1TU2A

The complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title Structure of the complex between plastocyanin and cytochrome f from the cyanobacterium Nostoc sp. PCC 7119 as determined by paramagnetic NMR. The balance between electrostatic and hydrophobic interactions within the transient complex determines the relative orientation of the two proteins.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tu2A00
1B3IA 3CG8A 3QJVB 4BDVA 2IDFA 1JZHA 2BO0A 5B1JA 3IN2A 3HB3B 3SBQA 1L9TA 1M56B 4YVNA 1ILSA 3WIAA 3SQRA 2BP0B 1SF3A 3UAEA 1PCSA 4P5RA 4M3HA 5TK4A 2OJ1A 4A2HA 1JZFA 1AS6A 1BXUA 4GYBA 1MG3C 4L0PB 2EIMB 2VN3A 3U25A 1NINA 3NJLA 2AANA 4YL4A 1IUZA 4AX3A 2FT7A 4F2FA 3NP3A 1SHWA 2IDTA 3AG3B 4HCGA 1CURA 1ASPA 2VW7A 1MZZA 2JFCA 3CZUB 4E9YA 1CC3A 1L9PA 1KDJA 3OMIB 5AFAA 1ZDSA 2BP0A 1IC0A 1SF5A 5D4JA 3CDZB 1A4CA 1ETJA 4YSTA 3DTUB 5AZUA 2CBPA 1V10A 3AG4B 3SBRA 1SDDB 5B1AB 1KV7A 2IDSA 2EIJB 3NT0A 1SJMA 1X9UA 4A2GA 1JZJA 2BW5A 2W88A 3S3CB 3NSFA 2PLTA 1AZRA 1NIAA 2AVFA 4GXFA 4RH4A 5B7FA 2X88A 3N55A 3TBBA 4DP9X 3AW5A 1ID2A 3CDZA 2XU9A 2DY2A 4KOCA 1QNIA 3NSYA 4PAZA 2HRHA 2I7OA 2CJ3A 3QJUB 4KNUA 1SDDA 1JZEA 3NSDA 1KCWA 2Y1AA 1DYZA 1V55B 2FT8A 1OE2A 3MX0B 2PPCA 3NJKA 1TEGA 4YSAA 4E9RA 2QPDB 4DP0X 4DP4X 3NJMA 1HAWA 1IBYA 1AANA 2WO2B 2RACA 1NIEA 1KGYE 3AZUA 2XXGA 3EH3B 1E65A 1CUOA 1ZV2A 2J55A 1GY2A 2BHFA 1A4AA 2I7SA 3QPKA 2DV6A 3PAVA 1X9RA 1JVOA 4E9QA 4G7QB 4N4YB 4YSQA 2VMJA 2IWFA 3AG1B 3WG7B 4KO5A 3WI9A 1T5KA 2GC7C 3PAZA 2OV0A 1NIBA 3PAUA 2YXVA 3ABKB 2VSKB 1ASOA 1IKOP 4HCIA 1JZGA 3GXUB 5LDUA 2XV3A 1WAEA 3QJQB 1QHQA 1KDIA 5B1JC 4CSZA 4A2EA 1OF0A 2HXAA 2X87A 2YARA 4KNTA 1ET5A 4DP6X 3WKQA 5PAZA 1PF3A 2YXWA 4G72B 4UANA 2FTAA 5I28A 4YSEA 2W8CA 1BQKA 1AG0A 4HCFA 1BYPA 1BAWA 1AQ8A 2GHZA 3FQ1A 2IAAC 1J9SA 3WKPA 1XMEB 3H4HA 2FJSA 3UGEA 3UADA 4W1TA 1MZYA 1FFTB 1I53A 4CSPA 2PPAA 4DP5X 2BZCA 1PY0A 4F7KA 2CALA 4BXVA 1BYOA 3IEAA 2H47C 4G70B 1GYCA 1ZDQA 1N68A 2ZONA 3NP4A 3D12B 1EZLA 5B7EA 1BQRA 4F2EA 3FSAA 1L9QA 2H5UA 2IH8A 4M4RB 1AZBA 3V9EA 2DWSA 3ZX1A 3DIVA 4E9TA 2P80D 2DYSB 1CYWA 1W6LA 2PPDA 4WTQA 4JHUA 5E9NA 2PP7A 1AZNA 2YQBA 2HX8A 2PCYA 3ABMB 4Q89A 2BZ7A 3TA4D 1GS7A 1BEXA 1WA0X 3QJSB 1JOIA 3T6ZA 3S8GB 4YSCA 1NZRA 3PLYA 1NWOA 1N70A 1VLXA 3AY2A 4NERA 3OD3A 1ZIAA 2N0MA 3FPYA 2PP9A 3PPSA 3FSZA 3PCYA 2IDQA 3FU9A 1KYAA 1E5YA 1OCZB 1M9WA 4A66A 2VW4A 3ABLB 4KO7A 5I5IA 3AG2B 3BQVA 3GYRA 3FS9A 3X1BA 3GDCA 3IE9A 1DZ0A 4HAKA 4BWUA 1AACA 1OV8A 1TEFA 2J5WA 1A4BA 1E5ZA 1PNCA 1ET8A 2MRYA 3NJHA 4ENZA 3C75A 1J9RA 3V9CA 1PZBA 1AZUA 2Q5BA 4FA7B 3T6XA 4P5SA 3T9WA 3X1NA 4DPCX 1RZPA 3QJRB 1MDAA 4E9WA 5I6OA 1AS7A 2PPEA 1NDTA 1HAUA 5PCYA 5D4IA 1JXDA 3FT0A 1ASQA 3JT2A 3FU8A 4G71B 4HZ1A 4W9ZA 1HFUA 3T6VA 2UX7A 2XXFA 1NTDA 4MFHA 4A68A 2FWLB 4GP4B 5I6LA 4G7RB 1WA2X 2YAFA 1RKRA 4DPAX 3EH5B 2JKWA 2B08A 3PXLA 4KO6A 4BXSV 3FSWA 4E9VA 4X4KA 1L9RA 1QLEB 4DP1X 1E30A 1OE3A 3RYMA 1RCYA 2UXTA 2WO3B 4A67A 1BXVA 4A2DA 4YSRA 2AFNA 4QLWA 2VW6A 2YAQA 1V54B 3CVDA 2YAPA 5I6MA 1CYXA 3OMAB 1WA1X 3WNJA 2BP8B 2XVBA 2R7EB 4GY4A 3IN0A 3S3BB 2GIMA 4BK5C 1A3ZA 2HLEB 1UATA 1BXAA 1W8EA 2XV2A 1J9TA 1A65A 1ILUA 5B3SB 1L9SA 1XB6A 3H56A 4AZUA 3WNIA 5B7MA 5I5MA 2H3XC 4YSOA 3SBPA 3OQRA 1AS8A 2YAMA 2IWEA 2YAHA 5FC9A 4ZK8A 4FAAB 1SFDA 3FSVA 3FYEB 3EHBB 2GC4C 2J57A 1ZIBA 4PCYA 1M57B 2BP8A 3QJTB 1AOZA 1J5CA 1SNRA 2QDVA 2R7EA 7PAZA 8PAZA 3T71A 1OOWA 2XX0A 1KBWA 2I85A 4UAHA 1BQ5A 5B1BB 2OCCB 1RZQA 3X1GA 4AKPA 4DP8X 4K9JA 5TK2A 1A8ZA 2IDUA 1EHKB 2AZUA 2UXGA 4KOBA 4BWWA 3UABA 1XB3A 4E9XA 4DP2X 2GBAA 2ZWNA 3NJFA 2PP8A 1WS8A 3IBOA 2IWKA 1J5DA 4GP8B 3T6WA 1PAZA 2TSAA 1NPJA 2QDWA 3ZIYA 1W6WA 1IBZA 2ZXWB 3S3DB 2ZOOA 1SHXA 2UX6A 1NPNA 2XWZA 1GS6X 4YSPA 3NJJA 5A7EA 2NRDA 2PCFA 3S8FB 1AZCA 4DP7X 3ABGA 2FQGA 3HEIB 4DPBX 1AG6A 1AR1B 2P80A 4YVUA 1JXGA 5I26A 1NIDA 1GSKA 2IH9A 3N2JA 3G5WA 2DWTA 7PCYA 4BWTA 1AIZA 4HHWA 3ERXA 4JHVA 3FU7B 2XLLA 3ZBMA 1L9OA 1ZPUA 3CVBA 6PCYA 1FWXA 2BWIA 1XB8A 3KW8A 3ASOB 3X1EA 3JTBA 1PZCA 2XYBA 2FQFA 2WSDA 3FQYA 1GR7A 2PPFA 4AKQA 4JKNA 5I6NA 3OM3B 1FA4A 1F56A 3TBCA 2MTAA 3KW7A 3X2QB 1PNDA 1OE1A 1R1CA 1PLBA 2YAEA 1PLAA 2AZAA 3QQXA 2GB2A 2E86A 3DKHA 2BWDA 3FU7A 4YSSA 2XV0A 1PMYA 2QPEB 2VM3A 3FQ2A 2Y69B 1TU2A 2DYRB 3NJIA 2FT6A 4HIPA 4KNSA 5IY5B 3TASA 1ET7A 1SFHA 3BVDB 3NYKA 2FQEA 5I6PA 2A3TA 1J9QA 1JERA 2VSMB 3EF4A 1MG2C 2BW4A 2QT6A 1E67A 1TKWA 4AKOA 1NWPA 3EH4B 3NJGA 4YSUA 3UACA 1JVLA 2JXMA 2LLNA 1ADWA 1KBVA 5D4HA 2HRGA 1OCCB 1PLCA 4AI7A 3TU6A 3L45A 4EF3A 2HX7A 2VM4A 2EINB 4NAJA 3NJNA 2EILB 2HZHA 4NB7A 4A2FA 2UXFA 2CUAA 5EHFA 2FNWA 1JZIA 3FYIB 1NIFA 2UXVA 2XX1A 3UAAA 2HX9A 4G7SB 4E9SA 3ASNB 5AKRA 4QKTA 2TSBA 4KO9A 6PAZA 1OCRB 5ANHA 1GW0A 2B3IA 5F7BA 2GI0A 1YLBB 1GS8A 3NSCA 4HALA 2CAKA 4WKXA 4HHGA 2Q9OA 1JXFA 5I6KA 4BDVB 1NICA 5I5JA 4Q8BA 1WS7A 5B1KA 2J56A 1OCOB 2XUWA 3FPXA 2CCWA 2FQDA 3H4FA 3OMNB 4GP5B 9PCYA 4TXVB 5F7AA 2YAOA 4YSDA 3X1FA 1URIA 1PZAA 3ZDWA 1AAJA 1KCBA 1GY1A 2GSMB 3MBWB 2EIKB 4UF7C 4N8UA 3CVCA
chains in the Genus database with same CATH superfamily
