3VXSA 3P77B 2ZWYA 4I8DA 2GCYA 3LZFH 4YDMA 4KKLD 2J20A 1WITA 1GW6A 5D1XE 1H3TA 3TNNA 4H8UA 3V2AR 2AJYL 1AIFB 2BWIA 1XHHA 3SKJL 4OUUB 3DX0A 1J0JA 4JN1L 4WI0A 3ZT5A 4ZW3A 4RGNC 1TJIL 4QLRA 1UOWA 4JANB 5TF1H 3TYFB 1AFVH 1NANH 3K6NA 1Y07A 1AZRA 2ARJB 4XBEL 3RIFK 1JGDA 2OSYA 3LZRA 1DVFB 4XB8A 1DJYA 1YMMD 2V8MA 3V52H 2FWSA 3C08H 3RX7A 5D7IB 1ZKAA 4E9YA 3LB6C 4JLRA 1PJWA 1MW1A 1UWEL 2J1YA 5F7FA 4JRWA 2XA3A 4F33B 2X4TA 4N68A 4X9HA 4PJGF 4XPAH 3TN0D 1Z3GH 4Y4HB 3EBHA 3TN0C 1PZBA 2VLMD 5GZOD 2YAQA 3P1VA 1XGUB 2V2WA 2XKNB 1GC1L 3VXME 4DJMA 1XCTA 2DS4A 3GXTA 5KVDH 1SOXA 2WJ5A 4P4KC 4BK8A 4UAOB 3OJDB 3EZJB 35C8H 3HNVH 5DC2A 1KFAH 3EJZD 4WI4A 2YUXA 4O5LL 1AXSA 4R7DA 2XG5B 2NUPB 4B3VA 4H5SA 3AXIA 2X1PA 5CUSL 2Z35A 3SY0A 3REWA 1SDYA 3P2TA 3V6OC 2JCCB 2DYPB 4TPRH 1EWHA 4KTEH 3MAWA 4BK5C 5KSAB 1E8WA 3QIBB 2JKTM 2X4UB 3GHPA 1MIEL 3MNZB 1W15A 3SKNB 4PJ5A 3GNMH 3UTPD 4F8TA 2MIZA 1T89C 3DI2B 3APFA 4K7PL 3O6FD 4JCLA 2BWQA 2DMKA 1B4LA 5FK9B 5JPNB 3LRSB 1HH6A 4KQ3H 5IVZA 1YQ2A 5H2BA 1E4KA 3IJHB 3CZFA 1JWUB 4MA7H 1TQBC 2IADB 2IFGA 4OU3A 5DJ6A 3T6VA 1FG9C 4DVBB 4JR9H 5FOBA 3EG9B 4MNQD 3PJLA 5E0QA 2NY0B 2ICWI 4OCWH 3QGVA 4GXFA 4JO2H 4PWGA 5J13C 1O0VA 2Y2YA 4ZPTA 4HPHA 4M6AA 3D18B 3D69B 4M6MH 3JWDL 3SYAA 2A2QT 2N1KA 4PEEA 3O2WL 3GMPB 2DQHL 2R2EB 4HK3J 4PRNA 2EDQA 3IPBA 3NGBC 4MJJA 2C26A 4NRYA 4YBQD 3PQYE 3PDDA 5LJYH 2VM9A 3OHXA 4AW4A 1JN6B 3SKMB 3GMLB 2EUXA 5DWUH 3U9PH 1BGXL 4ELMA 1M2VA 4AXWB 4D94A 4K23L 4CVWA 5DD6B 3S34L 3MV7E 2QVKA 4LKXA 1ND0A 5CUSH 3F7VB 3W39A 3HCVA 2ZCLL 2D0FA 5EBWA 4BK5A 3A67L 4JVWA 2O6EA 2VGLM 4O5LH 3U25A 2NY6D 3FSOA 4OUUA 1A7NL 2HRPH 3S4SG 4BKLB 3PP3K 1OAKH 2FK9A 3GEFA 4NO5A 2MNUA 4ODXA 3VNZA 4PRID 4DOHE 1XBRA 4DQOL 4BA8A 3ALWA 4ZODA 2C7FA 1HL9A 1NWOA 2NLJB 4G2AA 2ZX7A 5BQ7B 5GGSY 1OP5K 3UJJL 4ELMF 3RILA 1OGPA 3AB0C 4XNUL 1O6VA 2Y1AA 1FV1B 3H7LA 5EU5B 5I76B 3GKWL 5H8DA 3IE4A 3NJLA 4NLHA 2UY7A 1FWXA 1EV2E 1UWEH 1UM5L 1P7QB 4XC3L 2FHBA 4RWYL 4PQXA 1G7JB 5ETUB 5J6HA 4F9LA 4P5TB 4QRPD 1JGUL 3NUKA 1CBVL 5D7LD 2FLMA 1PQZB 2PCPB 4TM9A 5EIVA 2YQ2A 3R4RA 2FZ3B 4HLZG 2DQMA 4MS8D 4OCLC 4UYQA 5TF1L 3JZYA 3Q5YA 1T4WA 3IMRA 4I0PA 3QO1B 1BCIA 3O6FB 3U0WL 1AHKA 4F33A 3PDOB 4XWGL 4PJHE 4M5YL 4A2FA 3EH1A 1FNEB 2VDNH 2X4NA 4G6KH 3HR6A 3GZOA 1A6VL 5IMOA 5JO5B 5IMKB 4JKNA 3Q01A 3IFNH 1ZJAA 1G7LB 2R1WA 5MERB 1ZVYA 4EI6B 1IAMA 4E9SA 1K5WA 4G6KL 4BUHA 4F37F 1HWWA 1ROCA 3LCYA 5SWZE 3HMXA 5MEOA 4DPCX 3NDZE 3GI8L 4N8CL 5DHDA 5E4IA 4J7RA 3CFCH 3DYPA 3T04D 5BUGA 4YHYB 2V4LA 3UJTH 5E23A 4HC1H 3K1KC 3RI5K 3IMTA 4WI7A 4I48A 5IR1B 1EHAA 5D1XA 3U1PA 3U46A 3GIZL 4BKTC 5CR1A 5KZCB 2XETA 3X12A 5BOPA 5I1KL 2FL5A 4XPTH 3V6ZA 2BFGA 3AUVA 3EUDA 4DGIH 4UV7L 1UA3A 1DBAH 3UZQB 5DK2A 4PBWD 3N6YA 3V0WL 1KG0B 4UTBH 5ID0B 3B7RL 4FN0A 3L5IA 4LVNB 2A9AA 3D0VA 3QDHA 1QLFB 1YMMA 2AQSA 2MPAL 3GKWH 1FIEA 4MXQC 3JWOL 3FT4A 2YQBA 2A73B 2X6VA 4OT1L 2X6CA 1GGIL 1V3JA 4X6EA 