1TU2A

The complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title Structure of the complex between plastocyanin and cytochrome f from the cyanobacterium Nostoc sp. PCC 7119 as determined by paramagnetic NMR. The balance between electrostatic and hydrophobic interactions within the transient complex determines the relative orientation of the two proteins.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tu2A00
4YSRA 1AZNA 1HFUA 3PCYA 1JXFA 1L9QA 3AZUA 1SF5A 3TASA 1ID2A 2IDQA 1KBWA 3CDZA 3CVCA 2GIMA 2QT6A 4G7QB 5E9NA 1IBYA 2QDWA 2CAKA 4G71B 3DTUB 5D4JA 3FQYA 1JZGA 1J5DA 4BWUA 1M56B 3T6ZA 1QHQA 4E9WA 1E5ZA 1J9SA 2YAEA 1IUZA 2PPFA 4HAKA 3UACA 1RKRA 1E5YA 2EINB 1MZZA 1SFDA 2AVFA 2IAAC 2CJ3A 1KYAA 1QLEB 1TEFA 4NB7A 4FAAB 2MRYA 4KNTA 1AG0A 2UXGA 3BQVA 1OCZB 2JKWA 3UABA 3T6XA 1EHKB 1NINA 1NICA 4BDVA 3SBQA 1FWXA 3TBCA 2VM3A 4G7SB 2B08A 4YSAA 1QNIA 2YAMA 7PAZA 1IBZA 2PPCA 1KBVA 1WA0X 2J55A 1PLCA 3ERXA 2FQDA 3QQXA 4GY4A 1SHXA 4DP5X 1AACA 2PP9A 2IWEA 4NAJA 2HXAA 3DIVA 2UXVA 1BQ5A 2I7SA 2IDFA 1FA4A 1J9RA 1SF3A 3X2QB 5I26A 2BO0A 2GI0A 1RZPA 3NSYA 3X1BA 4DP6X 5IY5B 3FQ2A 4BDVB 3GXUB 5I6PA 3IN0A 1KCWA 4BK5C 1KCBA 4KNUA 5I6KA 1WA1X 3NJNA 5B7FA 2AANA 4CSZA 4DP7X 1B3IA 4JKNA 4WKXA 4QKTA 2Y1AA 1GS8A 2JFCA 1CYWA 5B1KA 1BAWA 2AZUA 2GSMB 5AZUA 1JZEA 1DYZA 4RH4A 3X1FA 3FQ1A 4BWTA 3QJSB 4KOBA 3NJLA 2XUWA 3RYMA 1WS8A 3S3DB 1N70A 1CC3A 4HHGA 3WIAA 1M57B 4EF3A 1NZRA 1NWOA 2ZWNA 4UANA 2UXTA 7PCYA 2OCCB 1KDIA 4E9YA 3FSVA 2HX9A 3NYKA 3WNJA 3NT0A 1AOZA 4G7RB 1URIA 4F2FA 3GYRA 2FNWA 2P80A 1NPJA 3SBRA 5I6OA 2BWDA 1CURA 1V54B 3EH5B 2BW5A 1A65A 1ZPUA 4GP8B 2J5WA 1EZLA 2EILB 1OOWA 5AKRA 1OE3A 4PCYA 4A2HA 4AX3A 5I28A 2GHZA 2I85A 4P5RA 5LDUA 1NTDA 2VN3A 3X1EA 2TSAA 4HZ1A 3SBPA 3MBWB 1OE2A 4E9VA 3EF4A 1OCOB 3BVDB 1NIAA 5FC9A 1L9RA 5I5MA 4K9JA 1AS8A 2PLTA 1OCCB 1PMYA 3ABMB 3AG2B 1NPNA 1L9PA 1PY0A 4DPAX 3QJVB 2VSMB 3JT2A 3NJJA 1W6WA 1ASPA 1MG3C 1WA2X 2PCFA 1PZCA 3FU8A 2YXVA 4HIPA 3SQRA 2BP8A 3OM3B 4HCGA 4GYBA 5TK2A 3IEAA 2IDTA 2X88A 2YXWA 2ZXWB 1M9WA 4AI7A 3NJFA 2J56A 1AQ8A 1AIZA 4A2GA 3S8FB 1L9TA 3UGEA 2WO2B 3N2JA 2YAQA 1W6LA 2VW7A 5B1JA 2GB2A 2A3TA 2I7OA 3PAZA 1JOIA 1TKWA 2EIJB 4QLWA 3CDZB 2HZHA 2FQGA 3IBOA 1GSKA 1MZYA 2JXMA 2FQEA 2CBPA 3T71A 3AG3B 2VM4A 3OMIB 1A4CA 3FYEB 4M4RB 1GY2A 2Q9OA 2Y69B 1ILUA 1PAZA 1N68A 2YAFA 4YSPA 3ABKB 4P5SA 2H3XC 2B3IA 2XWZA 4G72B 1WAEA 3S8GB 4KO7A 4HALA 1NWPA 1CYXA 1HAUA 1WS7A 1J9QA 2LLNA 1KDJA 4HCIA 3FSZA 4AKPA 1BQRA 3FPXA 3ZBMA 1GYCA 1W8EA 1CUOA 2HX7A 1SHWA 3JTBA 4YSDA 3T6WA 2YAPA 2DYRB 3AG4B 5ANHA 3KW8A 1J5CA 1V10A 1JVLA 5D4IA 5I5IA 9PCYA 3TU6A 1A4AA 2H5UA 2TSBA 1JXDA 3H4HA 5I6LA 3OMAB 1DZ0A 2OJ1A 3V9EA 2DYSB 4F2EA 2W8CA 4ZK8A 4M3HA 3AW5A 1GS7A 4YSEA 4NERA 1AANA 1XB3A 3HB3B 1V55B 4W1TA 4BXSV 2XXFA 2BWIA 4AKOA 1X9RA 1A8ZA 3NJGA 4E9RA 2XLLA 1BXUA 1GR7A 2VW6A 4YSCA 3NSFA 2FT6A 4E9SA 3KW7A 1AS6A 2GC4C 2IWKA 2R7EA 4JHUA 3ABGA 5F7AA 1ETJA 4KOCA 3PXLA 2VW4A 2OV0A 1NIDA 1MG2C 1JERA 5F7BA 1SJMA 4YVUA 3NJKA 3NSCA 4YSTA 4UF7C 2FT7A 3S3CB 4A2FA 1SDDA 3UAEA 1JXGA 5B7EA 1AAJA 2FT8A 4E9QA 3ZDWA 5I6MA 4BWWA 3TBBA 1AZRA 2HRHA 2R7EB 1ZV2A 4A66A 1KV7A 4A68A 5PCYA 1OCRB 2PP7A 2XV2A 1PZAA 2Q5BA 2WSDA 3X1GA 1JZFA 3TA4D 1A3ZA 3NP3A 1ZIAA 1SDDB 2DWSA 3WG7B 4Q8BA 2J57A 2ZONA 3FYIB 3WKPA 1ET5A 3IN2A 2XYBA 2HRGA 2QPDB 2H47C 3GDCA 3QJQB 2HX8A 1F56A 1E65A 1NIEA 2EIKB 2IH8A 1PF3A 1SFHA 4Q89A 4A67A 4AKQA 3OD3A 1E67A 2XXGA 2BP0A 3ZX1A 1ET7A 3ASOB 1KGYE 4G70B 1I53A 4E9TA 5TK4A 1OE1A 4GP4B 4DP0X 2BP8B 4KO9A 3EH3B 4FA7B 1ILSA 4DPCX 3NJHA 1VLXA 2N0MA 1ZIBA 4HHWA 4L0PB 3WNIA 3FU9A 4GXFA 1ASOA 1RCYA 2PCYA 2VMJA 2MTAA 1AG6A 2FQFA 3ABLB 3NSDA 1TEGA 2RACA 2CCWA 3V9CA 1ZDQA 5B7MA 4N8UA 4YSUA 3EHBB 2BP0B 1T5KA 2E86A 3PLYA 4YL4A 2DWTA 1X9UA 1JZIA 1BEXA 3FSWA 3H4FA 1HAWA 4DP1X 1FFTB 2PPEA 3H56A 3S3BB 3L45A 2BZ7A 5I5JA 3NJIA 2QDVA 1ASQA 1NDTA 1PNDA 2YAOA 1A4BA 2ZOOA 3ZIYA 1BYOA 1AS7A 1PZBA 2BW4A 6PCYA 2EIMB 3OMNB 2YARA 2IWFA 1NIFA 3PAUA 1IKOP 4A2EA 2XU9A 3QJRB 1BXAA 1OV8A 3AY2A 4DPBX 2FTAA 2VSKB 4PAZA 1J9TA 1AZBA 2XV3A 4F7KA 1JVOA 4KO6A 1ZDSA 4E9XA 2YAHA 5AFAA 1AR1B 3CZUB 1PLAA 5B1BB 4BXVA 2XVBA 1JZHA 2AFNA 3HEIB 3QJTB 2PPDA 1BQKA 2FJSA 5B1JC 2WO3B 3FT0A 3FU7A 3D12B 2YQBA 4A2DA 1YLBB 4YVNA 1E30A 3FSAA 3QJUB 4KNSA 4ENZA 3IE9A 3T6VA 2HLEB 4KO5A 1BXVA 4UAHA 2CUAA 3CVDA 3EH4B 1GY1A 1XB8A 2XV0A 4DP2X 3NJMA 3FS9A 4WTQA 2BZCA 1L9OA 3U25A 4X4KA 2P80D 2AZAA 2X87A 3CVBA 1XMEB 3FU7B 1ET8A 1L9SA 3PAVA 1XB6A 1ADWA 4N4YB 1JZJA 2GBAA 2IH9A 3T9WA 1GS6X 3FPYA 6PAZA 3DKHA 2IDSA 2PP8A 1OF0A 5B3SB 2FWLB 1PNCA 1SNRA 2DV6A 2W88A 3AG1B 4TXVB 1PLBA 3OQRA 3N55A 3QPKA 4CSPA 1PCSA 5B1AB 2CALA 3G5WA 8PAZA 4DP4X 1GW0A 3C75A 5I6NA 3UAAA 1BYPA 4HCFA 2GC7C 2BHFA 2IDUA 4DP8X 4YSOA 1MDAA 4GP5B 3WI9A 2UXFA 3NP4A 4YSQA 4DP9X 4W9ZA 4AZUA 1AZCA 4YSSA 2XX0A 1AZUA 5D4HA 5A7EA 2PPAA 2UX7A 4MFHA 3WKQA 5EHFA 3UADA 4JHVA 3X1NA 2NRDA 2DY2A 2XX1A 3ASNB 1UATA 1R1CA 1IC0A 2UX6A 1NIBA 1TU2A 3PPSA 3CG8A 2QPEB 5PAZA 1RZQA 3MX0B
chains in the Genus database with same CATH superfamily