1FIGH 1I85A 2OXHB 2W07A 4L3FA 5K9JL 5MERA 2C9VA 1IBHA 2Y36H 3L16A 1FFOB 3FU6A 4P46A 3VGGA 4YVNA 1ILSA 4EOWH 4LDEB 3CX5K 1KT2B 1G6RB 1T21B 3RIFK 3GSRA 5DHVA 4YFEA 2FSEB 3UZQB 2E7LC 2C9XA 3EFFB 4IIQB 5AWNH 4DK6A 2JLLA 3IETA 2P52A 3ML9A 4MJ5B 1ZSDB 4TVPD 3MV7D 4MNGA 2IDTA 5H8DA 1RZKC 2Z31D 3U4BH 3AB0C 4MD5B 5H35A 5EZJA 3GXTA 3PGFL 4N6RB 1II4E 1N4XH 4KPHL 2UWEE 4HUUA 1GGIH 2WQUA 4W70A 2NSQA 3VTTA 1WFUA 4NQDA 4YSTA 5J1AB 4LSVL 3LQMA 4HWBH 3SPVB 5IG7B 1HYSD 2ZWZA 5I1JL 1TVHB 3ILQC 1JYXA 3QIUB 5E2TL 1R3HB 4AQAB 2G2RB 2X4RB 3H3PH 4N0UE 4WHDA 5E2WH 4U1GB 5F93C 4L8SC 4WJG3 4LLVB 2NR6A 4R9HA 1R3LB 3NQKA 3ZSSA 4LQFH 2AGJH 2QVFB 5J12B 1I7ZA 4YHLL 2DQEH 5HDBB 3V5DB 4UQIM 4BE6A 4HK0A 2AQRA 4RA3A 3NSXA 1S5IH 2OBGA 1V3MA 3VM5A 4Z7AA 1YPZB 2OMUB 4N2DA 5CFAA 3FUKA 1X7TA 4KKLD 2Q7AA 4AZ8A 4UTCA 3WFDL 4PRPA 3H0TB 3LQAL 2CE6A 4IRSB 4RFOH 1U3ZA 2X0WA 4GMTL 1D3CA 4FJZA 3NN8A 3RL2A 1MVFA 1RIHH 2QLVB 2ENPA 4YBLC 4LVOB 4PJCE 1LO2H 3JTSA 4FG6D 1NAMA 4IGBB 2ARJB 2LTQB 4LVNB 2FR4B 5K9QG 4UOJA 2IOMA 2P5WE 4JHAL 4QXWA 3DMMD 3V4VH 2XA8H 4XCCH 3D3VD 3DV4B 5FKAB 5J11C 3ARDC 2OQJA 3ALXA 4J4PA 1U3HA 2G9HA 1S7VB 2P8PA 4G7QB 4Z7VB 4U1MA 4P49A 5DA0B 4NKOA 4NOBA 1CYGA 4CJ1A 1T5KA 1ORSA 1HEJC 2OMYB 3BKJL 5BNXD 2KZKA 1EO8H 3EO0A 4KK9D 4TQ8A 4IU2A 2R23A 4PIRF 2IADB 1OLZA 3IU4L 3P2BA 3W81A 3QZBA 3WDJA 2WGXA 1PIFA 2X1XR 2Q1EA 2LT9A 4FG4A 1INDL 2Q0ZX 5D7IF 5CF3A 1NAML 2QQLH 4X6BA 4YN3A 3ZYIA 3WKQA 1SY6A 3IVKB 4EZMA 2BM3A 1ULVA 3Q8FA 3QQ9C 4NZTL 1P4LB 2OYKA 1MF2L 3BFOA 1NKGA 1EXUA 3WEOA 4IEFA 5T8IA 3T0EE 4JFXB 4PHXA 5EN2B 4HPYH 4B6ZA 1YDPA 3C8KA 4Y5YC 5DTFA 3ZQWA 2E9BA 4M4PA 5ELIA 2Q86A 3F7VB 4W1TA 2OW6A 3TEYA 1I53A 2Q8AH 5ANMB 1WZAA 4TUOA 3ZDYF 1BIIB 2RJMA 4P5TA 3C6EA 5E4IA 3ZXAC 2XICA 1SY6L 4G70B 2BIIA 4NZFA 3QCUH 4HOWA 3LH2L 4RX4D 4F2EA 5JORA 4HC1A 2X4TA 4PS8A 4X2UA 2H5UA 5F7LB 4FXKC 5J0BA 2DWSA 4L9DA 4OUUA 4ZMWA 3MV9A 5D72H 4JHUA 4U0QB 3O11B 1LO0H 2B2XL 3CMOL 4Q89A 4M3JA 1FRGH 1YNKL 1I8IA 3SPJA 4XP5L 3SPGA 5I1EL 2ICES 1NZRA 4OF0A 1KXQA 3SPIA 3I74A 2ZG2A 3OKNA 1N19A 4MHHI 3FSZA 4Z3FA 4DK5A 1O6VA 3QQDA 2NTFA 1M9WA 3NZHH 1SBBA 2E76C 1E42A 5FA4A 4AE0A 3UTQA 2Z34A 4GLRI 1KUMA 4WI9A 4NP9A 2YUXA 5CJBA 1TEFA 1H3PH 4N5UA 5DVMA 3VX1A 1YJDC 3P0VH 1XH2A 4LCWE 1Y18A 3LCYA 2V37A 4H25A 4HJ1A 5IVXF 3WN5C 1Z9LA 2AERT 3KR3L 3QO1B 4KY2A 5IMMA 1R5WB 2YPLE 3ULVE 4ODSL 3EW3B 1ZK5A 4HIIB 3MA7B 5AENA 1P5UA 2VDPH 4FQPA 4DQOL 4HJGA 2V2TA 3CSGA 3MRMB 1NFIA 2WZ5A 3Q1EA 1HH6B 2YGVA 3PGCB 4J3XA 3TS8A 1I3GL 1I7RB 1WIPA 1YMMB 3FB5A 3F64A 4M5YH 4ORZC 4YXLH 3UO1H 5ID1A 1PD1A 4UTAA 3N1QC 5FDWB 1WA2X 5AALA 1X7QB 4HWNA 1HJBC 1IAII 3NPSB 3EJJX 3FSWA 5B8CA 4ZMNA 1L9RA 1SJHA 2ERJC 1DDHB 2RMNA 3CH8A 5F1NB 5E8PB 1RU9H 3P4OA 1X9QA 3QZMA 5K9OA 4Z0BH 1MWAA 2EYTA 1VGKA 3LPFA 1MVYA 2R1XB 4XBGA 3SPCA 4PR5A 3IJYB 4ZTPL 1NBYA 2B9AA 4N5ED 4C59B 4QRRE 3T77A 1GCFA 4ERSL 4ECNA 3QHTC 5FF6A 4H8WH 1JK8B 1UEMA 3C60C 4CC4C 3ULUL 4LSSL 4WSKA 2DQFA 2DB8A 4JO1L 3STLB 4L1BA 2OMVB 2B1HL 4UTAL 4PRBB 3OKLB 4OF7A 3VI4B 1MCNA 5T5FA 1MCRA 2JMRA 2WXKA 3MJ9H 2V7NB 1UHVA 2C3GA 1FZMA 1IAOA 3BFWA 1MVUB 2DEWX 1CXKA 1E8YA 1MY7A 5L2KA 2QZQA 1PY9A 2P5WD 1ZY9A 3I9GH 2F1EA 3MUY1 1MWAL 3PWPB 5CGYD 5MP6H 5I5MA 3BH9A 4QAMB 1PX4A 4FAAB 3EHBB 4G82A 2R1WB 4NO5B 3OJ2C 5C0FA 2C3XA 1SNRA 2CGZA 2DBLH 1XCTA 4KRNA 3KWWB 8PAZA 1OSYA 4DN3L 3OKOB 3AS0A 4XP4L 1PEWA 5F9JA 3VW3L 3QZWG 2AXHA 2WLLB 3UTTB 3P54A 3KYOB 3QSKB 5T5FL 3DJTA 1HNGA 5ALCH 2V9UA 1FLTX 4BV1A 5CJXA 4TS6A 1IZJA 4I18C 2EVHA 4XXCC 1INEL 1CLYL 1GC1H 2FX9H 1IM3B 3QUYD 5HXMA 1GZQA 2XN9A 2NT0A 1UJTA 5DRNB 4AIZA 2Z31C 4E41E 3S3DB 2HN7B 3K3QA 5E8DH 4ELKA 5FA3A 5KYXB 2OMTB 1BZQK 1CICB 3OR7B 4PJFF 5D4QA 4Z7QF 4ZS6C 5I17B 1FGVH 3ZZLA 4Y1AE 3MUZ1 4GLRH 1IGCL 1KY6A 4LPCA 1BOGB 4KVPA 3UPRA 1J8SA 2E27H 2LLLA 2VQ1A 5AYTA 2A1WL 3BVWA 2IBZY 1YC7A 2WLKA 3WOVA 4WGVB 2ITDA 1NGWA 2Z9TA 3FT2B 3NA9L 3SO3C 1NANH 2FHBA 2LHAA 1BZ9B 1SBSL 4BWTA 4HHWA 4PGEA 1F4WL 3ZTNH 5AUMB 1E5AA 1CR9L 3DSFH 5KS9E 2CLVA 3AY4A 3KXFE 5JLZB 1VFBB 2TRYA 4LT7A 2VDMB 3SYAA 3N0PB 4P3CL 3W5MA 3JTBA 2SEBA 5E6ZA 5TGBA 4P23D 3JTTB 1A6WL 2FWOA 3LH9A 2E4TA 4MNHB 3VSQA 3OM3B 1LWRA 1M1XA 1UASA 1IAIH 4KKLC 3VI3E 3GIZH 2F8XC 2VZ3A 5L8JB 2ESVB 3LZFL 1AXTH 3N43B 4HS6B 1P84K 3LN4B 2VWEE 2XI9A 2VSDA 3B7RL 2Y24A 4GRMA 1QRNB 5DUPL 5BV7H 2CZNA 3CQPA 2VM3A 3NJIA 1D6VL 4FYTA 3WEXB 5SWSB 3QBTB 4FG6C 4JKPL 4NZDA 1XTLA 2VITA 3MUGB 4NUPA 4UQDA 3NK4A 1MHHB 4LLWA 1NFAA 2CKBH 1S8DA 2K8QA 1IQWL 3DMMC 3SE4C 1SEBB 2VSMB 4JRYB 5K59E 1A3LL 3X3FH 4J7RA 4LCWD 2L7JA 1TITA 1YY8A 2RHEA 2H9GA 1VCBC 1QEWA 5CKAA 4R2GB 2YPLD 1MDTA 3VAEA 1PSKH 4R26L 1YZZA 1EMTH 4P07A 3NABH 4KK9C 4RZCA 3KVDD 3TN0C 4XN9A 2BVPA 4K7FA 1YUHB 5JOPE 4U1SA 4XOEA 3FYIB 2F0CA 4NKIH 3QARA 1SJVA 2QGEA 3NIDB 4OZHB 3GNMH 4X9HA 1V3LA 2R0WH 2B3IA 4XB8A 4AM0B 2R1YB 3DOSB 4KTEH 3HPLA 3ZO9A 4U31A 1HXKA 3HZYB 1IGML 1PZSA 4UV4L 1Z2KA 2Q9OA 4WKXA 4LDOB 3LV3B 3LHAA 4ZMPA 5GJTL 3M07A 4V1DA 4ZFFA 4B0MB 1WS7A 3WKMH 2Z64C 4QRRD 2B4CH 3L4XA 3EDDA 4I4WB 1EAJA 3KPMA 1FNSL 3CDYA 1N9PA 2FQDA 1YEWA 2GTWA 1AI1L 1LQBC 1AQMA 3IK2A 1UVQB 5EPMA 4F80A 