3OKNA 3ILQD 5IFHL 1WTLA 3S7GA 3QIWB 5F71A 3UYOD 4P2QB 1SBSH 1MWAH 1X9RA 4NBYB 4POYA 5JHLH 2FD6L 1E6OL 4LLVA 3NCJH 2IFFH 3MRCB 2VLJE 1HC1A 3OD3A 4IRJD 4HV8A 3DHUA 1TZGL 4YBQC 3T77A 2EC9U 3APNA 1U8HA 4KNUA 4F7MB 1QYGL 3UROR 4FABL 3FU3A 2Y6SC 3EBIA 4HIJA 3BHBA 4YNYB 4ETYA 2XNAB 4OTXL 4OZ4A 1R5VA 4F8PA 4MNQE 2Z1KA 2IQAA 4G3YL 4NYLA 1QI5A 3DX7B 1J0HA 3FQNB 3VX0A 3ZDWA 1JNHA 5TK2A 2YPKB 1KNOB 1J8HA 4NN7C 2K7QA 3WFHB 1B4JL 3EOTL 1GGUA 1TQSA 2HT2C 2X9WA 4XXDB 3T9WA 3VW3H 2CGRL 1G4MA 2GJPA 2XQYA 2BOBA 1LDPL 3ZO9A 2XI9A 3CBKB 4RNRB 4ZTEA 4RNRA 2R15A 2XXMB 3WIAA 4R7VA 4JO2L 1F58H 5HDQH 4IRZL 4HS6B 3ESNA 2JF1A 3FT0A 2AQ3A 3QUYD 1J8HB 3K74B 2ICEA 2G2PA 4X4YB 2Q7YB 1JXFA 5IW6A 4L9LB 4FP8H 3TO4D 3BUYB 4JZNA 3PJSA 1P53A 1NBYB 5CZRA 2BERA 1DQJB 4ABWA 2P1YA 2CUAA 1NUDA 2UXTA 1F1GA 4ZXBA 3QCUH 2GAZA 4DKFH 5C8JA 5C0BE 4KNQA 3CCHA 3DJSA 1SJVA 2BNRA 3QRGH 3MV7B 1DQKA 2BCMA 1A5FL 1RJLA 3P0GB 4K9EC 5AVYB 1I7UB 3MRQB 3X3FH 2CO3A 1IAIM 3BEWA 3UTZA 4N2HA 5C70A 5HPMB 4QRSA 4XNQB 1RV6X 2W9DH 2EDFA 3MRJB 3QCTH 4NXKA 1S9VB 3CDFA 3S8WA 1WE5A 3GB7A 2JXMB 3CK0L 1O9ZA 3DX1A 4NKIL 5C0IB 1OAQH 3RPIB 5JOEA 4GMTL 3RDTB 3G6AB 5IMLB 5F9WC 1YQVL 3F62A 1X5XA 4YK4C 2R4RL 2G60L 5KVDL 4GXVH 2VSCA 1CLZH 2DOCA 4XHJC 1NWPA 5I30H 3NZUA 1II4E 4OGXH 4RSYA 3MGOA 2BDNH 4HWEH 3DUSB 3GLAA 3QI9A 4RRPA 3WFCL 1DR9A 2PPEA 1CBJA 1JPTL 4NQDE 4PI2A 4ZUWB 3P0VH 2HLFC 1YEKH 3NEOA 2FL5B 3QXAB 1CGTA 3V6ZB 3VG9C 3DV4A 4N5UA 3H9ZA 1V27A 3L48A 3QFJD 3BZ4B 1T66C 3D25B 3ULVH 1VFBB 3KG5A 3FB5A 2V9TA 4I3RL 2HH0L 3WIIL 2B77A 4QOKD 2PP7A 3MUJA 3KYNB 1ADQA 2CLZA 5JQHC 3PREA 1JGVH 3HG1A 2Z92A 2GJJA 5GHWL 1JPGB 4PLKC 15C8L 1PLGL 4JRYB 1BMWA 2HFEB 5T1LD 2E74C 3FB5B 3S96B 5TDOB 2Z93A 1NZRA 3ZMEA 5K69A 1AQDB 1T5KA 2PTUA 3KPMB 4HLEA 3I3EA 1YEFH 2Y7LA 4HZLB 3FCSA 5F1KC 5HGAA 5TH2B 3VI4B 5HY9B 3U0TB 4JFEE 1C12B 4ZMAT 5TQ2H 4YDKL 3DC0A 4LIQE 3VFGL 4DKAA 3WFHA 4Z1PA 2ADYA 1R3IH 4AE1A 2ENJA 2KKQA 5DRZB 2Q2EB 4LIQH 2HT3D 4WENB 4NO5B 3ZTNH 4HAGA 3VWKC 1ZVNA 4WI5A 3DTXA 3DX7A 2KZWA 4ELKB 1ACYH 1HHGB 4HG4J 3KH4A 5FCUL 1RSYA 4D0DB 3K46A 2UWEE 4F8LA 3RTLA 4UOW0 3L3HB 5HHXH 4FKEA 4AMKH 5IHUL 1K3ZA 4X9GA 4PP2B 1HXMB 2AERT 5I1AA 1BAFL 4CBZA 4CMHC 1UJTA 2OMXA 3LTVA 2WO3B 4AQAB 1HDMA 1YYMH 3GGWA 1I4FA 3THMH 4X6DA 4BKLA 3B2DC 3FU5A 1SXSA 4P9HH 2ILLA 3MR9B 4B53A 3CSYA 1M7XA 2UVFA 1SMAA 4IJ3B 5LO7A 2W5PA 3MLUL 3KS0H 1HQ4A 4HCRL 3BLBA 2I32A 4S2SA 2QKIB 3OZ9H 3I9AA 4ICWA 1R5IA 4RX4A 5IZ7A 3RWCB 4BZYA 1INQA 5DGRA 2NZ1A 2EEFA 3FYIB 2XN2A 3NEXA 2X5PA 5C3IA 4WW1A 1I9IL 1FO0L 5ALCL 5H35A 1QZ1A 4E9XA 2F5AL 1I8LC 1F90L 1C16B 4MSWA 1T1ZB 1KLUA 4PREA 4MJIE 2WGNB 1GPOH 1RURL 3HNTH 4UQ3B 2D7NA 4WWPA 1F4WH 2CUHA 3D18A 3D69A 1QFWL 2WNGA 4P99A 5LGYA 3ZGIA 3VX1A 5IVNA 4JFWA 2E7LC 1I82A 2FECI 3MLUH 1P7HL 3ME0B 3PV7A 4PJEB 4PRDB 3DTDA 2BMKA 4YX2H 4MAUH 1J8HE 4PB9L 4I18C 5DTFA 4UQ9A 5DJ6B 2I27N 4NO0A 1BVNT 1YECH 3PWUA 4HS3A 2OP4L 1RIHL 