1KB5A 1OK0A 4ZXBB 3VGBA 4EUPH 1ZEAL 1E4HA 1L9QA 3AZUA 3ILDA 1A7NH 3TASA 4I89A 1CFBA 2EE6A 2V5TA 3FNKA 4AQAB 3ILQD 3BVWA 4K9EH 1KELH 4FFVD 4NUGL 5KW9H 5DSCB 1OT1A 5HXMA 1BFOA 5I0DA 3MV7E 3BGAA 3H42H 2APBA 4O02A 2Y6TE 2M26A 4DN3L 3GSRB 3MSPA 1KN4H 1RKRA 2WY3B 4OGYH 2JIXA 4AYDC 1RLBA 1MZZA 1DUZB 2E7BA 1QLEB 2XVLA 3NQKA 1DJHA 4I48A 4Z76A 3P30L 4LHUD 3SE9H 3F6LA 1G7HB 2JKWA 3FB6B 5HJBA 2A0LD 5D2LF 3ULVC 2LAGB 3ULVL 4NYLB 1CGUA 1SXZA 1E7VA 4G7SB 3FTZA 4C4KO 4YSAA 3TZVA 1MQKL 5AB9A 1OZTG 4AMWA 4UT6L 2NY6C 1AGEB 4DP5X 2EDKA 1HXYB 1SQMA 2NZ1A 1IV8A 1N0LB 3ZE2F 1ZK5A 4YDKL 3CMOL 2EC9U 4AUYA 3PGFH 5E8PA 2F18A 4N2GA 4AQ1A 3LHPH 2NY7H 3HAEG 3P2DA 5I6PA 2ENPA 1HOCB 3PWVB 1JK9A 2C34A 2D7NA 2X4OB 1WA1X 4NQEA 5A6IA 2DQIL 5IMMA 4DP7X 2DQ6A 1K2DA 3DBSA 1DQIA 4G6AD 4UT9H 1R9FA 4I77H 4A04A 1I7UA 1IIIA 1P4IL 4PJ5D 2YGQA 5B1KA 4LOEA 5EU6E 3CHPA 5F8QC 3IWUA 2QADB 2F68X 4Z3IA 1TQTA 2XUWA 4D9RE 5KSBE 1CK0H 3DX6B 3RYMA 5KSVB 1AY1L 3N6YA 3DTXB 3RUGB 3FULA 3D2UA 5I74C 3UOAB 2GJ6A 4O51A 3SYAA 4NQSA 4RNRB 2Z35B 3SD5A 4RAUA 5LCVL 4DWHA 2WKOA 1QSVA 1BIIB 2VH5L 2CIIB 2ZWNA 2A9DA 3BIKA 3LCYA 1MCJA 2FDBP 1P1VA 1YHPA 2YA1A 3BKCL 3L3JB 2Z8WC 3L2LA 3MRBB 5E24E 3KBPA 4QKXB 1V27A 2YQ3A 4G7RB 1HESA 2DKUA 1OGTB 2DJSA 1JGIA 5DHYA 2ZOWA 1HQ4B 3G04B 2DQJH 3OZKA 4GKZA 5DZAA 4PJ9B 3QORA 3ES6B 4L3CA 5CILL 3PWNA 4IOSA 1A65A 4OV5B 1H0DA 4Z7UF 5FUOL 4ZJ9A 1X5GA 3AQYA 3M7FB 2JMRA 3RWGA 5IFAH 3BW9B 5F1NB 4X6CB 4WO4D 2VL5B 1UYWH 1HIMH 2ZJSL 4JFPA 3BXNA 2G60H 3S37X 1AGCA 1OT4A 2TSAA 5DRNB 3UO1L 1ZA3A 3GKWH 2V5MA 3KPOB 3PP3H 5E94A 4L8CA 2PN5A 3P54A 2QSQA 2QVTA 3S0PA 3QNXA 1L9RA 1E2VA 1EEZB 1WUNT 1QI3A 4H13C 1OCCB 4QHMB 1AQDA 2Y7QA 4JG9A 3VH8G 1U8PB 2CUIA 2WXLA 2GEQA 1VFAB 5LN8A 1KJMA 1YMHA 3BZ4B 3NIGF 2FLMA 3WAJA 3OKOB 1OM9A 1MG3C 4G6KL 2B5IC 4RFEB 3STLA 2YXVA 3W2DL 5GRJL 2BP8A 4UILH 4AQEA 4Z0BH 5EG6C 2ZXWB 1G1OA 1N4XH 4HD5A 2F8IA 4QMEA 5BZDB 1AYOA 4LFHD 3SPCA 2J56A 3VAEA 1FNEB 5ALBL 2EUWA 4URTB 3WS6A 1RUPH 1G6VK 1JOIA 2PWDA 2VNCA 2EXWC 4LCWB 1YEIH 2FX9L 3IDMA 1NCHA 2ITCA 3CSYB 4IMLA 3V0VA 4DT2A 2A73A 4XN2A 3VSQA 2JELH 5EPMB 3D85A 1SXAA 4OIFA 3FMGL 3DX9B 4U1JB 1PAZA 4HU2A 4KKCC 5CLXA 4R2GB 1FDLL 1ESOA 2XFGB 4BFRA 5HY9A 4HIIA 2P5WB 1SJEB 4NQVB 4OCYH 4PUBL 1BWWA 5IHBA 1JCVA 2XYCA 1DBAL 3DBXA 3QNYA 1SQ2N 4F33A 4XTRC 2QLVB 3EGSA 5FCUL 2APXA 4WFED 2OXGB 2GI7A 5KTEH 3QNZB 4KK6C 4HSQA 3REWA 4LP5A 4MBOA 2BFVH 3MLSL 4FXGA 4G42A 3D52A 5IF0B 5IEKA 4RIRB 3T6WA 1TPXC 3CFEB 3MRPA 3QQ4A 4WNJA 4CNIB 5KWYC 2YAPA 4KK5D 3CXHK 4M93B 4PRBB 4ORGA 2H1PH 1ZHBB 5EZJB 1I3GH 2AERT 3BPOB 3FTWA 5HSFA 4UV7L 2GK0A 2UWEF 3GF8A 5JW5B 1N9PA 1IGTA 2ZYSA 4LLWB 4Y16B 4YR6A 1HHKA 4M00A 1ODUA 5I1KL 4J3OD 3H4HA 4QXWA 1B4JL 1BXXA 4O2FB 4LBEB 1D9KC 4M6ML 3TA3A 1OT2A 2RFXA 1G9HA 2K70A 3P77B 4IOFC 1S78C 2W8CA 2DQMA 4DKFL 1P4BH 4PGBB 5TTRA 4U6XB 3EJUA 2WXJA 4YE0A 2X6MA 4GRLD 3B3IB 1HNGA 2I9LA 4I18B 4APQA 5E1AA 4KZCA 5F96H 3T0DA 1M4KA 3KPMB 4OQTA 3TVMB 1VSCA 4MD0A 4PJ8D 5HPOA 3AABA 4B5EA 4N25A 4FHKA 3ABGA 1S7XB 5KG9B 4KQ3L 4NZFA 3ZL1A 4KWUA 4FQ2L 3W9EB 1O7VA 4MQXC 4OZIE 3WDHA 3MJ7B 3GJFK 4UF7C 1FUNA 2GCYA 1QP1A 1IM3A 2FEDD 1NCWH 3GI8H 3MUY1 1JGVH 5J6GA 2BOLA 1E9PA 1Z1WA 4OU3A 1P2CA 2C9VA 3LDBC 5LBGA 4Z7VE 5JPNC 1K9TA 1PDKA 5HHOB 5L7XH 1OCRB 2H0PA 2L4OA 5F1IB 4UAOB 4JR9L 1F4XL 4HU8A 5BS0B 4K5LA 4WW2F 5EZIH 4QOKA 2P9RA 1AZVA 4AYID 2BVYA 1FVCB 4OR1A 3QWRD 4NZUL 4XCEB 5IT2L 1RMFL 4YOKA 2E7DA 5FCSH 3VD0A 5DXWA 2HP4A 4YHNA 2VLME 4PJXB 3QUGA 5JHDA 3QR1A 5E8OA 4FMFA 2H47C 3GDCA 2UZPA 1HSBA 1C1EL 5IUCA 5K9KB 2VIRB 2MPAH 5C0BD 3IXTB 4DEPB 2Q76A 2ZWLT 3HHMA 5ERWB 2EVHA 2OCJA 4AKQA 3TEWA 4IRJA 3ESOA 4U1SB 4C56E 4UOW0 1TZIB 3CXDH 2BSSB 5TK4A 2XN9D 3O4LB 1FN4A 4UYPA 2R69L 5HDBB 3PWPA 1ILSA 5B8CB 1VZHA 3ALPA 3DRTB 4MXVF 3FCUB 2I9TA 4HHWA 1OHZA 3FU9A 4RSVA 3RRQA 3L3DA 5I17B 2DZEA 2WSKA 2C3XA 4PP1D 2WXQA 4R7VA 1R0AL 2UZIL 2FJFA 1ETB1 2WLZA 1U0QA 2Y07L 4Y5XA 3O8XC 3SYPA 5TQ0L 4L1HA 5EWIL 2XBZA 5CINL 1AI1L 1X9UA 3WHXA 3U4KA 1QD0A 1YRKA 4YLCA 3LQZA 2ZCHL 2P8PA 3S3BB 2X6AA 2YRPA 4FKEA 1JK8B 1CIUA 4K3EH 2P44B 2XG4B 1FVDA 2EDHA 2G75A 3L1OH 5A6LA 1QQDA 5FGCB 3UAJD 3LXCA 1MCPL 2R1XA 3CVHA 1CPUA 3UCQA 4FGMA 3LKSA 3O3AB 3T8XA 2ZNWA 2IANA 2O6PA 5K59F 1IE5A 4IRSC 4MQ7B 3K8MA 1JJUA 2XU9A 3VRJA 3ZE0F 2K9UA 4Z7NE 3BJ91 3MRIB 4WHDA 4XC1L 2ATAA 4F7KA 3VG9B 4S0SD 1KNOA 1PLAA 2Y2YA 1NJ9B 3QJTB 2GHWB 5D1QD 5L2KA 5B1JC 2WO3B 2X4SA 3LV3A 2WYIA 1TTCA 4EI5B 1FFNA 1OAZL 3BFQG 4HKXA 4CW1A 1EQWA 3X13B 1R34A 1HTYA 1YLBB 5AW2B 5LDSA 1DBML 4PD4J 1C5BH 3GNML 1KTRL 3V4VA 2CUAA 3CVDA 1OEZW 1R33A 5T5FL 1H3WM 2YR3A 1BP3B 1RURL 3FS9A 2AQ2A 1ZE3C 3NK3A 3MBED 4R7NB 4HX1B 4WHYH 1EZSA 3U25A 3FOMA 4M7LL 3FB5A 3FCSA 3QEQA 1OAQH 1OGAD 3Q8AA 2XZZA 3RU8L 1KCSH 4WFGD 1GS6X 1F42A 1LDPH 3GMNA 2FL5B 6PAZA 4NSKB 3MRMB 4P3CL 2BIIA 4X4MA 3U9PL 5DEZA 1KIPB 2DYPB 5D7IF 1HXKA 5J3HC 3HI6L 4EPSA 1CO1A 5BV7L 1FYTB 1RK7A 1CLZL 2NXYD 1YEGH 2XJKA 1PLBA 4K3HA 1CGSH 1G1YA 2BY3A 3EDJA 3VFGH 4P46C 5EUKA 1OPGL 3SE8H 2HFGL 4XPGH 5C0JB 8PAZA 3D18A 5BO1H 3M86A 4O5LL 1KLFB 3KGUA 4MXWH 2GC7C 1LLAA 1DJGA 1H5BA 4YSOA 2W9EL 