4OIFA 2R4RH 1NDMA 4UIMA 4MNQE 4FQLL 1U42A 2ZX9A 2EUWA 4K9EC 3TCTA 1GIGH 4AUUA 1NCHA 3TCLA 4JREC 3C5XA 1Z9OA 4HKBA 4GJTB 4ZAKD 4RWYL 2OL3A 5MHSE 1SVBA 4WUKL 2TAAA 3NGBC 4IRJD 3IGUA 5D7IB 2F5BL 1AHWB 1N2RA 3A3YB 3C5JB 3FBKA 5C09B 3VFRA 3Q05A 2AK4B 3UAEA 3LPGA 5HHOA 4P06A 4R7DA 4WNQA 4JFUA 1FDLH 3D2UD 2NX5A 5JIQA 2VGLM 4UT9A 3U25A 5AW0B 1NINA 2WWKO 2KDGA 1JHLH 1I1AA 4OLUH 4DTGH 4DFHA 1R9FA 1LEIA 5E95B 2VW7A 3IAQA 2B7DT 4FXLA 1AXIB 3MRIA 1MQ8A 3L5WA 4XPHL 3CWGA 1N12A 2OL3L 1P7QD 4PWHA 5HHME 3E6FA 1OP5H 5AYQA 3MRBA 4QOKE 4XCEA 1AD9A 3X13A 1OF2A 1HL4A 1DVSA 3ZDXE 3MLSH 3LHPH 4TLSA 1FNGB 5I8CB 1UWFA 4E41D 5IVNA 2TRHA 5B1AB 5HDBE 3L4VA 2XZAL 4UT9L 1UXSA 2HFTA 4FQ2H 1OM3H 1TENA 2ATAA 4Y1AD 2CR6A 1AZRA 2FBJL 1U3YA 1YPZE 5HYSG 4BFRA 4O00A 2NPLX 3VSVA 4QRBA 1QNZH 1VFMA 4E42A 5IUSA 4MCMA 3VMNA 4OGQC 1FH5H 2Y5TB 5LAXB 4JM2A 5D2LA 4QHUB 1XD1A 2VL5A 5BRQA 1QQDA 3PFQA 3SIKA 1QPPA 1NGZB 4J2XA 5TQ2H 2YGQA 3KXFD 1PQZB 4HLZG 3D34A 4AQZA 3MOAL 2QPDB 4X6CA 1O6TA 3PGDA 4TSCL 2NY1B 1ZVNA 4TLKA 4OY9A 4FKHA 1IAKA 4WW2A 4N5EC 1FCGA 2WO2B 1NGPH 4NM4H 5D6CB 2ADFH 1W0VB 2BH0A 4PJ7A 3HMXL 4GQ9H 3UYPA 2EVGA 4JJ5B 1XCWA 3SDDA 5IVXB 3WUWB 4PHZA 3W9DA 4JY4A 1MI5E 3MXWL 4HZAA 1RZIA 4JVUA 32C2A 3MX0A 1WBXA 3QDME 4W9KC 1SYSA 1XIWD 3LKOB 4DAGH 1KY7A 2YMXL 2OMBA 4YBQD 4OFVA 2CJUH 4JRWA 3DVFA 3EUUA 3KD4A 5DQDL 5I2IB 5CGYC 2DBJA 3QIBD 1USQA 1PZ3A 5TE4L 1UADC 3CK0L 3JWDL 2IF7A 5EU4A 2XWJB 5B1CA 4XNQB 4Y1TA 3KPOB 5IT2L 2IG2H 2BSSA 5HVWA 3FQNB 4KNTA 1SOSA 4YHYC 4ZNEA 4JJOA 4RFNB 3UJIL 5IEKB 3PY9A 3B8YA 4BQ9A 4D9LH 3GBNL 1TR7A 2NY7H 1X5FA 4XCYA 2QHRH 1TO4A 4A04A 4OQ1A 1F1DA 3MNMA 5F7MC 3SOTA 5JOPD 3D48R 5B39G 4UQ3A 5T1MB 2IBGA 1F4YL 1A7PH 4MA7H 1Q9LA 1LP9B 5EZJB 1WFTA 3QUYC 1MZYA 1LO4H 1OANA 1IKNA 2C1OA 1ZT7B 1CD1B 1MIML 4JZOA 2B5IC 5ALBL 5DLMH 4OTXH 2PO6A 3OXSB 4PJEA 1A4KA 2H1PL 3MNVB 4NQDB 5F0JB 5HYJE 5L4MA 4K5NA 3IKKA 3HHSB 4U3XA 5FUZH 5IEHA 5EUOE 1BF2A 3FSAA 1FHNA 3P9LA 5K33A 2OSLA 4CN1A 3N91A 1IT9L 3GS7A 4LCCC 1XF3B 5HVGB 3TJEH 3ZGHA 3ZHNA 4DQAA 1XEDA 2PXYD 3NH7L 4PJ8B 2BRQA 3RPIA 3RVVD 2EDYA 2OXGA 2ICCA 3HFMH 3RWFA 3WE1A 1OLLA 4MNQD 5EORL 2VUOA 3ECBA 1ZV9A 4FXGC 1I7ZB 5DRZA 1ZPLA 4AW4A 3FNKA 2UZXA 3L1OL 1TPXB 3QG7H 5IVOA 4S1SH 3M45A 4M6NL 2WSKA 1CXHA 5MHSD 5KVFE 1NWOA 2GVYA 4M1DL 2R2EB 3FMGL 4KXAA 4C56E 1F97A 4F7CB 1KCWA 5I16B 3E1F1 3QIWA 2N0MA 1CQYA 1CXEA 1A7RH 4AZ8B 4P23C 1G7PA 4YDLC 5J7CC 3GMPB 4PRPB 4PS7A 4A66A 2O4EA 3QZLA 3IGAA 3BKCH 3FAXA 3US0A 1KEGL 1FNEB 2FSDA 3F6JA 4PRIB 4AEIL 3X1BA 2XQYG 3EH1A 4QHMB 4L4JA 1DZ0A 4O9HH 1AIFA 2BVTA 3BIKB 2ENYA 1KXTA 3BP6B 4ELMB 3JTSB 1I4FB 1HE7A 3DDGA 2CBOA 3D4CA 3UDWA 4JG0L 1YMME 2Q5BA 5I0WA 3VXSE 1SJXA 4FA7B 2E9IA 1P7HL 2X0UA 3IMTA 3SDXF 1G7HA 3GBLA 5HHMD 3IFOA 2YA2A 4R0LB 3H42H 4XP9H 2H0JA 3PP3K 1F4AA 4QOKD 4ABQA 5J6SA 3TYGL 1I8KA 1ORSB 1ZHBA 4X7EC 1Q9OB 3FT0A 1QW8A 4L5FH 4OCXH 5GZOD 3HCVA 1EAPB 4WI0B 4R4FH 2GTZA 3K72A 5EU3A 1NUFA 5HPMA 1KEML 4X7TB 1WHPA 5J06A 1NKRA 3GSOA 4NKDB 1PFOA 4G7RB 4TVSa 1RFDL 3FCBA 4FQJL 4UMSA 4B9GA 4M00A 3AWEA 2WLJA 1UZ6E 4QF1A 3RDTB 2XTSA 3CIAA 4PJ9C 3QQ4B 4IRSD 1QAWA 2ZUTA 3V2AR 3VI4E 1RJLB 4J3OD 1Y6NR 1RJZB 1MRCL 1RZ8A 1P4IH 1ZTXH 5T33H 1V8HA 1YDPB 3C8KB 1B6UA 3IWUA 2B39A 9CGTA 1BEYH 1S3KL 2VDOH 3PWPE 3QORB 3QPXL 3IU3B 4YK4B 2Q86B 3PG2A 3G9AB 2KS0A 1QWHA 4F7TA 4JZNA 1ZANL 5KSBF 3F85A 4Y16D 3N1FC 4ODTL 5T3XE 3H6JA 5B3SB 4GG6B 4DO4A 1WUZA 2OMWB 5B7MA 1G7MA 4J28A 4DZBA 5EDSA 3EYSL 3MV01 3ZE0E 1MI5D 1FUNA 1KIQA 3HC0A 1AOZA 3MLYH 1J5CA 4AL8C 3SDAA 3QDMD 3L3DB 4ZAKC 1DSYA 3H3BC 1GZPA 1BQ5A 4IRJC 5HI4D 4CC0A 1DHKA 2VN6A 1EDYA 3TT3L 2A74B 4R3SA 4OZIF 3IXAB 3FH8A 4C8XA 1KSRA 5HI3C 2IPTL 4DGIL 3CZNA 5D70L 3P4MA 3AABA 2F7RA 1UWGL 2LVEA 3OKNB 2ZUYA 3GHBH 1SOXA 2Z1PA 2XBZA 1MUJB 2QMJA 3RA7H 4ADJA 4GP8B 3APCA 3FO1B 5DJ8B 1NPJA 3D85B 4QGTA 1NGQL 1SMAA 4WWID 5FA4B 2BNQA 1IBGH 4JN1L 1TTGA 3EH2A 3MOBH 3OG6B 4O5LL 1AH1A 1ETB1 4KQ3H 3FRPB 3SZKC 4OGAC 4YHML 3I50H 3JVFC 3DVIA 5JPMA 3G08A 3VB9A 3ARBD 4WTXA 5E9AA 5JUEH 2APXA 3E8VA 2PCFA 4AYID 2WWMD 1DQIA 2Z8VC 5KSAD 5CCKL 2MQ0A 3HE6C 3BD5A 3FO0L 2H0PA 1J88A 1IGYB 1MFCH 1U8PA 2HT4D 3BGAA 3VXME 2GCYA 2VSCA 2ZKYA 1AG6A 4HJGB 1GYWA 2XV6B 2V2TB 3WFCH 2G4EA 4M6MH 4KI5F 3Q6FB 4U7KA 3N9GH 5HYJD 4NQSA 1AGDA 3GRWH 1Z1WA 1HDMA 4KQ4H 3R06A 5F1IA 4S1QH 4M56A 4ZMAT 2I60L 4H20H 1VEPA 2DL2A 1PZCA 1HOCB 5JHLA 2XACC 1ZGLP 1UOLA 1GPOH 2PPFA 3ES6A 3JYBA 2QLYA 4ADGA 3P4OB 4OFIA 5KYYB 1NC4D 1NL0H 4GIAA 3B7UX 3FTGB 2WLYA 3SEPA 4H88H 5DJCA 3ZGIA 5JW3H 1MLBB 3WIHA 3T77B 2IFGA 3W0WE 3SDCA 4DH2A 2J1KA 3KPQA 5DMGD 2C4FU 4M48L 3FONB 1USZA 4MS8C 4KNSA 2FT6A 4LPXA 1XEUA 4AQEB 4MXWH 4X0KA 2EE3A 5GHWL 3EGDA 3KLLA 3PV6B 1PD0A 2HG5A 5J13C 3VXQA 1FLRH 1OAKL 1VADB 3QI9A 5JHLL 3RTQA 2N7AA 2Q7NA 2Y7QB 5IHHA 1KZYA 4HIQA 1J10A 3EH4B 3O3EB 4HS3A 1IL1A 4OJEH 5E0QA 1BMGA 1YMMD 1J1XH 2RQ8A 5I0VA 1VFUA 1KBVA 3VXSD 4FD0A 2IQ9L 2QV2A 3WIHL 3BX7C 4YBQC 1ETZA 4QEGA 4DCQB 2AITA 1J11A 5HHPA 4P2QE 5A2IH 4NB7A 4A2FA 1EDQA 3QIBC 1K5NA 1AJ7L 1BAGA 1TVDA 5ISZE 2DPKA 1VB9A 2WNXA 5JO5B 5LQBL 3ECVA 4HT1L 3AFLA 5CD3B 