4Y7OC 3ZQ9A 4EIZC 1P1VA 1U92A 1MW2A 5HVGB 4GW1A 3WMPA 2DJ4A 1GOFA 4GT0A 4ZFGL 3P69A 3P9LA 2J6EA 4JO3L 3LIZL 4KJQC 3V0GA 2IPTH 3L4UA 1N4XH 3PE9A 4PJ5B 2VZTA 3HZ3A 1ZSHA 2J1XA 5EC2B 4HV8B 3O0RH 1QWNA 1FRGL 5BZWA 1UXSA 4B60A 3OKMB 2CK0H 2J57A 5J57B 3VXPA 1HNGA 1Y0LB 5AKRA 4R4FH 2AAVA 3QIWA 1J88A 3SN6N 2VABA 2Z3FA 5INCA 3SHSA 5BJTA 5HJBA 3UC0L 2Z4TA 2AV1B 4A7GA 1YMHB 3UYRH 1W72L 3VFGH 1N10A 2W0FA 3IJYA 3QQDA 2AQ1A 4UTCA 4XVJL 1ZTXE 5BVJA 4R2GD 1JYXA 3FUIA 1LE5B 1I7TB 1CL7L 3ABMB 5ESQB 4R0LA 4HIIA 4EO5A 1QSFA 3F01A 3NT0A 1OGAD 4P23D 2WZ5A 3HLAA 4P3DB 2GTZA 3ULVD 1IAOB 2YAOA 2DLEA 4TVUA 3GUTB 2YBGA 3WFEH 5DT1H 3DRQB 3GBNL 5T3XD 5EEZA 3C5JA 1RZPA 4LLQB 3EJYD 3WY4A 4RBPK 1Y1UA 3DUSA 1JGVL 3FSVA 1KC5H 2E5EA 1R3LB 3B1UA 4BSJA 7PAZA 1A7QL 3O0RL 4GG8B 4IK6A 3QQXA 1UWXK 5G4OA 2CLVB 4GW4B 4NQDD 4YZFF 3UG5A 4F7TB 4JM2F 2BX5A 5DRWB 4AYMC 1E40A 2XPZA 4MQXD 5IHBA 4ZX3A 3VXUE 3GSUB 4LSSH 3D8MA 5AOIA 4L0ZA 4WI0B 3BAKA 4A7VA 5ICYB 4WY7L 2OAAA 2IPUK 3QFJA 1F00I 3P9MA 2XZQL 5E2JA 1U8PB 4Z95H 2G2NA 3V5HB 5ACZB 4LLDB 5GSRB 1IC7L 3DXAA 5FYJD 2FJSA 3OQRA 2K8QA 2L8AA 4ELME 3UACA 3IFLL 4R2GB 5EUOB 2AVGA 4NQXB 3JSSA 4Z7VF 4QR7A 1I3RA 3GM8A 5I17A 2G75A 3US0A 4FX5A 1LJMA 4GMTH 4QHUA 1BQHG 3WCYA 1MI5B 4ZQKA 4Y2LA 4ZAKB 5KVGL 1FDLH 4LKCA 4TN9A 4ES8A 2Q7YA 5BNXD 5BRZB 1RK1B 1EAPB 3PV6A 1MJJA 1EVUA 4EUPA 3BAXA 4HJIA 4ZYKB 3RWEA 1NBCA 4KOBA 1P7KB 1TKWA 2WKOA 1MVUA 2F1EA 3VFOA 4EUPH 5T3ZH 4PJ5D 3NIGB 3BESR 3LIUA 2R69L 5DUML 2D7TH 2ZKWA 1CXLA 3QZWB 4G1EB 1A0QL 1MREH 2VSMB 4NQED 3PHQB 4QYAA 5I16B 4X5LA 3FSZA 4BHUA 5I74C 1UHVA 4UT9A 3T6QC 3OC5A 1HHKA 1GZPB 3DIVA 1J05A 1BPLB 4XX5A 2D73A 5D5ME 3F6LA 4ZUTB 3VJ6A 1ZHLA 3EJSA 5DC0A 3QJQB 1A3LH 4JS7A 4XR8C 1PYWA 1CFTA 3HI6H 4K3JL 3SYQA 1CF1A 4P2QD 4PJIF 1I9RL 1FZMA 3O45A 4PB0H 1ZT4B 4L4TB 4NNPL 5IFAH 2WBJD 3MGTA 3QXWA 4RCAA 5JYLA 3QH3A 4FLRA 2Y2WA 1DN2A 4S0SD 5ILTL 2JKJA 4WW2A 4NQCD 2YBRA 4N0YL 3EUUA 1PZ3A 2YBRB 3HC4H 1CGSH 4LVEA 1WHPA 5IQ9A 3CAFA 3VI3A 2MTAA 4OFVA 2N7SA 4U3XA 3EJUA 3WIHH 1X5KA 3CQPA 4TSBL 1YEHH 5HYEA 5K9QI 3BP5B 3UBXI 4R8WL 4LCWD 3WUZA 6FABH 3KYOA 1MF2L 2GG1A 2HKAA 3RBGA 5SWSA 15C8H 4X6CE 1S7TB 4B95C 2XA8H 2YA2A 4MJ5B 3U48A 3W11D 1CFSB 4PG9B 2QT6A 4KXDA 1NIBA 2L7JA 3WKPA 3S35L 3VFMB 5LBSH 2XCMC 1S9WB 4J3OH 9PCYA 5JIIA 4KX8A 4I48B 2JELL 4BM7A 4WNQB 5AB1A 4AQOA 1HCZA 1GZQB 2WOYA 4PS8A 4XMLH 5EO9A 4MXWH 4DCQB 2V37A 1UT1A 5IFHH 1LD9A 1GGIH 3U36B 3ZDXF 4ERSH 4PJ5E 4RZCB 4FG0A 1AYOA 3CHRA 3KHQA 3KWXA 2HVJA 4JFQB 1FHGA 3BX7C 3H53A 1JBJA 3P0VL 2ZJSH 2YMXL 1J10A 4WKZA 4XTRD 2ZOOA 1IGJB 3JVGA 1JFQH 1A1NB 1IILE 3HS8A 1BQHA 1KYOJ 1HE8A 4U49A 5D55A 3WFCH 1X5ZA 2FEEI 4HKXA 3UXFA 5L8JB 1X44A 5E6IA 4RESB 3MRBA 2XXFA 2H32A 3INOA 3VSTA 5I17B 4QRQB 3EOBB 3IDJB 1V7ML 3GIZH 1YQVH 2J8UE 4ZOEA 2CJUL 1WWBX 1F4XH 3QEGL 2OL3A 2XWZA 3V4UL 3NJIA 3U9UB 3GSRA 4PJCF 2FVNA 2VDQH 5IIEA 3NCYP 2J21A 4R4NC 4ENZA 4GBXB 1RP8A 