3ARFB 4NQXA 2W9DL 5F97E 3ARTA 3OKEB 1EJ8A 3UYPB 1E4XH 1Q9OB 2CJUL 3T0EA 4YUEH 3SPGA 1JNHB 4GMSH 1W0VB 5IB2A 1AZCA 2PR4H 4D9LL 2GJZB 1NFDE 2WBKA 3U36A 2YOAA 3NCJH 4GUPB 4JVPA 1TT6A 4TULL 4Z7OB 3KVQA 2K9FB 2Q86A 4R83A 4JUTA 1CD1B 2JCCE 1IAIL 1L9MA 3PPSA 3QIBA 1ANUA 4E5XA 1Z9NA 1F1GA 4PJFB 5EIIB 1KPUA 2BY1A 3L5WA 4HT1H 5L0QC 3ALWA 3ARGD 2NY2C 4YSRA 1ZSDB 2ATPB 5HJGA 1AXSA 4LLVA 4GIAA 1JRHL 3I74A 4HBQA 3CVCA 2VLKA 4HC1A 5E9NA 1HHJA 5CCJA 3KPTA 5CJOL 2WLLA 4JO1L 4BWUA 4IU3B 4WHYG 4PJBE 5GQBA 4P9HL 3WD5H 1B4TA 3IDJA 1J9SA 3NCMA 1S3KH 3D39B 5KVDH 1E5YA 4XOAA 3CVIL 3L4VA 1EGJA 3QUML 4JDVB 2GTZA 1RAMA 2AVFA 2CJ3A 4JN1H 3LRHA 5DUMH 2C26A 3FH7A 5L4JA 1FFPA 3N1MC 4Y1AB 2UZXB 1J7VR 4JM2B 3V79C 2HRPH 1T7VA 1RK1B 2QQNH 1EO8L 4WFEE 3N1FC 1RHHB 4LLMB 5LAPA 3HNSL 1K6QH 1EHNA 3DVFA 5CBEB 4ZUSA 2H32B 2FWOB 5GSVB 3QUYC 3TCLA 4ZFFA 3N42B 4YBQD 3SD2A 3S8WA 3NBNA 1BMGA 1JUFA 1SHSA 3CC1A 3V6ZB 1R3JA 1A6WH 4MJ5A 4WNQB 2A9AA 4HCRL 4X9IA 1E42A 2E75C 3NSYA 3AS0A 1NDMB 3WMQA 2XWCA 4GAGL 4GW4A 1T7YA 1M9SA 1VA9A 3WIFB 4IIZA 4PWHA 4K94C 4K94L 4AL8H 2UZYA 4HPYL 1D6EA 5EUOA 4KNUA 1A1NA 3R06B 5JIHA 3U48A 2AANA 1CU4H 5DHDA 1W72B 4KXZI 4OIAA 3FC8A 4PJHB 2A6IA 3V4PB 4AK1A 1IGFH 4QKTA 5D9SB 2HPOA 4R97C 3IDNB 4OFKA 2JJTC 2M8XA 2FEEL 5LGKA 1JDDA 1IM9D 1MJ7H 3ROLB 3IDXH 1XZ0A 3RE0A 3VCLB 1G6RL 3HI5L 3DHMA 5HHMB 2YA0A 3OV6A 2MNJB 4O2CB 3S5LB 4N6RB 5DI8B 1VEOA 4JPIB 2ITFA 2GIYA 4PYGA 1CLYH 1BG9A 4N8PA 3AMLA 3SDAA 4YBHA 1UKSA 3VI4E 4Z7IA 1EK3A 4QRTB 2Y06L 1KZYA 2ZP8A 1MHPH 3VXMA 5C3TA 2UV3A 3WLWD 4B96A 1IBFA 2R4RL 1I1RA 4HKBB 4HG4K 3FTUA 3BUYB 3BP4A 3MRJB 4JHAH 2BWDA 5A3ID 4RGOH 4IBQA 1CIDA 3SGKC 2HT4C 2JJVA 3JVFC 1E3FA 2H7WA 5I23A 3PU7A 3DO7B 3W37A 1EXUA 5EC1A 2XBTA 2E9BA 4MJ6A 4R90L 2RQ8A 5HBBA 5CHNA 4ZZFA 2VN3A 5CM1A 4PRAA 2AQSA 2EO7A 5ESQA 2FLRT 4PJGE 4NI3A 2CO7A 4MLIA 5HHXH 1NIAA 2NY1D 1DLHB 3SO3C 3APFA 4W9CC 4ZOCA 2PLTA 1LD9B 4DZBB 3GXPA 3PQYD 2Y36L 2WYTA 1JPGA 4R4BA 5ACZA 2CKNA 1G5GA 3Q0HA 1TNMA 3JT2A 1YUHA 5C0BE 4QNPE 3A47A 3L8QA 2YUZA 2GAZB 4Z77B 5L8JB 3MRLA 4ICWA 5HGDB 2XN2A 3PGCB 2OXHB 3GSNB 4HCGA 3ILPA 5MP6L 5FOJA 4DEWA 2XN9E 1CD0A 3MNZA 3QDMB 5EORL 1U8LA 3L3KA 1HKFA 4JJ5B 4NQDA 4AI7A 1MLBA 3B9DA 4JY4A 4MNGE 4YJZL 5I19H 4NRZB 4JFOA 5FO7A 2BRQA 1SY6A 2ENYA 1ND0A 1OSYA 3IGAA 3P4MB 5D72H 4AJ0A 3G6JB 1CFTA 1GZHC 3GFUA 4PRPB 3DIDA 2OBGA 1RL1A 5BZWA 4UQ2A 4H2CA 2VM4A 1P1ZB 5H37A 4QAWA 2JKNA 1JF6A 1KGCD 2A77L 1Y18B 1SZNA 1YPZE 2P42B 2EUZA 4HUMB 4ONFH 2LVEA 3QJHA 2GIXA 4G72B 1UASA 1WAEA 1TLKA 2X4QB 3VGAC 4KO7A 1S7VA 4LSTL 2XKNB 4J7RA 3RVXC 1H6FA 4X8JB 5H2BB 4QRUB 1PG7L 2E76C 3CDGB 1LWJA 3FSZA 5KJ4A 4AKPA 3P4NB 2FECL 2FD6H 3O41B 4PPTA 2CGZA 5AUMB 1CUOA 4FERA 4RRPA 1DQJB 1OP5K 2VM9A 1PZUB 3LD8C 4ONHA 5F7FA 5ABAA 4HPOH 2HT2C 3P4OA 3S96A 1U2CA 3EGDB 4JM0A 2AQRA 4P4RB 5D1QE 3V6OE 2X89D 2DYRB 5K33A 4L18A 2XWTB 4WRLA 2VE6A 3TH2T 4ZUVA 1XL4A 4ILDA 5H4ZA 4PREB 3IDUA 5CJQH 3TNNA 5BO0D 1MCOL 4BCZA 4W93A 2HKFL 3OZ9L 2W59A 3C5ZD 3QJFA 3BKYL 3O2DL 4LVOC 4WI6A 1B2YA 3EH1A 3OKYA 4BUQA 4XR8C 1HK6A 3QCUH 2QGDA 4OT1L 4V11A 4KKBD 4DGVL 5EDSA 3LPWA 3OMAB 4LHQB 1QOKA 5B21A 5TF1H 2NY4B 4LVNC 1R5VA 4PRNB 3ARBC 1B88A 3GMMB 1GW6A 4KDTC 4L8BB 1MI5D 4WFGE 4HWBA 5KSAB 1V55B 5SWQA 1Q1JL 4OAWB 2F54D 3LPOA 4XC3H 4X4YA 4GRMB 2KZWA 3BZFB 5EBLB 2I26N 2OSLB 1A8ZA 4M7KH 4OZFA 4WZ9A 2E7HA 1T2QL 2W0FA 2NNRA 1RZIA 2IWKA 4JHUA 5EO0B 3PHQA 1MUJA 4KOCA 5FF6B 2OK0L 4GG6F 4WHTA 1HZHH 3LX9A 5AOKA 4CC4C 1VF5C 4NUPA 2VDNH 1GTFA 5IVNA 2AJVL 5MEPA 3W5MA 4J2XA 4X7CC 1AGFB 1PG7X 2FHBA 3S3CB 2N1TE 4X0KA 1DVFD 2Z8VC 3H6AA 4U3HA 3MQIA 4RVBA 1KJ3L 1F8TL 2Y7NA 4AXWA 1I8IB 3A67L 4NQCB 1K85A 5E56A 1AAJA 5HVHB 2FR4A 2XV6B 3V5KA 3ZDWA 1E2ZA 2O5NA 1I8KB 1XGTB 1BGXH 3KPRD 3RPIB 4EN2A 2A38A 1QEWA 4QR7A 2ICCA 2CRMA 4LRIA 4FHBD 4P48A 4LK4A 4XO9A 5AYUL 3VXOA 2NY0B 3Q43A 1SN2A 1Q0XH 5ISZA 2J4WH 5IQLA 1E6JH 1A3ZA 1N2RA 3LRLA 3ZTNL 4WAFA 2YZ8A 4KHTH 3EJYD 5E2VH 3R1GH 3A21A 3BEVA 1XGPA 3RZCC 4YDVB 3TM6A 1HH6A 1JGLL 5K9JL 1NCTA 5F9AC 3QJQB 3PWUB 2EIKB 3KS0J 3QI9B 4ZSOB 3HR5A 5ID1B 3T6QC 2CK0L 5TH2A 1I7RB 2XPZA 3CN3A 3POHA 1UWGH 5CU9A 3BQUD 3NFPB 2SODB 4XVSH 2YSTA 1PIGA 3THML 2IMNA 4QT5B 1FGVH 5DYOA 2WTRA 4Q4IA 1E4WL 4ELMB 3B5HA 3TO4A 1NGYA 3B6SA 4HH9B 3UZVB 5JLZB 3KWWB 3MGTB 2X4RA 3MKGA 4OIBA 1FL5B 1UT2A 1CD8A 4AQOA 3JV0A 2G9HA 2AVGA 3D0VB 2PXYC 5T1KB 5F7UA 2VR8A 1QZ1A 4JO3L 3PL6B 3I6LD 3L3GA 4UTBL 1JZIA 4HJTA 5AZ2L 2O4EA 4OTXL 5CGBA 1AQMA 5DJ6B 1FYHB 4GQZA 1E9QB 2FO4A 3FUNA 2BNUA 3MNWB 1HJBC 4FNQA 2H0EA 4I0PB 2KERA 5CCHE 2IC2A 3DPBB 4JDZA 2EKSA 1GGIH 4H1LB 3WLBB 2ZCLL 1B90A 2QHRL 3JZYA 5JQHC 1G7PA 2YLHA 1XGRB 1NIFA 3HE6B 3PAUA 5I1CL 1I8LC 3UZQB 3ULVF 3GLEA 5EIIG 5DK2B 2OM5A 2JWYA 5IKCA 1L6XA 2ZSWB 2R9HD 5DLMH 4FLQA 1NGXB 1JXKA 3HNTH 4JPKL 2FRGP 2APTA 1PKOA 3EYOB 2YSSA 3IFOB 3DJSA 4FLRA 2CBMA 4U6VH 4Y4HD 5TE4L 2ZF8A 1YYMH 1BQKA 3U6XA 2CKBL 1OSZA 3D12B 3QHZH 4UTCA 4S2SA 5GS2D 2VO5A 2EEBA 3O11B 3S6CA 5IV2B 4D8PA 1Z3GH 2OL3H 4U6TA 4MZIA 5C0NC 2MEJB 1WH0A 4DKEH 3MRFA 2KH2B 5KYXB 3KVDD 1VEPA 4J1UB 1MEXL 1VZIA 5AW4B 1XXFC 2BZCA 3TFKD 