3EBIA 5FLVA 4GFTB 2DH2A 4HUNB 1B0RA 1RP8A 3RJDA 5F7BA 2J7LA 5DUBA 4U49A 1FBIH 3UBXG 3QZNA 3DROA 3TWCL 1HHGB 5BZDB 1HTYA 4BDVB 1PS3A 5AAPA 3AU0A 5F7YC 1BG1A 2QPUA 4UM8A 2XN9B 3PE9A 4ZYKA 4MAYB 3U9UB 2VR8A 1LHZA 2XUWA 5FEBA 2XWCA 4PWGA 4JPVL 1D5RA 3H4FA 2VQTA 2AXGB 4MDJA 2CO7B 1SUHA 2XY1A 2A4CA 3EDEA 1AXSB 5EBLB 2EC9U 1F3DJ 3PWPD 5C09E 3OGCA 1KCBA 4JDTH 3QUZA 4YE0A 4AQ1B 2HT2C 4N8UA 2VQ1B 3FN0L 3EHBD 3K71A 1KOAA 4HD5A 2Y5QA 3D5OF 1G0DA 5T3XD 2A6KA 2FUQA 2ITDB 5GRVK 3B5TA 3APNA 4FMKA 3V4LA 1NJ9A 3DX6B 3ZMRA 4HDIA 2PXYC 3RVVC 4CGUB 3QR2A 1UD4A 5EEYA 4HEPA 4W4NA 4W9GC 1UB6B 3T2QA 1UA3A 4IBVA 4UV7L 4KQ0A 4F15C 5ICXA 2VQUA 3HLKA 2MCPL 3UPAA 2A77L 5IB1B 1GYUA 2PTTB 4OAWB 4AX3A 4IIQC 5E6IA 2FWOB 4CDHA 1D5MB 4RLDA 2LFEA 1Q94B 3N44F 3VVWA 1HSAA 4JFVA 3CZUB 4F8NA 1VACB 2PYFB 2FJFB 4U6VL 2AKRB 4RQQA 5IMKB 4ZMQA 2QFRA 2NUPB 1CICD 5L4IA 1RURH 2OJZH 5DUML 3KVPA 1QLFA 5TE7L 3HRZA 3TIDB 3IKCB 2X70B 4KAQH 3CLEL 1T7ZA 3GXMA 4FLRA 1F45A 2MNJB 3SBWC 1NCOA 4NCC2 3BSHA 5E8EB 2F1BA 3MRCB 3IS0X 3NRPA 3QIUC 2P45B 3FQXA 1AKJA 5A2FA 1TZIB 5L88H 4NRXA 4WTWA 1PZDA 1WLHA 1NCCL 5JHDE 4M1CD 4U1GC 4E2OA 1TTAA 4YUEL 5DHYB 4QRPB 3WD5H 5FDYA 3HHMA 4LFHD 1CXLA 1DUZA 4F20A 3VXMD 5GGQH 4OLWH 2YSSA 5I1CH 2OULB 2VXQA 2BVPB 2E47A 1EK3A 1AO7A 3N40P 4N22A 4KNUA 3IFLH 2I5YH 1WD9A 3O45A 4U1SB 5HJ3A 3ZK0A 3ZR6A 2FT8A 4UTBA 3U6RA 1SHMA 3DX9A 3V5HA 4AENA 4ZFQA 3SE9H 1BVLA 4PLNC 3BSZH 4MCYB 3DHUA 4ODUA 4IRSC 3GI8H 5DZVA 5C0ND 3SGKA 4DKFL 4R90L 5KSUA 4JFWA 1HEZA 1DLHB 3CIQA 2NDGA 5I0XA 4RMQA 5DA4A 4LVOC 2XXGA 1RZKH 3B2UD 5GSRA 4FFVD 5F7EL 4BZ1H 3W39B 2LTQC 4LVNC 2WKOF 3IJHA 3AS1A 4XMVA 1U93A 2VLME 1X9RA 3W0WD 3GSQB 3FQUA 5IOPB 2VXQL 1QSEB 2VDQH 3KPMB 3P3RA 4G8EB 3VSUA 3GHEL 2BCKA 1T83A 2OTUB 3KYKH 4UTBL 1IFHL 2VAAA 4Y16C 1NIBA 1BF5A 1ERNA 3BGMA 3P69A 4PI0A 2GJ6A 5FHAH 3KS0J 1JPFB 2A83B 4OD2A 2XVGA 5GGSY 5CBAA 3F7YB 4NO0B 4XVSL 1LMIA 3MLVH 2WIMA 2OYLA 1DSFL 3CXHK 3WL9B 3VMOA 2LQRA 1OTUD 4WWKB 2CO6A 2X87A 5L7XL 1AGFA 1J1PH 1UD3A 4MNGE 2BY1A 1LP9E 4GSUA 5CGMA 1WEJH 3LDBB 5HI4C 4P2QD 3GO1H 2NX5B 1RIUH 5I23A 2VLKB 2EE6A 2PF6A 5HD8D 2VIRA 5DF0A 2F8IA 1OEZW 1IGFL 3K4DA 5ISZD 2ORBL 5CIPH 5HYEA 4ODHL 3HG4A 5E2UL 3V6ZB 1AQ8A 4NQDE 3ZZSA 2GJJA 2F8OA 4U6XA 3BSGA 4XZUA 4DKDC 3S36L 3H4HA 1YNTF 2FJSA 5ILTH 2VXSL 4YHKH 4AQ8C 3CFBA 2EEBA 5I82A 4EI0A 4K8RD 4MA8H 4JK0D 1IILE 1Z9SB 4KRLB 4DP5X 1HKLL 2VTFA 4HMEA 2QQQA 2CALA 2OX5B 5GRXG 4D3CL 3MNWB 4KHXH 1UM4L 2FLMA 2ZAHA 3ET9F 3TBWB 4HIHB 3UC2A 2DDQL 3WY3A 3HI1B 5B7EA 3S5LG 1BQRA 3WJMA 1IFGA 2WWMC 3RVWD 3QR1A 3QCVH 4ZDHA 1WWCA 1IM9B 3AAZB 1QR1B 1CYWA 5FB8A 3DGGA 4NSKB 3VXPA 5JW5A 5C09D 3SYQA 3TL5A 4PRPE 5FK9A 3QQ3A 4NBXB 3KWTA 3RL1B 3VFVA 2VDRL 4TNVF 4EN3D 4WHCA 1JOIA 1WUNT 3PUUA 1NAKH 1DBMH 1EEUA 1LWJA 4NDMB 4NHCH 1R75A 2FBRA 3CZJA 4GXVH 4XPTL 1KGCE 1UJ3C 4OBSA 3U4KA 3PCYA 3HC3L 4X5WA 3VTMA 3L3GB 4PY8I 2OMXB 3GYRA 2BIMA 1U8MA 3D07A 4M93B 4X6CB 4F33A 1PZUB 4MHHG 5LO7A 1XT5A 1Y6KR 2Y7NA 3LXBA 4HAKA 3MQIA 3OKDA 4HV8B 1G9ML 4TQEL 3EOBB 1PZBA 1U33A 4Z8FH 4OKVB 3LRSA 3MLUL 4QT5A 4FQIH 2I9LA 3L5JA 4JDVA 1BD2A 3GZOA 4FTDA 1RZIB 3V4UH 1OGAB 5I6OA 1U8NB 3ETTA 1LE9A 5ESAA 1J0JA 2ROXA 2W80C 4LZKA 4PGBA 5CINL 4BSWB 1R34A 2HKAA 4HH9B 4NZUL 1OXYA 2K3HA 2V5YA 3PWJB 4J3TA 2X09A 2XXFA 2JCCA 3LEYL 4M5SA 1N0XH 4G8GA 4GSXA 4ZS7L 3TBSB 4ZMXA 1A1MB 2YAFA 3B9KB 5H94A 4BSVA 5D93B 4N0CD 2PR4L 2BSSB 1DQQA 2CKNA 4S1RH 3C8HA 3UP1A 2WBJA 3UZVA 1R3JB 4RIRB 3AREA 1EZVY 1XX9C 3BQUD 3GMRB 4FI6A 4I3SH 4NPKA 5I1GL 4XWOD 1DBJL 2M83A 1J7VR 2BK8A 4HWUA 1FZKA 4IBWA 4FFZA 2HWZL 2J4WH 3QK0A 2Y2YA 4C4KT 5I6MA 2CPCA 1FV1A 2HJKB 1MJUL 3WFHA 4EI5B 3DURA 4RRPM 2NNCA 5EN3A 3EJYD 1XTMA 3S3BB 4LLUB 4GKSA 1T4WA 2GIMA 4XBPA 4QRTA 1W8EA 3QHZL 4IQHA 3PHOB 5TPWH 3MV9E 5C3TA 1YJDH 3H9SA 1EH9A 2X4PA 5KVGH 3K2UL 1W72B 2RAMA 1RHHB 3WNIA 2VXUL 2WB7A 1BW8A 1KIPA 2YAMA 2VLMD 4UT6H 5IWLA 2X6AA 3V5KA 3WJJC 2OSLB 1NLBL 4FFZL 4UUJA 1R5IB 3EHBC 4M7LT 4PGCA 4P46D 4AVHA 4X9GA 1KXQE 4B9YA 1RZFL 3OC8A 4HFWB 4EKXA 5CEXA 1T7VA 2VAJA 4NS0A 1MLCB 2NY6D 3BRGC 4Y19B 2DMGA 4LCIH 4G43A 5TK2A 2IDUA 1R17A 3EBAA 4E5XG 3UABA 4OJFL 4Q14A 2EO9A 4KH2A 2HA1A 2ZWNA 5F3FA 1A8JH 3P1VA 4ZFOA 3EJRA 2ZF8A 1KJVB 3QA3B 3IGAB 1QPKA 4P3WA 5IJKC 3EYOA 4LVEA 3WY4A 1Q72H 4PG9A 2ZNXA 3DXAB 1JPSH 3B37A 1GS6X 2XKNA 3JSSA 4LEBA 4NENA 4U05A 4WRLA 1CICC 4NQDD 1BVOA 3EYVB 4JFQA 1F1AA 3ULUE 2AXFA 4QKXB 1AZCA 4WEUD 3H53A 5LGHH 4E0RA 1BXXA 4FFTA 5HGBB 5A1AA 3HEIB 1XDTT 1KJ2A 3R19A 4PPTA 3V8OA 4HIJB 4EQ2A 2J8UF 4BK8A 2DQIL 4JM4H 3GBEA 1FG2A 2P80A 5ECGA 2WKLA 3M46A 2QPFA 2UVEA 4X8JB 3TVMB 1S9VA 2NR6D 2CNYA 2ZP9A 1EXGA 1KB3A 3BGFB 4P5KA 4ZFOL 2NY0D 3QWRA 2GTZB 3BZ5A 1EHXA 5DJAA 1VZGA 4FFWD 5AW9B 1LO5A 4M1CC 2HJFB 2XXMB 4G7VL 2ZPKH 5IQ9B 5GGSA 4FGMA 1RULH 3D9AL 2NXYB 1M7IB 2X4SB 1O6SA 5TH2A 1QUNB 3N42F 2XKSA 2DD8L 5I6NA 2NCMA 3MPCA 3SDYL 5DDHB 4PRPD 5FYJH 1ZLVK 4YLCA 3VFNA 2JQZA 1YEGL 3KW7A 1NUNB 5KVEH 2ZP0T 1ZD6A 3QZWA 1KJ2L 1PLBA 1VPOH 5AAWA 1WAPA 4KX9A 4PBDA 1H5BA 4FNLL 1KGCD 4NZ8A 5FYKL 3VH8B 1XD0A 5BVJB 4L8BA 2BOBB 3QJHA 3TM6A 3NJXA 5C0NC 4QNPE 