3WBDA 2ICWB 2FWLB 5KTEL 2FEEL 2I25N 1J5OH 4L5FE 4YXHL 1X9UA 4C59B 4H1LB 3FQRA 2EC8A 2BS8A 5H37G 3B2UD 2IBGA 5AW4B 2WBJB 4K94L 4MD0A 1MCOH 5KSBB 1J1PL 3KPLB 1J18A 5GISL 4PV8B 1BQ5A 2H2PC 3CBJB 4F80A 1F6FB 4FP8L 4G9DA 3N9GH 4HHAB 2D7QA 3E3QE 1FVDB 4MJ6B 3TBWB 4OM1H 4QTIH 5I82A 1T1YA 1KEGL 3CPUA 4IS6A 2CLRB 3PU7A 5E5MB 3BN3B 4XP5L 3VFUB 2CBMA 4NLAA 4JRXD 5E4OA 5KYXA 2YEQA 5HDQL 4OM0H 4UOZA 4YSPA 4LFHG 4Z7OE 1N68A 4IBLT 3QJHA 1WFUA 4XP9H 3H85A 4DZ8B 5ICZB 4RAUB 1LDPH 2AQRA 4O9HL 1LO3L 4NM8L 3TONA 1WWAX 1X5JA 2EYSA 4HSAC 4YIQB 1XB6A 3FF8A 4OW6A 3V0FA 3ARDA 3DMMC 5BS0D 4KDTA 1GGCL 2NY4B 3ZBMA 4EDWL 5J0BA 1F3DJ 1J8SA 4CDGC 3GXNA 1TVDA 3PWNB 3SGDI 2X88A 1MN4A 2CM6A 4HCRA 4AJ0A 4Z77B 2KDYA 5HPOA 4ALAL 3ZR5A 3NCWA 4G3YH 3X1BA 4DQOH 4KAQL 3TEXA 3UAJD 4LASH 4ZFFA 3SJVD 4NNYB 4R9HA 1Q4NX 4LGPB 3WGUB 3K71B 4LOUC 1RZQA 2CO4A 1GJWA 3HW7A 5EOQH 1V54B 4YDLC 1BZ9A 5IHZA 4KK5C 3V4PH 3TO2B 1DJZA 4K23H 4W9IC 4XO9A 4TTDC 1XH3B 3CZFB 1RPQA 5JHLL 4PJBF 5LG1A 5MP6H 4J3SA 2SEBB 1G6VK 1ZTMA 3IGKA 5DJCB 4LK4A 3DJRA 2ADIA 4XAKD 2IGTA 2C1PA 2Z0BA 5L4FA 2VDMH 3QJXA 4Q2ZA 2XNAA 1ESOA 1BQSA 2A74B 2CKBB 4FFYA 2ZICA 1QO3A 4HJ0C 3TH4T 4MD4B 1TQVA 3IEAA 4R0LC 4JFFD 3WNLA 2EVFA 2CWRA 4PRBB 2LU7A 1SMOA 4PWFA 5JR1H 1LEKB 2YRLA 4U1GC 4C56B 5ISZE 3REWB 5FW7A 4OM0L 4HEPA 3FQTA 1D5ZA 1E28B 3F85A 4MNGA 4UV7H 4DGYL 1JI1A 4DGIL 5AYQA 4FQQA 4XPHH 4BWTA 4UM9B 4BELD 2DQGL 3ERXA 3IPFA 1TYRA 1SJEA 2EIZB 1RUKH 1RUPL 3KYNA 4PWHA 5AZEL 2VAAA 4K7PH 2Z7ZA 3AVEA 3GI8H 5DHMC 4PJAF 5B1KA 5C0JA 2OL3H 2J8OA 4YHOL 1XR9B 1KCBA 1MIEH 2RCSL 1HSAA 2PCFB 3L5WB 3ZDYB 1KBGH 4JDEB 1QNZH 5FDWB 5FM5M 1LQBC 3CHOA 2CXKA 3C75A 2NSXA 4FCHA 2K3HA 3IXTB 3OMZA 2OMNA 1J5CA 4OJYA 3RAJH 3GIVB 2X4SB 1N2RA 1AI1L 3L3HA 3B9VA 1KB9J 3STLB 1FI8C 1KFAL 4YFLF 2OX5A 2ZG1A 4POUB 5KYYA 3NIGF 2MKWA 1P84K 1LEIB 1SJMA 4RSVA 3DKHA 5SV4A 4X80L 4NP4L 1DEEB 1NCTA 1P5VB 3IU4H 2YUVA 2CNZA 1SEQH 2YKKA 1EEZA 3RVTC 3SYOA 3T2LA 1FC2D 1A47A 2ZF9A 3WLBA 1C8PA 1GZHC 3UYPA 1PIGA 2VRAA 4CC0A 5E51A 3RUGA 4G6FB 3ALPA 2OBGA 2ZJSL 4ES9A 1FFTB 3QQ3A 2VQTA 3HBQA 4I2XA 1S5IH 1JTTA 2Z31B 4L3CB 3PPSA 4BK4A 3PDOA 3HC0B 3LKSA 3TFKC 2EEXA 3ZMNA 1GYWA 1VACA 3WL9A 1AFVL 3CCHB 3BPLC 1TOXA 2YAMA 2ZUWA 2W8CA 4WDIA 1E3FA 2X87A 3B9AA 4GRMA 1F6AA 5INCB 5BJTB 4NJAH 5DTFB 1NCCH 1SDDB 4MMXB 3BGMB 3AAZB 3QZMA 3ECWA 4AK1A 4XODA 4UMGA 3RAJL 1F4YL 2R7EB 2W95A 4IU2A 2DJSA 1RAMA 2X1WL 1CWVA 1CE6B 2OW6A 1WGVA 1AZVA 3MLXL 1OOWA 1VGKB 4Z3HA 5E2TL 4GUPA 5DA0B 1KBGL 1ADWA 3G6JF 4X6DF 2ZPKL 3VFVB 3FT3A 2YAPA 3LZPA 3LQZB 3ZQWA 1NANI 5BV7C 4DH2A 2R29H 2R9HD 4K5NA 4KHXH 4UZUA 2VW7A 1TG8A 4B41A 4QHNB 3R8BB 5AG8A 3CV5A 4OBRA 5A6LA 5J89A 2ADGA 1KBVA 4F58L 2DQGH 2HP4A 4GAFB 4OCMC 5FGRA 4P9HC 4OIFA 1G7PA 4C56E 5ISZB 1F3JA 2BS9A 2TSAA 4NO2A 2AXWA 2VLLA 2X12A 3CVHL 4IKLA 3EYFB 5ESVA 1J1XH 2PNDA 3ZW3A 1MCSA 1ND0B 4KMQA 5CGYD 2ATKA 3H7BA 2NY6B 2XZAL 4HIJB 4FC3E 4PRPD 1NCWH 