1OAKL 1ROWA 3FU7B 3IVKB 4R4FL 1CICD 1LO0H 3HZKB 3IRZA 1RZ7H 1J87A 2E47A 4TUJB 2C7FA 1M71A 2E3VA 3D1MC 1AR1C 3E6HB 4YHYC 5FX3A 1TZGH 5BVPL 4S0HA 1GOGA 1I85A 5D2LA 3ARWA 3T1WA 3UAJC 4IM8A 1RSFA 1LTXA 5I1DA 3QWQB 3N55A 5DD6A 2KPNA 3GHPA 1RZ8B 3X17A 3ML8A 3MOBL 2HMID 3WO4C 4X4XA 4AGMA 2V7NB 1XCQB 3JTTA 5CCKH 3RVUD 3Q05A 1IVTA 5HJ3A 2HJLB 2CLZB 4L4JA 5HHVH 2XSKA 3L3OC 4G1EB 1EZUA 5IMKA 5C0IA 5F9OL 5F2FA 4L3FA 2YJQA 4HS6B 4PRDB 2AGJH 4BCYA 1C08B 4JEGB 1IQDA 4NZDA 4BQ6A 3OAUL 1NCCL 1KJ2L 2EIDA 4AJWA 5I1JH 5DJXB 4MFHA 2VLJB 2WWKT 4XPTL 3A6BH 4JHVA 1UGNA 3QFJA 3N40F 3SB3A 1MHHB 5FGSA 5E1HB 3O2WL 2AEQH 3AWGA 3L7EA 1UACL 3FQNB 4YGVA 2F53B 5JA8B 2BXZA 3B1TA 4FTVE 1DZBA 2R2EA 5AKTA 1HWHB 3TH4T 3TV3H 2P24B 3MX0B 3ZMRA 2ZPKL 3VI3B 1B9KA 1FNGB 5FFOA 3S5LG 3AT8A 2N56A 1RXLA 3WTYA 3D05A 1U3NA 1ZD6A 3I9GH 4XBPA 3HVDA 4X7DC 4GFTB 5K39A 3O3UN 2G5UA 3QRFM 4DFIA 3UTTB 2FBRA 1DLFH 5GRZA 2ARJB 1U8KA 2ZKHH 1NOFA 4P2RD 5I8EA 3HMXH 3VXRA 1RZFL 3VWKA 3K72B 4WDIB 2PYEB 1KGCE 4HAKA 5DMIL 4WGVB 2VUKA 3H9SA 2W60A 1P7BA 3RWIB 4JO2H 1WQVT 2H6PB 5HHNB 4BZ2L 4FAAB 3HLAA 4TUOB 3I9AA 1KXVA 1IKNC 2VDMB 3VE0A 3DETC 1JZ2A 2C9PA 1TJMA 1MFUA 2G2NA 1ERNA 2HYMA 5D1XA 4TSAH 1LEKA 1NKRA 4PJ7B 1JTOA 3CHRA 3D25A 3ZYZA 1QNIA 1MXDA 3BUDA 3EG9A 4A6YH 4FKHA 4WWKA 4Z7UA 2CIKB 1EUUA 4P23D 1SHXA 4JGNA 4QRPD 2BS9A 2LGNA 4NN7B 1T0MA 5L2JA 3K6IA 3WSQL 3IU3A 4KY2A 3EFOB 4EXPX 2QKIC 3RURA 2AQTA 5GZOD 4KKNA 1HHHA 4PY8I 4DP6X 3WNNA 4PWGA 3IU4H 2CMRL 5CZVH 1XIWD 3IN0A 2FJGA 3HHRB 4KVPA 4X8GA 4MHHI 1GAFH 5I8OL 5ITFA 3MLZH 5I6XB 4KI5C 3FFCA 4D9QD 3CGTA 4IU2A 4NZRL 2XVKA 3EFFA 4EAEA 2F5AL 3OR7A 1JDAA 4HH8A 1NEPA 3V5HA 4B7LA 4CC1A 2LABA 3OKLB 1VACA 2AZUA 1CXKA 2V17L 3IFNH 3O6FC 1MI5E 2GSMB 1TSRA 4MAUL 1M05A 5D7SH 2YMOA 4GBXB 2F54E 4YHPB 1MSPA 1MVUA 1UEMA 1SBBA 2VDOH 4YAQB 5IQOA 3ZKSD 1UGKA 4MA3A 2HLAA 4GINA 1QZNA 2EYSA 2A83B 5KYNA 1KTCA 4ODXB 4RMVA 1U4EA 1AD9B 3FRPB 4JFFA 4XCCH 5ADPH 1MW2A 5LNGA 4WV1B 5DEJA 4ODTH 4Z7WE 4EDXA 3UP1A 5BJTB 1Z2KA 4PTTB 3BFWA 3DVGB 3HZ3A 1QX1A 5IMLB 3RI5K 4JRYB 5CIPH 2B9AA 5AAMC 4JHWL 2N59A 4S1QL 2GEEA 3BO8B 5IB3B 2WBJA 2B0SH 5A7BA 5AB0A 1R4XA 3RGVD 4YEEA 1N64H 1G9NH 1XVSA 4H8VA 2VQUA 2VDRB 3KPRE 1B4RA 3GMOB 2WHVA 4HDIA 3TGXA 1OOWA 1OP9A 1KACB 1XF3B 3MYJA 3RTQC 4HD9A 1NC2A 3PP4H 4ZXBD 2VR7A 4X5RA 2H6UA 3MLWH 2CO1A 3MRDA 3ETBF 3DSNB 1Q8MA 2J1KA 2BCMA 4CADB 1MELA 2ENSA 3MTRA 1S9VB 4X83A 5I5MA 3QEUB 5F0PB 1KENH 4LQFL 3BRGC 2W9LA 3C08H 5IG7A 1ZS8B 3AG2B 2IPKA 2EYTB 3I3BA 4NUQA 3WFCL 4NFCA 1EMTH 3L4ZA 1QSED 5F3BA 3PF2A 1I9IH 2YBRA 4S1RH 3AU0A 3EDKA 2UWEA 4H44C 4JFEA 3MXVH 1JWMB 1NCNA 4PBDA 3T3MF 3VFPA 3WELA 1LQBC 3O45A 2VZUA 4LKXA 1NAMA 4MJJA 3RKPA 2C4FU 3NA9L 4WWOA 2DJ4A 3VB9A 4WUKL 4OCWH 4OLYH 3HI1B 3S98A 1HE8A 2XRAL 4FMVA 3QK0A 2H3NA 3L5XH 2VR9A 2R8SL 4GXVH 4GMTH 5KN5A 1HX0A 2XFXB 3KH3A 5CUSH 1W6LA 4PBVC 4JQIA 3SE4C 3UPAA 4E0RA 4MJID 2IAMA 1ETA1 4BSWB 3RG1C 5JIIA 3RFZA 1JNLH 1M7DA 1NGWA 1HL4A 2C1OA 2HG5A 5E03A 1WEJL 3ABZA 3IM1A 4LT7A 3HN5A 2FQEA 4G8AC 3MAWA 2QFPA 1GMEA 1PX8A 2IALA 1SMAA 2GT9A 1SEBB 1AHWB 3I6LE 4YDLC 3ZTJG 2WNGA 1G9NC 3H7BA 1IZKA 4JBSA 4WK0B 3LS5H 4O02B 5DVOA 3NAAH 2NY5L 5C09B 2B8OT 2XWZA 2OR9L 4XAWL 3FQTB 2ZUVA 2VC2B 4I48B 4KFMA 5DRWB 3MRHA 1TKWB 3RP1A 3NZHL 3L17A 4OFYD 1I1AC 4LCUA 2YD8A 3G5YA 2E9IA 2QADD 1GGCL 1ZT1B 2AK4A 1ZT4A 1VZGA 3WFBH 5GGRY 1KN2L 4OD1L 1FBIH 1GSMA 4XNZB 1LNUA 4WW2A 4R7LA 4BE5A 2G3ZA 1IMHC 3ASWA 1J10A 1MCFA 2OI9B 3ZYOA 4HWZA 3G5ZA 5CP7A 1EA9C 1N6QL 2OMTB 5DFVD 4NO0D 3UEZA 5E8PB 1V7ML 2J43A 3BPLC 2X05A 2P5EE 4M6NH 5IROC 5JOFA 4IYKA 3EXJA 3U7WL 2B15A 1N5YH 4UTAL 3B2DC 1QUPA 2YA2A 3BKML 4PGEB 1P7QA 1M7UA 1JK9B 1CMOA 1FE8L 1QNZH 3EOTH 2CGRH 5SWSD 4M1GH 3C9NB 3AW5A 1I7UB 4N0UA 1Z3RA 3GBDA 1AANA 1WFNA 2GKIA 1R47A 1HHGA 1T04A 4UZGA 1QPPA 3B7TA 5AWNH 3VRLE 5CEZH 1ZVSA 3QRLA 3MLVL 3P0YL 4J23A 2D3VA 1TJGH 3DPDA 3VD9A 3R19A 3Q8CA 2VLRD 4O51B 4CN6A 1N59A 4OZHF 4RAUB 4H1LG 2EXYC 3OAZK 4QTFA 5JPMA 2QSCH 1H6EA 1RIVH 3NSCA 3GXIA 4FNLH 4UDTA 3ZO0A 5IW6A 5M95B 4NP4H 3DV6B 2NQDA 1BVKA 1HNYA 4AG4H 1A7BA 1JXGA 5TDOB 3L3IA 3RDTB 1X5YA 2ZNXA 4PJCE 2V9UA 3T4AB 3LMJH 4GKZB 4MKTA 3CHSA 1JPST 3QORB 3TPUB 5E6ID 3PWNB 2ZWZA 2MPVA 3UBXB 1AGDA 4P5KB 1QBAA 2O26U 1JRHI 2Q5BA 3C5ZC 4OM0H 2F7OA 3VFMB 2MWCA 1KB9J 5DQDH 2XIBA 3LPPA 5E4EC 3VXTA 2J1WA 5K9OA 3BXNB 5HYFA 1J1PH 4I8DA 4Q8BA 5E5RB 5HHQA 4L8CB 4LCWD 3WKPA 3JWDH 3QNXB 2WP3O 4G8GA 4XMPL 1WZAA 3CBKB 3B9KA 2D0FA 1AQDB 4GSDH 4TQHA 3MV8E 4RQQB 1A6UH 3V0JA 1YMHB 4EN3B 4R2GD 5GS1A 4QIRA 2ITEA 4TNWK 1G0YR 1FCCA 4P2RE 4A67A 3MJ9L 4LARL 1GYWA 1F4HA 4Y4FD 5ADOL 2P5WD 2HTKD 2EE3A 2X2IA 1ET7A 2E59A 3BISA 2OFQA 4KROB 3ROOA 3L54A 2BP8B 3WN5C 3KLAB 4M8QB 3NJHA 1J8SA 3EO9L 5CGYD 3Q2CA 5KVGH 1KIQB 1E4XI 4MAYB 1YQVH 4ZW6A 4BE6A 3UTSA 3W11C 3UTPD 3L6FA 4F2ME 2YMXL 1I7ZA 4HWEL 3O6MH 4KRPB 4XE5B 5D7IA 3VXUB 3Q06A 2BSTB 3WE6A 4QRPE 4PEEA 4CGUB 1ES0A 3QA3B 4IMLB 3V0VB 4UT7L 4N9GB 5J12B 4NP9A 5DS2A 3K71B 3H56A 2BZ7A 2VDQH 3D85B 4UINL 4Y16D 5I5JA 3W0WA 3ZYJA 4BSJA 1E9OB 3O6LL 2ZXCA 4DZ8A 1F0LA 2YAOA 2XETA 5FM4A 4H25A 5DWUL 