5I0DA 1MW3A 1CFVL 4LSRH 1SFHA 1RVFH 4UAOB 4PD4K 4FFVC 4J4PD 4UIKL 1U3HD 2A9CA 4IDJL 5EOTA 4YHLH 1QSFB 4JY5H 2BW4A 3D0VB 2R0ZL 2Z1KA 3CQFA 4JPWL 1E67A 1P5VA 3MCKA 1K85A 5DEFB 2YGOA 4NN6B 3HZ3A 4LSQH 2Q76A 4NI3A 1K4DA 2DTMH 2ZUWA 4PCSA 4L9LA 4WEMB 4XE0A 4YDVB 2HRGA 4PJGA 2G5RA 4YO0A 2DWXA 1NCGA 4ZOEA 3QPQD 4MGXA 3UAJA 2HX7A 5C07A 2JKJA 4FULA 1FE8H 3VRLF 1RQ5A 4MMZA 5ETUB 4FFYA 2D2CC 3M17A 2XC8A 2AJZB 3BP4B 1PKQB 3MREA 2XN9E 3B5HA 1T7YA 2QQNL 1GW0A 1JZ8A 3P30H 3RUGB 5JIMA 3SO5A 3ME0A 4DZ8A 4HALA 1UB5B 2NW3B 3CHRA 3QJOA 2Z0BA 1HN1A 2AJUH 4K94L 4N8CL 5HD8C 3O2VL 2FJHB 3GSNA 4HMCA 5IFHL 5IGXL 1RUAL 1UD2A 2R56L 3PU7A 2AABH 3T04D 4DOHE 4CVZB 2Z7ZA 3K5RA 4XNYL 1A2YB 4AEHL 4FFYL 4OCSL 3MKKA 3OMNB 5FIEA 4P5TD 1LVEA 1JGIA 5A6LA 5JPMB 5C0IA 2CSPA 2HRPL 4YXHL 1P2CA 1DQJA 3QXTA 1AE6H 1UT2A 1U8LA 4JFOA 5AW7B 3E0GA 1MCOH 2JNZA 4MZ3A 4N2EA 3QDHA 3CG8A 2Y06L 4JL1A 4F8QA 3LJ3A 5E24E 5CJQH 4UYPA 1FCCA 2G0LA 2XWTA 1E8XA 2VABA 4X4XB 1XH3B 3GSNL 3R4DA 4DKEH 1E4KC 3F12B 4I2XB 5JXEA 1NLDH 3QH3A 4WEBH 4HAGA 1JZ5A 5MEPA 1PCSA 3T3PF 2E7DA 2CO2A 1B4LA 2VDKL 1XHHA 1CE1L 1YEEL 2IANB 4GYBA 4R7NB 1KTLB 4ZUUB 2CDEB 4YHZH 4EN3C 3V0WL 3WU1A 3S35L 2FUTA 4NO3B 2KZBA 3L08A 3EFDH 5EC2B 1JV2A 4AJWA 4O58H 3CZEA 3NP3A 1SHWA 2VN7A 2ZSVB 4O2EA 4ZSOA 4OI9A 3T3ME 3D85D 1CURA 3Q06A 3O81A 1VFAA 1JWUA 4K71B 4N2GA 2CUMA 3S34H 4OGYH 1TDQA 5CZXC 4ABUA 5I75B 1Q4NX 1OSZA 1SQ2N 5BQ7A 5D4JA 1HJCA 3LS4L 1U8HA 4R8WH 4HJ0D 1YEIL 4J8RB 5F7NC 3FOMB 1N6QH 3HZMB 4M7JH 1A7NH 4JQXA 2HG5B 4JFPA 1KB5B 1C5BH 1KTRL 3OG4B 3KPLA 1JZJA 1QFWM 2FHCA 1U91B 3VA6A 1IL1B 5I18H 5EU7E 4Z3EA 1OARL 2Z35A 4QHNB 5ABAA 3RVUD 3ULUD 1I7TB 3RWHA 1L7TH 3VM7A 3BAWA 4K9EH 3SKOB 2B3RA 3IJ8A 2A9DA 4QI3A 4HC1H 1MCHA 4XCNB 4KZEL 3POCA 2GI7A 1KTDB 5TF1H 4M7ZB 1K5NB 3WS3A 4NO2B 2AXJA 1V5JA 3Q44A 1ZGLM 4Y88A 3D05A 1PKOA 4QGYA 1A6TB 3S88H 1WWAX 1XGQA 4V1DE 2ZNWA 1DBAL 4N0CC 4QYOA 2D7TL 2V17L 3VFWA 1ZLWK 1P7KB 1FO0B 1ES0B 2ZX6A 4H1LG 4HHAA 4JQIH 3ZKMD 4HVBA 4CADB 5ES4B 4A6YA 1J05B 1JMXA 4G8FB 1NOFA 1I3VA 3GM0A 4FX5A 5DGQA 3MI6A 1U8IB 4U1IA 3DO7B 3MRJA 2BHFA 1FVDB 1HHHA 2CRYA 2DIEA 1VZHA 3BWAB 3LZPA 5C1MB 1QA9A 4MB1A 1LE5A 4N4YB 2XTLA 1JFHA 2CMRH 4N68A 2D9QB 5M94B 4N2OA 4JFZL 4G6MH 2WPGA 4PV1C 4M5ZH 3ZE2F 5HHOE 3NFSH 1H8SA 3H9HB 3A6BH 4MXVF 1TXKA 1EZSA 2NX5E 2FVNA 3QO0B 4A6YL 4O51B 1WZMA 3RRQA 2A6KB 4CSZA 3DSNA 2EJ1A 3WNMA 2AEPH 5E9DA 4OCWL 3I9AA 4OSUL 1EVTC 3PWVA 2FECI 2FNBA 4GUCA 3S96A 3BAEL 1YEHH 1I9EA 4IIZA 4RFNC 2G9KA 4LCVA 3X3GL 5TDOA 4GUPB 4Q9CA 5HYSA 2VLLB 4Q0XL 3II3A 1KULA 4RFEA 2M1KA 5ICXB 2R0LL 2OTPA 2DQHH 1I1FA 1E0OB 5CKGA 5KVDH 4PLOB 2ISDA 3PWUB 4J6IA 1ZXKA 5AOJA 2GHZA 2NY4B 4N6QA 5C0CB 3RZWA 1TYRA 1AD0A 5CM1A 1HSAB 2HLAA 2XN9D 3QUMB 1OGPA 3F58L 4GO8A 4MAYD 3QB7C 2P7TB 1YY9D 3IJSA 2C3VA 4PEEA 4YDKL 1KCRL 3P2TA 5EFIB 5C6TL 3WNLA 2OR9L 5E56A 4QXUL 3ZDZE 2WM0A 4R4BA 4N0RA 3HRZB 3PABB 3ARGB 1MHEB 1OAXL 2IH3A 2NZ9D 3CDGB 3RNKA 5GRJL 1JMZA 3C6SB 3HC2A 3WJLA 4P57A 2RALA 4HKXA 3TTYA 4X6DB 4WKZA 1WC7A 2V0AA 5EB9A 4Q6IB 4GQZA 1OAUL 2ED6A 2CIKA 1ZHLA 3CVHA 1AZNA 3FQXB 5D2LE 3DYPA 4PJHB 4ZODA 4OZFB 3SE8L 3HS0B 5A6IA 2FE0A 1HT6A 1E4WL 2GJPA 1FJ1B 3D6GA 1DBBH 3S37L 3IDGB 3H7LA 1OAZL 3GGWB 4X6CE 2PUQT 3ZYZA 1R3IL 2QGDA 1TPXC 4EUPH 3FTYA 1D2PA 3PP3H 2FB4H 2X6VA 1FYTA 4DEUA 3BPOB 1EHLL 5EBWA 5GRWA 1FAKT 3LKPA 3WSQH 2J88H 1E5YA 3FQTA 3FF8A 3BDBA 3OQ3B 1BVLB 3PDOA 3GPEA 3VFMB 2XIBA 1GGCL 3MZTA 2MHAB 4NNYA 2KC0A 5E6YA 5ACZB 1UQSB 4H40A 1L9MA 1OGAE 3CVHL 4Z95H 1DN0A 3EO1A 3IDIA 3U1SL 5E8OB 1J9RA 4OCRL 3V9CA 1AZUA 5GZNA 2OJEB 4RSYA 4C4BA 5JXAH 1TQBB 1HXMB 3M88A 5B39A 1JF1B 1F90H 2BS9A 3QE5A 3LTVA 3T9WA 3WNPA 4GRWB 5GGTA 5DS8A 5AVZB 2E6PA 1TLMA 5DVLA 3QP3A 2FIKB 5DJ6B 4LGRB 2IV8A 3W2DL 5ENWA 2QADD 3C08L 1G9NC 4WU7B 3MGAA 2H32H 2JKLA 4OD2B 4MFHA 5FHBH 1PZ5B 4P2OA 3RWEB 3G9VA 2XJKA 3B6SB 5CBAB 2RCSH 4LESA 5LXVA 2UYLB 2QSCH 1KJ3H 3TH4T 3MRQA 1RKRA 3QPQC 3KPRA 2F74B 3PXLA 4D0BA 3SQOL 3Q48A 1L0PA 1OCWL 1R0AL 3JZ7A 4DP1X 5GGUA 1G7JA 3PJSB 4FQXB 1JGDA 4G9FA 2D3LA 5GGTL 3T4AA 4A2DA 4KTDL 3H7BB 4QLWA 3Q7JA 4HOZA 2JJUA 1DR9A 4PJEE 1H3TA 2RGSA 3JWOH 1IEHA 4LAQL 4V1DD 1UKTA 3DX2A 4BZ2A 4HFUH 4K3JH 4XZUB 2ZWSA 5C8JA 1BPLB 1NUDA 1NFDA 2QV4A 4FLOA 2R0KH 4NFBA 3CFBB 3E8UL 1QLRB 1JGLH 2BINA 2NY2B 4MAUH 3BKML 4NIKB 4Q4IA 1TZGH 4Z0XB 1PLGL 1GHFH 2A9BA 2OYPA 3VG0L 5CLYA 2XQYA 1CL7L 2PYEB 4FHKA 4H7VA 1XB6A 3AS3A 4P5TC 1KF9B 2J21A 4ORGA 3MCG1 1JXKA 2AJVH 1S7WA 1I8LC 4LKCB 3NIFB 2WOBA 1MFMA 3DV6B 3FYEB 1VKXB 2EUXA 4Z3HA 2BP8A 5EBGA 1SXNA 7CGTA 4M62H 4EDXB 5CP3H 3MUUA 4PUBH 3ZTCC 4UAHA 4BZ2L 2CGYA 2F53A 4HBCH 5KYNA 4PMFA 5HHOD 1DJXA 3E38A 3EBHA 4K9JA 3CFKA 3EG9B 3QQ3B 3T4YB 3I2CH 1J18A 3ZO0A 1BECA 2NX5D 1QLEL 1C5DA 4PB0L 2JIXA 4PRAA 4KOBA 1W8NA 1A3QA 4J5VA 3GKZA 2ALAA 1I1AD 2R39A 1T0MB 1SYVB 3L3KA 4G3YL 4BK4A 3T6WA 2QDWA 1KLFA 5BZWB 1ECZA 4LHJB 4HF5H 1KG0B 1U8MB 4HQQH 4NXSA 1Q0XH 3AT8A 2UX6A 2DQUH 2YD6A 3CLFH 3DUSA 4YHNB 1EDHA 3I6GA 3OKDB 3FQWB 2H26B 4JGJA 3JUZA 4OF6A 4OZGF 3SKNA 1MHPH 2OCJA 3S8FB 1QFWI 1ZHKA 2VOTA 3LRSB 5KYUB 5AW2B 4K3EL 1MNUH 1MIEH 