4C4BA 1AY1H 4G7YL 3D2TA 4I1RA 1I4FB 5D7SL 4B9ZA 1G6RB 4TNVK 2JK5A 4XN5A 2HLAB 4U1HB 4JFHD 1OM3H 4AIZA 4BINA 4NGHH 4N2KA 3FXIC 4XNMA 3ZL4H 4V1DB 3JWNE 3RWDA 3WSQH 5AAWA 4X83A 2FLRT 1PY9A 1JRHH 2NY3B 2ITCA 2UZIL 1I8AA 1XR9A 5I9QB 3VXRD 5AVTB 3O0LA 2BP0A 4MHHI 4K3EH 2RH0A 4HIPA 3HMWL 2GIXA 2F58L 3FMGH 1TTFA 1U8LB 2OMYA 3MJGX 1S2EA 1NICA 3R06B 3CNKA 4FQLH 2H9GA 4CW1A 4Z9KB 5I1GL 1A25A 2W07A 1KJ2A 4UT6A 3UBXA 3HZKA 3K6FA 3DO4A 2E47A 3QUMH 4MYPA 4Z7QF 3WELA 4YHNB 2V3DA 5JMOC 2YSTA 3L5XL 2NYYC 4GQPH 4AT6A 1WBZA 2K1MA 4EDWH 1EFQA 4D0DA 1OIOA 3Q6GH 2Y36L 1UZGA 5G5DA 1IFGA 2YJLA 4KK9C 5IT2L 3QE5A 4PJHA 5AFAA 3CPLB 3BP6B 4I7ZC 4JM2B 1MCJA 2F1BA 4DKDC 3AUWB 1BEXA 3V4VH 4DERA 5IY5B 4PJDE 1A6AB 1MVFA 2X53A 1KF9B 4Q89A 1U3ZA 1HEHC 3H6JA 4AYGA 2ICWA 3O9WB 4NQCB 1U4EA 1YEDA 4XBEH 1VACB 2R0ZL 3WL9B 1MOEA 2H0JA 3HPJA 4CRPA 4X42A 4Y89A 1DBMH 2ENSA 3NMEA 5LAXA 2Q6WB 1U8OA 3OHMB 2Q8AL 3OPZL 4JJOA 4JPSA 1AZBA 5I8KL 5IIEB 2LOEA 1YLBB 1OD7A 1XGUA 3TV3H 2BVUA 3VU2A 3BKJL 1KC5L 4JY6A 1TZOA 1AD0B 4XOEA 1QBMH 5FPIA 2R7EA 4K94H 1JNLL 3WEXB 1VSCA 1OP5H 4PWIA 5F7NC 4WK0B 4X5RA 3H9HB 1DQTA 1N5AB 5E8DL 4G8GA 2A7BA 2EKJA 4M1DL 5K1VA 3KJ4B 1G7JA 3TIEA 2XDHA 4OZIB 3HTLX 2EXTA 1PZ2A 1CXHA 3INUL 4MB1A 3SDCA 3G08B 2NY2B 3UJIL 3V4LA 3BZ4A 2P5EE 4QEGA 4DP6X 2GI7A 3QNYB 3QP3A 2CBOA 1SOKA 2MPVA 3QK0A 3X3GH 1L3NA 3T6WA 2B3IA 4MJ4A 5KW9L 2EDXA 3N1GC 5E2WL 1MNUH 2CKBH 3KLSA 5CN1A 5AAMA 2XKUA 3K2IA 4WUKL 3J07A 1IBYA 4K8RH 1UQSA 2D31A 2QHLA 1Q1JL 2Y6TE 3BKMH 5D6CB 3RVWC 3BDYL 2EEAA 3BIKA 1U30A 1PEZA 1TNMA 4ZFGH 5SWSB 1NFAA 3KPPB 1ZLVH 4DAGH 1UKSA 4RGOL 3G3LA 1KCRL 5FKAB 2OP4H 4ERSL 1DLHA 1QHQA 3GO1H 1DANT 3Q2VA 3UTSA 4GBXA 4FJZA 3PLYA 4ACPA 1I9JH 1JWMA 3MX0A 5CGBA 3PNWB 1NFKA 4PPTA 4J3XA 1PDKA 2XWDA 3PDGA 4MLIA 1JZFA 1S7WB 3P4OB 3US9A 5I6OA 1I1AA 3ESMA 4PCKA 2VLRE 3GD1C 3RY4A 3DJ9A 1UEYA 3OPUA 3VQMA 1KT2B 4OCXL 1GPOL 3TA3D 4AQZA 4FYQA 3MLWH 3QFGA 1EAQA 2NNAA 2DWXA 3V55A 1FVCB 1LK2B 4R8WH 4JDEA 2BHUA 3AQXA 5HDOA 1IL1B 2VXQH 1LXMA 5FOBB 4OGQC 1B9KA 1R5VB 4W6WB 2WQ8A 1T2XA 3DGDA 3VG0H 2VXQA 1XL6A 4FG4A 2HVJB 4JFQA 3MV7D 1TEGA 5I6LA 3DHPA 4CN6A 6CGTA 2EIEA 1DFXA 2J6EL 2Q7NA 4FDWA 4MFHA 4XCFH 3ULUF 2GJ6D 1CS6A 3TN0B 4B9PA 4PJ9B 1AMYA 4FQCL 4XMXA 2GJZB 4MX7B 5EZIL 1ODAA 5IB5A 4G8EB 5FF6A 2AMGA 5GS0H 3S37X 4G6JL 5KSAD 3GHBL 3P11L 4P05A 4DZBB 1DE4B 5C92A 1AQ8A 3L3JB 4R84A 1HT6A 2H2SC 1D7DA 3SY0B 4L3EB 1DL7L 1RFDH 1ZS8A 4JFZH 4ZOCA 1CLOL 5IHUH 1MHHB 1NC4D 3C5ZD 2YIHA 1RK1A 3BUBA 4ANWA 4KC3B 4JVPA 3MHZA 3PAVA 3OXSA 1BZ9B 4E41D 5IHZB 4N0CD 4NENB 2YMOA 1ACYL 3O3EA 4XT1C 3QAQA 2JMRA 3ULUE 1PZUB 2F9BT 3Q5TA 3ARRA 1MCRA 2EUZA 3IJEB 4A2MA 3DK0A 2J4WH 4JZJB 5T33H 4P46B 4OFDA 3WTWA 1UG9A 3V5DB 2FBJH 3E6FB 2V0AA 4E0RB 4YE0A 1FN4A 2CALA 3E8VA 4KZ0A 3WN5B 4G9DB 4JLRB 2Z8SA 3DSNA 5CEYA 5SWSD 3FTWA 3HS0C 5EU3A 2IC2A 4G9FB 1DQVA 2Y7QB 4XPBH 4Q7DA 1AACA 5F3FA 4HJSA 1H8LA 3EW3B 3U9WA 