3IRPX 4X5PA 5I75B 2VUYA 1IFHH 2X0VA 3MJGX 4G6JL 4OZIF 4UDUA 2ZXGA 3DBXB 4D9QE 5F7DB 2X4NA 3OKKB 4HGWA 3EGSB 3F8UB 1UZGA 1KELL 2YAHA 1I4FB 4AMXA 3N91A 3WIIL 4FFWD 2R2HA 2QQLL 1MPAL 3REWB 1JZHA 5DC4B 5E00A 2EIZA 1FLRL 3SJVB 3ZDZB 2FJSA 4FXGB 5FIEA 3TVMD 2PTTA 4IIQC 3EO0B 1QI5A 3MRPB 3QQ4B 4MA8L 3CFBB 5DK0B 3QR2A 2FH8A 3P9MA 4HS8L 4X6FB 3II3A 5GGRA 4ZD3H 1IIKA 1NH6A 4Q9QH 1LO5A 3OXRA 1HEZB 4U1MA 1UENA 4YHLH 2D0HA 1IEBA 3LRMA 2JV6A 3BDYH 3TO2A 3JWOL 4YR6B 4QHNA 3ETSA 5T1LB 1HHKB 4P2AA 4X6DF 2AJUH 5HI4C 4OZGE 1CXIA 1LQSR 2G2RA 4JAMA 1IGIH 5E4OA 1MFCL 2FBJL 1INEL 1BVLB 2RFXB 4NN6B 5DEFA 2VXUH 4JFSA 1XGUA 4Z8FL 1WT5C 3OWEA 5FW6A 1IQWL 3T9WA 5JW4M 4JZOA 1JCKA 2YBGA 3NACL 1H19A 1XGQB 2EE0A 5CR8A 3DMMA 3HS9A 2GITB 1OM3L 5FOBA 3A24A 2EC9T 2XZQH 4APQB 5E1AB 2BVPA 1UM5L 3S97C 4ZG1A 5IB5B 3FT2A 3KZ8A 5DFAA 1T89A 1DVSA 1PD0A 3GWJA 4MD0B 4LEBA 5B1AB 5GJSL 2IJ0C 2ALWA 1NGPH 3D0LA 4ODVH 1YEHL 1O6SA 4RFOH 1J05B 3QDGD 4HQQL 2W0LA 4Y2DC 3O9WD 1V3JA 3BSHA 1F6FB 2UUDH 1W16A 4HIXL 4PLOB 4N2LA 5GGSY 1F97A 5JHLA 1DL7H 3CAFA 3MODH 1IM3B 4F8OA 5C9KA 3D50A 2OMUA 4YE4H 2LU4A 1DO6A 2COVD 3DI3B 5J6GB 4LDEB 3O4LD 4KZEH 4B3EA 5E8DL 2WTPA 4ACTA 4OLUH 4M7ZC 1PDKB 2NY3C 2UX6A 1R3HA 1G7QB 1NIBA 3JQOB 1TU2A 2JKXA 3FUFA 4TF4A 2WXRA 5CCGE 1KB5H 3BH8A 2F7RA 1HILB 3CK0H 5E9DA 2Q7YA 3QARA 3FRPG 5CD5D 3MRKA 3NZUA 5K1JA 4XHQA 4XNMA 3RWJB 3PCYA 4AVJA 1JE6A 2JB6A 3AQXA 4MJIE 4M5SA 5C9JA 1OIOA 2QDWA 1KEML 1CT8A 4N2BA 2EABA 4Z3JA 5KVEE 5ESAA 3OLGA 1HSBB 5E99H 4U7KA 5MENB 2ZOKA 3BMVA 1PJ9A 4XNQB 4ZMWA 5IFAL 3BP6A 2Z9TA 1QHPA 2HVJA 4ZAKA 3VU2A 1CBVH 2G5BA 3VTMA 4GUCA 2A9BA 4AQZA 1ZJBA 3DSFL 3GSVA 4GKNA 4FYTA 2OW7A 1FN4B 3QDAA 4G43A 1MCEA 5DR5L 4ZDHA 1I7TB 1NFIB 2ZUTA 5C0GA 3FK3A 2I9TB 5D70L 3OG6B 2BK8A 1V05A 4QRFA 1EHKB 1CL7H 1JI2A 4WW1B 3L3DB 1UXLA 4IHOA 4L2LA 5DJ0A 3QUXD 2FJFB 3ISYA 3NN8B 1ORSA 2ERJC 4M3JA 1RZGB 5KYWA 3RUGE 2BC4B 1DFBL 3K0WA 1CJYA 3MRCB 3X2QB 1F58H 1IGMH 3ARDA 1UWXH 3AROA 4FZEL 3FUIA 2BVTA 1JTTA 1G7MA 1QQDB 2Z93B 3QXDB 2R1XB 2OS7A 2Y5EA 1MCKA 3TT3L 1DBBL 3MOQA 2N7AA 5EOTB 4ZPVA 3SDDA 1YEIL 1QFUH 3CX5K 5LBSA 4QLRA 3CC5A 2KDGA 5EC2B 1ACCA 3Q7JA 2HUHA 3T8MA 1AMXA 4DESA 5BOPA 2DYPD 2JELL 1FC2D 1NFDF 4BIKA 3N50A 1N3NB 2WUBH 4M9PA 3SZKC 3NIFF 2M2DA 2V2XB 4PY7A 1A3QA 5L2KB 3IGLA 1YMMD 3LV3B 5ID0A 2WTOA 2NR6D 2MH4A 1FFNB 2JKSA 4HKXB 3DJRA 3CWGA 1H3PL 4MASA 3RX7A 3S3DB 5FM5M 1CC3A 1J0YA 1F90L 2Z7YA 3PDDA 1IKFL 2KYIA 3RWHB 4NKQB 1V3KA 1R3IH 3LKQA 5KS9B 3GSOB 5I30H 1A3LL 1QACA 3V4VB 3OGOE 3QG6A 1RJZA 1W0YT 1KBGL 1P4UA 3LKRA 4DGYH 3V0DA 1PLGH 4JFXA 3WNJA 5FKAB 1ODAA 2IOOA 2J73A 2RQEA 2MKWA 3VYOA 4L48A 1YEEH 3FOMB 2P80A 3FCSB 4L9LA 4NUJA 3U6RB 3QEQB 4WI5A 3W3BA 3UX9B 2YKLH 1FO0A 4WI2A 1BG1A 3BSZL 4A7SA 1EJFA 3GMNB 25C8H 3DUUA 4P2OA 5DMGC 4HUNB 2EILB 2X4PB 2B39A 4LL4A 4ECNA 4IJTA 4F7TB 2VDKH 2DBJA 3GRGA 4H8WC 4H8WL 5EUKB 3VFVA 5CF3A 4UNTA 1A02N 4Y5VC 1U21A 3BVDB 3DROB 4LCWE 3U9UA 4W9IC 2NNAB 3L4WA 1KWKA 3FB7B 4K0OA 4U1GC 4I2XA 1H5BB 4FABL 3ULUD 4NQXB 5D2NC 2GJJA 4UQDA 4JKLA 2V4LA 2VSMB 4N2DA 4AYMC 1GOHA 3NJJA 4I13B 5I0VA 2IFGA 3NRPA 4WU5A 5IB2B 2KZBA 4OIIH 3P4LA 4XH2A 2P5WE 2R29L 5D7JB 5GGSA 3IRCA 4Y1AD 4DERA 5GZNC 1GMIA 2ZAHA 2F8XC 2C8NA 4NQQA 4JM2D 1LK3H 1PGRB 4KAQL 5IHUH 4P4KB 2ISDA 3BGFB 5HI3D 4KUZH 3QIBB 1IILE 4E5XB 2V37A 3EW3B 3IMTA 1DANU 2IXQA 4PLKC 1KPUB 1XAKA 1MWAB 3B2UC 3L5WB 5HYJA 2VW7A 3N9GH 2BY0A 2TRYA 2DWEA 3UTPE 2VZSA 1AXSB 2R56H 2Z34A 4LLVB 4XNXH 3UJTL 4F92B 4J2QA 4DQAA 3B7UX 4HBCH 2VLKB 4PHXA 3X14B 3OJ2C 3MROA 4BA8A 1W0WA 3OMIB 1DJZA 1G9EA 3CSBA 3B7SA 5DD3H 4GG6A 1UXWA 5BW7A 1S6NA 2MQCA 4Y4KC 5JXAH 4O4YH 3IDJB 1NBZB 1U8JB 1T6BX 1A0QH 4P05A 1DQLH 3UBXG 3VI4F 2X7LB 1EH9A 5SWZA 1NWPA 2PO6D 1KZQA 3AS1A 3SE6A 3W9DA 1J9QA 1P6AB 2JLLA 1DQML 4TMPA 4PG2C 5IIEB 4NGHH 3H2PA 1FLTX 1QVOA 4JY6B 2RTTA 1GGTA 2WXHA 5ILTL 1MF2H 2DQCH 4IHBA 2OULB 4XOBA 3EAKA 2DQDL 4ZUSB 3S34H 1Q9LA 1QLEL 5HHMD 4ZFFB 1MAKA 1U91B 4JVWA 1MFVA 4FFTA 2QLYA 2X1OA 2X4UA 2VLLA 5E2WL 3RWFA 1O5PA 12E8H 4PJGF 3C60A 5KAQF 3FONA 5FLUA 2WQXA 2V6HA 2Y3NA 1J8HA 3NK4A 1X4XA 2FZ3B 3Q2VA 4M43L 5EUOB 4YXKH 1A1NB 3AT0A 4X5WA 4JFYA 1WHPA 3F2LA 2W91A 1DZ0A 3MGAA 4MBRA 4ANVA 2A6IB 4U6HA 2NUTA 3SCMB 5KVEL 1PFOA 3KL0A 4QNPF 2ZX8A 1JHKH 1R17A 3DHJA 3JWNH 4WIQA 5HHOE 5KVFE 2AS5M 2JKIS 2WB1A 2P43B 5E6SB 1MW0A 4OQTH 3ZJAA 5F9WB 5EBGA 4E9RA 5EEVA 3BVTA 3BLPX 3BWZA 2BHUA 2P26A 2HKHL 3NSXA 4P57A 1MFAL 2QHLA 4YO0B 1X5LA 3BAJA 2Y72A 4RGNB 2VW4A 3TIEB 2WWNA 2I5YH 1U8HB 3D34A 3D48R 5C7ZA 1E3ZA 1SDDA 3E8UH 3N3EA 3CIQA 3Q6GH 4XGZA 1JN6A 3UG3A 1NMBH 3VXMB 4IOIB 2F1EA 3ET9F 5EBWA 1I8AA 5T3XD 3BP4B 2FB4H 4L3AA 4MX7A 5GRUL 1RERA 1T4WA 3WJJC 1TJIH 1KV7A 3QDMD 3O4LE 5HDBE 3VB8A 4FFYL 4KMTL 5DJAB 2ZF9A 4HSAC 3U82B 1C5BL 3LJ3A 1JD7A 5EC1B 5EN2A 5FO9A 2L7QA 1EO5A 3KAAA 5KSUA 1MRDL 3WN6A 3GIVA 1OANA 2YHGA 1ZIAA 2OMVA 1MJ8L 2HN7A 3NMEA 4PRAB 3KGTA 4PTUB 2J57A 2PF6A 4PJIF 1OAQL 4PJ9C 5HGHA 3TONA 1KCSL 2R0LL 3F5WB 2FO8A 1JPGB 2HX8A 4F27A 4R4BB 1XD1A 1S3RA 2R0WL 3GMQA 3JWNC 3HE7B 5EO9B 5FGCE 5HYEA 2E8YA 3FQRB 3ZX1A 4Z6AT 2YWYA 3KJ6H 