1PJ9A 3DTXB 3K74B 2X0VA 1P6FA 4G42A 4HJ0C 4XPBH 4P59H 1BD2B 2FQGA 2O5ZL 3CC1A 3GKWH 3LB6D 3MV11 3U46A 3UTOA 1MCQA 4I0PA 4YVUA 2WZ0A 4XP6L 5LG1A 3W11D 3PJLA 5C0GB 2Q6WB 3U7WH 5E4EB 4M5TA 1AIZA 3KYAA 2JCCB 3ULUC 4HGKC 3RVUC 2Q8BL 1CK0L 3O3DA 4AVKA 5C0RH 2HUHA 2J1ZA 4PJIF 5GS0L 3WKYA 5I8OL 4OZIA 3C5SA 4JM2D 5H94B 3EGXA 2OL3H 1UENA 4RAUA 2WOYA 3FQYA 1ZE3C 2MKWA 4AGQA 1GMEA 1OP9A 2ATPA 4AKQA 3VXTB 2WZ6A 1G7LA 2N1KA 2IALA 3D87B 1BFTA 1AHMA 3OB8A 4UDUB 1Z66A 2E7BA 4O4YH 4LRIA 4K5MA 2MWCA 4OQTA 3FQ4A 3RU8H 2WWNA 3QQXA 3PL6B 3CSPA 4Y9FA 3CMGA 4XN8A 5FYLH 4UQBA 5CZVH 2HPOA 4MDIA 3WFHB 4G59C 3FB7B 1ET7A 2WLIA 2EIZB 3HNSL 4HZLA 1IO4C 3NYKA 4Q2ZA 2EYSA 1JWSB 1OGAD 4QHLB 5ID0B 1ZCRA 2HFFB 1MJ7L 3RZCB 3V4PH 1CU4L 2F9BT 4ZPVB 3QCTH 3VQMA 4JPKL 4UOZA 3BLPX 3PWNB 5KJ7E 4KH9A 2ADYA 4H5SA 3DX4A 4UOW1 5TQ0H 5HHQB 1UWYA 3SD2A 4OQTL 3Q3GA 2FX7H 3SKMA 4KZDL 3STZA 3T2NL 2VM4A 4LBEB 1YQVH 4I5BB 4OBRA 3MOAH 3RUGE 3ZJAA 1MNNA 4ZUTB 1XCXA 4LMQE 4X50A 3V6BR 3ILPB 1KCUH 1DSWA 2IH1A 2CQVA 5LGJB 3AGVA 4KY1H 1UKQA 4ODBD 4RMSA 3NCYP 4JDEA 4F5CA 3FUHA 2W9DL 2PW2A 2CR0A 2WXFA 3ZKQD 2BNQE 4ZXBA 3CZGA 4PWIA 1A6UL 3WLWD 2FEJA 3RTLA 4DUWA 5CEZH 4MDRA 5SX5K 3B1TA 5F3HA 5CJXC 4JFFB 5DD3L 3BO8A 3BP5B 4XAWL 4LEOA 1YYML 4KV5F 1BBJA 4F7MA 4GKOA 2ZJSL 3VO0A 5B1KA 2J56A 1KBKA 4YJZL 5T1DL 5J5EA 1SN2A 4Z7UF 1AGBA 2O6PA 2XQBH 4MAYC 4PV8A 1FIGL 2PO6D 4JANA 2YBGA 5I6XB 4YHPB 1YY9C 1LTXA 1GTFA 4YSDA 1AZVA 1IKFH 4BD4A 4EZLA 1ZOXA 2Y36L 3K4AA 2VC2B 3L9YA 1A9BA 4EOWL 4G2AA 3DPBA 2MJWA 3GXDA 2OYMA 5K39B 4YSOA 2K7PA 4APQA 2NZ9C 1OAJA 1FF5A 2ZQKA 2DYPA 5DWUH 2L7UA 1CF1A 5B1JA 3O6FA 1QFWH 3HHRB 4HWBA 3SBQA 4H8PA 2DLFH 2VERA 3IPFA 4A63A 2FO1A 3OJDA 5AWNL 2AVGA 4ONOA 4Y19D 4YS4A 5AW4B 4RMTA 1KFAH 3G5ZB 3U4BL 3RWCA 3PWLA 5GGSB 4Z7NF 4FQCH 2HVKA 5F9WB 4Y4KB 2EIMB 3HIZA 5E1HB 1N4XL 2EVIA 3MBWA 1H6TA 3F5WA 3QIWD 5G55A 3G6JA 5C70A 1GGIL 1H15B 4RA0C 5KZCB 4ALAH 4UQCA 2XN0A 1KDJA 3QFDA 4OLZH 4M8QA 4HWBL 4IBUA 2AQ3A 5E7BA 5SV3A 3U36B 5IW3A 1N7MH 3VFSB 3JV6A 1KCSH 2DQMA 2FH8A 5BS0A 3OGOE 3CDZB 1T5WA 3BD4A 2ZG3A 2ZAIA 3H3PL 3UBXA 1GRWA 2VLRB 5E2WL 3FCGA 1GW6A 2X2JA 1F2QA 1SEQH 4QRFA 7FABL 1F6FB 1IBFA 1ZVSB 1T66C 1SDDB 1IJ9A 4LQFL 2AGJL 3X14B 1WZLA 43CAB 3V4VA 3CSYA 2CU9A 2DQEL 4XMUA 3RKPA 2A6JB 5LBGA 2V4LA 4DGYH 5C86A 4XP1H 2Q76B 4PJXF 3CPUA 1S5IL 4PYHA 1K4DB 5B7FA 2QADC 3KCWA 3ELAT 1K3ZA 1I1YA 3AW5A 3EYQC 3GBMH 3ROLB 4A7SA 1T1ZA 4WNJA 2WQXA 1E3XA 5A16B 2W81C 4Y4FA 3V6OA 2BVQB 4TQPA 5D1ZA 5EO0A 4RFOL 2P9RA 3NSYA 5DJ0B 3DIFA 5E8NA 4ZUVB 1RIHL 2IBZX 5EU7C 1LO2L 5JNYB 4PP2A 4OI8A 3NCMA 1G6RH 3P4NB 3WTWA 4ENED 1MSPA 2XA8L 4XCCL 3V4VL 4DP4X 1ZA3B 3C09B 2R4SH 5L9DH 4LKXA 1ZWIA 3CFJB 3QGVA 1R3KB 2DQTH 2MOGA 3SY0B 2BXYA 1CUOA 3U2SB 3T2PA 4B0MM 2YUVA 3CN2A 4UOW0 3LPWA 2OZ4H 3BZEB 1EO8L 4JY6A 4E68A 1WICA 5ESVB 3TP4A 4DF9A 2V2WB 2GC7C 1CFTA 1DQJB 5HDWA 4EZJA 2QQLL 1KJMB 1HK6A 3MBEA 4KMLB 3ETBF 2E6JA 4N1CA 2AAAA 1QWUA 1OO2A 2ATKB 5I1IH 3EXLA 4IW4C 4AXWA 4H0GA 3SDAD 3HG5A 3AS2A 1YRKA 3J07A 3OF6A 5FO2A 2NSMA 3ZYOA 4NIYE 3HOGA 1A7OH 4WWKC 2HXAA 5HHNB 3U2JA 3VFGH 4HPYL 4F8LA 1XGRB 4TTGA 2PWGA 5MEPB 5CWSB 3QRGH 3KCPA 1AY1H 1T22B 1C08A 5FO8A 1DJZA 1H9DA 4GUQA 4BRJA 3TYFA 3BPNB 5C7ZA 3LDBC 4FOMA 2OS7A 5BRZA 3WCYA 1BAWA 2Q8AL 1NBVH 3G04A 3L4WA 3BLKA 1DBKH 1B4RA 3FOLA 1I1AC 4O2EB 2D0HA 3K0YA 4XB3A 1XMEB 4G83A 4WCYH 1YMHB 3B9VA 4BK5A 2ED9A 1ETA1 3QCUL 2BNQD 2JQMA 2V6HA 3GSUB 3MMEB 3VWJB 3U6XA 1WBZB 2AHIA 1O5PA 3UC0H 1KYOJ 1MCPH 3CFCH 5A3ID 3GRBA 2H47C 1DVFB 4U1NA 5D72L 4K3GA 3ZT6A 1NBCA 5F9OH 1LO0L 1EZLA 4EI6B 3LH8A 2V9TA 3ZPDA 3N1PC 4JFPB 4PS4H 1FRGL 3QHFH 3U7AA 3V9EA 5IVZA 1AGCA 3FCUB 5DJZA 4DUXA 3UBFA 5FOBA 1REIA 5DD6A 1EHAA 2NUTA 3LB6C 1X5KA 2AK1H 2IDCA 3QRBA 3WFBH 4K07A 3RLSA 3C6LB 3UH8A 3W11C 3RFZA 2O61A 1KBGH 2PMZA 3NZHL 1T4KA 1LJMA 2Y23A 3NRFA 4BRVA 1HYRC 3SOBH 1N70A 2Y3NA 1MH5B 3H2PA 4NERA 4JM2C 3CH1A 3FPYA 2AEQH 4PGDA 1BHGA 1H3PL 1P0SE 1KYAA 2F19H 3P0VL 3FFDB 4GAGH 1E27A 3AG2B 1TETH 4ZQKA 2HH0H 3SDCD 2CH8A 2IO5A 3TXAA 4F7EB 4W81A 4M93C 4BH7B 1LGVA 3NQIA 5F7HA 4GAJH 4A6YB 1IC5H 1O7SA 1PNCA 3GDBA 3HRPA 4WW2C 3IFPA 2VDPL 3JWDC 3NJHA 3C75A 1I9RH 1F6LL 4I48A 4ACPA 4U1IB 3FCSA 4ZUWA 4P48A 2GJ6E 3MRJB 4PRHA 3O8XB 5IBUG 4XMLH 3BVNB 2WSPA 4HSCX 4YXLL 4LAJH 3QI9D 4M5YL 3UO1L 4AT6B 4AJ0A 2N7BA 5F2FA 2UZIH 1KB9J 3CVCA 3ORJA 3O0LA 5D4IA 2WNWA 3MJ9A 3ZHDA 2MPVA 1BQHG 3LRLA 3LKSA 1EQWA 4LPWA 2WVVB 4YH6A 4CMMB 1SXAA 1X5ZA 1RU9L 1KGXA 4Z0BL 4X99A 3S5LA 1AKPA 3UL4A 1TIUA 3RIAK 5IB5A 5E9DB 1IRAY 3B9KC 3IFNH 4HU2A 4W6XB 1ZLUK 3B2PA 3Q2CA 4H8WL 4N28A 1B2YA 2R69H 4WWNA 5D93C 4PM1A 4RESB 3T09A 4Z3JA 2KUTA 4CNIA 1CD0A 1DVQA 1JV5B 3TO2A 2WO3B 5F96H 5TDOB 3I3DA 1F11A 4P5MA 3HMWH 4UZGA 3RY6A 1A6ZA 3L95A 1I1FB 2XHNA 3MJ9L 1YN7B 5MENA 3WLWC 3M8OH 3FB6A 4MJHA 5T1LB 1AD0B 1Z5LB 5CO1A 1T20B 1JK9A 4JEGB 3I9GL 3D39B 1QTPA 1K4CB 1NBZA 2BCMA 3NIFE 3PV7A 5MP6L 3IJSB 2BSEA 1TQCC 1OK0A 4BH8A 2ZXAA 4XMWA 4JCLA 3PFUA 2DBLL 4H2CA 4P4RB 4AM0Q 2AQQA 5BOJA 4N85A 5IW6A 5DQ9B 2VE6A 1N0LA 3IWVA 3TBYA 1D7FA 4P57B 5IB4B 5KW9H 2AV7B 2WZPD 2ITFA 