3IFLH 5D1QC 4LPYA 5D1ZA 3NJKA 4GS7B 2QGCA 4NT6A 5IMKA 5JO5A 1FIGL 2EAEA 1ML0A 1TJGH 5G4MA 1OAJA 2CAKA 1OLLA 3X11B 5ENWB 1FVDA 3FSAA 3Q8BA 4LLYB 3EOAB 3EDKA 3HNSL 3EH4B 1Z0NA 3KYAA 2VDRB 4FLSA 5I28A 3C6LC 5I1DA 1PLBA 3ULVL 5LNDA 3GO1L 1FJ1A 1NGXA 4RGOH 3G9VA 2RGSA 3VXTA 1H3WM 1NDGB 3SPJA 1THAA 2CRZA 4A39A 3OG6B 4J8RB 3D09A 3V79C 4QHMB 3BZDA 3QWOB 1FL3B 3BKML 1A65A 2H32H 5FGSA 1FL3A 5E9DD 1YNTF 3IFPB 3OQ3B 1G9NH 1S7VB 2BDNL 4HWEL 1RUQH 3DGCR 4PJIE 4UIMB 3T09A 1EXUB 3VXNB 5CN3A 3HI5L 2X2IA 3QEUB 4GW5A 5IVXF 3SDXF 4PW9A 4MCNA 3ROLB 3RFZA 4YDJB 3K6SA 2Y7MA 3MV8B 2W92A 4QRUA 5BV7B 3CK0H 4ZD3L 5EUKA 4FMFA 4FA6A 1KCVH 3QR1A 3MRBB 1RZKL 3EGXA 4U1SB 4XP4L 2VLRD 5LCVA 1TJMA 1MEXL 1S7VA 4UIMA 5CAYB 1CUOA 3BT0A 4JBSA 3ETTA 2EP6A 2XWJB 3HE6D 3RIAF 1LO2H 4FQPA 4N26A 3MV9B 2DEYX 3SDCD 2FYVA 3UYRL 3LNEA 2OL3B 3X14B 3BQUD 3EJZC 4E9LA 3SDCC 3ROLA 4P57A 3K6SB 3FCTB 2GSGB 1IE4A 3FU9A 3ZDYE 1KTDA 2IH3B 2WQRA 4HXAL 1CG9A 3VD5A 5F88A 3GSVB 4NZRL 2HTLC 4PJ7A 2CK0L 2PYEE 4TTGA 1WPCA 4WGVB 5EPMB 3WNOA 1NQBA 2HTLD 3QNZA 4P48A 1ZWIA 1CLCA 3ATDA 3OPZH 1RZJH 5I8KH 4NFDA 3ZRSA 4NOBA 3QWNA 4EIUA 4YSSA 4F9PC 3ABKB 4R7NA 5C07A 3U6XS 2ZWNA 2R0ZH 2GCYB 4NC2B 4KRMB 1RIHH 2QLYA 3UIYA 4JMXA 3UBXB 1Q9OB 1YDPA 1RL1A 3F7VA 3I6GB 2W07B 3U1QA 3FJTA 4J4PD 4WW1B 3DPBB 4DKTA 1U93A 1XF5B 4J3OG 1MCIA 2C3HA 3KWWB 4FNSA 1QFWI 5GIRB 5T3ZD 3A4EA 3IJSA 4P2RA 5GGVL 3Q6GL 3BD4A 4CN1A 5IV2B 4GO6B 3W37A 1LO4L 2J73A 4V1DD 1G1YA 1T7YA 3SY6A 3LQMA 3VXRB 5AVWB 4HAKA 4FXGC 2E9GA 3SDDB 3IJEA 5IVXE 4FXLA 1ZV9A 4NUMA 3BE1L 5PCYA 5IUCA 2P49B 1OLZA 3RWGA 1R0AH 4PGDA 4LBEB 3CXHK 2Q8BL 1CR9H 2VR4A 4L29B 4QCIB 5B7FA 3NBNA 2YGOA 2X7LA 5DJAB 3QXVA 4APQD 4Q56A 3L9RA 3I9IA 4BZ1L 2NY1D 1T83C 3FOLA 1I3GL 1NLDH 2F19H 2GJ6A 3FRUA 3AXLA 4FXTA 4NQVA 5I1EL 4YEEA 5DSCB 4RISH 1L5GB 1RIVL 1DBKH 2DLFH 4DVRL 2CE6A 2QV4A 4H2AA 4KJYA 4YPGA 3BSZL 2J4WL 3NPSC 1WA2X 5T33L 5EIIG 5F9DC 2XN0A 4X6DE 5C0FA 3RVXC 3EJQA 5KSAA 1SXNA 4G7YH 3SSGA 4F7KA 2NY5C 4QRRD 4YUEH 4PJIB 3CDGA 4DNLA 4KFZC 3B7YA 1E9OB 2RIKA 4FFWD 1TVBB 2H1PH 2I60H 5CJQL 1A1OB 1U91A 2AGJH 2BLFA 2J8UB 5E6ID 4I88A 1DTUA 3BUDA 4GEIA 1JHKL 3P4MB 4U4BA 2H45A 1J1OL 1HWGB 1OW0C 4NI3A 3DOSA 3N91A 1XCTB 2BSTB 2WB1A 5FX3A 4LLMB 1G9ML 4P59H 3RBSA 4BQ9A 1AVAA 3EJRA 4XP1L 4B9JA 1AE6H 4MS8C 1GC1C 2IEPA 4X8GA 4NRZA 1S9XB 2ZQKA 1ILUA 1NA8A 1GTNA 1R3LA 2K70A 3PL6A 3RPKA 2M1KA 3V5HA 1SLXA 1XF3A 2J6EH 1B3JA 5ACZA 5CKAA 2NRDA 5JOFA 4TKWA 3QXAA 2IF7A 4PP2A 5I26A 1ZGLP 2CIKA 1QTSA 3T2QA 4GQQA 4M1GL 2VCOA 5EOCL 5D7KD 3HLAB 4JPQA 3ZL2A 1OZTG 1F11A 3MFFB 2W65B 5MENA 1UD6A 4FQHA 1XGQA 2BSRB 5FV1L 2DM2A 5CCKH 1WFNA 4PGEB 4P3WA 4WTZG 2GK0B 4ELKA 2HH0H 4HEPG 3BSHA 5BVJB 2ZUQC 1EXGA 2XYBA 5IREA 3VM7A 2W94A 5GS2H 5FYJU 3KGTA 1T1WB 4OZHA 1UT2A 2QVMA 3GKZA 3FFCD 5F7LB 1S5IL 3FW6A 4DPBX 3SJVB 2VE6A 4IKJA 1F2XK 4HS8H 1FNHA 3T2NL 5EZLB 4QRRA 3QG6B 5HDRA 5FS5A 4E36A 1DQDH 2YS4A 4GLRI 