3QZNA 1CGSL 2L7JA 3MRLB 3VFGL 2AQ3A 4O9HL 1F3JB 4KU1A 3ILPB 4FOMA 5HVWA 2HPTA 3GM0A 1U8LB 4IEFA 4NQDB 4XCYA 1MLBB 2NTFB 4M56A 5JDJA 4ADGA 2R1YA 2NZ9D 2E6JA 1RUQH 3VGHA 1NCJA 1ND0B 3IGAB 1EX0A 4GMSL 1ZHLB 5EF2A 2PR4L 3Q2LA 1T20A 1CE1L 1CFTB 3NCJL 2WVVA 1UJ3A 2WZAA 3U2JA 2ZYHA 4JN2A 5BZWB 1WWWX 3V0AC 2NXZB 1X7TA 4HULB 2X3CA 1AXTH 1YECH 4UUJA 3D0AA 1QASA 1Z9SA 4FQ1L 2XY2A 4PI0A 3CVHH 1BZ9A 2YD5A 1WRFA 1WZMA 4ZMVA 1LE5B 3QJHB 3STZA 3HPJB 2EIMB 3QWOA 2BNRA 1S7VB 2NY4D 3ZKXB 1U8NA 1AKJA 3RIFK 5L88H 1XGZA 4PAZA 2VRKA 2DQEL 3IGKA 1OQXA 3MV7B 4M5TA 4R2GC 3IJHA 2J8UF 1T21A 3EF7A 2R2CA 4IRZL 3BSGA 3S96B 3AY4C 1HE7A 2YQBA 1YMME 2AXFA 4TLKA 2OMWA 3FSAA 4MMZC 2VE6B 2K0RA 2YPLA 4L2YA 5JYMA 4KO5A 4Q0XH 4UT9A 5CGYC 3EOBB 4BFOA 2Y6SC 6TAAA 2VXQL 1K5NB 3B2VH 1T3FB 3QJFB 3GSXB 5CSZA 2D31A 1NGZA 4KI5F 3AUWB 4WI8A 1BREA 4XP4H 5F89A 1L0XA 4NQCD 3GBNL 4M6AA 1P7KB 2F8OA 1MHEB 2IMMA 3J8F7 4PSPA 4GEIA 1JZJA 1DEDA 1R5VB 4Z7OE 3BPOC 4ZTPL 3QQ3B 1T1ZA 3MDJA 3RAJL 5FYJH 3T65B 4F7MA 2APSA 4ZS7L 1KLGA 2UY7A 1J1OL 4QHPA 3NZSA 1ZRUA 4Y16C 2BJML 2Z3FA 3T04D 2IH3A 3QFDA 4B50A 2OYLA 4PJFE 4LCIL 1CFVL 3BH9A 2HLFD 2WLKA 2ZX6A 2Y7LA 2W0FB 1WWAX 4ODHL 1CU4L 2ZUWA 3D08A 1NUFA 3PHQB 1MUJB 5G4NA 4Y9CA 1SUJA 3BPNB 4HCFA 2LTQB 2NUPB 5EB9A 5KVMC 2XA8H 3HG3A 2AJXH 3O81A 4PP2A 1ETZB 3UPRB 1MDAA 3QI9D 5FECA 1YNTF 5KSBB 5C6WH 2APVA 2X9XA 4WI3A 3ULUE 2NNFA 4YXLL 3D39E 4AXWB 4KJWD 5AOZA 4QTHA 1EHXA 3FQ4A 4TVPH 3CFJA 2W0PA 3PIQA 4K3JH 1YY8A 4Y1AE 5C0RL 3HPLA 3A4AA 4DUVA 1S9WB 1X5IA 4ACPA 2LVCA 1N2RB 5DHVB 5T1KD 3LKNA 2AQQA 1E4KC 3S5ZA 1KXTA 1O9WA 2A7BA 2QKSA 3F6JA 4OLWH 4NJ9H 1XGPB 2LU5A 3GEFA 3PL6D 4JDEA 2O61A 3CHQA 4RGOL 1TTFA 1IGCL 3OJDA 5E5MA 3S88H 4KKZA 5KVFL 3DTUB 5D4JA 1GKOA 4I3RL 2YD4A 4UAOC 3WU1A 1I82A 2BVQB 3T6ZA 1E6OH 2ESVA 5ACMA 5FA4A 5D7EA 2EDOA 2YAEA 1MFDH 1EGJH 2ORBH 2PPFA 1G7JA 3GMLA 4ODBD 5TH2B 3L13A 4MCMA 1X5HA 4I0CC 4N8CH 1HHIB 4TQPA 1ACYL 1D9KA 4DO5A 4GAAA 2F15A 3J2PA 4OGAD 4YQXH 5IFJB 4KZDH 2F6AA 3KHQA 1MIEL 1T83C 4PJHE 2UXGA 1W9XA 5JQ6L 1XX9C 2WTRB 1AD0A 2D4DA 1ZMYA 3MKKA 1NGYB 3B6SB 5F21B 5J89A 4PV1C 1UCBH 4DEPC 1B9ZA 2X4RB 2P7TB 1Z6JT 1VFOA 2XG5A 2YAMA 5HPMA 3ISWA 1FNAA 2YLKA 1XCTB 2V3FA 1AACA 4U7SA 3KEHA 1OGSA 5B8CC 1X3DA 5HHME 3L3GB 2IGFH 4DHLA 5D1ZB 1F2XK 4XNDA 4EQ3A 1RUMH 2FO4B 4ESKA 3QPXL 2BNUB 5IY5B 3FQ2A 4N0FA 4MSWB 2Z7WA 2JKLA 4NHCL 4U49A 4XP6H 2HTLC 1XHHA 5DC9B 4JDZB 4M7LT 4ZFQA 1KCBA 2Y23A 4DF9A 4QJ5B 5GS0H 1PQZB 2JQMA 3QHTC 4LCCB 1G7PB 1PVHA 2J5LB 4H88H 4E5XG 3DO4A 2CLVB 2Y1AA 5DUBB 1EV2E 5JPNA 5ACLA 5IKCB 1ZA6A 2PWHA 4YDMA 4XWOD 5JORA 2IADB 2YSSB 1YEKH 3MCKA 2C9AA 4XPFH 3VXNB 3EGXA 3SEPA 1YN7A 1WWBX 4Z1PA 15C8L 4PCTA 3LRGA 4FXLA 1MCBA 1CLOL 3FXIC 2DH2A 5KBKA 3AREB 2J6EH 2R23B 3CFCH 4X5XA 4HLEA 4AEHH 2PYFB 4OSUH 2AXGB 1LK2B 3K4ZA 2Q7AA 4K71B 5LXGL 2BZDA 4PJAB 2PWEA 4ALAH 4RESB 1OY3B 4EI5C 1X7QA 2EIBA 5DGQA 2VLJD 1K3IA 3DX2A 2Y7OA 1HEHC 2L8AA 1YDPA 3FCBA 4GNKB 4NO3A 5T3XE 2DEXX 4FQCH 3B43A 3K2UH 3QDME 3T77A 5DS1A 2QGEA 5BZXA 5TDPA 3MV9A 3L1EA 1BD2A 4ZBJA 5DQ9A 4FCAA 1QAWA 4RMRA 4KY1H 5E9AA 3DI2B 4DN4H 3O8XA 5CJ8A 5DD6B 1XF1A 5J56B 2ADJA 2CUMA 2ED7A 2B3RA 5C07A 2VQTA 1MW3A 3G6JE 4PRPE 3IJEA 1BJ1J 5HJ3B 4B5ZA 3QXVA 3SKNA 3IAQA 2BM3A 4HKJB 4NCC1 5IMKB 3ARQA 5C0IB 3BAEH 4UQ3A 3I6GA 1MCHA 2PYED 3QE5A 4G9FD 5K9QG 2DICA 3OSKA 2NR6C 3K6SA 1KTDB 1ZXKA 5B39A 2OQJB 1B0RA 3IJSA 3RL1B 3EKCA 1RPQA 3EZJB 4U3XA 2YXWA 4J8RA 5GGVH 3UPCA 3TT1H 1M9WA 3T2NL 1UXSB 2APWA 3ARFC 4RZCA 4CBPA 1D7FA 4ENED 4L0ZA 3RHWK 2R2EB 4ZMTA 3D09A 1A22B 1ZJAA 3JSSA 4X9YA 3BKJH 5B1JA 1A9BA 2GB2A 4ALAC 2A3TA 4ZS6D 3DGGB 5EF1A 5GHWH 3I3DA 4MB5A 3WBDA 5FHAL 1GSKA 4Z7VB 4CU6A 1U8IA 3SDCB 4FF9A 4QXGL 1KBBA 3CU7A 1MIML 4XCFL 5K39B 1QRNA 4U1HA 1A4CA 2NW3A 1NBYA 5EOCJ 1UADC 1U8KB 3BIBX 5T5FA 4OZHA 4UWQB 5I8EB 2KI6A 2ZXEB 3VWKB 1XO8A 3RI5F 4BFJA 1HQRA 3QWNA 3EOYG 1GIGH 1N0XL 4KHTL 4NZTH 4I1PA 5ICXA 1RSYA 1SLUA 3FT4B 1YUKB 4JPSA 3P3UA 3GTNA 5D71H 4DQOH 1ZANL 3HG1D 4X8XA 1C5DA 1HVXA 1WS7A 2JXMB 3VE0B 2V7HB 3KLHC 4HCIA 4JCWA 5DQJA 5D1XB 4Z5RA 3ULUC 4QDGA 3ULUL 1T6VN 5TE6H 5CJXC 4GBXD 4POUB 2O6EA 2E4FA 4G6MH 1ZLVK 4EI6A 1JZ5A 4U3SA 1D7DA 3NZ8A 4XXDA 4KKLD 1FV1B 4GQQA 3CHXA 2DDQH 3M88A 2CPUA 4LEXL 4M1CC 4P46A 4XPHH 4UNIA 4A7QA 4XVSL 2OJZH 3IDIA 3MXWL 4XNUH 4DJMA 5J6SA 1T0MB 3IU3B 3C6SB 5C0CD 1IRAY 1XR9A 5HI3C 3ARVA 1MW1A 2EH8L 3MNVB 3JUYA 3QHFH 3EJZC 4OCSH 2MCAA 4WENB 2AI0L 1QUNB 2ZOTA 4F9PC 3TF4A 2BIMA 2WW8A 2JKJA 2FJGB 4JRYD 1E28A 4EJ1C 4FG6C 1ZGLA 4Y9BA 3G6DH 4NI6A 4YX2L 3N44F 4NQCE 1NBCA 4IU2B 3V0FA 5IR1A 1N8ZA 1VENA 2EADA 1GS7A 5I0XA 3F01A 1TIUA 5AD0A 2RB8A 3V5HB 1VACB 3VFTA 4LSQH 4AKOA 4OZFH 1PJWA 4GS7B 2BIHA 1QW8A 3UZEC 3V6FA 1OARL 3CFKB 4ZUTA 5GSRB 1KCVH 3E0GA 5HDOA 1W72L 3JV6A 5GGTA 3V4PL 5H37G 4JK0D 1WAAE 4HOXA 4RDQF 3WKMH 3VD7A 3ZHDA 4Z7NB 2ROXA 3J07A 5EOQH 1OAXL 4PJ5B 5DLML 2KUTA 3HNTL 3DHUA 4YSTA 5TE7L 1KCLA 3DC0A 1RFDL 5GISH 4ZSOE 1FSKC 2CM5A 4JFDD 2Q8BL 5F7EL 1HN1A 4IGBA 2KDYA 1NOAA 4HMCA 3DXAA 3PNWB 2WBJB 2G30A 3CCHA 3J27A 4RRPG 1QEXA 5MERA 3ARYA 3OX8B 1HDMA 3ZDXF 4OZIA 