1ND0B 4HJEA 5HSFA 4NGHH 5INCA 1ZHLB 2NLJA 1B0GB 5ALCL 4KJYB 3UTSA 4JPQA 1H3GA 2WXPA 2Z92A 3IMWA 1C12A 1GC1L 2FX9L 4BHUI 3PXJA 3VXUB 3GI9H 4WF7A 2X4OA 2COVD 1V27A 3LKQA 2JB6B 5E6ID 5E8DL 2YPVH 3GSWB 2DQDH 1OKEA 3ZDYE 1F18A 2AEOA 5A2AA 3HB3D 5AYUH 3QIWC 3ZHFA 1FGVL 2WVUA 1JSYA 2WN2A 3DX8B 5B38G 4EVNA 2IAMA 4HWZB 5F0MB 4WFEE 2OW7A 3O3AA 4NNYB 2E27L 4Y7MA 1BD2E 3ARPA 4YGAB 5KJ4A 3GIVB 4Z7UB 1DN0B 4HUXA 4B96A 2DKSA 4PGZA 1OD7A 2ZYHA 3M1BB 1ZLVH 4XO4A 2JCCE 2P5EA 3QWQB 2WQ8A 2WYIA 2B0SH 1CI5A 3BN9C 3ZTNL 4PTTA 4HG4K 3Q6GH 4LLMB 5FPIA 3KDMA 4I0KA 3DSFL 3KBFA 4Y5XB 5KBMA 4Z7OB 3K2KA 3O6MH 2WW8A 1AKJD 2CKBA 1RJYB 4PRDB 2OLDA 2ZWLT 1ZHNB 3WE6B 2CLRB 1PCXA 1TFPA 3BGFC 1NMCB 2EDDA 3ZTDC 3ZBMA 3GMQB 1MFDH 3W9EB 1L9NA 1IAIL 1CFMA 2WTPA 3DC0A 3GIZL 1CLVA 2NXYC 4X7FC 2Q2EB 1AXTL 3WBDA 2GSIA 4EXKA 4AH2A 3QDGA 3KNBB 2OTWA 5BV7L 5GGUB 3TBCA 1VSCA 1B2WH 2HT3D 3FU0A 4L8SB 3IGLA 2NZIA 3M1CA 3UXFA 2VXTH 5FCUH 2DN7A 5EZPA 2YAEA 4P3DA 4QCIA 2C1PB 2WD0A 1VEMA 2CKBL 1K5WA 2RH0A 1KPUA 4ENEC 1H8LA 1C1EH 4LLDB 3OLDA 4E5XA 3H9SE 5KN5A 2PWEA 2DJMA 2JTYA 2Y69B 3X3FL 5E00A 3LNEA 1QD0A 1PYWA 4N8PA 5IIEA 1IGTA 2HTLD 4NQVA 3ZR5A 1QHPA 1FC1A 4UAOC 1TO5A 3K8LA 4HPHA 1PSKL 1S7UB 2QT6A 2YD4A 3MRDA 1EMTL 3NFPB 3NABL 3S5YA 4RGNE 4GNKB 4LLQA 1WQVT 4L29B 2J8UA 4NN6C 2GJ6D 4GW4A 4G6JH 1TQWA 3ZZ1A 4JAMA 4MA3A 3LKNB 4NKIL 3ASWA 5FFOA 3GNML 2KQNA 2R0WL 4LCUA 4KTEL 4BFKA 4MQ7B 3GSVA 2Y4SA 3MJWA 3OKKA 4JFEA 4KFMA 3MO1A 4XMXA 1NCAH 5DEGA 3F7KA 1NIFA 2GIYA 5D5MF 1W8OA 5CHNA 5KUMA 3CFKB 4TVUA 5D9SB 2C5DC 3V9FA 5ANHA 2YD7A 4WDIA 3CFDA 2BY3A 2WQSA 3WKML 1KGIA 2DMCA 2VDMH 1P1VA 2B4CL 1NFKA 3WAJA 4X4YA 1S9XB 4ONHA 3UBGA 1XR8A 4GKNB 2WLMA 1EFXB 4KXCA 5DYOB 5LHDA 2JCWA 3IDNB 4R7LA 4BA0A 1QVOA 2R4RL 5F7DB 2NY2D 4D9QE 2X7LB 3ALPA 1OCOB 4X4ME 5GIRA 3B7YA 1GIGL 1CDHA 2CPUA 5HP5A 3I6GB 2XPGA 3KL5A 5FYKE 4H26A 4FJ6A 1EJ6A 3BUYB 5A3IC 5JPMC 1FZOB 4XOCA 1NC2A 2XG5A 1XGUB 3UO8B 4Y5YB 2I9TB 1CGSH 2APWA 1HNYA 1T0OA 4G42B 3MROA 4R96A 1JZHA 2BO0A 4XXDA 3T0VA 2OKMA 2EE0A 3AXHA 3EOTH 2HJLA 2WCPA 3DX7B 4GRLA 4PIBA 3AUWB 4IYKA 3QUXA 5ABZA 5BZXA 4LIQH 4HX1B 5EC1A 4GKLA 3VRIB 1JHLL 4OLUL 2RA1A 4DTGL 3TNMB 4P5RA 1A0QH 5AOKA 2BOCA 5LWYH 1SM3H 3BLBA 1OT1A 3WTTA 5DRWA 5DUJA 5EO1B 2YD2A 3UIYA 1VZIA 5IM7A 2X53A 4LGPB 4HKJA 1A1OB 2UWEF 2D03H 5J89A 3GB7A 2ZOUA 4F2FA 4HMDA 4HUWB 3ARUA 2ZCKH 4GT7A 1JFQH 4Z7QE 2GK0A 4PJBB 1K72A 4WO4A 2X6CA 1MHCA 1ZDSA 2QHLA 3MLSL 3LHPL 4K71C 5F3BB 5C7XH 1P1ZA 4GAYA 2R51A 2VMEA 4ETQB 4FQ2L 4MCNA 5GGRB 4BIKA 3IDJB 4JFYA 1OM3L 4XX5A 5AL8A 1J8KA 5BZZA 4WFED 1ZS2A 4PJGE 3EGSB 3AG4B 3IGKA 3FO2A 1BD2D 1A6AB 1QNZL 1R47A 1ZLWH 1DJGA 1HHIA 3T65B 1VFOA 2F08A 5FM8A 3VCLA 3QEGH 3Q8CA 4XBEH 5EO9A 3QI9C 1FH5L 4MD0A 3S3CB 5BUAA 3AU1B 5D71H 2BNRB 1JPEA 1M71B 5J6GB 3REWB 3GJFA 1ID5I 4HOMA 4R5XA 3Q3GB 3SKMB 3D18B 3STZB 5D7LB 5FUCE 4OV5B 4R5TA 4YAQB 5TQ2L 3D8MA 1IQDB 3EYFA 4APXA 3ZE1E 2PWHA 1QNIA 5ADPH 2HRHA 3M7OA 4EUPG 5FYJU 2CJ3A 5DJDA 4B9ZA 2V2XA 4M7ZC 3ARED 4NYLB 4RCAA 5DK2B 1NEZG 4PJCF 2IH1B 4QO1A 3L13A 1NGPL 4NM4L 2ADFL 3FZUD 1G7IB 3KGUA 4OFKA 4GQ9L 5IOKA 5CMAB 3TZVA 1F02I 2CLZB 5D1QA 3PL6D 4XTRC 1PAMA 1XWVA 2DAVA 4Y5VA 1S5HA 1RK0A 3FC8A 5IB3A 2WP3T 2IOIA 3A6OA 5K1VA 4RRPG 4DAGL 4I1RA 3T2LA 2L7EA 4RVBA 4DKTA 2W0KA 2CJUL 3NRQA 4F9LA 3H9SD 2JV6A 2P8MB 4D0CB 5MEQB 2XA3A 3ATAA 3ABKB 4F57H 2IG2L 3TO4B 2BC4A 2X2UA 1JZGA 5LDUA 5FAAA 5TTRA 4D9LL 2NY7L 4RGND 5BJTA 2C26A 2QHRL 3I3BA 3T8XB 4HIEA 2JH2A 5ECJE 1UZ8A 1AQDB 4ZSOE 1XF4B 4RSVA 1X44A 2VISB 2ITCA 2XKUA 2FAUA 1T7WA 3MRNB 1A7PL 1HEHC 4MA7L 4LHUG 2Q20A 1C7TA 5I28A 5K5YA 1LO4L 3A4AA 1TJMA 3G5VA 3ISWA 1M4KA 3O41B 5DLML 1CE6A 2A2QT 2YFNA 4OTXL 3W57A 5E6IC 4KROD 4B97A 3CFNA 3TWYA 2AJSH 2NY4C 3OHMB 1FFTB 3N5AA 1UM6H 4KZ0A 2O5XH 5AEAA 1OQOA 1WZ1H 5FUZL 1XF1A 2CHDA 4YDJA 2JJTA 3SKJH 2BZCA 4Z78A 3JV6B 1FVEB 2Z93B 4H1LA 3TJEL 1YA5A 4MWFA 1T5WB 1LNUB 1WV7T 3JV5A 4NBYB 4HKZA 2Q10A 2ZONA 3HRZC 5EUKB 4UQAA 3HFML 4I18B 3ARGC 4ZOCA 2V7HB 3KPNA 3B56A 4D9QD 3W38A 1WCBB 2EE9A 1E28B 4M4RB 1AZBA 3MV7B 2BSRA 4YHIA 2P80D 5FGCE 3QG7L 5FYKD 1CFQA 4S1SL 4NUGH 3ZHLA 1E5CA 2XVLA 3K5SA 3BDYH 3QWRD 3SCMA 3T0AA 1UOWA 1IEAA 2VYRE 1EXHA 1E9QB 3HS0C 5IJVB 1GS7A 1I1YB 1Q90A 1WA0X 4TV3A 1A7RL 1S7RA 4XRCB 4DHLA 3WTSA 3JBG7 2J8OA 1TSHA 1JP5A 4Y4KD 3ULSB 5D1ZB 5EO0B 3BKCL 1I9IH 1S78D 3S5ZA 4QUOA 1AC6A 3VXOA 5JPNA 2GBTA 2EDNA 3ARFA 3AY2A 4O9HL 3BPOC 2XIDA 4NCC1 1G4RA 1HNFA 1PEZA 4AWJC 3GUTA 3TNNA 2WUCH 5KZCD 3RGBA 1A6PA 3LNDA 1CIDA 3BESR 4RDQG 1O7VA 3AVEA 4JLRB 3GDCA 1XV8A 2XNAB 1DQKA 1XGYH 1R4XA 1ET8A 2K3TA 3H42L 4XP9L 3U2IA 1U58B 2VLRD 1UEYA 4Y9CA 3FT3B 3RB7A 5DHMC 2EICA 1Z7JA 2A73A 3BI9X 1JGUH 4POZD 4L5FL 5C0DA 4OCXL 4P5SA 1TQBC 4RDQF 4DPCX 4R4FL 3HAEB 5HYFA 4LCYB 2HTLC 4XXWA 2J1XA 5E9DE 4FNUA 4BFIB 3ESMA 4AK2A 4HZ1A 4YMPA 3J8F7 4IBTA 4IU3A 1O9ZA 2CRMA 3UAJD 3TEXA 1FL6A 4M02A 4EBQH 2E9GA 3QUHA 4NZJA 1W0WB 1U21A 2ZYRA 2JKWA 2B08A 1U8JA 2A9NH 3BAYA 3V0VB 1P4IL 3WO3B 5K1NA 1ZTXL 2G2NA 2VXVH 3NCWA 5T33L 3MGTB 3WMQA 2DLIA 3O2DH 3W37A 1FVCA 1NCJA 1BEYL 2VDOL 1MCFA 2Q3XA 5DEJA 5GS3A 