3L3OB 3WXWL 5DRNB 3TWCL 2BVPA 1U8OB 2GKIA 3G6DL 4JUSA 3PPEA 1QWHA 2Q5BA 5BS0A 1Z5LB 1BLNB 2IVFC 5EN2A 4W9DC 3RDTC 2OV0A 2WAHA 4XN1A 4XPFL 1OE3A 4KQ4H 4BH8A 3IDYB 3JQOB 4M6OH 3D39B 1EDQA 4JZNB 3GXDA 4KVCL 4JG0H 3FH5A 3UABA 3IM1A 3WAJA 1ZHNA 3C09C 2XTSA 1KIQA 3UIZA 4ZS6C 2PABA 1AO7A 4JVUA 2W9EL 1VFBA 3GHEH 4Z5RB 1A14L 2WSPA 1QNZL 3APDA 4KKQA 4MD5A 3GDBA 4NAQA 4YHOH 2GEEA 4AQ1A 2H0FA 3MTRA 1QVOA 4Y4FD 5HYSB 5H35B 1KB5A 5F7BA 5JQ6H 3FQYA 2RTTA 4APQC 5CMAA 3ZZLA 1OF2A 2AXJA 4ZXBC 3D4CA 3QDGE 1T1XB 3BMWA 4GW1B 4Z7OB 3AREC 2AEPL 3HMXH 2VISB 4FTVE 5E00B 4HS3B 3LZLA 4P4RB 4Y9EA 1USZA 1RZ8B 4UDTB 4XCYA 1RMFH 2X9YA 4DUWA 1L3WA 1MLCA 3L2LA 1QBAA 4ZMQA 2QQKL 1QSZA 2HWZL 4HXBH 4JDTL 5EF2A 5DMKA 1CGVA 3H6AA 3KPNB 2Y07H 5DMKB 2E8ZA 4I87A 1RK0A 2QPSA 1PPIA 4ZRGA 4U6HB 1H8NA 3M07A 3LZQA 5F6HJ 3ZQXA 3KPTA 1P0SE 2JIXD 1XDTT 4N8VB 5D70H 3O6FC 3V4VL 3P54A 3C09B 1OPGL 1PLAA 3MXVH 4UMSA 1H8OA 5DURB 4KTEL 1WC7B 3HB3D 5D2LA 4JREC 4XH2A 1GZHA 4TVPD 5CHNB 3RWJA 5I1IL 4O2CA 2HMIC 1NGYB 1U8KB 5H4ZA 5EDXA 5C08D 3WS3B 2WC7A 4L1DA 3N85L 4FNPA 2Q87A 4Z3EA 5KBPA 3OAYH 4OJDH 3OR6B 4OSUH 5F1NA 5F3BB 1YNLH 2DWEB 2X89D 3MI6A 1O7DC 5HY9A 4LCCB 5IQOA 3F5WB 1CD0A 1A7BA 4XXCC 4APQA 4F2FA 3EYOB 3NVQA 2B5IC 5FO8B 4KROD 1KDIA 3DK2A 3H3BC 4N3UA 3QUKB 1RHHB 1WT5C 5EULV 1LYQA 2J1ZA 3DX8A 4KGJA 4CU7A 1TCRB 2BC4B 2J1WA 4V2BA 2B1HH 1RZIB 1TLMA 3BH8A 3DVGB 3ATAA 3FC8A 3WFZA 4R83A 43C9B 1ZS2A 1FVEA 3P40A 4XP9L 4AYBA 4OKVA 1IM3B 2IQAB 2UZIH 4NYLB 5L9DL 4P57B 2TRYA 1L9QA 1EIBA 3UGEA 2X70B 4PLNC 4R6UA 1SVBA 3DXAE 3QQ9D 4I18B 3RY5A 5DI8B 3NN8B 1N6UA 3TC9A 3KPSB 1RZKC 2MQCA 2KMWA 4IDJL 3L1OL 1ZIAA 5I18H 1NAKL 2OS7A 4B5ZA 2JTDA 1KGWA 3ARDD 2RB8A 4POZC 5C0BB 1JDDA 4LRIA 5FLVA 3B9EA 2B7DT 3L3OA 4RQQA 5SX4I 2CO1A 1ACCA 4JW3A 4YVNA 4EXKA 4PJGE 4F3FB 1MCOL 1MLBA 2HTKC 2F7PA 1R24A 4UQDA 1EHLL 3F65A 2OW7A 4TNFA 5LWYL 4AKPA 1SEBA 3TJHD 4FAAB 1HI6A 4DK3A 4LL9A 4BH8B 5IEKA 3ZO0A 5JQ6L 5L6YH 3MRDA 5CNHA 4PLKD 4AIEA 1O5DT 4AM0Q 1MFBH 4B9FA 4U1JB 3MYJA 3GB7B 1BIHA 1D6EB 3Q1SH 3TESA 4XN8A 3RNKA 1JV2B 2OKMA 3OKOB 2O6CA 4WIQA 2EXWD 3SBRA 3CVIH 4X99B 1QG3A 4NFCA 5FYKH 2OSWA 3RUGB 5JW4R 2BRQA 1KXHA 4I9WE 3Q13A 3UTZB 3O4LD 3LOWA 3QBTB 3TEUA 5E8PB 3PXLA 2XZCH 4M61B 5ESAA 3L1GA 3ESPA 3MGOB 1UH4A 1G7HB 1GJUA 2CJ3A 2LQRA 4K5LA 3KDPB 2I07A 4M6OL 4PRIA 3LRGA 4YHPA 3LKOA 5I6KA 5DQ9A 4GAYA 4AQ8C 4GAGH 3RL1B 4AH2A 3L45A 5HJ3B 4FOMA 1RUML 1I53A 2VZOA 3F04A 4EI6A 2CMRL 4FL4C 2YPLA 5I1HH 1DSFL 4W1TA 4N86A 2XWTA 5FIEA 4IEFB 4MXWL 5ADOH 5CEYB 4Q6KA 1PZ5B 3FUNA 1NFDB 1E4WL 5F21B 1BWMA 3PP4H 1YNKL 2DEXX 2YOCA 2PETA 4G7VL 2CG9X 4G7SB 4KK6D 3AITA 5SWZA 2XG4B 3PL6B 3OF6D 5C0IA 2FHFA 4QXWA 1OF0A 3TA3A 3BRGC 4XZ4A 2YK1H 2ZKYA 4PR5A 4JO8A 2GAZB 5C8JB 2G5BA 3KPRD 3QDJA 4YGVB 5LGJA 2F15A 3QORB 3VSVA 1OGAE 3KL5A 3QS2A 3HRPA 2ORBL 2V5MA 3SE3C 4JKPL 4ZPTB 5DWUL 3U9PL 3VXMA 1JERA 2EDJA 1NGQH 3DGGB 3RWIA 1IC1A 4MMYA 