4KDVA 1A7PH 4ELME 1S9XB 2IPTH 1P84J 4HDIB 4LSSL 1X6NA 2VERN 3MYJB 3T1FA 1M53A 1Q72L 1JZFA 2CZNA 2Y5TA 2HFEA 2ZUXA 4UZSA 4JFVA 1PKQA 4JB9H 1I75A 3U4BH 1JPTL 4UM8B 4WSKA 3QUYA 3H2WA 4HXBL 2QTVA 4IW4C 2WWOA 3KYOA 2VDPH 5IG7B 2IPKB 1KYDA 4NRXB 3E1F1 4OF0A 1BQLH 1I9JH 1MY5A 2D73A 5F3BB 3DV4A 2G9KA 4HHAB 1PF3A 2YBRB 1TZGL 4P9MH 5IW1B 2JIXD 1AGBA 2P5PA 3ZQWA 2XZCH 5ITBH 1JZ3A 4XN9A 1FL6B 4X6DA 4X9HA 3VFPB 1KIRA 3IB4A 4LKXB 3HC0A 1NAMB 3KXFA 4U1NA 3EH3B 4EBQL 4NKDA 3MVSA 4IS6B 5FYLE 1PZSA 1VRSA 4UIMA 4MYPA 5DJYA 4G80A 3K6NA 1QSFA 4GXFA 4AYBA 1HS6A 3TZVD 1VJSA 3UJIH 1X9QA 3T2QA 4C56A 3PGDA 5KN5B 5DFTA 3AAZA 4PVBA 3OLIA 4E0RB 3BT2L 1IAKA 4I88A 5T3XL 5IP4A 3RFZB 5G4MA 1M7DB 1NGWB 3GSNL 5DVNA 4R7DA 4BRVA 2B16A 3KBFA 4YXHL 3A6BL 4R9HA 2N01B 4CKVX 4YDJA 5MI0B 3VRLF 2JCCB 4MVBC 4RCAA 2LQRA 1NDTA 1PNDA 2DKMA 3FB8A 3SGDI 2MHAA 5FYKH 1I8MA 4MMYB 3ZW3A 1TFPA 1S8DA 2ITDA 3U0WL 5JW3H 1BYOA 4HYTB 4OF8A 3T08A 1EAOA 1VERA 4TPRH 3MLRH 5JA9A 1IKOP 3FQWB 3SGKA 1AYRA 3MJ8A 2FCBA 3FT3A 5KBPA 5ICYB 4HEME 4LCUB 3S35H 1T80A 3CN0A 3HS0B 1YNLH 4ZFGL 1ZT4B 1CGXA 3A6CH 4KQ4H 4R96B 2XQ0A 1JZ8A 2O5YH 5KYYA 4YC2B 2B59A 4AC4A 3EYQC 3EZ8A 1SYSB 3D2UD 3C6LC 2GJ6D 2C1PA 1NANH 4XCNA 2ZWSA 1W2KT 1K4DB 4ZX3A 3MCLH 2Y2TA 5CO1A 1BQUA 3FUHA 2GFBA 3INUL 2GJRA 4OGZA 4TLUA 4ANKA 5DFWH 4PS4H 3D4ZA 2W38A 2BMKA 4PR5A 4TSAL 4RETB 5KZCB 5JUEH 2EVIA 5C7XH 1BM3L 4WI9A 1TZHB 1DJIA 1P7QB 3S48A 1TTBA 1T66D 1I9RH 3L4XA 2OP4H 3GSWA 3QORD 2VLJE 1RZKH 2GBAA 2X70A 3ZXAC 3LNDA 4E42A 4IOSD 4HLZH 1HCFX 1HHGB 2WOBA 2R2BA 1B0IA 2A1WH 2FWLB 4MYWB 3RWEA 1LMKA 5FUCC 4Y8DC 5ETUA 3ML9A 1GAFL 1TCRA 1U42A 3KNBB 4LNRA 4G3YH 1FGNL 3NRFA 4PJDF 3VG0H 1GZHA 1QR4A 4XOCA 1PEWA 3T09A 2N0KA 1JNNL 3Q1SL 4O58L 1HKLL 4UM9A 5KSAC 4MCYA 1LJMA 4DP8X 4EN3D 1JWSA 2QVFB 4GP5B 4GRLB 2WXIA 2COQA 1BVKB 3WMSA 2PYEE 3RVTD 4UU9A 4G9FE 4KROD 3WUWA 1IJ9A 2FX7L 5AG9A 1AC0A 2WC7A 3CQQA 5D4HA 5DZVA 2L04A 1JV5B 1YJDC 1YJDL 1Y0LA 2AJYL 4OCRH 1XSIA 4LSRH 1KTLA 3WFHA 2XXCB 1OSPL 4DVBA 1S7TB 3U7YL 1KBPA 2WAQA 3LRSA 2WIIB 4GI6A 2PMZA 3V7MA 2B2XH 1MCQA 5I1AB 4KRPD 5IJVB 1NFDA 3CFMA 5CZXD 5HVHC 1NCBH 2OTUA 3NPSB 1QA9A 5HDQH 3AXLB 4P2YA 5BNXD 4BGDA 3H53A 3WIHH 1GPOH 1IBYA 2DOCA 1H9DA 4JG0L 3TH3T 4OKVB 2NY0C 3FO0L 3D85D 1MREH 1PCXA 3RIAF 1EVUA 1E5ZA 3R4DA 5KANG 1A7RH 1NFKA 5DDHB 1A47A 3SQOL 1Y6MR 5HGAA 3BD5A 1ADQL 2W92A 4LMQE 3KYNA 3WS3B 3WV0A 3MR9A 2K4WA 2FSEA 1M6OA 2LLLA 3LS4L 3MLWL 3ROOB 4TTDD 3BWSA 3SDYL 4Z3EA 1KGUA 3KPPA 2BCKB 3ARBA 3ZSTA 4ZW8A 3HG1E 4KDTA 3IAGC 4YDIH 4BUGA 2BIPA 1NINA 1ROCA 4J8QA 4MWFA 1WYJA 3TBCA 4UQ9A 1HEJC 4JE0A 2O30A 1I9IL 5I8KL 3SQBA 2H4EA 3ERXA 1I7ZB 2F19H 4I1NB 5D7IB 1E27A 5DMYA 3E1ZA 1TJHH 2CKBB 4QYOB 4F7PA 1BBDL 3PAYA 1KC5H 4K07A 3OXSA 2YD1A 1J9RA 3CD4A 1UWEH 1ES0B 3DIFB 1OWWA 2X1QA 3R8BB 4CC4A 1RZPA 4HLJA 4MNGB 3AXHA 5C0CE 5B3NA 5JW4N 3ECBA 2EDNA 4BDVB 2EDRA 2W94A 2C4FT 2WWMD 5JW4R 4DIXA 1NDGB 2CQVA 3L5XL 2MOGA 3MTXA 5CUSL 4HEPA 3GZKA 3NJNA 3TA3D 4JRYE 1MRCH 5BQ7B 4JO5A 4UQIM 4Y2OA 4UDUB 4UIKL 3WJMA 1NPUA 1V3MA 3QXTA 2AEPL 3HRZB 4U1LA 2X4NB 4HGWB 1K5WA 3W56A 1CXEA 3TN0C 3O3DA 3CXFA 1JZEA 4I0PC 4F5CE 2BIOA 4APQD 3UCRA 2E7MA 3CLFH 5E00B 3HC3L 1YG9A 3ESNA 2PTTB 2XTJC 1WS8A 3HE6C 1EFXA 4Q6YA 4XX1G 5FYLL 1OLLA 4BBWA 5GGRB 3KLLA 5I76A 3RZCA 2CRIA 1VPOH 4OLVH 4CBZA 5DZNA 3MLUL 3OXRB 3MBXH 1IC1A 1IEBB 4HXAL 1T22A 2QELA 5C6TL 1EEUA 1NC4A 3F7YA 4QHNB 1O9VA 4YPGA 5EFIB 5GJTH 1T1XB 4G8FB 1IM3D 5CMAA 4P59H 2AV7A 2G2RB 4JAMB 5D1QB 3WE1A 2BDNL 4JFDE 4ZOEA 5DEFB 5AAWC 4HUXB 1XGUB 2CK2A 2VWEE 1F4WH 4OJFL 1IBGH 4S1SH 3LH8A 4WEBH 4JZOB 3VI4A 2V0AA 3EJRA 3KDMB 3DMMB 1KPVA 1YQ2A 3EH2A 5F1KC 5FOBB 3KYMA 5DK3A 1OB1A 1FH5L 3KLQA 1N10A 1NGQL 4QOKD 1LE9B 1UT1A 3FT2B 4W9HC 2PXYA 2AK1L 3MBEB 1RUKL 3F04A 3WUZA 1OE2A 3QUKA 2OYMA 1OGAB 4PV8B 2CCVA 1O6SB 3BN9C 1BX2B 4ZNEE 4UTBA 5AYQA 4XWOC 1E8ZA 3ABMB 4R5XA 2L0DA 3OPUA 4P5MB 4W70A 2V3EA 4IBWA 3C6EA 4IRJD 3F83A 2OMYA 3EHBD 4PJGA 3CQFA 2E0PA 2PCFA 2NXYB 4ISVB 3UJJH 3QH3B 1A2YA 1SDYA 2H9GA 1WHOA 3FJTA 4HGKC 3DRQA 2FIKB 4GYBA 3SYQA 4CVZA 4JKPH 4ZMNA 1JF5A 1A5FH 4KQ0A 5IHZB 1NM9A 5IMOA 4LCVA 3FSOA 4JQVC 4G9DB 1TU2B 2E9GA 3ZKMD 1S5IH 1YCSA 1RIVL 5CN2A 3ZE1F 3NJFA 1N6UA 3S5YA 3BH8B 4L9DA 1V3LA 5E9DB 1OAYL 5I18H 3H0TB 4MA1C 4AG4L 1A25A 4YBLC 4YEFA 2VABA 2OSWA 3KPSA 1MNNA 1CQYA 2XN9A 4UQAA 4K23H 1QFOA 4QLWA 5C9JB 1OB0A 3LH9A 4CILA 4DAGL 3H1ZA 2VITB 1CT8B 1EDHA 4X6CF 3WXWL 3AG3B 5CLYA 3FYEB 4M6OH 1G4MA 3MRNA 2DQHH 1GH7A 1J1XL 1Q1PA 3WKYA 4ZAKB 5HVGB 2IOIA 1GC1H 3IETB 2IAND 3ARGB 3GSVB 1J1PL 2X6VA 3U4EA 1UC6A 3NA4A 3M7OA 4N6QA 1HAUA 3GHEL 3JWDL 5FM5O 3TJPA 5C0GB 1DVZA 3QQ9C 1KDJA 2OAAA 1NMAL 1A7QL 2QV2A 1NEZA 3TFBA 2EVGA 4EDWH 5C0FA 4L3EA 1XH0A 1UA3A 2X2JA 4R26L 4IHOB 1TLMA 5L2KD 1UA6L 3IPBA 3DOIA 1GHFL 1B3JA 2DIBA 4TUKL 3IJYA 3VXQA 3D4YA 4MDJA 2VDML 1K8DA 4Q9RL 2GJ6E 3QZWA 2VXSH 3IT8D 4PJIA 3A4EA 3TIDA 3F85A 3ARDB 1JVLA 3L3OA 2CHWA 2E7CA 3HR6A 2A74B 2Z7ZA 4WEMB 4F3FA 1K4CA 2TSBA 3GUTA 3GB7B 3VWJC 3WEMA 1DBJL 3QEQD 1KJ2A 4CDHA 5CD3A 1A4JA 4NN7C 1DDHA 2IG2L 3QBTB 5F7NC 3U4AA 4OD3L 1JF1B 4RBPK 