3WEMA 1CZ8H 2QSVA 4MMYA 2XY2A 4LSTH 4FQQA 3UJTH 4KK6D 3U4EB 3G04B 2VMCA 5DK0A 5FKPB 3MCLH 4BSJA 4DWHA 4FNTA 3L4UA 1RH8A 4EIUA 1NMAH 1CGVA 5BOZG 1A9EB 1U36A 3E80A 1OGTB 1E7VA 4JFSA 4ZX4A 3HZVB 2NY2C 4OR1A 1A65A 4OI7A 3MLYL 4LNRA 4MJ6A 2N0KA 3O9WA 4IJ3C 2J2ZB 2FJGB 1F6AB 3K81A 5CLWA 5I1AA 1DFBH 1HCZA 2IWEA 3LQZA 5CS7A 5HGAA 3HNVH 1MCLA 4NRYA 1AGCB 4XN1A 4IOFC 1N5YH 1F8TH 1HHKA 1XGTB 1FYTE 4MA1B 1G9NH 5JXED 4HA1A 5IFJB 4GW5B 2VDPB 2M2DA 5JOFA 3GHBL 1JUFA 5HJDA 3QWNA 5E4AA 5CEYB 2VR9A 4J8QA 2HMIC 3RA7L 1MCWW 5ITFA 3GRWA 1XB3A 1CB4A 2GBAA 2Q2LA 2W0FB 3PHQB 4PJAF 1IBGL 4QRQA 4WI7A 4Z7WF 3F83A 3MOBL 3HE7A 4JREB 2PP8A 4KQ3L 5F6IB 3CH1B 3GHPA 2BMKA 2AQSA 3IF1A 3I50L 3HR5A 3ESPA 3VWJD 4I88A 1Q9WB 2TSAA 1L7IH 1L5GA 1FNLA 4ZTOH 5JUEL 2CA4A 4BQ8A 3HG1A 1FL5B 2X6BA 4Z7OE 2XWZA 3FF7A 1JIBA 1MFCL 5B3NA 4K23H 1DVXA 5F1KC 1U2HA 4HUVB 1HILA 3IJEA 3WFCL 2XWEA 3S8WA 3GXNA 3N9GL 4ODXB 3GRWL 2Z7UA 4XT1C 4KQ4L 3UBHA 4S1QL 4W68A 2C7UA 4L05A 1H6EA 2GT9B 3QUGA 2E6QA 3CFTA 3KPRE 5I74B 4H20L 5I26A 4L8DB 3JXAA 2JJSA 4ZUSB 3OHXB 3HN3A 2FGZA 1GPOL 2ICEB 4WV1B 4OU3A 1VENA 1KNOB 5BO1H 1NL0L 2CNZA 2QTVA 3KW8A 3VI3F 2FIRT 4H88L 5JW3L 2NNXA 3QNYB 4EQ3A 4TKWA 2F54A 1OB0A 3LKRB 1GR7A 4OLVH 5F88A 4GI9A 5IB5B 4OT1H 4X5PA 3RJQB 4NT6B 3V7AG 2Z8RA 1ZT1A 2DF3A 2WLNA 4UB0H 2WTRB 3CFEB 3AREC 4O2CA 4Y2OB 5I1LB 1NFDE 4NOFA 4NC1E 1SLXA 2MOQA 4MXWL 1PLAA 4AVJA 4F7PA 3FZUC 4XHQA 3RGVA 3NTCH 1FLRL 2XV0A 2YLHA 2YFOA 3PL6C 2KMWA 3Q13A 4M03A 4RBPK 4IK6A 1DQVA 1TU2A 4Z3TA 4KKCD 4OZGA 3LMJH 3O8XD 4UBDD 3GFUA 3Q43A 3BEWB 1S7QB 1J1XL 1J0ZA 1QFUH 1UGKA 5E1AB 5F89B 4UU9A 5CP7A 4N9GB 4RNRA 5HYQB 4BH8B 2GIXA 1BZ7A 5SX5H 2WUBH 3MA9H 4XNXH 2F53E 2DI9A 2LGNA 3UACA 2AV1A 3U4AA 1FPTH 1BGXH 4X9BA 8FABA 2YD1A 3S35X 3D0AA 2VR3A 3KM2A 3TBYB 2OMZB 3R7RA 4UILH 5IWLC 1AQHA 3JYCA 4FQ1H 4W9HC 2EILB 5E9DD 4PJIA 3P3UA 1QFPA 2NLJB 3KYMB 5CN2A 2DL9A 1FBIL 5FECA 1LEKA 1KPRB 1OIOA 3DBXB 3ASNB 1DUYB 4NEHB 4GMSH 2X4OB 3KAAA 5ESQB 4IKLA 1RK1A 2P5WB 2GI0A 3IRCA 3LZOA 2YGPA 4PW9A 2BLFA 3REVB 1ZE3H 3KPPB 4OFQA 1XF5A 2E7MA 5GPRA 3MTRA 3DDFA 5DZOA 4B7LA 3ARVA 5HDLA 1JBJA 3HPJA 4GOSA 2N56A 2O6CA 1NCIA 5KBLA 3LEXB 2FEDD 4NQXA 4JDTL 4KROC 5KBPA 1EZVX 4B60A 4M6OH 3CZLA 4YDNA 3MLRH 2Z91B 3L3IA 5I6XC 2YAOA 3MRHB 4M43H 4HS8H 4NBZB 4PRNA 1AAJA 1U30A 5CFHA 1C9SA 2I32A 4WTZG 1RZGB 2HVBA 3BUTA 2BP3A 5J9PA 1JYWA 3QUYB 5EEXA 3L7FA 1JGEB 3H8NA 3VJ6B 2FCBA 3DTDA 2B5IB 2BP0B 3T0EB 2XZQH 4M7KH 4UNVA 4PJBE 3QS2A 1CD9B 4HEME 3MNZB 3OWEA 2XQ0A 2UY7A 5C9JA 1BQSA 1INQB 4OCYH 4FYQA 2CDFA 1DE4A 4ZW7A 4MCZB 1FYTD 5G4NA 5F9WC 3F00A 4Y4KC 1JWMB 4MBOA 4U0RB 1S78C 2GSIB 1HZHH 1RURL 2OJZL 4N1HB 4P2RA 4KK5D 1K8DA 3DRQB 4KAQL 4PTUB 4N90E 4FC3E 1E6OH 4MJ2A 5AAWC 1T04B 2W1NA 3U1PA 4NHUA 5HDBF 3BSZA 1N8ZA 5IQOA 1QO3A 2HTKC 4CAGA 2DMKA 4OFYA 4HETA 1Z5HA 3RURA 4X7CC 5L88L 5CGBA 1YPZF 3CHQA 4U1LA 5HHVH 4D8PB 1VRSA 2N01B 2V3EA 2QVTA 4NQCA 2F15A 5EDXA 1NDGA 3SBRA 4YDLB 1YECH 2OK0H 4Z1PA 4XNMA 4FG2A 4POZC 3WD5L 4BZ1A 1KZQA 5IW1A 2CO3A 3GD1C 3WELA 2DKMA 5GGQL 2UZPA 4OLWL 5I1CL 2QBWA 2PLTA 3K6SA 1P7BA 4DUVA 1E4JA 3RG1C 4AYDC 4K55A 4G80A 5EWIH 4P2OD 3IFLL 4CW1A 1TCRB 2I5YL 4K94C 4KHTH 4F5CE 1I1RA 2GUOB 4IMLA 2D7NA 3DRTA 4Y2NA 3SE9L 4ODWB 3S98A 3GMOB 1KXHA 3UAJC 3BSZL 3KPRD 1U6AH 4OW6A 4TNEA 1BPVA 4KI1A 4XHJD 4YDIH 4Z7VF 3BEVA 3GI8L 1XH0A 4JG1H 3G6AA 3OKKB 3MO1B 5HY9B 1V55B 2HLFD 1HCYA 4DW2H 1HX0A 3AJ7A 5C0BA 2MOVA 5H37H 1RZKL 4LCWB 4BZ1L 2B59A 4WDIB 5C08A 4PJDB 1BX2B 3I75A 3P11H 4DP0X 2LLGA 4FXTA 1WE5A 2L0DA 3HUJB 1HI6B 1MFAH 3HKZA 2VDQL 4N24A 1CS6A 1F41A 1NIEA 2ZCLH 1RLWA 2CM6A 4KK6C 2E9WA 3N40F 3KYKL 3L4ZA 1A4AA 3FT4A 3PAVA 5CIPA 4DVBA 3Q5YA 5FHAL 4KX7A 3UYRH 5GIRB 2B20A 5D7JA 2BS71 3RQ3A 2W94A 3DVGA 1KLGA 3MLVL 3S37X 1X5XA 2X42A 4WHTB 5T3ZE 3A47A 4NWUH 1E2VA 3BCDA 3FBQA 3FTZA 4PJXA 3HI5H 1J1PL 3MJ8A 2YEQA 2Z7YA 2G2PA 1MAKA 4R96B 3P9MA 1D5ZA 3GC3A 3X12A 1YEFH 1WEJL 4ODVH 1NGXA 1KDIA 4MXQD 4XZ4A 3ARDA 3L3JB 3GO1L 1RIUL 1M05A 2F53D 1OF0A 2GITB 3G6JE 3JV4A 2Y7MA 4M8VA 4MJJA 1BIHA 4CL7A 1WFMA 5JXEC 3TH2T 1N59B 3V0EA 5ILTL 1WIUA 4YHKL 3BPNC 3BRDA 5EV7A 4MA8L 3GZPA 5BS0E 3FUNA 4S0SD 4DEPB 2XFXA 2CHNA 4KHXL 1MXGA 3TC9A 4CILA 2HKFH 1AGEB 2F1AA 4WO4B 4L4TA 4IRJB 5CN3A 3DGDA 3MODH 3VWJC 5EIVA 5I9QB 2PPAA 4U1KB 5GS0D 2QR0B 5EUOF 1UM5H 3OKEB 1PY0A 5F9AC 3WS6A 1BVKA 4HIXH 1F1GA 4BXVA 3QCVL 1BYOA 3NAAH 2FZ3B 4A55A 3D2UB 1DVFC 4L1HA 2BVOB 4K5LA 1JZ7A 3WDIA 4KU1A 1BLNA 3TEZA 4JQXC 5IJDC 3D25A 3V6OE 1V7MH 1M6OA 1W6LA 4EMZA 3RWGB 4Y8AA 1BP3B 2ADGA 2AEWA 1NAKL 1DBML 3UGXA 5J3HD 4ZW5A 2O6FA 4NHCL 1N67A 4Y2DA 3SZ6A 4GXVL 4OVVA 4GUOA 1P7QB 1PDKB 3CXDH 1KCKA 1EFQA 1DEEA 2FWSA 4HYTB 4E41B 3PNRB 2VRKA 3EZ8A 4PREA 4CVUA 5AD0B 3V7MA 1XF2A 1RZJC 4DSYA 4PY8J 4Y1AB 4B5ZA 3KLAA 1Y07A 4CVXA 2MKLC 3P4LA 4Z8FL 4I77H 3QEHB 4FQIL 4L1LA 2XTJE 4V2CB 2DIAA 1OT4A 4FEIA 1Y0LB 3V4UL 1ZLUH 4TOYH 1OB1A 1DJWA 1IE4A 4UM9A 4XP6H 2I24N 3GK8H 3O0RH 1P84J 3L54A 4N90D 1A4JB 5CSBA 5I76B 3O8XC 2KLSA 4UBDC 2X41A 1ZJAA 5ERWA 1OWWA 1MFNA 1N0XL 2E9JA 2QZ5A 5KSVB 3MR9A 4MB4A 2ZOKA 5KS9B 1RSFA 1BBDH 2RFXB