2JNZA 3SB3A 5B3JE 2JCCF 2PYED 2WINA 3U2SA 1W72B 2QR0B 4HUMB 3IRCA 2YQ3A 1MUJB 1Q38A 1UB6B 3HZYB 4MCYA 4HF5L 1CGSL 4FJ6A 5ELIA 5IKCB 3PG2A 1GTFA 4LF3A 5JW4Q 2J43A 3UAFA 3T2PA 5ILTH 3KVPA 4UM9A 4BJLA 4Z8FL 1JFHA 4FQQB 4S1DC 2CKBA 3EIFA 5J3HD 2ZWKA 3ABZA 4HFUH 5BOZG 1IVLA 4LHQB 4MWFB 3VFMA 1DCEA 4C56A 3K6DA 2ZYIA 5HYJB 1WIUA 4AYID 4JUTA 2FATL 2VR7A 5D5MF 5EBWB 1U58A 2YZ1A 4ZAKD 4PJ8A 1MXDA 1IEBB 3FB6A 4KQ3L 4LEEA 1HL4A 5GXBB 4GKNA 4X6FB 1AC0A 2BSDA 2FH8A 3LPGA 3HVNA 4FTDA 4LB8A 4TYUA 2MNWA 4PG2A 1I7ZA 1MG3C 2EDHA 4GIAA 4BRVA 3KPQA 2EDKA 4MS6A 3N44B 1S3KH 25C8H 4Y5VA 1BD2A 2W0KA 3SE6A 1TETL 2NY7H 2R4SH 5AVVB 5C97A 2JWYA 3QHZL 3EYSH 2WO4A 4XVTL 4AGLA 4X98B 4YAQA 4D0CA 5KJRH 5GGUB 2ZG2A 1W0YT 5D96B 2HAZA 5CILL 1WIOA 4C83B 2GY5A 2P24B 3VFNB 4U31A 3BVNA 2FDBP 1MIML 3FPYA 3HFMH 2FSDA 4YLQT 1AKJB 3Q06A 1R0AL 4AVKA 4N2AA 1VESA 1RD6A 2C3VB 2X89A 4U6XB 4OAWA 3SQBA 3L4YA 4OF3A 4ZMPA 3KE0A 1W9XA 3NYKA 5FK9A 4F91B 2B1OA 1T1YB 1FPTL 5IR1A 2Y06H 1O6SB 3SGKC 2R8SH 3FHQA 1L9OA 1EH9A 3BVTA 5LXGL 2N3JA 3OM3B 3H9SD 3K91A 1CTNA 4PUBL 5KWYC 2VMJA 5KSBA 2ENQA 5GGVH 1G43A 2I24N 4PJXF 4XTRC 3QB7C 4OVVA 4KU1A 4MJ6A 3TBWA 3MREB 4KJWD 1AXSB 1LQSR 2E59A 4FEIA 5BZXA 4Z7VA 3BQUC 3FO1B 4Y2NA 4Z7VB 5I19H 1B0GA 1U3YA 2CRYA 3T3PB 1FNEA 1D5XA 4YO0B 5K9OA 1TCMA 4OLXH 1LO5B 1TUPA 2VL5A 3IDMB 4PGBA 5EUKB 3GBNH 5E08L 1KEGH 4QXGL 1YPZE 3TVMA 1U3NA 4K71B 4YQXL 5FYJL 3TO4A 4B50A 1XSJA 4B3EA 1WS7A 2ZXCA 4WTQA 3TTYA 4RGNB 1CURA 5GISH 1SUHA 4DW2H 3T8XA 1E4KC 4N1EA 4LCIH 5DQJB 4HKBB 2A99A 2ZUXA 4NDMA 4QXTB 5DQJA 3RUGE 4I89A 4D8PA 3TPKA 3RFZC 4IRZA 3BAIA 1AGBA 1AMXA 2GJ6E 4NT6B 2CM5A 3IDUA 2PTTA 3MLYL 4LL4A 3LRLA 1AZNA 4WLCA 4PYHA 3CFIC 4OIIL 4Y19B 3ZUCA 2I9TA 4YDVA 2VQUA 5FUOL 3QFDA 4C4UA 1G9HA 2WZ6A 1QSFE 4OKVB 3CH1B 1KN4L 2WWMD 3O3AA 2QJDA 5C86A 5DLLA 1N6QH 1GAFH 3L7FB 4D9LL 4EN3B 1CFQB 3BOVA 1BQUA 1BFVH 3ILQC 4HOMA 4S1DD 4JE0A 1FNAA 5A2IH 4M6NH 4BFEA 4NQQA 4NRYB 3MRFB 4NJ9L 3DRQA 3S0PA 3LDBC 2HCZX 1K5NB 3HS0A 3HKFA 2A74C 5EWIL 3U36A 3GZKA 1S7RB 5IJDC 2BY2A 2NPLX 3C8HA 4JHBA 1SJHA 1KJ3L 1NMAH 1LNUB 4JG1H 4AOFA 4ELMB 2ZUUA 4ODSH 5EUOE 4UWQB 2C1OA 5CHNA 3RWJB 2F5BH 3COOA 2WXRA 4XH2B 4X4ZA 4GKSB 3VFTA 3JZ7A 1ZK9A 5B7MA 1N3NA 1R3JB 4NUJB 4Q8BA 2VABB 3H54A 3MUUA 3L3JA 4AV0A 3B56A 3MR9A 1OANA 2BVEA 4P5KB 5E9DB 3OB0H 2CRIA 5LBSL 1FO0H 3CFDA 2BPBA 1LEGA 3NP4A 2B9AA 3QJSB 4IOFD 2R1YA 1LP9A 2AZUA 2KT6A 2AI0H 3OZLA 4IRJA 2Q1EA 5E5LA 3AREB 3ZE2E 1GGYA 3TEWA 1AJ7L 3J7HA 3QIBC 3VFOB 4YS4A 4GXUN 5E1AA 3BRFA 5B38B 5E6IC 3QIBD 8CGTA 1ZTXL 3VWJD 4KO7A 5LVEA 4P9HL 3KPQB 1MHCA 1N0XL 4MWFA 5CXPA 3D08A 4HSCX 1P7BA 3GSNH 2PWEA 1I1AC 1V3LA 4IHOB 5AW0B 4JFDD 1R3KA 3MUY1 5K39A 4CJ0A 4JFXA 4F7PB 5CLXA 2PWDA 3QJUB 4NAJA 2DH2A 3FONB 4ZMZA 5J12C 5DEGB 2WQUA 4LARL 4JB9L 3IDXL 4XNYL 4HT1H 4YHZL 4KROB 1TNNA 3PIQB 1HHKB 1GZPA 1D5XB 3QR2A 1UWFA 2PO6C 3M1OA 1ZEAL 3N55A 4Y16B 5FC9A 5C7XL 3BAWA 5D7IA