1FZJA 5I9QB 3WFZA 4AMKH 1LXMA 4WSGA 1TQBC 4XBGA 2KMWA 2HFFA 1SN0A 1YN6B 3ZMNA 1P4LB 5FLVA 2LE9A 5E2UL 4PY7B 4RWYL 3BUTA 4QWWD 1KIUA 2DQGH 1PFCA 4GIOA 4N0YL 5GIRA 5I6XC 1T1YB 1RZJL 5HYSA 4O2EB 1BJ1H 2K45A 1UVQB 4J12A 3SPJA 3CN2A 2WVUA 3FQUB 1M3IA 1Q9WB 3QDHA 4N24A 4QI3A 4QHUB 4WUUA 4AYGA 2FATL 3LKQB 5E2JA 1ZLUH 1SHMA 1FNSL 1EERB 3BX7C 1RJZB 1EHAA 2R0ZH 4D0DA 1WF5A 5TDNA 2CLRB 5DD0L 2A6KB 3SOBL 1QLFA 3T0ED 4RMBA 1GVIA 4NUJB 5D7JD 2P3YA 4LE8A 1TQSA 4Z0XA 3UEQA 5EU3A 3TBBA 4L1SA 3HA0A 4TVPD 3MYZA 4AC2A 1HL9A 1F6AA 1H3GA 1IKNA 1HINL 3BZEB 3AWEA 5PCYA 4WV1C 3DUUB 3HB3C 4JO4H 3HNVH 4JFZL 3QIBD 4DNLA 1WTLA 5L6YH 4YHZL 1MAML 2NSMA 3RX9A 3BP5B 1PSKL 3W38A 3U1SL 3Q9QA 5HI5D 2J8UA 3VXUE 3I6KB 4U6YA 5F7LB 4TRPH 4TYUA 4NPYB 2VLKD 3O3EA 4N2FA 5EOCH 2VDRL 4ZTOL 1G7IA 1ZLDA 3CE1A 2HRGA 2QKIA 1WFMA 1S5HA 2QPDB 2CR0A 3BE1H 3MACL 2DB8A 3L95A 4PRHA 4ZFOA 4HJ0D 5IB4B 1FRGH 2OR8A 4I2XB 4QF1B 2IH8A 2KPWA 2XT1B 4K7FA 3ZHKA 4B9ZA 5JXEC 5F7YC 5IOPA 1OTSD 2JF1A 3ZMEA 2TAAA 3ASOB 3D69B 4XH2B 4G70B 5GGSB 3ECUA 1UOVA 5AOJA 4YNYA 3ZZSA 4KO9A 4ODVL 5LG1A 3WTSA 2NY1B 1VLXA 2QR0A 5J0BA 3FN0H 1RULL 4J3OG 5AW0B 3PQYB 3O6FA 1OCWL 3NSDA 1WBYB 2IXQB 1MFMA 3QP3A 1NEUA 1YC8A 3HMXA 4PWKA 2Q3AA 3SJVE 3ZDZE 2VWEC 2HRLA 3OHXC 4M61A 1AHKA 2E86A 1YY9D 3HLKA 4ICXA 2VMFA 2X2HA 3QB7C 4CMHB 5DJ8A 5I73C 5I1EH 1HAWA 4DP1X 1W0WB 2DI9A 4AGPA 1INDL 5HVFB 1H15A 3VSVA 5A2CA 3BRDA 2FLBT 4XPBH 1UXWB 1Z0MA 3QPQD 3CK0L 5DO2D 4KKAD 4PJXF 2QVMA 4A6YA 2G4EA 1T03H 4FZ8H 4FFZH 1YNTA 5AAMA 1BJMA 5CNHA 5GS0D 2B1AH 2GUOB 3LN5B 3V5DA 4PY8J 4LLYB 4GFXA 1KCRH 3B8SA 4BZ1H 3BVUA 5I16A 1AHWC 4XHJD 1T1WB 1JVOA 5F88A 4DK5A 5F0LB 2WQWA 4O02L 3RTQA 1CFNB 1DUYA 4ETYA 4JNXA 1NKOA 3ZK0A 2I32A 2VC2L 2D3NA 4NBXB 4NO2A 4ZOAA 4DVRL 5C70A 1Q9LB 1LO4H 2OMZA 1E5CA 3VGGA 3ATDA 4RGND 4EKJA 1UZ6E 4TSBL 4D7BA 1BA9A 3Q6FB 4GRWH 1PTZA 3ETBJ 3SDAD 1U8QB 3B56A 1HWGB 1CFSA 3C60B 5AOLA 4H20L 3IDGB 4ERSH 5T1MA 1HI6B 3TBWA 1NCOA 3VXMD 2WLYA 1I1FA 4AOFA 2BRRH 3KM1A 1H3XA 3MI6A 1KXHA 3HW7A 2NDGA 4JFYB 5DT1L 2OI9C 5IVZA 3GC3A 3FCTA 3TX4A 1JPSH 4NC1E 3D9AL 5EZLB 1U3JA 4JZNA 3UG4A 5J7CC 2O1AA 2G5RA 3L2MA 4BFIA 3LQAH 1TFHA 3S36L 5I1LA 3QUZB 1SNRA 3QS3A 3AITA 5JDSA 2W95A 3VO0A 1DSFH 5L9DH 3EBIA 1QLRB 3FBQA 5FAAA 3L9EA 2O5ZL 1EAQA 1Y1UA 4GXUN 2H0JA 4XP5H 3ZDYF 2JQZA 5H35B 3EJPA 3T0AA 2J8HA 3C75A 2OYPA 1AZZC 3SKUD 4HUWA 3BC9A 5SX4I 3TPKA 5DRZA 2F61A 5DTFA 5E2TL 4I5BA 3VYNA 4F57H 5I0ZA 5JHLH 3MFFA 2DKSA 4HF5H 4Y7OC 5MENE 1Q9KA 5L8LB 3C5SA 3RVWC 4H26B 1JN6B 3V9FA 3LB6C 1Y1DA 3IAPA 1CI5A 5AW1B 5IHWA 3WKQA 5C0EB 1J0KA 1UATA 3AVEA 1I1AA 4RISL 4A38A 2YEZA 4NQDD 4KK9D 4Z7WB 5EN2B 4KJPD 2ZOLB 3E2HB 4QTIH 3MJ6A 4LLUB 3GIVB 4ONGH 3RDTC 5A2FA 1DR9A 1DVFB 3T4AC 1AZNA 5J9PB 1ONQA 3CDCA 1JXFA 1P9MC 5BRZA 3ZL4L 4FS0A 5HGHB 1KBWA 3OAYH 4Y2NA 2WZ5A 3LKPA 4JZJC 4N1EA 2JQAA 4FTVA 1M56B 5IROA 4JS7A 4NNPL 3Q5TA 5IBLC 3S36X 1KTJA 5A6MA 5BUGA 2V3DA 2VDKL 4N26A 1A3RL 5TGBA 4G8EB 4NM4H 4EUPB 2IANE 4KNTA 1OCZB 4L8DA 2JTYA 2R1WA 5JR1L 1WP6A 3UABA 4IEFB 4KXZH 4OLEA 5AVXB 3QEHA 5LGHH 3WGVB 4HV8B 4POZC 4EN3C 2X10A 5IFHH 2B08A 3HMWL 1BAFL 3QCTL 5I66A 4ZO9A 4OCLC 2A4ZA 4EIGB 4JPVL 2FE0A 2J55A 1JYVA 1IL1A 1MOEA 3U9WA 1ZVHA 5L2KE 4OM1L 1JZ7A 2J44A 1T20B 4NC0B 5DUJA 4Z7AA 2WVVB 1T0NB 1UJ3B 4QAMB 4ZTEA 2JK5A 4MAYC 3HC2A 4K8RD 2EDQA 5KS9E 3V95A 1Z9SB 3ZUNC 3U79A 2IEPA 3BUBA 4BH8A 3KJ4B 4N85A 1JGEA 3WOVA 5CZXC 3EYUH 3L2NA 3QWOB 2X89A 2K78A 1ZV9A 1U8NB 3QEQE 5LBSH 1SM3L 4HOMA 5JNYA 2DTML 4IBTA 3D3VA 2J25A 2VN4A 1U2HA 3B7YA 4XRCA 4JPQA 1OTUD 4ZUWA 2I60H 2J20A 2VO8A 4JY5H 3X1FA 4X4ME 3IJHB 4F58L 5F71A 2Q20A 5I75C 1U30A 3CUPB 1AQKL 1DBKL 2B9BA 3UG5A 4KJQD 4KPHH 4TTDC 8FABA 4FLHA 2OMWB 1E90A 1FNHA 2C3VA 2WM0A 3AUVA 3LZPA 4N1HB 4N0RA 5J1AA 3WY1A 5F1OB 3PABA 5KBMA 2EXTA 3CXHJ 1NBVL 4M5ZL 2F54A 1NLBL 2AF2A 4NGHL 4O00A 5CSZB 2D31B 2DM4A 4GI8A 2QQQA 3VD4A 3PHAA 1R24A 3KYKH 4POYA 3GYRA 1RIHH 5F89B 5LLIC 4DGWC 3BH4A 1FO0H 1OHQA 4GG8B 3MLTB 3PWLA 5AW6B 2MFNA 1RJYA 3WN5A 1KY6A 1FAIL 2OMXA 7FABL 4TVPE 5M7QA 2BW5A 1NCDL 2X38A 2UY7B 1VGKB 4GLRI 5ICUA 4X99A 5ISZD 4PCYA 2A9NL 1J0HA 3LEVL 2IH3B 3QFDB 3OR6B 1KYUA 3TXAA 3BH9B 4XMLH 1KFAH 3HG2A 2H41A 4RX4A 3KE0A 5E08L 3HAEA 2VDLH 1OCOB 3GMPA 3GIZH 2UVEA 4XODA 2VLKE 1PMYA 2WN3A 2DQUH 1HCYA 3IF1B 2ADIB 4NWUH 3QISA 2RH0A 4FL4B 2FIRT 3ZT6A 5IESH 3OG4B 5FECB 1EJOL 1QMUA 1W6WA 5I71B 4L5FE 4XNBA 4OQTL 3FO9B 1PU0A 4QPEA 4M48L 1O0VA 2V9QA 2BSRA 2EYRB 1D5XB 2ZYRA 1YY8B 2WWKO 5TD4A 3HVNA 4BH7A 4FEMA 5EIQA 1AE6H 1FPTL 3HPLB 1CI3M 1SPDA 4HIJA 4R3SA 4UV4L 4JRXA 2ZUQB 3GSUA 2YZ1A 2R0KH 1FL3A 1D5IL 2YMTA 4WCYL 3CBRA 4PMFA 3LKNB 1NL0H 1QPKA 1MWOA 1NMBL 5EO1A 4YZFE 4IIQA 4NC1C 2NSQA 1TPXB 4D0BA 4JDEB 1P5UB 4AE0A 1ZLWH 4N68A 1BZ7A 4ZYKA 1IAIM 2J1XA 2XPYA 1LO2L 1IAMA 1RIUH 4Z78B 3AU1A 1I3RA 5F3HB 4ZQKA 1RK0A 2ZXBA 4M62L 4HFUH 5J8OA 2BVEA 1KPRA 3GMLB 5DD5H 1G7JB 5FYKD 2B3IA 4R4ND 5A16B 5DMJB 5G2NA 3QEGL 4PJEF 5EUOE 3VYPA 3UMNA 1QR1B 1WT5A 5IVXF 2V5YA 4J3XA 1LEGA 4QRSB 1I8UA 4R5VA 3KHOA 3RL2B 1AD0B 1MJUH 4XI5C 1GGBL 2EDJA 3GS7A 1V7NH 2AP2A 2XXMB 1FJ1A 5B22A